F487507
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 985 | 775 | 459 | 136 |
Family's Representative Sequence
| Representative Sequence | 3300044658|Ga0466972_0029385|Ga0466972_0029385_811_1290 |
| Length | 159 |
| Sequence | MKAGFGEIRCPEKTKGRDEAMADKSKVFVYPKDVSAFGFDWGRLSLTVAPEVNGAERFSGGVVDLPPGKGHSRHNHPGAEEIIFVISGQGEQMVEDEKGNPVVAKVGPGCTIYVPESRFHSTLNTGDQPMQLFVVYSPAGPELALRDLPDFRLLPAGGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 4 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 5 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 6 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 7 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 8 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 9 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 10 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 11 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 12 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 13 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 14 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 15 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 16 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 17 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 18 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 19 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 20 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 21 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 22 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 23 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 24 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 25 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 26 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 27 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 28 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 29 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 30 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 31 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 32 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 33 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 34 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 35 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 36 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 37 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 38 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 39 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 40 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 41 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 42 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 43 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 44 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 45 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 46 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 47 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 48 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 49 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 50 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 51 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 52 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 53 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 54 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 55 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 56 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 57 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 58 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 59 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 60 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 61 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 62 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 63 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 64 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 65 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 66 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 67 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 68 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 69 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 70 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 71 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 72 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 73 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 74 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 75 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 76 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 77 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 78 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 79 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 80 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 81 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 82 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 83 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 84 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 85 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 86 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 87 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 88 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 89 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 90 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 91 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 92 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 93 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 94 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 95 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 96 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 97 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 98 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 99 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 100 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 101 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 102 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 103 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 104 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 105 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 106 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 107 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 108 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 109 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 110 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 111 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 112 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 113 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 114 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 115 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 116 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 117 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 118 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 119 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 120 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 121 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 122 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 123 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 124 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 125 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 126 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 127 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 128 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 129 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 130 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 131 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 132 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 133 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 134 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 135 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 136 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 137 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 138 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 139 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 140 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 141 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 142 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 143 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 144 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 145 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 146 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 147 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 148 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 149 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 150 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 151 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 152 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 153 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 154 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 155 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 156 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 157 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 158 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 159 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 