F487507

General Info

Members Datasets Scaffolds Average Seq Length
985 775 459 136

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0029385|Ga0466972_0029385_811_1290
Length 159
Sequence MKAGFGEIRCPEKTKGRDEAMADKSKVFVYPKDVSAFGFDWGRLSLTVAPEVNGAERFSGGVVDLPPGKGHSRHNHPGAEEIIFVISGQGEQMVEDEKGNPVVAKVGPGCTIYVPESRFHSTLNTGDQPMQLFVVYSPAGPELALRDLPDFRLLPAGGK

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276019 Ensifer aridi TW10 Isolate Nodule
6 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
7 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
8 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
9 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
10 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
11 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
12 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
13 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
14 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
15 2512875024 Mesorhizobium loti R88b Isolate Nodule
16 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
17 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
18 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
19 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
20 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
21 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
22 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
23 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
24 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
25 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
26 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
27 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
28 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
29 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
30 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
31 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
32 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
33 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
34 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
35 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
36 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
37 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
38 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
39 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
40 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
41 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
42 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
43 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
44 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
45 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
46 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
47 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
48 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
49 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
50 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
51 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
52 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
53 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
54 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
55 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
56 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
57 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
58 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
59 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
60 2643221629 Devosia sp. Root105 Isolate Unclassified
61 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
62 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
63 2643221662 Devosia sp. Root413D1 Isolate Unclassified
64 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
65 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
66 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
67 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
68 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
69 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
70 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
71 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
72 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
73 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
74 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
75 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
76 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
77 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
78 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
79 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
80 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
81 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
82 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
83 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
84 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
85 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
86 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
87 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
88 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
89 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
90 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
91 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
92 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
93 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
94 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
95 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
96 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
97 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
98 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
99 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
100 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
101 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
102 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
103 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
104 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
105 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
106 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
107 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
108 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
109 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
110 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
111 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
112 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
113 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
114 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
115 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
116 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
117 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
118 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
119 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
120 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
121 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
122 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
123 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
124 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
125 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
126 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
127 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
128 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
129 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
130 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
131 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
132 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
133 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
134 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
135 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
136 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
137 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
138 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
139 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
140 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
141 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
142 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
143 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
144 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
145 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
146 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
147 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
148 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
149 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
150 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
151 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
152 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
153 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
154 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
155 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
156 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
157 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
158 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
159 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
160 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
161 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
162 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
163 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
164 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
165 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
166 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
167 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
168 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
169 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
170 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
171 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
172 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
173 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
174 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
175 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
176 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
177 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
178 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
179 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
180 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
181 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
182 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
183 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
184 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
185 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
186 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
187 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
188 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
189 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
190 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
191 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
192 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
193 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
194 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
195 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
196 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
197 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
198 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
199 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
200 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
201 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
202 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
203 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
204 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
205 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
206 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
207 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
208 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
209 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
210 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
211 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
212 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
213 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
214 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
215 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
216 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
217 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
218 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
219 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
220 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
221 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
222 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
223 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
224 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
225 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
226 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
227 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
228 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
229 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
230 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
231 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
232 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
233 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
234 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
235 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
236 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
237 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
238 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
239 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
240 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
241 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
242 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
243 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
244 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
245 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
246 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
247 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
248 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
249 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
250 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
251 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
252 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
253 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
254 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
255 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
256 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
257 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
258 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
259 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
260 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
261 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
262 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
263 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
264 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
265 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
266 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
267 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
268 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
269 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
270 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
271 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
272 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
273 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
274 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
275 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
276 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
277 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
278 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
279 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
280 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
281 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
282 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
283 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
284 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
285 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
286 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
287 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
288 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
289 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
290 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
291 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
292 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
293 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
294 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
295 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
296 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
297 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
298 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
299 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
300 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
301 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
302 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
303 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
304 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
305 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
306 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
307 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
308 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
309 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
310 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
311 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
312 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
313 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
314 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
315 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
316 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
317 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
318 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
319 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
320 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
321 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
322 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
323 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
324 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
325 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
326 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
327 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
328 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
329 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
330 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
331 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
332 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
333 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
334 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
335 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
336 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
337 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
338 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
339 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
340 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
341 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
342 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
343 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
344 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
345 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
346 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
347 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
348 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
349 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
350 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
351 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
352 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
353 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
354 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
355 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
356 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
357 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
358 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
359 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
360 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
361 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
362 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
363 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
364 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
365 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
366 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
367 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
368 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
369 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
370 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
371 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
372 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
373 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
374 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
375 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
376 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
377 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
378 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
379 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
380 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
381 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
382 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
383 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
384 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
385 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
386 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
387 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
388 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
389 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
390 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
391 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
392 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
393 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
394 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
395 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
396 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
397 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
398 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
399 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
400 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
401 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
402 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
403 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
404 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
405 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
406 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
407 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
408 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
409 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
410 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
411 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
412 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
413 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
414 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
415 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
416 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
417 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
418 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
419 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
420 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
421 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
422 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
423 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
424 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
425 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
426 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
427 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
428 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
429 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
430 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
431 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
432 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
433 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
434 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
435 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
436 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
437 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
438 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
439 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
440 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
441 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
442 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
443 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
444 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
445 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
446 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
447 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
448 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
449 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
450 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
451 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
452 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
453 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
454 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
455 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
456 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
457 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
458 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
459 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
460 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
461 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
462 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
463 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
464 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
465 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
466 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
467 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
468 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
469 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
470 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
471 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
472 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
473 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
474 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
475 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
476 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
477 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
478 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
479 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
480 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
481 3004167301 Mesorhizobium loti 582 Isolate Unclassified
482 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
483 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
484 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
485 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
486 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
487 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
488 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
489 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
490 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
491 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
492 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
493 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
494 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
495 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
496 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
497 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
498 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
499 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
500 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
501 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
502 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
503 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
504 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
505 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
506 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
507 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
508 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
509 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
510 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
511 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
512 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
513 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
514 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
515 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
516 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
517 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
518 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
519 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
520 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
521 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
522 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
523 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
524 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
525 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
526 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
527 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
528 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
529 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
530 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
531 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
532 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
533 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
534 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
535 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
536 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
537 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
538 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
539 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
540 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
541 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
542 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
543 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
544 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
545 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
546 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
547 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
548 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
549 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
550 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
551 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
552 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
553 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
554 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
555 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
556 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
557 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
558 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
559 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
560 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
561 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
562 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
563 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
564 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
565 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
566 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
567 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
568 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
569 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
570 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
571 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
572 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
573 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
574 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
575 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
576 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
577 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
578 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
579 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
580 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
581 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
582 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
583 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
584 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
585 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
586 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
587 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
588 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
589 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
590 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
591 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
592 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
593 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
594 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
595 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
596 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
597 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
598 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
599 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
600 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
601 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
602 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
603 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
604 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
605 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
606 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
607 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
608 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
609 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
610 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
611 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
612 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
613 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
614 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
615 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
616 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
617 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
618 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
619 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
620 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
621 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
622 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
623 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
624 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
625 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
626 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
627 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
628 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
629 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
630 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
631 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
632 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
633 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
634 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
635 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
636 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
637 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
638 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
639 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
640 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
641 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
642 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
643 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
644 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
645 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
646 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
647 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
648 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
649 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
650 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
651 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
652 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
653 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
654 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
655 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
656 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
657 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
658 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
659 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
660 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
661 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
662 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
663 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
664 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
665 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
666 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
667 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
668 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
669 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
670 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
671 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
672 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
673 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
674 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
675 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
676 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
677 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
678 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
679 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
680 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
681 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
682 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
683 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
684 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
685 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
686 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
687 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
688 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
689 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
690 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
691 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
692 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
693 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
694 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
695 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
696 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
697 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
698 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
699 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
700 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
701 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
702 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
703 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
704 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
705 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
706 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
707 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
708 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
709 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
710 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
711 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
712 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
713 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
714 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
715 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
716 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
717 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
718 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
719 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
720 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
721 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
722 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
723 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
724 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
725 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
726 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
727 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
728 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
729 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
730 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
731 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
732 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
733 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
734 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
735 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
736 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
737 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
738 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
739 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
740 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
741 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
742 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
743 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
744 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
745 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
746 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
747 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
748 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
749 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
750 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
751 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
752 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
753 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
754 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
755 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
756 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
757 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
758 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
759 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
760 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
761 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
762 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
763 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
764 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
765 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
766 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
767 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
768 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
769 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
770 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
771 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
772 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
773 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
774 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
775 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 46.6
Metatranscriptomes 0
Isolates 53.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.64
Nodule 49.85
Rhizoplane 1.83
Rhizosphere 30.25
Stem 0
Stem Tuber 0
Unclassified 8.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1002201 3300002741 Bacteria 5352
2 JGI25159J45721_1000461 3300002987 Bacteria 18823
3 JGI25165J46597_1000034 3300003214 Bacteria 292458
4 rootH2_10028209 3300003320 Bacteria 1775
5 JGI25160J50197_1000248 3300003354 Bacteria 41777
6 JGI25161J50226_1000183 3300003374 Bacteria 41777
7 Ga0055542_1001063 3300003762 Bacteria 16922
8 Ga0055542_1035206 3300003762 Bacteria 616
9 Ga0055529_1003010 3300003763 Bacteria 2960
10 Ga0055543_1000245 3300004625 Bacteria 41815
11 Ga0065165_1001012 3300005262 Bacteria 34230
12 Ga0070658_10942686 3300005327 Bacteria 751
13 Ga0070683_100399870 3300005329 Bacteria 1310
14 Ga0068869_100559938 3300005334 Bacteria 961
15 Ga0070660_100168327 3300005339 Bacteria 1769
16 Ga0070660_100552396 3300005339 Bacteria 961
17 Ga0070661_100001089 3300005344 Bacteria 19198
18 Ga0070674_100024016 3300005356 Bacteria 3954
19 Ga0070674_101191248 3300005356 Bacteria 676
20 Ga0070674_101310060 3300005356 Bacteria 646
21 Ga0070673_100268827 3300005364 Bacteria 1491
22 Ga0070659_101326089 3300005366 Bacteria 638
23 Ga0070667_100348158 3300005367 Bacteria 1341
24 Ga0070663_100832400 3300005455 Bacteria 793
25 Ga0070662_101337753 3300005457 Bacteria 617
26 Ga0068867_100107653 3300005459 Bacteria 2137
27 Ga0068867_100272240 3300005459 Bacteria 1385
28 Ga0070706_100890647 3300005467 Bacteria 822
29 Ga0070679_100713333 3300005530 Bacteria 946
30 Ga0070679_102103818 3300005530 Bacteria 514
31 Ga0070684_100705097 3300005535 Bacteria 941
32 Ga0068853_100006106 3300005539 Bacteria 9539
33 Ga0068853_100009175 3300005539 Bacteria 7968
34 Ga0068853_100186085 3300005539 Bacteria 1885
35 Ga0068853_100508722 3300005539 Bacteria 1138
36 Ga0070665_100237090 3300005548 Bacteria 1825
37 Ga0070665_101413680 3300005548 Bacteria 705
38 Ga0070665_101885244 3300005548 Bacteria 604
39 Ga0070704_101670473 3300005549 Bacteria 588
40 Ga0068855_100252035 3300005563 Bacteria 1969
41 Ga0068855_100331519 3300005563 Bacteria 1680
42 Ga0068855_101100257 3300005563 Bacteria 831
43 Ga0068855_101165797 3300005563 Bacteria 803
44 Ga0068857_100124242 3300005577 Bacteria 2325
45 Ga0068854_100019081 3300005578 Bacteria 4615
46 Ga0068854_100214546 3300005578 Bacteria 1520
47 Ga0068856_100034379 3300005614 Bacteria 4964
48 Ga0068852_100007354 3300005616 Bacteria 8035
49 Ga0068852_100511857 3300005616 Bacteria 1197
50 Ga0068851_10000365 3300005834 Bacteria 20408
51 Ga0068851_10467013 3300005834 Bacteria 752
52 Ga0075365_10002114 3300006038 Bacteria 9514
53 Ga0075365_10036263 3300006038 Bacteria 3194
54 Ga0075365_11074739 3300006038 Bacteria 567
55 Ga0075368_10006791 3300006042 Bacteria 4019
56 Ga0075368_10060503 3300006042 Bacteria 1516
57 Ga0075368_10072602 3300006042 Bacteria 1392
58 Ga0075368_10588066 3300006042 Unclassified 503
59 Ga0075363_100044193 3300006048 Bacteria 2359
60 Ga0075363_100074111 3300006048 Bacteria 1853
61 Ga0075363_100205752 3300006048 Bacteria 1125
62 Ga0075363_100361637 3300006048 Bacteria 849
63 Ga0075363_100362481 3300006048 Bacteria 848
64 Ga0075363_100586664 3300006048 Bacteria 667
65 Ga0075362_10164715 3300006177 Bacteria 1069
66 Ga0075362_10392812 3300006177 Bacteria 699
67 Ga0075367_10043744 3300006178 Bacteria 2623
68 Ga0075367_10057338 3300006178 Bacteria 2316
69 Ga0075367_10184904 3300006178 Bacteria 1299
70 Ga0075367_10816648 3300006178 Bacteria 594
71 Ga0075369_10024082 3300006186 Bacteria 2520
72 Ga0075369_10297875 3300006186 Bacteria 753
73 Ga0075366_10124451 3300006195 Bacteria 1554
74 Ga0075366_10349889 3300006195 Bacteria 907
75 Ga0097621_101618810 3300006237 Bacteria 616
76 Ga0075370_10022024 3300006353 Bacteria 3495
77 Ga0075370_10150186 3300006353 Bacteria 1365
78 Ga0075370_10611464 3300006353 Bacteria 660
79 Ga0075428_100686712 3300006844 Bacteria 1091
80 Ga0075430_100171599 3300006846 Bacteria 1804
81 Ga0075430_100381615 3300006846 Bacteria 1163
82 Ga0075431_100008602 3300006847 Bacteria 10219
83 Ga0075434_100486499 3300006871 Bacteria 1255
84 Ga0068865_100225653 3300006881 Bacteria 1467
85 Ga0079104_1014584 3300006946 Bacteria 2365
86 Ga0079104_1016005 3300006946 Bacteria 2205
87 Ga0105240_10066593 3300009093 Bacteria 4467
88 Ga0105240_11826999 3300009093 Bacteria 633
89 Ga0105240_12053865 3300009093 Bacteria 594
90 Ga0105245_10319392 3300009098 Bacteria 1529
91 Ga0105243_11671647 3300009148 Bacteria 665
92 Ga0105243_11822633 3300009148 Bacteria 640
93 Ga0105243_12595170 3300009148 Bacteria 546
94 Ga0105241_10036083 3300009174 Bacteria 3720
95 Ga0105241_10281116 3300009174 Bacteria 1421
96 Ga0105241_10616650 3300009174 Bacteria 982
97 Ga0105237_10054607 3300009545 Bacteria 4003
98 Ga0105237_10207731 3300009545 Bacteria 1958
99 Ga0105237_11189679 3300009545 Bacteria 769
100 Ga0105237_11851660 3300009545 Bacteria 611
101 Ga0105238_10038235 3300009551 Bacteria 4874
102 Ga0105238_10426000 3300009551 Bacteria 1322
103 Ga0105238_10594859 3300009551 Bacteria 1114
104 Ga0105238_10979796 3300009551 Bacteria 866
105 Ga0105249_11273321 3300009553 Bacteria 807
106 Ga0123341_1000002 3300009765 Bacteria 191257
107 Ga0123342_1030249 3300009766 Bacteria 2736
108 Ga0105239_10050615 3300010375 Bacteria 4556
109 Ga0105239_10137640 3300010375 Bacteria 2719
110 Ga0105239_10207776 3300010375 Bacteria 2194
111 Ga0105239_10368082 3300010375 Bacteria 1624
112 Ga0105239_10597182 3300010375 Bacteria 1259
113 Ga0105239_11331550 3300010375 Bacteria 828
114 Ga0105239_11885803 3300010375 Bacteria 693
115 Ga0105239_12759595 3300010375 Bacteria 573
116 Ga0105239_13007697 3300010375 Bacteria 549
117 Ga0105246_10539373 3300011119 Bacteria 998
118 Ga0105246_11016211 3300011119 Bacteria 752
119 Ga0105246_11590128 3300011119 Bacteria 617
120 Ga0157370_10075580 3300013104 Bacteria 3175
121 Ga0157370_11280226 3300013104 Bacteria 661
122 Ga0157369_10188646 3300013105 Bacteria 2167
123 Ga0157374_10197245 3300013296 Bacteria 1970
124 Ga0157374_11478086 3300013296 Bacteria 703
125 Ga0157378_10042568 3300013297 Bacteria 4031
126 Ga0157378_10528673 3300013297 Bacteria 1182
127 Ga0163162_11230278 3300013306 Bacteria 850
128 Ga0157372_12446487 3300013307 Bacteria 600
129 Ga0163163_10235476 3300014325 Bacteria 1880
130 Ga0163163_11008438 3300014325 Bacteria 896
131 Ga0157377_11344622 3300014745 Bacteria 561
132 Ga0157376_10409571 3300014969 Bacteria 1313
133 Ga0157376_11842785 3300014969 Bacteria 641
134 Ga0182006_1031178 3300015261 Bacteria 2150
135 Ga0182007_10028924 3300015262 Bacteria 1900
136 Ga0163161_10224288 3300017792 Bacteria 1456
137 Ga0214544_1000010 3300021320 Bacteria 270164
138 Ga0214542_1000023 3300021321 Bacteria 191557
139 Ga0214542_1019114 3300021321 Bacteria 5520
140 Ga0214543_1000019 3300021327 Bacteria 267908
141 Ga0214543_1000156 3300021327 Bacteria 96889
142 Ga0228711_1000056 3300022739 Bacteria 78987
143 Ga0228710_1000229 3300022740 Bacteria 58988
144 Ga0209026_1000100 3300025250 Bacteria 156131
145 Ga0209148_1000069 3300025254 Bacteria 334444
146 Ga0209148_1003960 3300025254 Bacteria 3806
147 Ga0209759_1000549 3300025256 Bacteria 38630
148 Ga0209233_1000028 3300025261 Bacteria 642062
149 Ga0209233_1014135 3300025261 Bacteria 2259
150 Ga0209455_1000135 3300025272 Bacteria 148007
151 Ga0209130_1000098 3300025284 Bacteria 142506
152 Ga0209758_1014469 3300025297 Bacteria 4191
153 Ga0207426_1000069 3300025302 Bacteria 334513
154 Ga0207656_10029735 3300025321 Bacteria 2252
155 Ga0207688_10158858 3300025901 Bacteria 1339
156 Ga0207680_10176801 3300025903 Bacteria 1441
157 Ga0207647_10120437 3300025904 Bacteria 1548
158 Ga0207647_10134094 3300025904 Bacteria 1454
159 Ga0207645_10111210 3300025907 Bacteria 1773
160 Ga0207705_10120282 3300025909 Bacteria 1948
161 Ga0207705_10206070 3300025909 Bacteria 1491
162 Ga0207684_10616503 3300025910 Bacteria 926
163 Ga0207654_10270039 3300025911 Bacteria 1147
164 Ga0207654_11132240 3300025911 Bacteria 570
165 Ga0207695_10096031 3300025913 Bacteria 2966
166 Ga0207695_10390991 3300025913 Bacteria 1275
167 Ga0207695_10399632 3300025913 Bacteria 1258
168 Ga0207671_10011147 3300025914 Bacteria 7344
169 Ga0207671_10048066 3300025914 Bacteria 3158
170 Ga0207671_10082216 3300025914 Bacteria 2416
171 Ga0207657_10015036 3300025919 Bacteria 7516
172 Ga0207657_10118186 3300025919 Bacteria 2183
173 Ga0207649_10016189 3300025920 Bacteria 4200
174 Ga0207649_10092468 3300025920 Bacteria 1983
175 Ga0207649_10515957 3300025920 Bacteria 911
176 Ga0207694_10041236 3300025924 Bacteria 3556
177 Ga0207694_10221861 3300025924 Bacteria 1542
178 Ga0207694_10447154 3300025924 Bacteria 1078
179 Ga0207690_10064234 3300025932 Bacteria 2506
180 Ga0207706_11007353 3300025933 Bacteria 700
181 Ga0207669_10637924 3300025937 Bacteria 870
182 Ga0207669_10691447 3300025937 Bacteria 837
183 Ga0207669_10950921 3300025937 Bacteria 720
184 Ga0207691_10090174 3300025940 Bacteria 2749
185 Ga0207689_10943409 3300025942 Bacteria 728
186 Ga0207661_10198497 3300025944 Bacteria 1763
187 Ga0207661_10303869 3300025944 Bacteria 1431
188 Ga0207667_10935294 3300025949 Bacteria 857
189 Ga0207667_11023867 3300025949 Bacteria 812
190 Ga0207651_10493860 3300025960 Bacteria 1057
191 Ga0207640_10016463 3300025981 Bacteria 4301
192 Ga0207640_10168202 3300025981 Bacteria 1630
193 Ga0207640_10525514 3300025981 Bacteria 990
194 Ga0207640_10792726 3300025981 Bacteria 820
195 Ga0207639_10024149 3300026041 Bacteria 4395
196 Ga0207639_10043661 3300026041 Bacteria 3367
197 Ga0207639_10214961 3300026041 Bacteria 1657
198 Ga0207639_11137361 3300026041 Bacteria 732
199 Ga0207678_10245762 3300026067 Bacteria 1532
200 Ga0207678_10860983 3300026067 Bacteria 801
201 Ga0207702_10076518 3300026078 Bacteria 2893
202 Ga0207702_10976183 3300026078 Bacteria 840
203 Ga0207641_10550009 3300026088 Bacteria 1126
204 Ga0207648_10134399 3300026089 Bacteria 2178
205 Ga0207648_10153697 3300026089 Bacteria 2031
206 Ga0207674_10042765 3300026116 Bacteria 4676
207 Ga0207674_10043491 3300026116 Bacteria 4631
208 Ga0207674_12134905 3300026116 Bacteria 524
209 Ga0207698_10094232 3300026142 Bacteria 2461
210 Ga0207698_10512673 3300026142 Bacteria 1169
211 Ga0207698_10743370 3300026142 Bacteria 979
212 Ga0207698_10953417 3300026142 Bacteria 867
213 Ga0207698_11872215 3300026142 Bacteria 615
214 Ga0209281_1000272 3300027111 Bacteria 99700
215 Ga0209281_1000709 3300027111 Bacteria 33568
216 Ga0209282_1000055 3300027666 Bacteria 101018
217 Ga0209813_10016156 3300027866 Bacteria 2033
218 Ga0209813_10265884 3300027866 Bacteria 656
219 Ga0209813_10321086 3300027866 Bacteria 606
220 Ga0209813_10449076 3300027866 Bacteria 527
221 Ga0209974_10287731 3300027876 Bacteria 626
222 Ga0268266_10033856 3300028379 Bacteria 4342
223 Ga0268266_10110141 3300028379 Bacteria 2439
224 Ga0268266_10460688 3300028379 Bacteria 1210
225 Ga0268266_10480157 3300028379 Bacteria 1185
226 Ga0268266_11799320 3300028379 Bacteria 587
227 Ga0265318_10006422 3300028577 Bacteria 5414
228 Ga0307515_10001956 3300028794 Bacteria 45627
229 Ga0265339_10408694 3300031249 Bacteria 634
230 Ga0265316_10541105 3300031344 Bacteria 829
231 Ga0307513_10245401 3300031456 Bacteria 1592
232 Ga0307408_100530996 3300031548 Bacteria 1035
233 Ga0265313_10175580 3300031595 Bacteria 903
234 Ga0307413_11662331 3300031824 Unclassified 569
235 Ga0307412_10382383 3300031911 Bacteria 1140
236 Ga0307412_10481124 3300031911 Bacteria 1030
237 Ga0315914_1000095 3300031967 Bacteria 74092
238 Ga0307409_101499315 3300031995 Bacteria 702
239 Ga0307409_102147767 3300031995 Bacteria 588
240 Ga0307409_102741992 3300031995 Bacteria 521
241 Ga0307416_100405938 3300032002 Bacteria 1402
242 Ga0307414_11131611 3300032004 Bacteria 724
243 Ga0307414_12291093 3300032004 Bacteria 504
244 Ga0307510_10282945 3300033180 Bacteria 1128
245 Ga0315913_1000019 3300033430 Bacteria 100387
246 Ga0315915_1000023 3300033464 Bacteria 119157
247 Ga0316574_0405782 3300035398 Bacteria 858
248 Ga0373925_0909383 3300037068 Bacteria 725
249 Ga0395899_0084472 3300037312 Bacteria 2308
250 Ga0395900_0014410 3300037418 Bacteria 8069
251 Ga0395900_0180840 3300037418 Bacteria 2143
252 Ga0395900_0256309 3300037418 Bacteria 1749
253 Ga0395900_0421129 3300037418 Bacteria 1296
254 Ga0395900_0517868 3300037418 Bacteria 1141
255 Ga0395900_1016906 3300037418 Bacteria 748
256 Ga0395900_1624718 3300037418 Bacteria 557
257 Ga0395898_0546371 3300037466 Bacteria 1100
258 Ga0395905_0015692 3300037471 Bacteria 7196
259 Ga0395905_0133797 3300037471 Bacteria 2332
260 Ga0395905_0472963 3300037471 Bacteria 1152
261 Ga0395905_0482047 3300037471 Bacteria 1140
262 Ga0395905_1159852 3300037471 Bacteria 676
263 Ga0395901_0076932 3300038443 Bacteria 3482
264 Ga0395901_0259129 3300038443 Bacteria 1810
265 Ga0395901_0282485 3300038443 Bacteria 1724
266 Ga0395901_1514489 3300038443 Bacteria 626
267 Ga0439465_0017138 3300041413 Bacteria 2260
268 Ga0439465_0207644 3300041413 Bacteria 715
269 Ga0439465_0350353 3300041413 Bacteria 558
270 Ga0451797_0003339 3300041453 Bacteria 559
271 Ga0451797_0955447 3300041453 Bacteria 622
272 Ga0451797_1415564 3300041453 Bacteria 588
273 Ga0451806_075586 3300041462 Bacteria 672
274 Ga0451807_2300357 3300041486 Bacteria 1114
275 Ga0451833_0178365 3300041491 Bacteria 5220
276 Ga0451835_0861054 3300041492 Bacteria 572
277 Ga0451835_0921118 3300041492 Bacteria 698
278 Ga0451837_1679461 3300041494 Bacteria 882
279 Ga0451839_0326841 3300041496 Bacteria 1821
280 Ga0451839_0542047 3300041496 Bacteria 2193
281 Ga0451841_0564111 3300041498 Bacteria 2444
282 Ga0451845_0306592 3300041501 Bacteria 2148
283 Ga0451847_0471708 3300041503 Bacteria 1470
284 Ga0451849_1148107 3300041505 Bacteria 2895
285 Ga0451851_1221558 3300041507 Bacteria 2407
286 Ga0451843_0368501 3300041509 Bacteria 704
287 Ga0451853_0727081 3300041512 Bacteria 653
288 Ga0439431_0143712 3300041997 Bacteria 675
289 Ga0439433_0097307 3300041999 Bacteria 728
290 Ga0439445_0130328 3300042004 Bacteria 726
291 Ga0439432_020307 3300042006 Bacteria 2209
292 Ga0439432_163993 3300042006 Bacteria 650
293 Ga0439449_0026019 3300042007 Bacteria 2185
294 Ga0439458_0171420 3300042157 Bacteria 587
295 Ga0466972_0029385 3300044658 Bacteria 2706
296 Ga0466972_0155721 3300044658 Bacteria 1073
297 Ga0466970_0764168 3300044765 Bacteria 565
298 Ga0466960_0648551 3300044901 Bacteria 630
299 Ga0495638_0012184 3300046460 Bacteria 5904
300 Ga0495638_0123166 3300046460 Bacteria 1530
301 Ga0495638_0214620 3300046460 Bacteria 1079
302 Ga0495638_0423459 3300046460 Bacteria 686
303 Ga0495638_0476406 3300046460 Bacteria 633
304 Ga0495638_0478465 3300046460 Bacteria 631
305 Ga0495606_0218044 3300046507 Bacteria 1077
306 Ga0495632_0390255 3300046519 Bacteria 609
307 Ga0495643_0353655 3300046522 Bacteria 657
308 Ga0495654_0130108 3300046530 Bacteria 1131
309 Ga0495668_0036681 3300046616 Bacteria 2746
310 Ga0495611_0401065 3300046648 Bacteria 627
311 Ga0495625_0021804 3300046660 Bacteria 4921
312 Ga0495683_0145001 3300047323 Bacteria 1110
313 Ga0495686_0541580 3300047472 Bacteria 609
314 Ga0495626_0259575 3300048091 Bacteria 695
315 Ga0496105_0659412 3300048908 Bacteria 807
316 Ga0496106_1056658 3300048909 Bacteria 637
317 Ga0496108_0240447 3300048911 Bacteria 1575
318 Ga0496108_0793576 3300048911 Bacteria 817
319 Ga0496109_0695741 3300048912 Bacteria 954
320 Ga0496110_0293531 3300048913 Bacteria 1481
321 Ga0496112_0001731 3300048915 Bacteria 17084
322 Ga0496112_0607916 3300048915 Bacteria 1025
323 Ga0496113_0147244 3300048916 Bacteria 1856
324 Ga0496115_0121735 3300048918 Bacteria 2147
325 Ga0496115_0322285 3300048918 Bacteria 1264
326 Ga0496117_0135687 3300048920 Bacteria 1483
327 Ga0496118_0345079 3300048921 Bacteria 796
328 Ga0496119_0010974 3300048922 Bacteria 7562
329 Ga0496119_0027484 3300048922 Bacteria 3908
330 Ga0496119_0232531 3300048922 Bacteria 937
331 Ga0496120_0002155 3300048923 Bacteria 20986
332 Ga0496120_0020849 3300048923 Bacteria 4153
333 Ga0496121_0129424 3300048924 Bacteria 1892
334 Ga0496121_0154062 3300048924 Bacteria 1688
335 Ga0496121_0167571 3300048924 Bacteria 1599
336 Ga0496121_0397933 3300048924 Bacteria 903
337 Ga0496121_0670015 3300048924 Unclassified 629
338 Ga0496122_0296413 3300048925 Bacteria 875
339 Ga0496124_0114743 3300048927 Bacteria 2163
340 Ga0496124_0386392 3300048927 Bacteria 977
341 Ga0496125_0066554 3300048928 Bacteria 2846
342 Ga0496125_0582133 3300048928 Bacteria 614
343 Ga0496126_0152871 3300048929 Bacteria 1977
344 Ga0496126_0211436 3300048929 Bacteria 1633
345 Ga0501031_0000008 3300049568 Bacteria 156304
346 Ga0501031_0203455 3300049568 Bacteria 1291
347 Ga0501032_0000018 3300049569 Bacteria 156275
348 Ga0501032_0012010 3300049569 Bacteria 6200
349 Ga0501032_0016409 3300049569 Bacteria 5209
350 Ga0501033_0000032 3300049570 Bacteria 156304
351 Ga0501033_0010055 3300049570 Bacteria 7263
352 Ga0501033_0022431 3300049570 Bacteria 4762
353 Ga0501033_1059597 3300049570 Bacteria 540
354 Ga0501034_0000103 3300049571 Bacteria 156304
355 Ga0501034_0013483 3300049571 Bacteria 8413
356 Ga0501034_0071072 3300049571 Bacteria 3490
357 Ga0501034_0126713 3300049571 Bacteria 2538
358 Ga0501034_0293836 3300049571 Bacteria 1562
359 Ga0501034_0832082 3300049571 Bacteria 814
360 Ga0501034_1267285 3300049571 Bacteria 614
361 Ga0501036_0000012 3300049572 Bacteria 156304
362 Ga0501036_0021735 3300049572 Bacteria 5393
363 Ga0501036_1032294 3300049572 Bacteria 672
364 Ga0501037_0000018 3300049573 Bacteria 156304
365 Ga0501037_0070785 3300049573 Bacteria 2537
366 Ga0501038_0000017 3300049574 Bacteria 156304
367 Ga0501038_0024638 3300049574 Bacteria 5364
368 Ga0501039_0000024 3300049575 Bacteria 156304
369 Ga0501039_0085075 3300049575 Bacteria 2463
370 Ga0501039_0095117 3300049575 Bacteria 2322
371 Ga0501040_0040528 3300049576 Bacteria 3169
372 Ga0501042_0261884 3300049578 Bacteria 1248
373 Ga0501043_0004332 3300049579 Bacteria 11551
374 Ga0501043_0210059 3300049579 Bacteria 1509
375 Ga0501043_0262863 3300049579 Bacteria 1326
376 Ga0501043_0279990 3300049579 Bacteria 1278
377 Ga0501043_0829557 3300049579 Bacteria 667
378 Ga0501046_0020293 3300049580 Bacteria 5498
379 Ga0501046_0779640 3300049580 Bacteria 671
380 Ga0501047_0004558 3300049581 Bacteria 13028
381 Ga0501047_0086899 3300049581 Bacteria 3004
382 Ga0501047_0134003 3300049581 Bacteria 2357
383 Ga0501047_0470021 3300049581 Bacteria 1086
384 Ga0501048_0023451 3300049582 Bacteria 4508
385 Ga0501048_0331409 3300049582 Bacteria 1084
386 Ga0501067_0391902 3300049583 Bacteria 774
387 Ga0501068_0106036 3300049584 Bacteria 1744
388 Ga0501069_1016217 3300049585 Bacteria 507
389 Ga0501070_0026001 3300049586 Bacteria 4911
390 Ga0501070_0270601 3300049586 Bacteria 1387
391 Ga0501073_0319039 3300049589 Bacteria 1072
392 Ga0501261_068866 3300049690 Unclassified 617
393 Ga0501083_0833548 3300049744 Bacteria 600
394 Ga0501035_0000040 3300049822 Bacteria 156262
395 Ga0501035_0010917 3300049822 Bacteria 8410
396 Ga0501035_0013756 3300049822 Bacteria 7469
397 Ga0501035_0031169 3300049822 Bacteria 4856
398 Ga0501044_0000040 3300049823 Bacteria 156304
399 Ga0501044_0007916 3300049823 Bacteria 11685
400 Ga0501044_0013108 3300049823 Bacteria 8975
401 Ga0501044_0061348 3300049823 Bacteria 3846
402 Ga0501045_0094088 3300049824 Bacteria 2216
403 Ga0501045_0186559 3300049824 Bacteria 1545
404 nmdc:mga03683_114476_c1 3300050489 Bacteria 1195
405 nmdc:mga03683_141469_c1 3300050489 Bacteria 1082
406 nmdc:mga03683_405307_c1 3300050489 Bacteria 651
407 nmdc:mga03683_443758_c1 3300050489 Bacteria 624
408 nmdc:mga03n38_15460_c1 3300050490 Bacteria 2948
409 nmdc:mga03n38_17735_c1 3300050490 Bacteria 2794
410 nmdc:mga03n38_271022_c1 3300050490 Bacteria 903
411 nmdc:mga03n38_461833_c1 3300050490 Bacteria 708
412 nmdc:mga03n38_656118_c1 3300050490 Bacteria 602
413 nmdc:mga03n38_70345_c1 3300050490 Bacteria 1618
414 nmdc:mga0yw44_1188482_c1 3300050492 Bacteria 515
415 nmdc:mga0yw44_177287_c1 3300050492 Bacteria 1401
416 nmdc:mga0yw44_227875_c1 3300050492 Bacteria 1236
417 nmdc:mga0yw44_87133_c1 3300050492 Bacteria 1968
418 nmdc:mga0k408_442392_c1 3300050493 Bacteria 772
419 nmdc:mga0k408_521497_c1 3300050493 Bacteria 703
420 nmdc:mga0k408_546564_c1 3300050493 Bacteria 685
421 nmdc:mga0k408_561971_c1 3300050493 Bacteria 674
422 nmdc:mga06z11_299164_c1 3300050494 Bacteria 956
423 nmdc:mga06z11_630962_c1 3300050494 Bacteria 652
424 nmdc:mga04h51_190513_c1 3300050495 Bacteria 802
425 nmdc:mga04h51_287868_c1 3300050495 Bacteria 667
426 nmdc:mga04h51_298587_c1 3300050495 Bacteria 656
427 nmdc:mga04h51_57680_c1 3300050495 Bacteria 1322
428 nmdc:mga07m45_41591_c1 3300050496 Bacteria 2574
429 nmdc:mga0qj67_110919_c1 3300050509 Bacteria 2215
430 nmdc:mga06r32_15012_c1 3300050510 Bacteria 7030
431 nmdc:mga0n895_1252701_c1 3300050512 Bacteria 714
432 nmdc:mga0a205_419969_c1 3300050515 Bacteria 1199
433 nmdc:mga0sz30_192897_c1 3300050516 Bacteria 904
434 nmdc:mga0sz30_41876_c1 3300050516 Bacteria 1926
435 Ga0495655_0269375 3300053083 Bacteria 577
436 Ga0500643_190854 3300053087 Bacteria 549
437 Ga0500644_0063403 3300053088 Bacteria 1309
438 Ga0500646_0353370 3300053090 Bacteria 536
439 Ga0500583_0463455 3300053092 Bacteria 600
440 Ga0500641_0187048 3300053096 Bacteria 888
441 Ga0500595_087247 3300053119 Bacteria 907
442 Ga0500608_076771 3300053122 Bacteria 1582
443 Ga0500617_236154 3300053124 Bacteria 634
444 Ga0500652_333538 3300053131 Bacteria 578
445 Ga0500658_0213663 3300053134 Bacteria 883
446 Ga0500568_0000010 3300053139 Bacteria 249043
447 Ga0500568_0073172 3300053139 Bacteria 1309
448 Ga0500568_0122876 3300053139 Bacteria 967
449 Ga0500588_0058270 3300053146 Bacteria 1229
450 Ga0500604_0022802 3300053151 Bacteria 1781
451 Ga0500616_0141021 3300053153 Bacteria 1126
452 Ga0500620_000598 3300053155 Bacteria 6198
453 Ga0500622_0000734 3300053156 Bacteria 28647
454 Ga0500627_0417286 3300053158 Bacteria 569
455 Ga0500611_012404 3300053727 Bacteria 1437
456 Ga0500645_174566 3300053730 Bacteria 586
457 Ga0501084_0221979 3300054114 Bacteria 1595
458 Ga0501082_0145183 3300060353 Bacteria 2060
459 Ga0501082_0732117 3300060353 Bacteria 866