160 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 161 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 162 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 163 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 164 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 165 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 166 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 167 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 168 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 169 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 170 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 171 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 172 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 173 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 174 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 175 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 176 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 177 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 178 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 179 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 180 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 181 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 182 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 183 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 184 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 185 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 186 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 187 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 188 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 189 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 190 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 191 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 192 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 193 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 194 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 195 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 196 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 197 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 198 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 199 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 200 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 201 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 202 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 203 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 204 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 205 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 206 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 207 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 208 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 209 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 210 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 211 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 212 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 213 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 214 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 215 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 216 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 217 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 218 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 219 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 220 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 221 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 222 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 223 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 224 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 225 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 226 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 227 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 228 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 229 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 230 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 231 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 232 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 233 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 234 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 235 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 236 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 237 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 238 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 239 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 240 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 241 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 242 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 243 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 244 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 245 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 246 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 247 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 248 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 249 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 250 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 251 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 252 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 253 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 254 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 255 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 256 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 257 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 258 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 259 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 260 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 261 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 262 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 263 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 264 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 265 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 266 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 267 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 268 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 269 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 270 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 271 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 272 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 273 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 274 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 275 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 276 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 277 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 278 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 279 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 280 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 281 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 282 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 283 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 284 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 285 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 286 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 287 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 288 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 289 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 290 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 291 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 292 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 293 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 294 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 295 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 296 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 297 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 298 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 299 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 300 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 301 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 302 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 303 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 304 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 305 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 306 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 307 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 308 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 309 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 310 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 311 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 312 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 313 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 314 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 315 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 316 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 317 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 318 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 319 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 320 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 321 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 322 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 323 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 324 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 325 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 326 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 327 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 328 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 329 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 330 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 331 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 332 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 333 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 334 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 335 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 336 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 337 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 338 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 339 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 340 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 341 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 342 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 343 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 344 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 345 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 346 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 347 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 348 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 349 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 350 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 351 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 352 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 353 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 354 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 355 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 356 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 357 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 358 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 359 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 360 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 361 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 362 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 363 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 364 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 365 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 366 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 367 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 368 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 369 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 370 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 371 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 372 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 373 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 374 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 375 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 376 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 377 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 378 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 379 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 380 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 381 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 382 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 383 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 384 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 385 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 386 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 387 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 388 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 389 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 390 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 391 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 392 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 393 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 394 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 395 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 396 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 397 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 398 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 399 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 400 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 401 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 402 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 403 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 404 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 405 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 406 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 407 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 408 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 409 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 410 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 411 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 412 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 413 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 414 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 415 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 416 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 417 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 418 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 419 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 420 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 421 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 422 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 423 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 424 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 425 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 426 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 427 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 428 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 429 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 430 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 431 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 432 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 433 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 434 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 435 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 436 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 437 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 438 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 439 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 440 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 441 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 442 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 443 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 444 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 445 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 446 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 447 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 448 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 449 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 450 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 451 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 452 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 453 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 454 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 455 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 456 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 457 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 458 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 459 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 460 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 461 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 462 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 463 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 464 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 465 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 466 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 467 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 468 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 469 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 470 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 471 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 472 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 473 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 474 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 475 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 476 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 477 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 478 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 479 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 480 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 481 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 482 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 483 