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2961136820 2961138038 128
2 iso_pu_bacteria 2513237351 2514585980 131
3 3300013306 Ga0163162_11230278 Ga0163162_112302782 132
4 3300048912 Ga0496109_0695741 Ga0496109_0695741_542_943 132
5 3300049568 Ga0501031_0203455 Ga0501031_0203455_334_732 132
6 3300049569 Ga0501032_0012010 Ga0501032_0012010_1582_1980 132
7 3300049569 Ga0501032_0016409 Ga0501032_0016409_1403_1801 132
8 3300049570 Ga0501033_0010055 Ga0501033_0010055_2579_2977 132
9 3300049570 Ga0501033_0022431 Ga0501033_0022431_1563_1961 132
10 3300049571 Ga0501034_0013483 Ga0501034_0013483_4089_4487 132
11 3300049571 Ga0501034_0071072 Ga0501034_0071072_863_1261 132
12 3300049572 Ga0501036_0021735 Ga0501036_0021735_3414_3812 132
13 3300049572 Ga0501036_1032294 Ga0501036_1032294_169_567 132
14 3300049573 Ga0501037_0070785 Ga0501037_0070785_1580_1978 132
15 3300049574 Ga0501038_0024638 Ga0501038_0024638_283_681 132
16 3300049575 Ga0501039_0085075 Ga0501039_0085075_1582_1980 132
17 3300049575 Ga0501039_0095117 Ga0501039_0095117_425_823 132
18 3300049578 Ga0501042_0261884 Ga0501042_0261884_448_846 132
19 3300049579 Ga0501043_0262863 Ga0501043_0262863_315_713 132
20 3300049579 Ga0501043_0279990 Ga0501043_0279990_340_738 132
21 3300049580 Ga0501046_0020293 Ga0501046_0020293_3520_3918 132
22 3300049581 Ga0501047_0086899 Ga0501047_0086899_560_958 132
23 3300049581 Ga0501047_0134003 Ga0501047_0134003_560_958 132
24 3300049582 Ga0501048_0023451 Ga0501048_0023451_3957_4355 132
25 3300049582 Ga0501048_0331409 Ga0501048_0331409_544_942 132
26 3300049584 Ga0501068_0106036 Ga0501068_0106036_774_1172 132
27 3300049586 Ga0501070_0270601 Ga0501070_0270601_560_958 132
28 3300049744 Ga0501083_0833548 Ga0501083_0833548_181_579 132
29 3300049822 Ga0501035_0010917 Ga0501035_0010917_6450_6848 132
30 3300049822 Ga0501035_0013756 Ga0501035_0013756_4254_4652 132
31 3300049823 Ga0501044_0007916 Ga0501044_0007916_9706_10104 132
32 3300049823 Ga0501044_0061348 Ga0501044_0061348_1886_2284 132
33 3300049824 Ga0501045_0094088 Ga0501045_0094088_284_682 132
34 3300049824 Ga0501045_0186559 Ga0501045_0186559_437_835 132
35 3300053088 Ga0500644_0063403 Ga0500644_0063403_684_1082 132
36 3300053156 Ga0500622_0000734 Ga0500622_0000734_23187_23585 132
37 iso_pu_bacteria 2643221629 2644169826 132
38 iso_pu_bacteria 2643221662 2644350462 132
39 iso_pu_bacteria 2837651117 2837652036 132
40 iso_pu_bacteria 2508501122 2509111471 133
41 iso_pu_bacteria 2509276019 2509379610 133
42 iso_pu_bacteria 2509276033 2509442289 133
43 iso_pu_bacteria 2510065019 2510136116 133
44 iso_pu_bacteria 2510065057 2510306512 133
45 iso_pu_bacteria 2510461076 2510892881 133
46 iso_pu_bacteria 2511231052 2511499764 133
47 iso_pu_bacteria 2512047086 2512530187 133
48 iso_pu_bacteria 2512875026 2512975477 133
49 iso_pu_bacteria 2513237084 2513568417 133
50 iso_pu_bacteria 2513237086 2513584896 133
51 iso_pu_bacteria 2513237089 2513605873 133
52 iso_pu_bacteria 2513237091 2513618278 133
53 iso_pu_bacteria 2513237093 2513630726 133
54 iso_pu_bacteria 2513237103 2513711922 133
55 iso_pu_bacteria 2513237140 2513883029 133
56 iso_pu_bacteria 2513237143 2513903084 133
57 iso_pu_bacteria 2513237144 2513910477 133
58 iso_pu_bacteria 2513237146 2513924889 133
59 iso_pu_bacteria 2513237160 2514006828 133
60 iso_pu_bacteria 2513237162 2514018251 133
61 iso_pu_bacteria 2515075009 2515108957 133
62 iso_pu_bacteria 2515154107 2515611863 133
63 iso_pu_bacteria 2515154113 2515633038 133
64 iso_pu_bacteria 2515154114 2515640243 133
65 iso_pu_bacteria 2515154116 2515656324 133
66 iso_pu_bacteria 2516653046 2516897354 133
67 iso_pu_bacteria 2516653077 2517040898 133
68 iso_pu_bacteria 2517093000 2517098498 133
69 iso_pu_bacteria 2517487022 2517567069 133
70 iso_pu_bacteria 2524023207 2524453252 133
71 iso_pu_bacteria 2551306084 2551678535 133
72 iso_pu_bacteria 2551306084 2551681534 133
73 iso_pu_bacteria 2551306085 2551688910 133
74 iso_pu_bacteria 2551306086 2551695891 133
75 iso_pu_bacteria 2551306087 2551697596 133
76 iso_pu_bacteria 2551306089 2551714919 133
77 iso_pu_bacteria 2551306090 2551723432 133
78 iso_pu_bacteria 2551306091 2551730186 133
79 iso_pu_bacteria 2551306092 2551734294 133
80 iso_pu_bacteria 2551306093 2551742839 133
81 iso_pu_bacteria 2558860100 2558862914 133
82 iso_pu_bacteria 2558860100 2558866635 133
83 iso_pu_bacteria 2599185170 2599416450 133
84 iso_pu_bacteria 2615840624 2616297887 133
85 iso_pu_bacteria 2643221634 2644195207 133
86 iso_pu_bacteria 2643221643 2644241133 133
87 iso_pu_bacteria 2724679232 2725949385 133
88 iso_pu_bacteria 2765235802 2765464464 133
89 iso_pu_bacteria 2765235942 2766064606 133
90 iso_pu_bacteria 2775506902 2776267090 133
91 iso_pu_bacteria 2775506904 2776283435 133
92 iso_pu_bacteria 2791355091 2792621363 133
93 iso_pu_bacteria 2791355092 2792627952 133
94 iso_pu_bacteria 2791355094 2792643672 133
95 iso_pu_bacteria 2791355259 2793315015 133
96 iso_pu_bacteria 2802428858 2802720983 133
97 iso_pu_bacteria 2802428859 2802727474 133
98 iso_pu_bacteria 2802428860 2802733441 133
99 iso_pu_bacteria 2802428861 2802740165 133
100 iso_pu_bacteria 2802428862 2802746495 133
101 iso_pu_bacteria 2802428863 2802753231 133
102 iso_pu_bacteria 2838035591 2838036565 133
103 iso_pu_bacteria 2838661181 2838662455 133
104 iso_pu_bacteria 2839993093 2839997336 133
105 iso_pu_bacteria 2840764183 2840765802 133
106 iso_pu_bacteria 2842110456 2842113799 133
107 iso_pu_bacteria 2842205361 2842209929 133
108 iso_pu_bacteria 2842217011 2842219645 133
109 iso_pu_bacteria 2842278818 2842283383 133
110 iso_pu_bacteria 2842489311 2842494804 133
111 iso_pu_bacteria 2842495871 2842500840 133
112 iso_pu_bacteria 2847670302 2847674705 133
113 iso_pu_bacteria 2850079185 2850079394 133
114 iso_pu_bacteria 2855825444 2855830774 133
115 iso_pu_bacteria 2855839649 2855845454 133
116 iso_pu_bacteria 2856314179 2856317409 133
117 iso_pu_bacteria 2857516855 2857523131 133
118 iso_pu_bacteria 2858800743 2858805321 133
119 iso_pu_bacteria 2878035449 2878038447 133
120 iso_pu_bacteria 2881853255 2881860504 133
121 iso_pu_bacteria 2896384573 2896389749 133
122 iso_pu_bacteria 2906414383 2906417474 133
123 iso_pu_bacteria 2913295892 2913301661 133
124 iso_pu_bacteria 2915980308 2915983602 133
125 iso_pu_bacteria 2915986958 2915989753 133
126 iso_pu_bacteria 2915993759 2915997581 133
127 iso_pu_bacteria 2916000859 2916003644 133
128 iso_pu_bacteria 2916007675 2916011482 133
129 iso_pu_bacteria 2916014648 2916021148 133
130 iso_pu_bacteria 2916021584 2916025714 133
131 iso_pu_bacteria 2916028427 2916032488 133
132 iso_pu_bacteria 2916035215 2916039598 133
133 iso_pu_bacteria 2916041962 2916043855 133
134 iso_pu_bacteria 2916048683 2916053013 133
135 iso_pu_bacteria 2916055098 2916059331 133
136 iso_pu_bacteria 2916061851 2916063243 133
137 iso_pu_bacteria 2916068649 2916071959 133
138 iso_pu_bacteria 2916076590 2916082212 133
139 iso_pu_bacteria 2920760137 2920767145 133
140 iso_pu_bacteria 2921201388 2921201542 133
141 iso_pu_bacteria 2921208531 2921211485 133
142 iso_pu_bacteria 2921237296 2921243149 133
143 iso_pu_bacteria 2921244191 2921247414 133
144 iso_pu_bacteria 2921250672 2921252366 133
145 iso_pu_bacteria 2921257292 2921259143 133
146 iso_pu_bacteria 2921263974 2921268265 133
147 iso_pu_bacteria 2921282425 2921286564 133
148 iso_pu_bacteria 2921289301 2921293057 133
149 iso_pu_bacteria 2921296804 2921297058 133
150 iso_pu_bacteria 2924144063 2924149367 133
151 iso_pu_bacteria 2924150972 2924155143 133
152 iso_pu_bacteria 2924158325 2924162572 133
153 iso_pu_bacteria 2924165586 2924166874 133
154 iso_pu_bacteria 2924172951 2924176681 133
155 iso_pu_bacteria 2924179722 2924182622 133
156 iso_pu_bacteria 2924186466 2924188644 133
157 iso_pu_bacteria 2924193448 2924197077 133
158 iso_pu_bacteria 2924200457 2924206310 133
159 iso_pu_bacteria 2924207177 2924208790 133
160 iso_pu_bacteria 2924214083 2924218470 133
161 iso_pu_bacteria 2924221636 2924222210 133
162 iso_pu_bacteria 2924228884 2924231531 133
163 iso_pu_bacteria 2933586486 2933589565 133
164 iso_pu_bacteria 2936367885 2936374698 133
165 iso_pu_bacteria 2936375103 2936375867 133
166 iso_pu_bacteria 2936996657 2936998149 133
167 iso_pu_bacteria 2937002841 2937005277 133
168 iso_pu_bacteria 2937009748 2937011451 133
169 iso_pu_bacteria 2937016420 2937017241 133
170 iso_pu_bacteria 2937023124 2937026070 133
171 iso_pu_bacteria 2937029754 2937032019 133
172 iso_pu_bacteria 2937036028 2937038846 133
173 iso_pu_bacteria 2937042894 2937046585 133
174 iso_pu_bacteria 2937049772 2937055815 133
175 iso_pu_bacteria 2937056579 2937060675 133
176 iso_pu_bacteria 2937063883 2937067316 133
177 iso_pu_bacteria 2937071275 2937074497 133
178 iso_pu_bacteria 2937078374 2937081392 133
179 iso_pu_bacteria 2937084907 2937088871 133
180 iso_pu_bacteria 2937091812 2937095108 133
181 iso_pu_bacteria 2937098957 2937103769 133
182 iso_pu_bacteria 2937106411 2937109284 133
183 iso_pu_bacteria 2937113482 2937117364 133
184 iso_pu_bacteria 2937119839 2937120818 133
185 iso_pu_bacteria 2937126314 2937130657 133
186 iso_pu_bacteria 2957375807 2957375855 133
187 iso_pu_bacteria 2957382221 2957386751 133
188 iso_pu_bacteria 2957388812 2957391605 133
189 iso_pu_bacteria 2957395598 2957397542 133
190 iso_pu_bacteria 2957402308 2957407085 133
191 iso_pu_bacteria 2957408893 2957409330 133
192 iso_pu_bacteria 2957415311 2957418812 133
193 iso_pu_bacteria 2957422303 2957422804 133
194 iso_pu_bacteria 2957430029 2957435618 133
195 iso_pu_bacteria 2957437181 2957437944 133
196 iso_pu_bacteria 2957443900 2957444658 133
197 iso_pu_bacteria 2957450854 2957453023 133
198 iso_pu_bacteria 2957457609 2957463118 133
199 iso_pu_bacteria 2957464669 2957470460 133
200 iso_pu_bacteria 2957471148 2957476044 133
201 iso_pu_bacteria 2957478035 2957482177 133
202 iso_pu_bacteria 2957484790 2957489387 133
203 iso_pu_bacteria 2957491536 2957495393 133
204 iso_pu_bacteria 2957498199 2957502838 133
205 iso_pu_bacteria 2957505466 2957509003 133
206 iso_pu_bacteria 2960584000 2960587281 133
207 iso_pu_bacteria 2960591022 2960593990 133
208 iso_pu_bacteria 2960597568 2960600521 133
209 iso_pu_bacteria 2960603979 2960606897 133
210 iso_pu_bacteria 2960610863 2960612779 133
211 iso_pu_bacteria 2960617483 2960618426 133
212 iso_pu_bacteria 2960624210 2960628998 133
213 iso_pu_bacteria 2960631154 2960634293 133
214 iso_pu_bacteria 2960645483 2960651809 133
215 iso_pu_bacteria 2960652885 2960656110 133
216 iso_pu_bacteria 2960660292 2960661313 133