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 484 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 485 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 486 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 487 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 488 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 489 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 490 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 491 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 492 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 493 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 494 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 495 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 496 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 497 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 498 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 499 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 500 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 501 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 502 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 503 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 504 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 505 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 506 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 507 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 508 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 509 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 510 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 511 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 512 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 513 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 514 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 515 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 516 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 517 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 518 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 519 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 520 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 521 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 522 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 523 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 524 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 525 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 526 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 527 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 528 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 529 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 530 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 531 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 532 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 533 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 534 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 535 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 536 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 537 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 538 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 539 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 540 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 541 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 542 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 543 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 544 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 545 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 546 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 547 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 548 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 549 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 550 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 551 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 552 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 553 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 554 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 555 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 556 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 557 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 558 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 559 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 560 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 561 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 562 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 563 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 564 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 565 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 566 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 567 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 568 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 569 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 570 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 571 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 572 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 573 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 574 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 575 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 576 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 577 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 578 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 579 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 580 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 581 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 582 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 583 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 584 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 585 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 586 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 587 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 588 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 589 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 590 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 591 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 592 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 593 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 594 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 595 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 596 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 597 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 598 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 599 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 600 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 601 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 602 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 603 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 604 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 605 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 606 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 607 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 608 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 609 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 610 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 611 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 612 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 613 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 614 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 615 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 616 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 617 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 618 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 619 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 620 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 621 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 622 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 623 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 624 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 625 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 626 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 627 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 628 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 629 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 630 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 631 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 632 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 633 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 634 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 635 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 636 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 637 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 638 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 639 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 640 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 641 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 642 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 643 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 644 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 645 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 646 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 647 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 648 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 649 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 650 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 651 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 652 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 653 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 654 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 655 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 656 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 657 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 658 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 659 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 660 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 661 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 662 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 663 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 664 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 665 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 666 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 667 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 668 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 669 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 670 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 671 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 672 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 673 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 674 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 675 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 676 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 677 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 678 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 679 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 680 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 681 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 682 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 683 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 684 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 685 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 686 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 687 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 688 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 689 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 690 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 691 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 692 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 693 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 694 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 695 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 696 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 697 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 698 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 699 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 700 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 701 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 702 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 703 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 704 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 705 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 706 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 707 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 708 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 709 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 710 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 711 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 712 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 713 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 714 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 715 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 716 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 717 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 718 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 719 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 720 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 721 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 722 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 723 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 724 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 725 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 726 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 727 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 728 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 729 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 730 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 731 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 732 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 733 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 734 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 735 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 736 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 737 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 738 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 739 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 740 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 741 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 742 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 743 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 744 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 745 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 746 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 747 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 748 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 749 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 750 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 751 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 752 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 753 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 754 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 755 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 756 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 757 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 758 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 759 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 760 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 761 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 762 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 763 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 764 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 765 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 766 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 767 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 768 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 769 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 770 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 771 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 772 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 773 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 774 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 775 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 46.6 |
| Metatranscriptomes | 0 |
| Isolates | 53.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.64 |
| Nodule | 49.85 |
| Rhizoplane | 1.83 |
| Rhizosphere | 30.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25157J39369_1002201 | 3300002741 | Bacteria | 5352 |
| 2 | JGI25159J45721_1000461 | 3300002987 | Bacteria | 18823 |
| 3 | JGI25165J46597_1000034 | 3300003214 | Bacteria | 292458 |
| 4 | rootH2_10028209 | 3300003320 | Bacteria | 1775 |
| 5 | JGI25160J50197_1000248 | 3300003354 | Bacteria | 41777 |
| 6 | JGI25161J50226_1000183 | 3300003374 | Bacteria | 41777 |
| 7 | Ga0055542_1001063 | 3300003762 | Bacteria | 16922 |
| 8 | Ga0055542_1035206 | 3300003762 | Bacteria | 616 |
| 9 | Ga0055529_1003010 | 3300003763 | Bacteria | 2960 |
| 10 | Ga0055543_1000245 | 3300004625 | Bacteria | 41815 |
| 11 | Ga0065165_1001012 | 3300005262 | Bacteria | 34230 |
| 12 | Ga0070658_10942686 | 3300005327 | Bacteria | 751 |
| 13 | Ga0070683_100399870 | 3300005329 | Bacteria | 1310 |
| 14 | Ga0068869_100559938 | 3300005334 | Bacteria | 961 |
| 15 | Ga0070660_100168327 | 3300005339 | Bacteria | 1769 |
| 16 | Ga0070660_100552396 | 3300005339 | Bacteria | 961 |
| 17 | Ga0070661_100001089 | 3300005344 | Bacteria | 19198 |
| 18 | Ga0070674_100024016 | 3300005356 | Bacteria | 3954 |
| 19 | Ga0070674_101191248 | 3300005356 | Bacteria | 676 |
| 20 | Ga0070674_101310060 | 3300005356 | Bacteria | 646 |
| 21 | Ga0070673_100268827 | 3300005364 | Bacteria | 1491 |
| 22 | Ga0070659_101326089 | 3300005366 | Bacteria | 638 |
| 23 | Ga0070667_100348158 | 3300005367 | Bacteria | 1341 |
| 24 | Ga0070663_100832400 | 3300005455 | Bacteria | 793 |
| 25 | Ga0070662_101337753 | 3300005457 | Bacteria | 617 |
| 26 | Ga0068867_100107653 | 3300005459 | Bacteria | 2137 |