217 iso_pu_bacteria 2960667422 2960670622 133
218 iso_pu_bacteria 2960674078 2960676171 133
219 iso_pu_bacteria 2960680706 2960683015 133
220 iso_pu_bacteria 2960687367 2960689717 133
221 iso_pu_bacteria 2960693952 2960697727 133
222 iso_pu_bacteria 2964607997 2964612333 133
223 iso_pu_bacteria 2964615318 2964617219 133
224 iso_pu_bacteria 2964621998 2964625688 133
225 iso_pu_bacteria 2964628898 2964630117 133
226 iso_pu_bacteria 2964636051 2964637934 133
227 iso_pu_bacteria 2964643177 2964647112 133
228 iso_pu_bacteria 2964649959 2964654435 133
229 iso_pu_bacteria 2964656573 2964660934 133
230 iso_pu_bacteria 2964663802 2964664842 133
231 iso_pu_bacteria 2964670856 2964675198 133
232 iso_pu_bacteria 2964678106 2964683155 133
233 iso_pu_bacteria 2964685014 2964691179 133
234 iso_pu_bacteria 2964691889 2964694020 133
235 iso_pu_bacteria 2964698721 2964699707 133
236 iso_pu_bacteria 2964705432 2964709072 133
237 iso_pu_bacteria 2964712639 2964716421 133
238 iso_pu_bacteria 2967664464 2967668841 133
239 iso_pu_bacteria 2967671571 2967675732 133
240 iso_pu_bacteria 2967678726 2967683524 133
241 iso_pu_bacteria 2967686174 2967688230 133
242 iso_pu_bacteria 2967693043 2967697314 133
243 iso_pu_bacteria 2967699805 2967701329 133
244 iso_pu_bacteria 2967706974 2967707544 133
245 iso_pu_bacteria 2967714385 2967719289 133
246 iso_pu_bacteria 2967721400 2967724060 133
247 iso_pu_bacteria 2967728569 2967730182 133
248 iso_pu_bacteria 2967735183 2967739636 133
249 iso_pu_bacteria 2967742019 2967742419 133
250 iso_pu_bacteria 2967748971 2967751755 133
251 iso_pu_bacteria 2967755722 2967759469 133
252 iso_pu_bacteria 2967762386 2967764309 133
253 iso_pu_bacteria 2967769361 2967773918 133
254 iso_pu_bacteria 2967775926 2967781811 133
255 iso_pu_bacteria 2970019648 2970024230 133
256 iso_pu_bacteria 2970026789 2970027767 133
257 iso_pu_bacteria 2970033650 2970039352 133
258 iso_pu_bacteria 2970040964 2970043647 133
259 iso_pu_bacteria 2970047711 2970052270 133
260 iso_pu_bacteria 2970054988 2970057481 133
261 iso_pu_bacteria 2970061556 2970065799 133
262 iso_pu_bacteria 2970068827 2970071482 133
263 iso_pu_bacteria 2970076120 2970080347 133
264 iso_pu_bacteria 2970088815 2970093352 133
265 iso_pu_bacteria 2970095765 2970098980 133
266 iso_pu_bacteria 2970102677 2970105430 133
267 iso_pu_bacteria 2970109326 2970112673 133
268 iso_pu_bacteria 2970116247 2970119200 133
269 iso_pu_bacteria 2970122695 2970127759 133
270 iso_pu_bacteria 2970129317 2970133254 133
271 iso_pu_bacteria 2970136068 2970140398 133
272 iso_pu_bacteria 2970143518 2970149202 133
273 iso_pu_bacteria 2970149975 2970153501 133
274 iso_pu_bacteria 2970156795 2970163819 133
275 iso_pu_bacteria 2970164137 2970164994 133
276 iso_pu_bacteria 2970170962 2970177241 133
277 iso_pu_bacteria 2970177841 2970184228 133
278 iso_pu_bacteria 2970184632 2970191390 133
279 iso_pu_bacteria 2970191845 2970194579 133
280 iso_pu_bacteria 2977516862 2977520169 133
281 iso_pu_bacteria 2977523885 2977527598 133
282 iso_pu_bacteria 2977530762 2977533594 133
283 iso_pu_bacteria 2977537788 2977542860 133
284 iso_pu_bacteria 2977544691 2977548609 133
285 iso_pu_bacteria 2977551784 2977556434 133
286 iso_pu_bacteria 2977558990 2977562279 133
287 iso_pu_bacteria 2977565890 2977568403 133
288 iso_pu_bacteria 2977572785 2977576137 133
289 iso_pu_bacteria 2977579622 2977582107 133
290 iso_pu_bacteria 2996310559 2996316551 133
291 iso_pu_bacteria 639633055 639645357 133
292 iso_pu_bacteria 648276728 648737948 133
293 iso_pu_bacteria 8003992118 8003998148 133
294 iso_pu_bacteria 8003999396 8004005658 133
295 iso_pu_bacteria 8005289223 8005290827 133
296 iso_pu_bacteria 8005301065 8005301295 133
297 iso_pu_bacteria 8005376324 8005380541 133
298 iso_pu_bacteria 8005460587 8005467552 133
299 iso_pu_bacteria 8005556819 8005559467 133
300 iso_pu_bacteria 8005563573 8005566486 133
301 iso_pu_bacteria 8005688590 8005688890 133
302 iso_pu_bacteria 8018127388 8018132314 133
303 iso_pu_bacteria 8018163183 8018163760 133
304 iso_pu_bacteria 8024479707 8024481424 133
305 iso_pu_bacteria 8054558443 8054560633 133
306 iso_pu_bacteria 8057874678 8057881285 133
307 3300060353 Ga0501082_0732117 Ga0501082_0732117_57_467 134
308 iso_pu_bacteria 2503198000 2503199713 134
309 iso_pu_bacteria 2508501123 2509116654 134
310 iso_pu_bacteria 2508501127 2509142468 134
311 iso_pu_bacteria 2509276022 2509394642 134
312 iso_pu_bacteria 2510065059 2510318779 134
313 iso_pu_bacteria 2512875016 2512932871 134
314 iso_pu_bacteria 2512875024 2512960892 134
315 iso_pu_bacteria 2513237090 2513608982 134
316 iso_pu_bacteria 2513237164 2514036664 134
317 iso_pu_bacteria 2513237305 2514417287 134
318 iso_pu_bacteria 2588253730 2588518927 134
319 iso_pu_bacteria 2597489875 2597811081 134
320 iso_pu_bacteria 2599185301 2599939861 134
321 iso_pu_bacteria 2643221595 2643987610 134
322 iso_pu_bacteria 2643221627 2644157869 134
323 iso_pu_bacteria 2687453392 2688596965 134
324 iso_pu_bacteria 2693429783 2694630224 134
325 iso_pu_bacteria 2693429784 2694634304 134
326 iso_pu_bacteria 2721755686 2723574115 134
327 iso_pu_bacteria 2756170246 2756670929 134
328 iso_pu_bacteria 2791355123 2792748282 134
329 iso_pu_bacteria 2841734538 2841737461 134
330 iso_pu_bacteria 2844002411 2844008980 134
331 iso_pu_bacteria 2844009547 2844012306 134
332 iso_pu_bacteria 2847686936 2847690814 134
333 iso_pu_bacteria 2856320880 2856322802 134
334 iso_pu_bacteria 2856328259 2856328732 134
335 iso_pu_bacteria 2856334872 2856338337 134
336 iso_pu_bacteria 2856342000 2856349199 134
337 iso_pu_bacteria 2856349417 2856355333 134
338 iso_pu_bacteria 2856364286 2856366856 134
339 iso_pu_bacteria 2857349434 2857352256 134
340 iso_pu_bacteria 2857367948 2857370919 134
341 iso_pu_bacteria 2869162929 2869168560 134
342 iso_pu_bacteria 2869234852 2869241876 134
343 iso_pu_bacteria 2869242130 2869249188 134
344 iso_pu_bacteria 2869249662 2869249923 134
345 iso_pu_bacteria 2869256925 2869262910 134
346 iso_pu_bacteria 2869271264 2869276240 134
347 iso_pu_bacteria 2869278585 2869285654 134
348 iso_pu_bacteria 2869285874 2869287732 134
349 iso_pu_bacteria 2871429161 2871435680 134
350 iso_pu_bacteria 2871451962 2871452876 134
351 iso_pu_bacteria 2871459585 2871460250 134
352 iso_pu_bacteria 2871466892 2871473271 134
353 iso_pu_bacteria 2871474448 2871480886 134
354 iso_pu_bacteria 2871481445 2871487422 134
355 iso_pu_bacteria 2871488783 2871493521 134
356 iso_pu_bacteria 2871495908 2871496545 134
357 iso_pu_bacteria 2874102143 2874105294 134
358 iso_pu_bacteria 2874109183 2874115111 134
359 iso_pu_bacteria 2874116593 2874119247 134
360 iso_pu_bacteria 2874123672 2874128945 134
361 iso_pu_bacteria 2874131515 2874132900 134
362 iso_pu_bacteria 2874139085 2874142008 134
363 iso_pu_bacteria 2874146452 2874151363 134
364 iso_pu_bacteria 2874155637 2874158997 134
365 iso_pu_bacteria 2874162495 2874163033 134
366 iso_pu_bacteria 2874168670 2874175074 134
367 iso_pu_bacteria 2876363079 2876364879 134
368 iso_pu_bacteria 2876369609 2876377285 134
369 iso_pu_bacteria 2876377896 2876384965 134
370 iso_pu_bacteria 2876386047 2876387078 134
371 iso_pu_bacteria 2876392853 2876397707 134
372 iso_pu_bacteria 2876399893 2876405591 134
373 iso_pu_bacteria 2876406927 2876413853 134
374 iso_pu_bacteria 2876413966 2876417416 134
375 iso_pu_bacteria 2876420981 2876426023 134
376 iso_pu_bacteria 2878738818 2878744808 134
377 iso_pu_bacteria 2878745973 2878749243 134
378 iso_pu_bacteria 2878753008 2878757563 134
379 iso_pu_bacteria 2878760144 2878760773 134
380 iso_pu_bacteria 2878767105 2878767602 134
381 iso_pu_bacteria 2878774303 2878780501 134
382 iso_pu_bacteria 2878781027 2878784099 134
383 iso_pu_bacteria 2878788777 2878794337 134
384 iso_pu_bacteria 2881147464 2881149589 134
385 iso_pu_bacteria 2881155292 2881160770 134
386 iso_pu_bacteria 2881161766 2881166468 134
387 iso_pu_bacteria 2881845957 2881849487 134
388 iso_pu_bacteria 2881861095 2881863132 134
389 iso_pu_bacteria 2882632389 2882639382 134
390 iso_pu_bacteria 2882912400 2882918379 134
391 iso_pu_bacteria 2885305155 2885307949 134
392 iso_pu_bacteria 2885312484 2885313129 134
393 iso_pu_bacteria 2885318864 2885319416 134
394 iso_pu_bacteria 2885326080 2885326733 134
395 iso_pu_bacteria 2885334103 2885340994 134
396 iso_pu_bacteria 2885342637 2885349640 134
397 iso_pu_bacteria 2885350715 2885356107 134
398 iso_pu_bacteria 2888350351 2888354697 134
399 iso_pu_bacteria 2889010040 2889016312 134
400 iso_pu_bacteria 2889016732 2889018665 134
401 iso_pu_bacteria 2889790730 2889794441 134
402 iso_pu_bacteria 2889914905 2889914952 134
403 iso_pu_bacteria 2903448605 2903449659 134
404 iso_pu_bacteria 2903492973 2903498707 134
405 iso_pu_bacteria 2903492973 2903501293 134
406 iso_pu_bacteria 2903521522 2903522385 134
407 iso_pu_bacteria 2903528002 2903528764 134
408 iso_pu_bacteria 2903540706 2903541339 134
409 iso_pu_bacteria 2904659560 2904664358 134
410 iso_pu_bacteria 2906308376 2906310281 134
411 iso_pu_bacteria 2906321335 2906324346 134
412 iso_pu_bacteria 2906328253 2906333160 134
413 iso_pu_bacteria 2906354277 2906355227 134
414 iso_pu_bacteria 2906363423 2906365979 134
415 iso_pu_bacteria 2906378014 2906384877 134
416 iso_pu_bacteria 2906386501 2906387085 134
417 iso_pu_bacteria 2906401398 2906407987 134
418 iso_pu_bacteria 2906408224 2906414050 134
419 iso_pu_bacteria 2906427513 2906431559 134
420 iso_pu_bacteria 2922151315 2922153687 134
421 iso_pu_bacteria 2922158528 2922159041 134
422 iso_pu_bacteria 2922172374 2922172651 134
423 iso_pu_bacteria 2922185730 2922188374 134
424 iso_pu_bacteria 2924710171 2924712191 134
425 iso_pu_bacteria 2924718760 2924722536 134
426 iso_pu_bacteria 2924726620 2924730221 134
427 iso_pu_bacteria 2924733363 2924733919 134
428 iso_pu_bacteria 2924748358 2924749217 134
429 iso_pu_bacteria 2924754689 2924762399 134
430 iso_pu_bacteria 2924762789 2924767249 134
431 iso_pu_bacteria 2924776078 2924782839 134
432 iso_pu_bacteria 2924784321 2924786858 134
433 iso_pu_bacteria 2937813078 2937817105 134
434 iso_pu_bacteria 2937822353 2937822549 134
435 iso_pu_bacteria 2937836603 2937840303 134
436 iso_pu_bacteria 2937843397 2937847025 134
437 iso_pu_bacteria 2937848649 2937852484 134
438 iso_pu_bacteria 2937861824 2937867976 134
439 iso_pu_bacteria 2937868953 2937870534 134
440 iso_pu_bacteria 2937891427 2937892976 134
441 iso_pu_bacteria 2937972304 2937977571 134
442 iso_pu_bacteria 2937980651 2937983029 134
443 iso_pu_bacteria 2937994558 2937995195 134
444 iso_pu_bacteria 2938014810 2938016181 134
445 iso_pu_bacteria 2958034702 2958041669 134
446 iso_pu_bacteria 2958041894 2958047949 134
447 iso_pu_bacteria 2958064165 2958070662 134
448 iso_pu_bacteria 2958071322 2958071512 134
449 iso_pu_bacteria 2958084443 2958090788 134
450 iso_pu_bacteria 2958092219 2958095897 134
451 iso_pu_bacteria 2958100919 2958102443 134
452 iso_pu_bacteria 2958108152 2958113402 134
453 iso_pu_bacteria 2958115193 2958120910 134
454 iso_pu_bacteria 2958122699 2958128982 134
455 iso_pu_bacteria 2958130278 2958132134 134
456 iso_pu_bacteria 2958137437 2958138032 134
457 iso_pu_bacteria 2958144490 2958148753 134
458 iso_pu_bacteria 2958158011 2958164491 134
459 iso_pu_bacteria 2958165035 2958165540 134
460 iso_pu_bacteria 2958172287 2958174261 134
461 iso_pu_bacteria 2958179912 2958181948 134
462 iso_pu_bacteria 2961077736 2961079792 134
463 iso_pu_bacteria 2961114664 2961119357 134
464 iso_pu_bacteria 2961127735 2961132268 134
465 iso_pu_bacteria 2961163497 2961163999 134
466 iso_pu_bacteria 2961170736 2961175110 134
467 iso_pu_bacteria 2961183825 2961188402 134
468 iso_pu_bacteria 2963644680 2963646335 134
469 iso_pu_bacteria 2965018300 2965018935 134
470 iso_pu_bacteria 2965025482 2965027034 134
471 iso_pu_bacteria 2965032056 2965040199 134
472 iso_pu_bacteria 2965040258 2965046270 134
473 iso_pu_bacteria 2965047637 2965051211 134
474 iso_pu_bacteria 2965062239 2965062848 134
475 iso_pu_bacteria 2965089291 2965090429 134
476 iso_pu_bacteria 2965110997 2965117064 134
477 iso_pu_bacteria 2965119406 2965125246 134
478 iso_pu_bacteria 2967996073 2967999889 134
479 iso_pu_bacteria 2968003550 2968008248 134
480 iso_pu_bacteria 2968016561 2968020460 134
481 iso_pu_bacteria 2968083720 2968087139 134
482 iso_pu_bacteria 2968091066 2968091313 134
483 iso_pu_bacteria 2968097103 2968103141 134
484 iso_pu_bacteria 2968110612 2968115612 134
485 iso_pu_bacteria 2968117919 2968118985 134
486 iso_pu_bacteria 2968128360 2968128931 134
487 iso_pu_bacteria 2968138860 2968143471 134
488 iso_pu_bacteria 2968171901 2968172402 134
489 iso_pu_bacteria 2970469710 2970473757 134
490 iso_pu_bacteria 2970489779 2970490430 134
491 iso_pu_bacteria 2970503327 2970507698 134
492 iso_pu_bacteria 2970510686 2970516848 134
493 iso_pu_bacteria 2970524798 2970527093 134
494 iso_pu_bacteria 2970532167 2970534771 134
495 iso_pu_bacteria 2970540015 2970544534 134
496 iso_pu_bacteria 2970547951 2970548274 134
497 iso_pu_bacteria 2970554993 2970555626 134
498 iso_pu_bacteria 2970593180 2970600270 134
499 iso_pu_bacteria 2970619444 2970620168 134
500 iso_pu_bacteria 2970627176 2970633166 134
501 iso_pu_bacteria 2977821940 2977826720 134
502 iso_pu_bacteria 2977843712 2977847396 134
503 iso_pu_bacteria 2977851361 2977854158 134
504 iso_pu_bacteria 2977858184 2977861731 134
505 iso_pu_bacteria 2977864932 2977871926 134
506 iso_pu_bacteria 2977872689 2977873982 134
507 iso_pu_bacteria 2977907340 2977908170 134
508 iso_pu_bacteria 2977915119 2977921922 134
509 iso_pu_bacteria 2977922695 2977925276 134
510 iso_pu_bacteria 2977935797 2977940644 134
511 iso_pu_bacteria 2977942078 2977945675 134
512 iso_pu_bacteria 2977950692 2977954028 134
513 iso_pu_bacteria 2977957713 2977964756 134
514 iso_pu_bacteria 2977971508 2977973945 134
515 iso_pu_bacteria 2977986579 2977991286 134
516 iso_pu_bacteria 2979710463 2979715664 134
517 iso_pu_bacteria 2979742915 2979745631 134
518 iso_pu_bacteria 2979764755 2979771261 134
519 iso_pu_bacteria 2979779861 2979782193 134
520 iso_pu_bacteria 2979808191 2979812882 134
521 iso_pu_bacteria 2987636660 2987639440 134
522 iso_pu_bacteria 2987645492 2987648061 134
523 iso_pu_bacteria 2987652177 2987653913 134
524 iso_pu_bacteria 2987659509 2987660007 134
525 iso_pu_bacteria 2987666974 2987673447 134
526 iso_pu_bacteria 2987673487 2987680283 134
527 iso_pu_bacteria 2996341866 2996342789 134
528 iso_pu_bacteria 2996348954 2996352920 134
529 iso_pu_bacteria 2996386984 2996393294 134
530 iso_pu_bacteria 3000135777 3000139311 134
531 iso_pu_bacteria 3004167301 3004167352 134
532 iso_pu_bacteria 3004188549 3004189055 134
533 iso_pu_bacteria 3004195979 3004196619 134
534 iso_pu_bacteria 3004203850 3004204316 134
535 iso_pu_bacteria 3004211236 3004217770 134
536 iso_pu_bacteria 3004218560 3004221182 134
537 iso_pu_bacteria 3004232784 3004232811 134
538 iso_pu_bacteria 3004239961 3004243379 134
539 iso_pu_bacteria 3004268573 3004269931 134
540 iso_pu_bacteria 3004275668 3004279602 134
541 iso_pu_bacteria 3004289098 3004290609 134
542 iso_pu_bacteria 3004334049 3004336059 134
543 iso_pu_bacteria 637000159 637075955 134
544 iso_pu_bacteria 649633066 649871523 134
545 iso_pu_bacteria 8004300914 8004301845 134
546 iso_pu_bacteria 8004312739 8004314682 134
547 iso_pu_bacteria 8004361976 8004362268 134
548 iso_pu_bacteria 8004374579 8004379136 134
549 iso_pu_bacteria 8004387939 8004389517 134
550 iso_pu_bacteria 8004395343 8004402194 134
551 iso_pu_bacteria 8004445564 8004451788 134
552 iso_pu_bacteria 8004633249 8004637405 134
553 iso_pu_bacteria 8004640170 8004644029 134
554 iso_pu_bacteria 8004703790 8004712338 134
555 iso_pu_bacteria 8004714634 8004717915 134
556 iso_pu_bacteria 8004727605 8004734036 134
557 iso_pu_bacteria 8055617313 8055619182 134
558 3300028794 Ga0307515_10001956 Ga0307515_1000195641 135
559 3300037418 Ga0395900_1016906 Ga0395900_1016906_178_585 135
560 3300037471 Ga0395905_0015692 Ga0395905_0015692_1891_2298 135
561 3300037471 Ga0395905_0133797 Ga0395905_0133797_1557_1964 135
562 3300041462 Ga0451806_075586 Ga0451806_075586_222_629 135
563 3300041492 Ga0451835_0921118 Ga0451835_0921118_17_424 135
564 3300046460 Ga0495638_0012184 Ga0495638_0012184_2614_3021 135
565 3300053090 Ga0500646_0353370 Ga0500646_0353370_44_451 135
566 iso_pu_bacteria 3003930520 3003931264 135
567 3300003320 rootH2_10028209 rootH2_100282092 136
568 3300005339 Ga0070660_100552396 Ga0070660_1005523962 136
569 3300005530 Ga0070679_100713333 Ga0070679_1007133332 136
570 3300005539 Ga0068853_100186085 Ga0068853_1001860853 136
571 3300006042 Ga0075368_10588066 Ga0075368_105880661 136
572 3300006048 Ga0075363_100586664 Ga0075363_1005866642 136
573 3300006178 Ga0075367_10816648 Ga0075367_108166481 136
574 3300006237 Ga0097621_101618810 Ga0097621_1016188102 136
575 3300006353 Ga0075370_10022024 Ga0075370_100220242 136
576 3300009098 Ga0105245_10319392 Ga0105245_103193922 136
577 3300010375 Ga0105239_11331550 Ga0105239_113315502 136
578 3300013297 Ga0157378_10042568 Ga0157378_100425683 136
579 3300026041 Ga0207639_10043661 Ga0207639_100436613 136
580 3300027866 Ga0209813_10265884 Ga0209813_102658841 136
581 3300027876 Ga0209974_10287731 Ga0209974_102877311 136
582 3300028379 Ga0268266_11799320 Ga0268266_117993201 136
583 3300028577 Ga0265318_10006422 Ga0265318_100064221 136
584 3300031249 Ga0265339_10408694 Ga0265339_104086942 136
585 3300031344 Ga0265316_10541105 Ga0265316_105411052 136
586 3300031595 Ga0265313_10175580 Ga0265313_101755802 136
587 3300031824 Ga0307413_11662331 Ga0307413_116623311 136
588 3300031995 Ga0307409_102147767 Ga0307409_1021477671 136
589 3300032004 Ga0307414_11131611 Ga0307414_111316112 136
590 3300037068 Ga0373925_0909383 Ga0373925_0909383_65_478 136
591 3300037418 Ga0395900_0256309 Ga0395900_0256309_572_985 136
592 3300041997 Ga0439431_0143712 Ga0439431_0143712_118_528 136
593 3300042006 Ga0439432_163993 Ga0439432_163993_105_515 136
594 3300048924 Ga0496121_0129424 Ga0496121_0129424_1348_1758 136
595 3300048924 Ga0496121_0670015 Ga0496121_0670015_38_448 136
596 3300049571 Ga0501034_0126713 Ga0501034_0126713_2019_2429 136
597 3300049571 Ga0501034_0293836 Ga0501034_0293836_450_860 136
598 3300049690 Ga0501261_068866 Ga0501261_068866_69_479 136
599 3300050490 nmdc:mga03n38_271022_c1 nmdc:mga03n38_271022_c1_161_571 136
600 3300050493 nmdc:mga0k408_521497_c1 nmdc:mga0k408_521497_c1_103_513 136
601 3300050494 nmdc:mga06z11_630962_c1 nmdc:mga06z11_630962_c1_137_547 136
602 3300050495 nmdc:mga04h51_298587_c1 nmdc:mga04h51_298587_c1_14_427 136
603 3300053139 Ga0500568_0073172 Ga0500568_0073172_597_1007 136
604 3300053730 Ga0500645_174566 Ga0500645_174566_89_499 136
605 3300054114 Ga0501084_0221979 Ga0501084_0221979_111_521 136
606 iso_pu_bacteria 2996336353 2996341632 136
607 3300002987 JGI25159J45721_1000461 JGI25159J45721_100046118 137
608 3300003354 JGI25160J50197_1000248 JGI25160J50197_100024818 137
609 3300003374 JGI25161J50226_1000183 JGI25161J50226_100018326 137
610 3300004625 Ga0055543_1000245 Ga0055543_100024526 137
611 3300005262 Ga0065165_1001012 Ga0065165_100101218 137
612 3300005327 Ga0070658_10942686 Ga0070658_109426861 137
613 3300005344 Ga0070661_100001089 Ga0070661_1000010895 137
614 3300005367 Ga0070667_100348158 Ga0070667_1003481582 137
615 3300005539 Ga0068853_100006106 Ga0068853_1000061069 137
616 3300005563 Ga0068855_100252035 Ga0068855_1002520353 137
617 3300005577 Ga0068857_100124242 Ga0068857_1001242423 137
618 3300005578 Ga0068854_100019081 Ga0068854_1000190812 137
619 3300005614 Ga0068856_100034379 Ga0068856_1000343794 137
620 3300005616 Ga0068852_100007354 Ga0068852_1000073545 137
621 3300005834 Ga0068851_10000365 Ga0068851_100003657 137
622 3300005834 Ga0068851_10467013 Ga0068851_104670132 137
623 3300006042 Ga0075368_10006791 Ga0075368_100067916 137
624 3300006042 Ga0075368_10060503 Ga0075368_100605031 137
625 3300006048 Ga0075363_100074111 Ga0075363_1000741112 137
626 3300006048 Ga0075363_100362481 Ga0075363_1003624812 137
627 3300006178 Ga0075367_10043744 Ga0075367_100437442 137
628 3300006195 Ga0075366_10124451 Ga0075366_101244512 137
629 3300006846 Ga0075430_100381615 Ga0075430_1003816152 137
630 3300006946 Ga0079104_1014584 Ga0079104_10145843 137
631 3300006946 Ga0079104_1016005 Ga0079104_10160052 137
632 3300009093 Ga0105240_10066593 Ga0105240_100665933 137
633 3300009174 Ga0105241_10036083 Ga0105241_100360833 137
634 3300009545 Ga0105237_10207731 Ga0105237_102077313 137
635 3300009545 Ga0105237_11851660 Ga0105237_118516601 137
636 3300009551 Ga0105238_10038235 Ga0105238_100382353 137
637 3300009551 Ga0105238_10594859 Ga0105238_105948592 137
638 3300009765 Ga0123341_1000002 Ga0123341_100000234 137
639 3300009766 Ga0123342_1030249 Ga0123342_10302493 137
640 3300010375 Ga0105239_10050615 Ga0105239_100506153 137
641 3300010375 Ga0105239_10137640 Ga0105239_101376403 137
642 3300010375 Ga0105239_10597182 Ga0105239_105971822 137
643 3300013296 Ga0157374_10197245 Ga0157374_101972452 137
644 3300013307 Ga0157372_12446487 Ga0157372_124464871 137
645 3300014325 Ga0163163_10235476 Ga0163163_102354762 137