| 27 | Ga0068867_100272240 | 3300005459 | Bacteria | 1385 |
| 28 | Ga0070706_100890647 | 3300005467 | Bacteria | 822 |
| 29 | Ga0070679_100713333 | 3300005530 | Bacteria | 946 |
| 30 | Ga0070679_102103818 | 3300005530 | Bacteria | 514 |
| 31 | Ga0070684_100705097 | 3300005535 | Bacteria | 941 |
| 32 | Ga0068853_100006106 | 3300005539 | Bacteria | 9539 |
| 33 | Ga0068853_100009175 | 3300005539 | Bacteria | 7968 |
| 34 | Ga0068853_100186085 | 3300005539 | Bacteria | 1885 |
| 35 | Ga0068853_100508722 | 3300005539 | Bacteria | 1138 |
| 36 | Ga0070665_100237090 | 3300005548 | Bacteria | 1825 |
| 37 | Ga0070665_101413680 | 3300005548 | Bacteria | 705 |
| 38 | Ga0070665_101885244 | 3300005548 | Bacteria | 604 |
| 39 | Ga0070704_101670473 | 3300005549 | Bacteria | 588 |
| 40 | Ga0068855_100252035 | 3300005563 | Bacteria | 1969 |
| 41 | Ga0068855_100331519 | 3300005563 | Bacteria | 1680 |
| 42 | Ga0068855_101100257 | 3300005563 | Bacteria | 831 |
| 43 | Ga0068855_101165797 | 3300005563 | Bacteria | 803 |
| 44 | Ga0068857_100124242 | 3300005577 | Bacteria | 2325 |
| 45 | Ga0068854_100019081 | 3300005578 | Bacteria | 4615 |
| 46 | Ga0068854_100214546 | 3300005578 | Bacteria | 1520 |
| 47 | Ga0068856_100034379 | 3300005614 | Bacteria | 4964 |
| 48 | Ga0068852_100007354 | 3300005616 | Bacteria | 8035 |
| 49 | Ga0068852_100511857 | 3300005616 | Bacteria | 1197 |
| 50 | Ga0068851_10000365 | 3300005834 | Bacteria | 20408 |
| 51 | Ga0068851_10467013 | 3300005834 | Bacteria | 752 |
| 52 | Ga0075365_10002114 | 3300006038 | Bacteria | 9514 |
| 53 | Ga0075365_10036263 | 3300006038 | Bacteria | 3194 |
| 54 | Ga0075365_11074739 | 3300006038 | Bacteria | 567 |
| 55 | Ga0075368_10006791 | 3300006042 | Bacteria | 4019 |
| 56 | Ga0075368_10060503 | 3300006042 | Bacteria | 1516 |
| 57 | Ga0075368_10072602 | 3300006042 | Bacteria | 1392 |
| 58 | Ga0075368_10588066 | 3300006042 | Unclassified | 503 |
| 59 | Ga0075363_100044193 | 3300006048 | Bacteria | 2359 |
| 60 | Ga0075363_100074111 | 3300006048 | Bacteria | 1853 |
| 61 | Ga0075363_100205752 | 3300006048 | Bacteria | 1125 |
| 62 | Ga0075363_100361637 | 3300006048 | Bacteria | 849 |
| 63 | Ga0075363_100362481 | 3300006048 | Bacteria | 848 |
| 64 | Ga0075363_100586664 | 3300006048 | Bacteria | 667 |
| 65 | Ga0075362_10164715 | 3300006177 | Bacteria | 1069 |
| 66 | Ga0075362_10392812 | 3300006177 | Bacteria | 699 |
| 67 | Ga0075367_10043744 | 3300006178 | Bacteria | 2623 |
| 68 | Ga0075367_10057338 | 3300006178 | Bacteria | 2316 |
| 69 | Ga0075367_10184904 | 3300006178 | Bacteria | 1299 |
| 70 | Ga0075367_10816648 | 3300006178 | Bacteria | 594 |
| 71 | Ga0075369_10024082 | 3300006186 | Bacteria | 2520 |
| 72 | Ga0075369_10297875 | 3300006186 | Bacteria | 753 |
| 73 | Ga0075366_10124451 | 3300006195 | Bacteria | 1554 |
| 74 | Ga0075366_10349889 | 3300006195 | Bacteria | 907 |
| 75 | Ga0097621_101618810 | 3300006237 | Bacteria | 616 |
| 76 | Ga0075370_10022024 | 3300006353 | Bacteria | 3495 |
| 77 | Ga0075370_10150186 | 3300006353 | Bacteria | 1365 |
| 78 | Ga0075370_10611464 | 3300006353 | Bacteria | 660 |
| 79 | Ga0075428_100686712 | 3300006844 | Bacteria | 1091 |
| 80 | Ga0075430_100171599 | 3300006846 | Bacteria | 1804 |
| 81 | Ga0075430_100381615 | 3300006846 | Bacteria | 1163 |
| 82 | Ga0075431_100008602 | 3300006847 | Bacteria | 10219 |
| 83 | Ga0075434_100486499 | 3300006871 | Bacteria | 1255 |
| 84 | Ga0068865_100225653 | 3300006881 | Bacteria | 1467 |
| 85 | Ga0079104_1014584 | 3300006946 | Bacteria | 2365 |
| 86 | Ga0079104_1016005 | 3300006946 | Bacteria | 2205 |
| 87 | Ga0105240_10066593 | 3300009093 | Bacteria | 4467 |
| 88 | Ga0105240_11826999 | 3300009093 | Bacteria | 633 |
| 89 | Ga0105240_12053865 | 3300009093 | Bacteria | 594 |
| 90 | Ga0105245_10319392 | 3300009098 | Bacteria | 1529 |
| 91 | Ga0105243_11671647 | 3300009148 | Bacteria | 665 |
| 92 | Ga0105243_11822633 | 3300009148 | Bacteria | 640 |
| 93 | Ga0105243_12595170 | 3300009148 | Bacteria | 546 |
| 94 | Ga0105241_10036083 | 3300009174 | Bacteria | 3720 |
| 95 | Ga0105241_10281116 | 3300009174 | Bacteria | 1421 |
| 96 | Ga0105241_10616650 | 3300009174 | Bacteria | 982 |
| 97 | Ga0105237_10054607 | 3300009545 | Bacteria | 4003 |
| 98 | Ga0105237_10207731 | 3300009545 | Bacteria | 1958 |
| 99 | Ga0105237_11189679 | 3300009545 | Bacteria | 769 |
| 100 | Ga0105237_11851660 | 3300009545 | Bacteria | 611 |
| 101 | Ga0105238_10038235 | 3300009551 | Bacteria | 4874 |
| 102 | Ga0105238_10426000 | 3300009551 | Bacteria | 1322 |
| 103 | Ga0105238_10594859 | 3300009551 | Bacteria | 1114 |
| 104 | Ga0105238_10979796 | 3300009551 | Bacteria | 866 |
| 105 | Ga0105249_11273321 | 3300009553 | Bacteria | 807 |
| 106 | Ga0123341_1000002 | 3300009765 | Bacteria | 191257 |
| 107 | Ga0123342_1030249 | 3300009766 | Bacteria | 2736 |
| 108 | Ga0105239_10050615 | 3300010375 | Bacteria | 4556 |
| 109 | Ga0105239_10137640 | 3300010375 | Bacteria | 2719 |
| 110 | Ga0105239_10207776 | 3300010375 | Bacteria | 2194 |
| 111 | Ga0105239_10368082 | 3300010375 | Bacteria | 1624 |
| 112 | Ga0105239_10597182 | 3300010375 | Bacteria | 1259 |
| 113 | Ga0105239_11331550 | 3300010375 | Bacteria | 828 |
| 114 | Ga0105239_11885803 | 3300010375 | Bacteria | 693 |
| 115 | Ga0105239_12759595 | 3300010375 | Bacteria | 573 |
| 116 | Ga0105239_13007697 | 3300010375 | Bacteria | 549 |
| 117 | Ga0105246_10539373 | 3300011119 | Bacteria | 998 |
| 118 | Ga0105246_11016211 | 3300011119 | Bacteria | 752 |
| 119 | Ga0105246_11590128 | 3300011119 | Bacteria | 617 |
| 120 | Ga0157370_10075580 | 3300013104 | Bacteria | 3175 |
| 121 | Ga0157370_11280226 | 3300013104 | Bacteria | 661 |
| 122 | Ga0157369_10188646 | 3300013105 | Bacteria | 2167 |
| 123 | Ga0157374_10197245 | 3300013296 | Bacteria | 1970 |
| 124 | Ga0157374_11478086 | 3300013296 | Bacteria | 703 |
| 125 | Ga0157378_10042568 | 3300013297 | Bacteria | 4031 |
| 126 | Ga0157378_10528673 | 3300013297 | Bacteria | 1182 |
| 127 | Ga0163162_11230278 | 3300013306 | Bacteria | 850 |
| 128 | Ga0157372_12446487 | 3300013307 | Bacteria | 600 |
| 129 | Ga0163163_10235476 | 3300014325 | Bacteria | 1880 |
| 130 | Ga0163163_11008438 | 3300014325 | Bacteria | 896 |
| 131 | Ga0157377_11344622 | 3300014745 | Bacteria | 561 |
| 132 | Ga0157376_10409571 | 3300014969 | Bacteria | 1313 |
| 133 | Ga0157376_11842785 | 3300014969 | Bacteria | 641 |
| 134 | Ga0182006_1031178 | 3300015261 | Bacteria | 2150 |
| 135 | Ga0182007_10028924 | 3300015262 | Bacteria | 1900 |
| 136 | Ga0163161_10224288 | 3300017792 | Bacteria | 1456 |
| 137 | Ga0214544_1000010 | 3300021320 | Bacteria | 270164 |
| 138 | Ga0214542_1000023 | 3300021321 | Bacteria | 191557 |
| 139 | Ga0214542_1019114 | 3300021321 | Bacteria | 5520 |
| 140 | Ga0214543_1000019 | 3300021327 | Bacteria | 267908 |
| 141 | Ga0214543_1000156 | 3300021327 | Bacteria | 96889 |
| 142 | Ga0228711_1000056 | 3300022739 | Bacteria | 78987 |
| 143 | Ga0228710_1000229 | 3300022740 | Bacteria | 58988 |
| 144 | Ga0209026_1000100 | 3300025250 | Bacteria | 156131 |
| 145 | Ga0209148_1000069 | 3300025254 | Bacteria | 334444 |
| 146 | Ga0209148_1003960 | 3300025254 | Bacteria | 3806 |
| 147 | Ga0209759_1000549 | 3300025256 | Bacteria | 38630 |
| 148 | Ga0209233_1000028 | 3300025261 | Bacteria | 642062 |
| 149 | Ga0209233_1014135 | 3300025261 | Bacteria | 2259 |
| 150 | Ga0209455_1000135 | 3300025272 | Bacteria | 148007 |
| 151 | Ga0209130_1000098 | 3300025284 | Bacteria | 142506 |
| 152 | Ga0209758_1014469 | 3300025297 | Bacteria | 4191 |
| 153 | Ga0207426_1000069 | 3300025302 | Bacteria | 334513 |
| 154 | Ga0207656_10029735 | 3300025321 | Bacteria | 2252 |
| 155 | Ga0207688_10158858 | 3300025901 | Bacteria | 1339 |
| 156 | Ga0207680_10176801 | 3300025903 | Bacteria | 1441 |
| 157 | Ga0207647_10120437 | 3300025904 | Bacteria | 1548 |
| 158 | Ga0207647_10134094 | 3300025904 | Bacteria | 1454 |
| 159 | Ga0207645_10111210 | 3300025907 | Bacteria | 1773 |
| 160 | Ga0207705_10120282 | 3300025909 | Bacteria | 1948 |
| 161 | Ga0207705_10206070 | 3300025909 | Bacteria | 1491 |
| 162 | Ga0207684_10616503 | 3300025910 | Bacteria | 926 |
| 163 | Ga0207654_10270039 | 3300025911 | Bacteria | 1147 |
| 164 | Ga0207654_11132240 | 3300025911 | Bacteria | 570 |
| 165 | Ga0207695_10096031 | 3300025913 | Bacteria | 2966 |
| 166 | Ga0207695_10390991 | 3300025913 | Bacteria | 1275 |
| 167 | Ga0207695_10399632 | 3300025913 | Bacteria | 1258 |
| 168 | Ga0207671_10011147 | 3300025914 | Bacteria | 7344 |
| 169 | Ga0207671_10048066 | 3300025914 | Bacteria | 3158 |
| 170 | Ga0207671_10082216 | 3300025914 | Bacteria | 2416 |
| 171 | Ga0207657_10015036 | 3300025919 | Bacteria | 7516 |
| 172 | Ga0207657_10118186 | 3300025919 | Bacteria | 2183 |
| 173 | Ga0207649_10016189 | 3300025920 | Bacteria | 4200 |
| 174 | Ga0207649_10092468 | 3300025920 | Bacteria | 1983 |
| 175 | Ga0207649_10515957 | 3300025920 | Bacteria | 911 |
| 176 | Ga0207694_10041236 | 3300025924 | Bacteria | 3556 |
| 177 | Ga0207694_10221861 | 3300025924 | Bacteria | 1542 |
| 178 | Ga0207694_10447154 | 3300025924 | Bacteria | 1078 |
| 179 | Ga0207690_10064234 | 3300025932 | Bacteria | 2506 |
| 180 | Ga0207706_11007353 | 3300025933 | Bacteria | 700 |
| 181 | Ga0207669_10637924 | 3300025937 | Bacteria | 870 |
| 182 | Ga0207669_10691447 | 3300025937 | Bacteria | 837 |
| 183 | Ga0207669_10950921 | 3300025937 | Bacteria | 720 |
| 184 | Ga0207691_10090174 | 3300025940 | Bacteria | 2749 |