646 3300015261 Ga0182006_1031178 Ga0182006_10311782 137
647 3300015262 Ga0182007_10028924 Ga0182007_100289243 137
648 3300021320 Ga0214544_1000010 Ga0214544_1000010231 137
649 3300021321 Ga0214542_1000023 Ga0214542_100002320 137
650 3300021321 Ga0214542_1019114 Ga0214542_10191142 137
651 3300021327 Ga0214543_1000019 Ga0214543_100001995 137
652 3300021327 Ga0214543_1000156 Ga0214543_100015629 137
653 3300022739 Ga0228711_1000056 Ga0228711_100005648 137
654 3300022740 Ga0228710_1000229 Ga0228710_100022929 137
655 3300025284 Ga0209130_1000098 Ga0209130_1000098123 137
656 3300025302 Ga0207426_1000069 Ga0207426_1000069137 137
657 3300025321 Ga0207656_10029735 Ga0207656_100297352 137
658 3300025909 Ga0207705_10206070 Ga0207705_102060702 137
659 3300025911 Ga0207654_10270039 Ga0207654_102700392 137
660 3300025913 Ga0207695_10096031 Ga0207695_100960313 137
661 3300025913 Ga0207695_10399632 Ga0207695_103996322 137
662 3300025914 Ga0207671_10011147 Ga0207671_100111479 137
663 3300025914 Ga0207671_10082216 Ga0207671_100822163 137
664 3300025920 Ga0207649_10016189 Ga0207649_100161894 137
665 3300025924 Ga0207694_10221861 Ga0207694_102218612 137
666 3300025942 Ga0207689_10943409 Ga0207689_109434092 137
667 3300025944 Ga0207661_10303869 Ga0207661_103038692 137
668 3300025981 Ga0207640_10016463 Ga0207640_100164635 137
669 3300026041 Ga0207639_10024149 Ga0207639_100241493 137
670 3300026078 Ga0207702_10076518 Ga0207702_100765183 137
671 3300026116 Ga0207674_10043491 Ga0207674_100434915 137
672 3300026142 Ga0207698_10094232 Ga0207698_100942323 137
673 3300026142 Ga0207698_10743370 Ga0207698_107433702 137
674 3300027111 Ga0209281_1000272 Ga0209281_100027227 137
675 3300027111 Ga0209281_1000709 Ga0209281_100070916 137
676 3300027666 Ga0209282_1000055 Ga0209282_100005528 137
677 3300027866 Ga0209813_10016156 Ga0209813_100161563 137
678 3300031456 Ga0307513_10245401 Ga0307513_102454012 137
679 3300031967 Ga0315914_1000095 Ga0315914_100009550 137
680 3300031995 Ga0307409_101499315 Ga0307409_1014993152 137
681 3300031995 Ga0307409_102741992 Ga0307409_1027419921 137
682 3300032004 Ga0307414_12291093 Ga0307414_122910931 137
683 3300033180 Ga0307510_10282945 Ga0307510_102829452 137
684 3300033430 Ga0315913_1000019 Ga0315913_100001927 137
685 3300033464 Ga0315915_1000023 Ga0315915_100002350 137
686 3300041413 Ga0439465_0017138 Ga0439465_0017138_1720_2133 137
687 3300041453 Ga0451797_0003339 Ga0451797_0003339_45_458 137
688 3300041453 Ga0451797_0955447 Ga0451797_0955447_61_474 137
689 3300041486 Ga0451807_2300357 Ga0451807_2300357_106_522 137
690 3300041491 Ga0451833_0178365 Ga0451833_0178365_18_431 137
691 3300041492 Ga0451835_0861054 Ga0451835_0861054_88_501 137
692 3300041494 Ga0451837_1679461 Ga0451837_1679461_76_489 137
693 3300041496 Ga0451839_0326841 Ga0451839_0326841_473_886 137
694 3300041496 Ga0451839_0542047 Ga0451839_0542047_1182_1595 137
695 3300041498 Ga0451841_0564111 Ga0451841_0564111_1908_2321 137
696 3300041501 Ga0451845_0306592 Ga0451845_0306592_1582_1995 137
697 3300041503 Ga0451847_0471708 Ga0451847_0471708_856_1269 137
698 3300041505 Ga0451849_1148107 Ga0451849_1148107_599_1012 137
699 3300041507 Ga0451851_1221558 Ga0451851_1221558_1879_2292 137
700 3300041509 Ga0451843_0368501 Ga0451843_0368501_116_529 137
701 3300041999 Ga0439433_0097307 Ga0439433_0097307_226_639 137
702 3300042004 Ga0439445_0130328 Ga0439445_0130328_124_537 137
703 3300042006 Ga0439432_020307 Ga0439432_020307_589_1002 137
704 3300042007 Ga0439449_0026019 Ga0439449_0026019_154_567 137
705 3300046460 Ga0495638_0123166 Ga0495638_0123166_95_514 137
706 3300046460 Ga0495638_0214620 Ga0495638_0214620_535_951 137
707 3300046460 Ga0495638_0423459 Ga0495638_0423459_194_607 137
708 3300046507 Ga0495606_0218044 Ga0495606_0218044_346_759 137
709 3300047323 Ga0495683_0145001 Ga0495683_0145001_352_765 137
710 3300048911 Ga0496108_0240447 Ga0496108_0240447_834_1247 137
711 3300048915 Ga0496112_0001731 Ga0496112_0001731_15115_15528 137
712 3300048916 Ga0496113_0147244 Ga0496113_0147244_141_554 137
713 3300048922 Ga0496119_0010974 Ga0496119_0010974_2769_3182 137
714 3300048922 Ga0496119_0232531 Ga0496119_0232531_297_710 137
715 3300048924 Ga0496121_0167571 Ga0496121_0167571_959_1372 137
716 3300048924 Ga0496121_0397933 Ga0496121_0397933_84_497 137
717 3300048928 Ga0496125_0066554 Ga0496125_0066554_952_1365 137
718 3300049581 Ga0501047_0470021 Ga0501047_0470021_281_694 137
719 3300050489 nmdc:mga03683_443758_c1 nmdc:mga03683_443758_c1_74_487 137
720 3300050490 nmdc:mga03n38_70345_c1 nmdc:mga03n38_70345_c1_932_1345 137
721 3300050492 nmdc:mga0yw44_177287_c1 nmdc:mga0yw44_177287_c1_54_467 137
722 3300050493 nmdc:mga0k408_546564_c1 nmdc:mga0k408_546564_c1_128_541 137
723 3300050493 nmdc:mga0k408_561971_c1 nmdc:mga0k408_561971_c1_189_602 137
724 3300050494 nmdc:mga06z11_299164_c1 nmdc:mga06z11_299164_c1_250_663 137
725 3300050495 nmdc:mga04h51_57680_c1 nmdc:mga04h51_57680_c1_302_715 137
726 3300053092 Ga0500583_0463455 Ga0500583_0463455_84_497 137
727 3300053096 Ga0500641_0187048 Ga0500641_0187048_442_855 137
728 3300053124 Ga0500617_236154 Ga0500617_236154_138_551 137
729 3300053131 Ga0500652_333538 Ga0500652_333538_39_452 137
730 3300053146 Ga0500588_0058270 Ga0500588_0058270_534_947 137
731 iso_pu_bacteria 2960637947 2960643398 137
732 iso_pu_bacteria 2964719344 2964724819 137
733 3300002741 JGI25157J39369_1002201 JGI25157J39369_10022015 138
734 3300003214 JGI25165J46597_1000034 JGI25165J46597_100003479 138
735 3300003762 Ga0055542_1001063 Ga0055542_100106316 138
736 3300003762 Ga0055542_1035206 Ga0055542_10352061 138
737 3300003763 Ga0055529_1003010 Ga0055529_10030103 138
738 3300005329 Ga0070683_100399870 Ga0070683_1003998702 138
739 3300005334 Ga0068869_100559938 Ga0068869_1005599382 138
740 3300005339 Ga0070660_100168327 Ga0070660_1001683272 138
741 3300005356 Ga0070674_100024016 Ga0070674_1000240163 138
742 3300005356 Ga0070674_101191248 Ga0070674_1011912482 138
743 3300005356 Ga0070674_101310060 Ga0070674_1013100602 138
744 3300005364 Ga0070673_100268827 Ga0070673_1002688272 138
745 3300005366 Ga0070659_101326089 Ga0070659_1013260892 138
746 3300005455 Ga0070663_100832400 Ga0070663_1008324002 138
747 3300005457 Ga0070662_101337753 Ga0070662_1013377532 138
748 3300005459 Ga0068867_100107653 Ga0068867_1001076533 138
749 3300005459 Ga0068867_100272240 Ga0068867_1002722401 138
750 3300005467 Ga0070706_100890647 Ga0070706_1008906471 138
751 3300005530 Ga0070679_102103818 Ga0070679_1021038181 138
752 3300005535 Ga0070684_100705097 Ga0070684_1007050972 138
753 3300005539 Ga0068853_100009175 Ga0068853_1000091754 138
754 3300005539 Ga0068853_100508722 Ga0068853_1005087222 138
755 3300005548 Ga0070665_100237090 Ga0070665_1002370902 138
756 3300005548 Ga0070665_101413680 Ga0070665_1014136801 138
757 3300005548 Ga0070665_101885244 Ga0070665_1018852442 138
758 3300005549 Ga0070704_101670473 Ga0070704_1016704731 138
759 3300005563 Ga0068855_100331519 Ga0068855_1003315192 138
760 3300005563 Ga0068855_101100257 Ga0068855_1011002572 138
761 3300005563 Ga0068855_101165797 Ga0068855_1011657972 138
762 3300005578 Ga0068854_100214546 Ga0068854_1002145462 138
763 3300005616 Ga0068852_100511857 Ga0068852_1005118572 138
764 3300006038 Ga0075365_10002114 Ga0075365_100021146 138
765 3300006038 Ga0075365_10036263 Ga0075365_100362632 138
766 3300006038 Ga0075365_11074739 Ga0075365_110747392 138
767 3300006042 Ga0075368_10072602 Ga0075368_100726022 138
768 3300006048 Ga0075363_100044193 Ga0075363_1000441933 138
769 3300006048 Ga0075363_100205752 Ga0075363_1002057521 138
770 3300006048 Ga0075363_100361637 Ga0075363_1003616371 138
771 3300006177 Ga0075362_10164715 Ga0075362_101647152 138
772 3300006177 Ga0075362_10392812 Ga0075362_103928122 138
773 3300006178 Ga0075367_10057338 Ga0075367_100573382 138
774 3300006178 Ga0075367_10184904 Ga0075367_101849042 138
775 3300006186 Ga0075369_10024082 Ga0075369_100240822 138
776 3300006186 Ga0075369_10297875 Ga0075369_102978752 138
777 3300006195 Ga0075366_10349889 Ga0075366_103498891 138
778 3300006353 Ga0075370_10150186 Ga0075370_101501862 138
779 3300006353 Ga0075370_10611464 Ga0075370_106114641 138
780 3300006844 Ga0075428_100686712 Ga0075428_1006867122 138
781 3300006846 Ga0075430_100171599 Ga0075430_1001715992 138
782 3300006847 Ga0075431_100008602 Ga0075431_1000086025 138
783 3300006871 Ga0075434_100486499 Ga0075434_1004864992 138
784 3300006881 Ga0068865_100225653 Ga0068865_1002256532 138
785 3300009093 Ga0105240_11826999 Ga0105240_118269991 138
786 3300009093 Ga0105240_12053865 Ga0105240_120538651 138
787 3300009148 Ga0105243_11671647 Ga0105243_116716471 138
788 3300009148 Ga0105243_11822633 Ga0105243_118226332 138
789 3300009148 Ga0105243_12595170 Ga0105243_125951701 138
790 3300009174 Ga0105241_10281116 Ga0105241_102811162 138
791 3300009174 Ga0105241_10616650 Ga0105241_106166501 138
792 3300009545 Ga0105237_10054607 Ga0105237_100546073 138
793 3300009545 Ga0105237_11189679 Ga0105237_111896792 138
794 3300009551 Ga0105238_10426000 Ga0105238_104260002 138
795 3300009551 Ga0105238_10979796 Ga0105238_109797962 138
796 3300009553 Ga0105249_11273321 Ga0105249_112733212 138
797 3300010375 Ga0105239_10207776 Ga0105239_102077762 138
798 3300010375 Ga0105239_10368082 Ga0105239_103680822 138
799 3300010375 Ga0105239_11885803 Ga0105239_118858032 138
800 3300010375 Ga0105239_12759595 Ga0105239_127595951 138
801 3300010375 Ga0105239_13007697 Ga0105239_130076971 138
802 3300011119 Ga0105246_10539373 Ga0105246_105393732 138
803 3300011119 Ga0105246_11016211 Ga0105246_110162112 138
804 3300011119 Ga0105246_11590128 Ga0105246_115901282 138
805 3300013104 Ga0157370_10075580 Ga0157370_100755803 138
806 3300013104 Ga0157370_11280226 Ga0157370_112802261 138
807 3300013105 Ga0157369_10188646 Ga0157369_101886462 138
808 3300013296 Ga0157374_11478086 Ga0157374_114780861 138
809 3300013297 Ga0157378_10528673 Ga0157378_105286732 138
810 3300014325 Ga0163163_11008438 Ga0163163_110084382 138
811 3300014745 Ga0157377_11344622 Ga0157377_113446221 138
812 3300014969 Ga0157376_10409571 Ga0157376_104095712 138
813 3300014969 Ga0157376_11842785 Ga0157376_118427851 138
814 3300017792 Ga0163161_10224288 Ga0163161_102242882 138
815 3300025250 Ga0209026_1000100 Ga0209026_100010018 138
816 3300025254 Ga0209148_1000069 Ga0209148_1000069168 138
817 3300025254 Ga0209148_1003960 Ga0209148_10039603 138
818 3300025256 Ga0209759_1000549 Ga0209759_100054922 138
819 3300025261 Ga0209233_1000028 Ga0209233_100002883 138
820 3300025261 Ga0209233_1014135 Ga0209233_10141351 138
821 3300025272 Ga0209455_1000135 Ga0209455_100013519 138
822 3300025297 Ga0209758_1014469 Ga0209758_10144694 138
823 3300025901 Ga0207688_10158858 Ga0207688_101588582 138
824 3300025903 Ga0207680_10176801 Ga0207680_101768013 138
825 3300025904 Ga0207647_10120437 Ga0207647_101204372 138
826 3300025904 Ga0207647_10134094 Ga0207647_101340941 138
827 3300025907 Ga0207645_10111210 Ga0207645_101112103 138
828 3300025909 Ga0207705_10120282 Ga0207705_101202823 138
829 3300025910 Ga0207684_10616503 Ga0207684_106165032 138
830 3300025911 Ga0207654_11132240 Ga0207654_111322401 138
831 3300025913 Ga0207695_10390991 Ga0207695_103909912 138
832 3300025914 Ga0207671_10048066 Ga0207671_100480662 138
833 3300025919 Ga0207657_10015036 Ga0207657_100150362 138
834 3300025919 Ga0207657_10118186 Ga0207657_101181863 138
835 3300025920 Ga0207649_10092468 Ga0207649_100924682 138
836 3300025920 Ga0207649_10515957 Ga0207649_105159571 138
837 3300025924 Ga0207694_10041236 Ga0207694_100412363 138
838 3300025924 Ga0207694_10447154 Ga0207694_104471542 138
839 3300025932 Ga0207690_10064234 Ga0207690_100642342 138
840 3300025933 Ga0207706_11007353 Ga0207706_110073531 138
841 3300025937 Ga0207669_10637924 Ga0207669_106379242 138
842 3300025937 Ga0207669_10691447 Ga0207669_106914472 138
843 3300025937 Ga0207669_10950921 Ga0207669_109509212 138
844 3300025940 Ga0207691_10090174 Ga0207691_100901743 138
845 3300025944 Ga0207661_10198497 Ga0207661_101984972 138
846 3300025949 Ga0207667_10935294 Ga0207667_109352942 138
847 3300025949 Ga0207667_11023867 Ga0207667_110238672 138
848 3300025960 Ga0207651_10493860 Ga0207651_104938602 138
849 3300025981 Ga0207640_10168202 Ga0207640_101682022 138
850 3300025981 Ga0207640_10525514 Ga0207640_105255142 138
851 3300025981 Ga0207640_10792726 Ga0207640_107927262 138
852 3300026041 Ga0207639_10214961 Ga0207639_102149612 138
853 3300026041 Ga0207639_11137361 Ga0207639_111373612 138
854 3300026067 Ga0207678_10245762 Ga0207678_102457622 138
855 3300026067 Ga0207678_10860983 Ga0207678_108609832 138
856 3300026078 Ga0207702_10976183 Ga0207702_109761832 138
857 3300026088 Ga0207641_10550009 Ga0207641_105500092 138
858 3300026089 Ga0207648_10134399 Ga0207648_101343992 138
859 3300026089 Ga0207648_10153697 Ga0207648_101536973 138
860 3300026116 Ga0207674_10042765 Ga0207674_100427654 138
861 3300026116 Ga0207674_12134905 Ga0207674_121349051 138
862 3300026142 Ga0207698_10512673 Ga0207698_105126732 138
863 3300026142 Ga0207698_10953417 Ga0207698_109534172 138
864 3300026142 Ga0207698_11872215 Ga0207698_118722152 138
865 3300027866 Ga0209813_10321086 Ga0209813_103210862 138
866 3300027866 Ga0209813_10449076 Ga0209813_104490761 138
867 3300028379 Ga0268266_10033856 Ga0268266_100338564 138
868 3300028379 Ga0268266_10110141 Ga0268266_101101413 138
869 3300028379 Ga0268266_10460688 Ga0268266_104606882 138
870 3300028379 Ga0268266_10480157 Ga0268266_104801572 138
871 3300031548 Ga0307408_100530996 Ga0307408_1005309962 138
872 3300031911 Ga0307412_10382383 Ga0307412_103823832 138
873 3300031911 Ga0307412_10481124 Ga0307412_104811241 138
874 3300032002 Ga0307416_100405938 Ga0307416_1004059382 138
875 3300035398 Ga0316574_0405782 Ga0316574_0405782_197_613 138
876 3300037312 Ga0395899_0084472 Ga0395899_0084472_529_948 138
877 3300037418 Ga0395900_0014410 Ga0395900_0014410_7199_7618 138
878 3300037418 Ga0395900_0180840 Ga0395900_0180840_1271_1687 138
879 3300037418 Ga0395900_0421129 Ga0395900_0421129_568_984 138
880 3300037418 Ga0395900_0517868 Ga0395900_0517868_111_530 138
881 3300037418 Ga0395900_1624718 Ga0395900_1624718_66_482 138
882 3300037466 Ga0395898_0546371 Ga0395898_0546371_447_866 138
883 3300037471 Ga0395905_0472963 Ga0395905_0472963_44_460 138
884 3300037471 Ga0395905_0482047 Ga0395905_0482047_175_594 138
885 3300037471 Ga0395905_1159852 Ga0395905_1159852_161_577 138
886 3300038443 Ga0395901_0076932 Ga0395901_0076932_1284_1703 138
887 3300038443 Ga0395901_0259129 Ga0395901_0259129_1086_1502 138
888 3300038443 Ga0395901_0282485 Ga0395901_0282485_78_494 138
889 3300038443 Ga0395901_1514489 Ga0395901_1514489_104_520 138
890 3300041413 Ga0439465_0207644 Ga0439465_0207644_129_545 138
891 3300041413 Ga0439465_0350353 Ga0439465_0350353_84_500 138
892 3300041453 Ga0451797_1415564 Ga0451797_1415564_152_568 138
893 3300041512 Ga0451853_0727081 Ga0451853_0727081_35_460 138
894 3300042157 Ga0439458_0171420 Ga0439458_0171420_67_486 138
895 3300044658 Ga0466972_0029385 Ga0466972_0029385_811_1290 138
896 3300044658 Ga0466972_0155721 Ga0466972_0155721_133_549 138
897 3300044765 Ga0466970_0764168 Ga0466970_0764168_19_450 138
898 3300044901 Ga0466960_0648551 Ga0466960_0648551_66_482 138
899 3300046460 Ga0495638_0476406 Ga0495638_0476406_76_510 138
900 3300046460 Ga0495638_0478465 Ga0495638_0478465_196_615 138
901 3300046519 Ga0495632_0390255 Ga0495632_0390255_28_447 138
902 3300046522 Ga0495643_0353655 Ga0495643_0353655_61_477 138
903 3300046530 Ga0495654_0130108 Ga0495654_0130108_104_523 138
904 3300046616 Ga0495668_0036681 Ga0495668_0036681_1854_2270 138
905 3300046648 Ga0495611_0401065 Ga0495611_0401065_87_503 138
906 3300046660 Ga0495625_0021804 Ga0495625_0021804_3490_3906 138
907 3300047472 Ga0495686_0541580 Ga0495686_0541580_79_495 138
908 3300048091 Ga0495626_0259575 Ga0495626_0259575_250_669 138
909 3300048908 Ga0496105_0659412 Ga0496105_0659412_143_562 138
910 3300048909 Ga0496106_1056658 Ga0496106_1056658_95_511 138
911 3300048911 Ga0496108_0793576 Ga0496108_0793576_263_679 138
912 3300048913 Ga0496110_0293531 Ga0496110_0293531_597_1016 138
913 3300048915 Ga0496112_0607916 Ga0496112_0607916_591_1007 138
914 3300048918 Ga0496115_0121735 Ga0496115_0121735_250_675 138
915 3300048918 Ga0496115_0322285 Ga0496115_0322285_813_1229 138
916 3300048920 Ga0496117_0135687 Ga0496117_0135687_312_731 138
917 3300048921 Ga0496118_0345079 Ga0496118_0345079_348_764 138
918 3300048922 Ga0496119_0027484 Ga0496119_0027484_519_935 138
919 3300048923 Ga0496120_0002155 Ga0496120_0002155_3356_3772 138
920 3300048923 Ga0496120_0020849 Ga0496120_0020849_1447_1863 138
921 3300048924 Ga0496121_0154062 Ga0496121_0154062_239_682 138
922 3300048925 Ga0496122_0296413 Ga0496122_0296413_230_646 138
923 3300048927 Ga0496124_0114743 Ga0496124_0114743_828_1247 138
924 3300048927 Ga0496124_0386392 Ga0496124_0386392_137_553 138
925 3300048928 Ga0496125_0582133 Ga0496125_0582133_55_474 138
926 3300048929 Ga0496126_0152871 Ga0496126_0152871_694_1113 138
927 3300048929 Ga0496126_0211436 Ga0496126_0211436_407_826 138
928 3300049568 Ga0501031_0000008 Ga0501031_0000008_4704_5120 138
929 3300049569 Ga0501032_0000018 Ga0501032_0000018_151174_151590 138
930 3300049570 Ga0501033_0000032 Ga0501033_0000032_151185_151601 138
931 3300049570 Ga0501033_1059597 Ga0501033_1059597_88_504 138
932 3300049571 Ga0501034_0000103 Ga0501034_0000103_4704_5120 138
933 3300049571 Ga0501034_0832082 Ga0501034_0832082_110_526 138
934 3300049571 Ga0501034_1267285 Ga0501034_1267285_134_562 138
935 3300049572 Ga0501036_0000012 Ga0501036_0000012_151185_151601 138
936 3300049573 Ga0501037_0000018 Ga0501037_0000018_4704_5120 138
937 3300049574 Ga0501038_0000017 Ga0501038_0000017_4704_5120 138
938 3300049575 Ga0501039_0000024 Ga0501039_0000024_4704_5120 138
939 3300049576 Ga0501040_0040528 Ga0501040_0040528_45_461 138
940 3300049579 Ga0501043_0004332 Ga0501043_0004332_4855_5271 138
941 3300049579 Ga0501043_0210059 Ga0501043_0210059_1029_1457 138
942 3300049579 Ga0501043_0829557 Ga0501043_0829557_109_525 138
943 3300049580 Ga0501046_0779640 Ga0501046_0779640_62_478 138
944 3300049581 Ga0501047_0004558 Ga0501047_0004558_4639_5055 138
945 3300049583 Ga0501067_0391902 Ga0501067_0391902_162_584 138
946 3300049585 Ga0501069_1016217 Ga0501069_1016217_40_459 138
947 3300049586 Ga0501070_0026001 Ga0501070_0026001_3308_3724 138
948 3300049589 Ga0501073_0319039 Ga0501073_0319039_477_896 138
949 3300049822 Ga0501035_0000040 Ga0501035_0000040_4662_5078 138
950 3300049822 Ga0501035_0031169 Ga0501035_0031169_159_575 138
951 3300049823 Ga0501044_0000040 Ga0501044_0000040_4704_5120 138
952 3300049823 Ga0501044_0013108 Ga0501044_0013108_1741_2157 138
953 3300050489 nmdc:mga03683_114476_c1 nmdc:mga03683_114476_c1_136_552 138
954 3300050489 nmdc:mga03683_141469_c1 nmdc:mga03683_141469_c1_386_805 138
955 3300050489 nmdc:mga03683_405307_c1 nmdc:mga03683_405307_c1_172_591 138
956 3300050490 nmdc:mga03n38_15460_c1 nmdc:mga03n38_15460_c1_2394_2810 138
957 3300050490 nmdc:mga03n38_17735_c1 nmdc:mga03n38_17735_c1_731_1150 138
958 3300050490 nmdc:mga03n38_461833_c1 nmdc:mga03n38_461833_c1_154_570 138
959 3300050490 nmdc:mga03n38_656118_c1 nmdc:mga03n38_656118_c1_65_481 138
960 3300050492 nmdc:mga0yw44_1188482_c1 nmdc:mga0yw44_1188482_c1_44_463 138
961 3300050492 nmdc:mga0yw44_227875_c1 nmdc:mga0yw44_227875_c1_497_916 138
962 3300050492 nmdc:mga0yw44_87133_c1 nmdc:mga0yw44_87133_c1_694_1113 138
963 3300050493 nmdc:mga0k408_442392_c1 nmdc:mga0k408_442392_c1_42_458 138
964 3300050495 nmdc:mga04h51_190513_c1 nmdc:mga04h51_190513_c1_236_652 138
965 3300050495 nmdc:mga04h51_287868_c1 nmdc:mga04h51_287868_c1_55_471 138
966 3300050496 nmdc:mga07m45_41591_c1 nmdc:mga07m45_41591_c1_595_1014 138
967 3300050509 nmdc:mga0qj67_110919_c1 nmdc:mga0qj67_110919_c1_633_1055 138
968 3300050510 nmdc:mga06r32_15012_c1 nmdc:mga06r32_15012_c1_2586_3008 138
969 3300050512 nmdc:mga0n895_1252701_c1 nmdc:mga0n895_1252701_c1_226_648 138
970 3300050515 nmdc:mga0a205_419969_c1 nmdc:mga0a205_419969_c1_174_596 138
971 3300050516 nmdc:mga0sz30_192897_c1 nmdc:mga0sz30_192897_c1_341_757 138
972 3300050516 nmdc:mga0sz30_41876_c1 nmdc:mga0sz30_41876_c1_429_848 138
973 3300053083 Ga0495655_0269375 Ga0495655_0269375_81_500 138
974 3300053087 Ga0500643_190854 Ga0500643_190854_58_474 138
975 3300053119 Ga0500595_087247 Ga0500595_087247_451_870 138
976 3300053122 Ga0500608_076771 Ga0500608_076771_749_1165 138
977 3300053134 Ga0500658_0213663 Ga0500658_0213663_299_718 138
978 3300053139 Ga0500568_0000010 Ga0500568_0000010_38766_39182 138
979 3300053139 Ga0500568_0122876 Ga0500568_0122876_160_576 138
980 3300053151 Ga0500604_0022802 Ga0500604_0022802_598_1017 138
981 3300053153 Ga0500616_0141021 Ga0500616_0141021_283_702 138
982 3300053155 Ga0500620_000598 Ga0500620_000598_3815_4234 138
983 3300053158 Ga0500627_0417286 Ga0500627_0417286_80_496 138
984 3300053727 Ga0500611_012404 Ga0500611_012404_524_943 138
985 3300060353 Ga0501082_0145183 Ga0501082_0145183_296_715 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