| 185 | Ga0207689_10943409 | 3300025942 | Bacteria | 728 |
| 186 | Ga0207661_10198497 | 3300025944 | Bacteria | 1763 |
| 187 | Ga0207661_10303869 | 3300025944 | Bacteria | 1431 |
| 188 | Ga0207667_10935294 | 3300025949 | Bacteria | 857 |
| 189 | Ga0207667_11023867 | 3300025949 | Bacteria | 812 |
| 190 | Ga0207651_10493860 | 3300025960 | Bacteria | 1057 |
| 191 | Ga0207640_10016463 | 3300025981 | Bacteria | 4301 |
| 192 | Ga0207640_10168202 | 3300025981 | Bacteria | 1630 |
| 193 | Ga0207640_10525514 | 3300025981 | Bacteria | 990 |
| 194 | Ga0207640_10792726 | 3300025981 | Bacteria | 820 |
| 195 | Ga0207639_10024149 | 3300026041 | Bacteria | 4395 |
| 196 | Ga0207639_10043661 | 3300026041 | Bacteria | 3367 |
| 197 | Ga0207639_10214961 | 3300026041 | Bacteria | 1657 |
| 198 | Ga0207639_11137361 | 3300026041 | Bacteria | 732 |
| 199 | Ga0207678_10245762 | 3300026067 | Bacteria | 1532 |
| 200 | Ga0207678_10860983 | 3300026067 | Bacteria | 801 |
| 201 | Ga0207702_10076518 | 3300026078 | Bacteria | 2893 |
| 202 | Ga0207702_10976183 | 3300026078 | Bacteria | 840 |
| 203 | Ga0207641_10550009 | 3300026088 | Bacteria | 1126 |
| 204 | Ga0207648_10134399 | 3300026089 | Bacteria | 2178 |
| 205 | Ga0207648_10153697 | 3300026089 | Bacteria | 2031 |
| 206 | Ga0207674_10042765 | 3300026116 | Bacteria | 4676 |
| 207 | Ga0207674_10043491 | 3300026116 | Bacteria | 4631 |
| 208 | Ga0207674_12134905 | 3300026116 | Bacteria | 524 |
| 209 | Ga0207698_10094232 | 3300026142 | Bacteria | 2461 |
| 210 | Ga0207698_10512673 | 3300026142 | Bacteria | 1169 |
| 211 | Ga0207698_10743370 | 3300026142 | Bacteria | 979 |
| 212 | Ga0207698_10953417 | 3300026142 | Bacteria | 867 |
| 213 | Ga0207698_11872215 | 3300026142 | Bacteria | 615 |
| 214 | Ga0209281_1000272 | 3300027111 | Bacteria | 99700 |
| 215 | Ga0209281_1000709 | 3300027111 | Bacteria | 33568 |
| 216 | Ga0209282_1000055 | 3300027666 | Bacteria | 101018 |
| 217 | Ga0209813_10016156 | 3300027866 | Bacteria | 2033 |
| 218 | Ga0209813_10265884 | 3300027866 | Bacteria | 656 |
| 219 | Ga0209813_10321086 | 3300027866 | Bacteria | 606 |
| 220 | Ga0209813_10449076 | 3300027866 | Bacteria | 527 |
| 221 | Ga0209974_10287731 | 3300027876 | Bacteria | 626 |
| 222 | Ga0268266_10033856 | 3300028379 | Bacteria | 4342 |
| 223 | Ga0268266_10110141 | 3300028379 | Bacteria | 2439 |
| 224 | Ga0268266_10460688 | 3300028379 | Bacteria | 1210 |
| 225 | Ga0268266_10480157 | 3300028379 | Bacteria | 1185 |
| 226 | Ga0268266_11799320 | 3300028379 | Bacteria | 587 |
| 227 | Ga0265318_10006422 | 3300028577 | Bacteria | 5414 |
| 228 | Ga0307515_10001956 | 3300028794 | Bacteria | 45627 |
| 229 | Ga0265339_10408694 | 3300031249 | Bacteria | 634 |
| 230 | Ga0265316_10541105 | 3300031344 | Bacteria | 829 |
| 231 | Ga0307513_10245401 | 3300031456 | Bacteria | 1592 |
| 232 | Ga0307408_100530996 | 3300031548 | Bacteria | 1035 |
| 233 | Ga0265313_10175580 | 3300031595 | Bacteria | 903 |
| 234 | Ga0307413_11662331 | 3300031824 | Unclassified | 569 |
| 235 | Ga0307412_10382383 | 3300031911 | Bacteria | 1140 |
| 236 | Ga0307412_10481124 | 3300031911 | Bacteria | 1030 |
| 237 | Ga0315914_1000095 | 3300031967 | Bacteria | 74092 |
| 238 | Ga0307409_101499315 | 3300031995 | Bacteria | 702 |
| 239 | Ga0307409_102147767 | 3300031995 | Bacteria | 588 |
| 240 | Ga0307409_102741992 | 3300031995 | Bacteria | 521 |
| 241 | Ga0307416_100405938 | 3300032002 | Bacteria | 1402 |
| 242 | Ga0307414_11131611 | 3300032004 | Bacteria | 724 |
| 243 | Ga0307414_12291093 | 3300032004 | Bacteria | 504 |
| 244 | Ga0307510_10282945 | 3300033180 | Bacteria | 1128 |
| 245 | Ga0315913_1000019 | 3300033430 | Bacteria | 100387 |
| 246 | Ga0315915_1000023 | 3300033464 | Bacteria | 119157 |
| 247 | Ga0316574_0405782 | 3300035398 | Bacteria | 858 |
| 248 | Ga0373925_0909383 | 3300037068 | Bacteria | 725 |
| 249 | Ga0395899_0084472 | 3300037312 | Bacteria | 2308 |
| 250 | Ga0395900_0014410 | 3300037418 | Bacteria | 8069 |
| 251 | Ga0395900_0180840 | 3300037418 | Bacteria | 2143 |
| 252 | Ga0395900_0256309 | 3300037418 | Bacteria | 1749 |
| 253 | Ga0395900_0421129 | 3300037418 | Bacteria | 1296 |
| 254 | Ga0395900_0517868 | 3300037418 | Bacteria | 1141 |
| 255 | Ga0395900_1016906 | 3300037418 | Bacteria | 748 |
| 256 | Ga0395900_1624718 | 3300037418 | Bacteria | 557 |
| 257 | Ga0395898_0546371 | 3300037466 | Bacteria | 1100 |
| 258 | Ga0395905_0015692 | 3300037471 | Bacteria | 7196 |
| 259 | Ga0395905_0133797 | 3300037471 | Bacteria | 2332 |
| 260 | Ga0395905_0472963 | 3300037471 | Bacteria | 1152 |
| 261 | Ga0395905_0482047 | 3300037471 | Bacteria | 1140 |
| 262 | Ga0395905_1159852 | 3300037471 | Bacteria | 676 |
| 263 | Ga0395901_0076932 | 3300038443 | Bacteria | 3482 |
| 264 | Ga0395901_0259129 | 3300038443 | Bacteria | 1810 |
| 265 | Ga0395901_0282485 | 3300038443 | Bacteria | 1724 |
| 266 | Ga0395901_1514489 | 3300038443 | Bacteria | 626 |
| 267 | Ga0439465_0017138 | 3300041413 | Bacteria | 2260 |
| 268 | Ga0439465_0207644 | 3300041413 | Bacteria | 715 |
| 269 | Ga0439465_0350353 | 3300041413 | Bacteria | 558 |
| 270 | Ga0451797_0003339 | 3300041453 | Bacteria | 559 |
| 271 | Ga0451797_0955447 | 3300041453 | Bacteria | 622 |
| 272 | Ga0451797_1415564 | 3300041453 | Bacteria | 588 |
| 273 | Ga0451806_075586 | 3300041462 | Bacteria | 672 |
| 274 | Ga0451807_2300357 | 3300041486 | Bacteria | 1114 |
| 275 | Ga0451833_0178365 | 3300041491 | Bacteria | 5220 |
| 276 | Ga0451835_0861054 | 3300041492 | Bacteria | 572 |
| 277 | Ga0451835_0921118 | 3300041492 | Bacteria | 698 |
| 278 | Ga0451837_1679461 | 3300041494 | Bacteria | 882 |
| 279 | Ga0451839_0326841 | 3300041496 | Bacteria | 1821 |
| 280 | Ga0451839_0542047 | 3300041496 | Bacteria | 2193 |
| 281 | Ga0451841_0564111 | 3300041498 | Bacteria | 2444 |
| 282 | Ga0451845_0306592 | 3300041501 | Bacteria | 2148 |
| 283 | Ga0451847_0471708 | 3300041503 | Bacteria | 1470 |
| 284 | Ga0451849_1148107 | 3300041505 | Bacteria | 2895 |
| 285 | Ga0451851_1221558 | 3300041507 | Bacteria | 2407 |
| 286 | Ga0451843_0368501 | 3300041509 | Bacteria | 704 |
| 287 | Ga0451853_0727081 | 3300041512 | Bacteria | 653 |
| 288 | Ga0439431_0143712 | 3300041997 | Bacteria | 675 |
| 289 | Ga0439433_0097307 | 3300041999 | Bacteria | 728 |
| 290 | Ga0439445_0130328 | 3300042004 | Bacteria | 726 |
| 291 | Ga0439432_020307 | 3300042006 | Bacteria | 2209 |
| 292 | Ga0439432_163993 | 3300042006 | Bacteria | 650 |
| 293 | Ga0439449_0026019 | 3300042007 | Bacteria | 2185 |
| 294 | Ga0439458_0171420 | 3300042157 | Bacteria | 587 |
| 295 | Ga0466972_0029385 | 3300044658 | Bacteria | 2706 |
| 296 | Ga0466972_0155721 | 3300044658 | Bacteria | 1073 |
| 297 | Ga0466970_0764168 | 3300044765 | Bacteria | 565 |
| 298 | Ga0466960_0648551 | 3300044901 | Bacteria | 630 |
| 299 | Ga0495638_0012184 | 3300046460 | Bacteria | 5904 |
| 300 | Ga0495638_0123166 | 3300046460 | Bacteria | 1530 |
| 301 | Ga0495638_0214620 | 3300046460 | Bacteria | 1079 |
| 302 | Ga0495638_0423459 | 3300046460 | Bacteria | 686 |
| 303 | Ga0495638_0476406 | 3300046460 | Bacteria | 633 |
| 304 | Ga0495638_0478465 | 3300046460 | Bacteria | 631 |
| 305 | Ga0495606_0218044 | 3300046507 | Bacteria | 1077 |
| 306 | Ga0495632_0390255 | 3300046519 | Bacteria | 609 |
| 307 | Ga0495643_0353655 | 3300046522 | Bacteria | 657 |
| 308 | Ga0495654_0130108 | 3300046530 | Bacteria | 1131 |
| 309 | Ga0495668_0036681 | 3300046616 | Bacteria | 2746 |
| 310 | Ga0495611_0401065 | 3300046648 | Bacteria | 627 |
| 311 | Ga0495625_0021804 | 3300046660 | Bacteria | 4921 |
| 312 | Ga0495683_0145001 | 3300047323 | Bacteria | 1110 |
| 313 | Ga0495686_0541580 | 3300047472 | Bacteria | 609 |
| 314 | Ga0495626_0259575 | 3300048091 | Bacteria | 695 |
| 315 | Ga0496105_0659412 | 3300048908 | Bacteria | 807 |
| 316 | Ga0496106_1056658 | 3300048909 | Bacteria | 637 |
| 317 | Ga0496108_0240447 | 3300048911 | Bacteria | 1575 |
| 318 | Ga0496108_0793576 | 3300048911 | Bacteria | 817 |
| 319 | Ga0496109_0695741 | 3300048912 | Bacteria | 954 |
| 320 | Ga0496110_0293531 | 3300048913 | Bacteria | 1481 |
| 321 | Ga0496112_0001731 | 3300048915 | Bacteria | 17084 |
| 322 | Ga0496112_0607916 | 3300048915 | Bacteria | 1025 |
| 323 | Ga0496113_0147244 | 3300048916 | Bacteria | 1856 |
| 324 | Ga0496115_0121735 | 3300048918 | Bacteria | 2147 |
| 325 | Ga0496115_0322285 | 3300048918 | Bacteria | 1264 |
| 326 | Ga0496117_0135687 | 3300048920 | Bacteria | 1483 |
| 327 | Ga0496118_0345079 | 3300048921 | Bacteria | 796 |
| 328 | Ga0496119_0010974 | 3300048922 | Bacteria | 7562 |
| 329 | Ga0496119_0027484 | 3300048922 | Bacteria | 3908 |
| 330 | Ga0496119_0232531 | 3300048922 | Bacteria | 937 |
| 331 | Ga0496120_0002155 | 3300048923 | Bacteria | 20986 |
| 332 | Ga0496120_0020849 | 3300048923 | Bacteria | 4153 |
| 333 | Ga0496121_0129424 | 3300048924 | Bacteria | 1892 |
| 334 | Ga0496121_0154062 | 3300048924 | Bacteria | 1688 |
| 335 | Ga0496121_0167571 | 3300048924 | Bacteria | 1599 |
| 336 | Ga0496121_0397933 | 3300048924 | Bacteria | 903 |
| 337 | Ga0496121_0670015 | 3300048924 | Unclassified | 629 |
| 338 | Ga0496122_0296413 | 3300048925 | Bacteria | 875 |
| 339 | Ga0496124_0114743 | 3300048927 | Bacteria | 2163 |
| 340 | Ga0496124_0386392 | 3300048927 | Bacteria | 977 |
| 341 | Ga0496125_0066554 | 3300048928 | Bacteria | 2846 |
| 342 | Ga0496125_0582133 | 3300048928 | Bacteria | 614 |
| 343 | Ga0496126_0152871 | 3300048929 | Bacteria | 1977 |