61

136

0.95

PF00190

Cupin_1

Cupin

52

151

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x85-assembly2.cif.gz_C crystal structure of chicken cenp-c cupin domain 0.9559 16 118
5uqp-assembly1.cif.gz_B the crystal structure of cupin protein from rhodococcus jostii rha1 0.9323 38 118
7zvm-assembly1.cif.gz_A-2 thermococcus barophilus phosphomannose isomerase protein structure at 1.6 a 0.9301 36 117
5fq0-assembly2.cif.gz_D the structure of kdgf from halomonas sp. 0.914 20 123
4met-assembly1.cif.gz_A assigning the epr fine structure parameters of the mn(ii) centers in bacillus subtilis oxalate decarboxylase by site-directed mutagenesis and dft/mm calculations 0.8978 18 120
ID Description Score Start End Superfamily
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9396 20 117 2.60.120.10
af_A0A0R0L0M3_22_151_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9345 37 121 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9331 22 117 2.60.120.10
af_A0A0R0KI49_145_251_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9279 49 121 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9196 20 117 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A659UIY6-F1-model_v4 Cupin domain-containing protein 0.9952 1 118
AF-A0A659UIY6-F1-model_v4 Cupin domain-containing protein 0.9868 1 118
AF-Q2JYS6-F1-model_v4 Hypothetical conserved protein 0.9735 1 138
AF-A0A6H2H322-F1-model_v4 Cupin domain-containing protein 0.9678 7 137
AF-Q2JYS6-F1-model_v4 Hypothetical conserved protein 0.9666 1 138

Feature Viewer

pLDDT pTM Quality
94.41 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map