| 344 | Ga0496126_0211436 | 3300048929 | Bacteria | 1633 |
| 345 | Ga0501031_0000008 | 3300049568 | Bacteria | 156304 |
| 346 | Ga0501031_0203455 | 3300049568 | Bacteria | 1291 |
| 347 | Ga0501032_0000018 | 3300049569 | Bacteria | 156275 |
| 348 | Ga0501032_0012010 | 3300049569 | Bacteria | 6200 |
| 349 | Ga0501032_0016409 | 3300049569 | Bacteria | 5209 |
| 350 | Ga0501033_0000032 | 3300049570 | Bacteria | 156304 |
| 351 | Ga0501033_0010055 | 3300049570 | Bacteria | 7263 |
| 352 | Ga0501033_0022431 | 3300049570 | Bacteria | 4762 |
| 353 | Ga0501033_1059597 | 3300049570 | Bacteria | 540 |
| 354 | Ga0501034_0000103 | 3300049571 | Bacteria | 156304 |
| 355 | Ga0501034_0013483 | 3300049571 | Bacteria | 8413 |
| 356 | Ga0501034_0071072 | 3300049571 | Bacteria | 3490 |
| 357 | Ga0501034_0126713 | 3300049571 | Bacteria | 2538 |
| 358 | Ga0501034_0293836 | 3300049571 | Bacteria | 1562 |
| 359 | Ga0501034_0832082 | 3300049571 | Bacteria | 814 |
| 360 | Ga0501034_1267285 | 3300049571 | Bacteria | 614 |
| 361 | Ga0501036_0000012 | 3300049572 | Bacteria | 156304 |
| 362 | Ga0501036_0021735 | 3300049572 | Bacteria | 5393 |
| 363 | Ga0501036_1032294 | 3300049572 | Bacteria | 672 |
| 364 | Ga0501037_0000018 | 3300049573 | Bacteria | 156304 |
| 365 | Ga0501037_0070785 | 3300049573 | Bacteria | 2537 |
| 366 | Ga0501038_0000017 | 3300049574 | Bacteria | 156304 |
| 367 | Ga0501038_0024638 | 3300049574 | Bacteria | 5364 |
| 368 | Ga0501039_0000024 | 3300049575 | Bacteria | 156304 |
| 369 | Ga0501039_0085075 | 3300049575 | Bacteria | 2463 |
| 370 | Ga0501039_0095117 | 3300049575 | Bacteria | 2322 |
| 371 | Ga0501040_0040528 | 3300049576 | Bacteria | 3169 |
| 372 | Ga0501042_0261884 | 3300049578 | Bacteria | 1248 |
| 373 | Ga0501043_0004332 | 3300049579 | Bacteria | 11551 |
| 374 | Ga0501043_0210059 | 3300049579 | Bacteria | 1509 |
| 375 | Ga0501043_0262863 | 3300049579 | Bacteria | 1326 |
| 376 | Ga0501043_0279990 | 3300049579 | Bacteria | 1278 |
| 377 | Ga0501043_0829557 | 3300049579 | Bacteria | 667 |
| 378 | Ga0501046_0020293 | 3300049580 | Bacteria | 5498 |
| 379 | Ga0501046_0779640 | 3300049580 | Bacteria | 671 |
| 380 | Ga0501047_0004558 | 3300049581 | Bacteria | 13028 |
| 381 | Ga0501047_0086899 | 3300049581 | Bacteria | 3004 |
| 382 | Ga0501047_0134003 | 3300049581 | Bacteria | 2357 |
| 383 | Ga0501047_0470021 | 3300049581 | Bacteria | 1086 |
| 384 | Ga0501048_0023451 | 3300049582 | Bacteria | 4508 |
| 385 | Ga0501048_0331409 | 3300049582 | Bacteria | 1084 |
| 386 | Ga0501067_0391902 | 3300049583 | Bacteria | 774 |
| 387 | Ga0501068_0106036 | 3300049584 | Bacteria | 1744 |
| 388 | Ga0501069_1016217 | 3300049585 | Bacteria | 507 |
| 389 | Ga0501070_0026001 | 3300049586 | Bacteria | 4911 |
| 390 | Ga0501070_0270601 | 3300049586 | Bacteria | 1387 |
| 391 | Ga0501073_0319039 | 3300049589 | Bacteria | 1072 |
| 392 | Ga0501261_068866 | 3300049690 | Unclassified | 617 |
| 393 | Ga0501083_0833548 | 3300049744 | Bacteria | 600 |
| 394 | Ga0501035_0000040 | 3300049822 | Bacteria | 156262 |
| 395 | Ga0501035_0010917 | 3300049822 | Bacteria | 8410 |
| 396 | Ga0501035_0013756 | 3300049822 | Bacteria | 7469 |
| 397 | Ga0501035_0031169 | 3300049822 | Bacteria | 4856 |
| 398 | Ga0501044_0000040 | 3300049823 | Bacteria | 156304 |
| 399 | Ga0501044_0007916 | 3300049823 | Bacteria | 11685 |
| 400 | Ga0501044_0013108 | 3300049823 | Bacteria | 8975 |
| 401 | Ga0501044_0061348 | 3300049823 | Bacteria | 3846 |
| 402 | Ga0501045_0094088 | 3300049824 | Bacteria | 2216 |
| 403 | Ga0501045_0186559 | 3300049824 | Bacteria | 1545 |
| 404 | nmdc:mga03683_114476_c1 | 3300050489 | Bacteria | 1195 |
| 405 | nmdc:mga03683_141469_c1 | 3300050489 | Bacteria | 1082 |
| 406 | nmdc:mga03683_405307_c1 | 3300050489 | Bacteria | 651 |
| 407 | nmdc:mga03683_443758_c1 | 3300050489 | Bacteria | 624 |
| 408 | nmdc:mga03n38_15460_c1 | 3300050490 | Bacteria | 2948 |
| 409 | nmdc:mga03n38_17735_c1 | 3300050490 | Bacteria | 2794 |
| 410 | nmdc:mga03n38_271022_c1 | 3300050490 | Bacteria | 903 |
| 411 | nmdc:mga03n38_461833_c1 | 3300050490 | Bacteria | 708 |
| 412 | nmdc:mga03n38_656118_c1 | 3300050490 | Bacteria | 602 |
| 413 | nmdc:mga03n38_70345_c1 | 3300050490 | Bacteria | 1618 |
| 414 | nmdc:mga0yw44_1188482_c1 | 3300050492 | Bacteria | 515 |
| 415 | nmdc:mga0yw44_177287_c1 | 3300050492 | Bacteria | 1401 |
| 416 | nmdc:mga0yw44_227875_c1 | 3300050492 | Bacteria | 1236 |
| 417 | nmdc:mga0yw44_87133_c1 | 3300050492 | Bacteria | 1968 |
| 418 | nmdc:mga0k408_442392_c1 | 3300050493 | Bacteria | 772 |
| 419 | nmdc:mga0k408_521497_c1 | 3300050493 | Bacteria | 703 |
| 420 | nmdc:mga0k408_546564_c1 | 3300050493 | Bacteria | 685 |
| 421 | nmdc:mga0k408_561971_c1 | 3300050493 | Bacteria | 674 |
| 422 | nmdc:mga06z11_299164_c1 | 3300050494 | Bacteria | 956 |
| 423 | nmdc:mga06z11_630962_c1 | 3300050494 | Bacteria | 652 |
| 424 | nmdc:mga04h51_190513_c1 | 3300050495 | Bacteria | 802 |
| 425 | nmdc:mga04h51_287868_c1 | 3300050495 | Bacteria | 667 |
| 426 | nmdc:mga04h51_298587_c1 | 3300050495 | Bacteria | 656 |
| 427 | nmdc:mga04h51_57680_c1 | 3300050495 | Bacteria | 1322 |
| 428 | nmdc:mga07m45_41591_c1 | 3300050496 | Bacteria | 2574 |
| 429 | nmdc:mga0qj67_110919_c1 | 3300050509 | Bacteria | 2215 |
| 430 | nmdc:mga06r32_15012_c1 | 3300050510 | Bacteria | 7030 |
| 431 | nmdc:mga0n895_1252701_c1 | 3300050512 | Bacteria | 714 |
| 432 | nmdc:mga0a205_419969_c1 | 3300050515 | Bacteria | 1199 |
| 433 | nmdc:mga0sz30_192897_c1 | 3300050516 | Bacteria | 904 |
| 434 | nmdc:mga0sz30_41876_c1 | 3300050516 | Bacteria | 1926 |
| 435 | Ga0495655_0269375 | 3300053083 | Bacteria | 577 |
| 436 | Ga0500643_190854 | 3300053087 | Bacteria | 549 |
| 437 | Ga0500644_0063403 | 3300053088 | Bacteria | 1309 |
| 438 | Ga0500646_0353370 | 3300053090 | Bacteria | 536 |
| 439 | Ga0500583_0463455 | 3300053092 | Bacteria | 600 |
| 440 | Ga0500641_0187048 | 3300053096 | Bacteria | 888 |
| 441 | Ga0500595_087247 | 3300053119 | Bacteria | 907 |
| 442 | Ga0500608_076771 | 3300053122 | Bacteria | 1582 |
| 443 | Ga0500617_236154 | 3300053124 | Bacteria | 634 |
| 444 | Ga0500652_333538 | 3300053131 | Bacteria | 578 |
| 445 | Ga0500658_0213663 | 3300053134 | Bacteria | 883 |
| 446 | Ga0500568_0000010 | 3300053139 | Bacteria | 249043 |
| 447 | Ga0500568_0073172 | 3300053139 | Bacteria | 1309 |
| 448 | Ga0500568_0122876 | 3300053139 | Bacteria | 967 |
| 449 | Ga0500588_0058270 | 3300053146 | Bacteria | 1229 |
| 450 | Ga0500604_0022802 | 3300053151 | Bacteria | 1781 |
| 451 | Ga0500616_0141021 | 3300053153 | Bacteria | 1126 |
| 452 | Ga0500620_000598 | 3300053155 | Bacteria | 6198 |
| 453 | Ga0500622_0000734 | 3300053156 | Bacteria | 28647 |
| 454 | Ga0500627_0417286 | 3300053158 | Bacteria | 569 |
| 455 | Ga0500611_012404 | 3300053727 | Bacteria | 1437 |
| 456 | Ga0500645_174566 | 3300053730 | Bacteria | 586 |
| 457 | Ga0501084_0221979 | 3300054114 | Bacteria | 1595 |
| 458 | Ga0501082_0145183 | 3300060353 | Bacteria | 2060 |
| 459 | Ga0501082_0732117 | 3300060353 | Bacteria | 866 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2961136820 | 2961138038 | 128 |
| 2 | iso_pu_bacteria | 2513237351 | 2514585980 | 131 |
| 3 | 3300013306 | Ga0163162_11230278 | Ga0163162_112302782 | 132 |
| 4 | 3300048912 | Ga0496109_0695741 | Ga0496109_0695741_542_943 | 132 |
| 5 | 3300049568 | Ga0501031_0203455 | Ga0501031_0203455_334_732 | 132 |
| 6 | 3300049569 | Ga0501032_0012010 | Ga0501032_0012010_1582_1980 | 132 |
| 7 | 3300049569 | Ga0501032_0016409 | Ga0501032_0016409_1403_1801 | 132 |
| 8 | 3300049570 | Ga0501033_0010055 | Ga0501033_0010055_2579_2977 | 132 |
| 9 | 3300049570 | Ga0501033_0022431 | Ga0501033_0022431_1563_1961 | 132 |
| 10 | 3300049571 | Ga0501034_0013483 | Ga0501034_0013483_4089_4487 | 132 |
| 11 | 3300049571 | Ga0501034_0071072 | Ga0501034_0071072_863_1261 | 132 |
| 12 | 3300049572 | Ga0501036_0021735 | Ga0501036_0021735_3414_3812 | 132 |
| 13 | 3300049572 | Ga0501036_1032294 | Ga0501036_1032294_169_567 | 132 |
| 14 | 3300049573 | Ga0501037_0070785 | Ga0501037_0070785_1580_1978 | 132 |
| 15 | 3300049574 | Ga0501038_0024638 | Ga0501038_0024638_283_681 | 132 |
| 16 | 3300049575 | Ga0501039_0085075 | Ga0501039_0085075_1582_1980 | 132 |
| 17 | 3300049575 | Ga0501039_0095117 | Ga0501039_0095117_425_823 | 132 |
| 18 | 3300049578 | Ga0501042_0261884 | Ga0501042_0261884_448_846 | 132 |
| 19 | 3300049579 | Ga0501043_0262863 | Ga0501043_0262863_315_713 | 132 |
| 20 | 3300049579 | Ga0501043_0279990 | Ga0501043_0279990_340_738 | 132 |
| 21 | 3300049580 | Ga0501046_0020293 | Ga0501046_0020293_3520_3918 | 132 |
| 22 | 3300049581 | Ga0501047_0086899 | Ga0501047_0086899_560_958 | 132 |
| 23 | 3300049581 | Ga0501047_0134003 | Ga0501047_0134003_560_958 | 132 |
| 24 | 3300049582 | Ga0501048_0023451 | Ga0501048_0023451_3957_4355 | 132 |
| 25 | 3300049582 | Ga0501048_0331409 | Ga0501048_0331409_544_942 | 132 |
| 26 | 3300049584 | Ga0501068_0106036 | Ga0501068_0106036_774_1172 | 132 |
| 27 | 3300049586 | Ga0501070_0270601 | Ga0501070_0270601_560_958 | 132 |
| 28 | 3300049744 | Ga0501083_0833548 | Ga0501083_0833548_181_579 | 132 |
| 29 | 3300049822 | Ga0501035_0010917 | Ga0501035_0010917_6450_6848 | 132 |
| 30 | 3300049822 | Ga0501035_0013756 | Ga0501035_0013756_4254_4652 | 132 |
| 31 | 3300049823 | Ga0501044_0007916 | Ga0501044_0007916_9706_10104 | 132 |
| 32 | 3300049823 | Ga0501044_0061348 | Ga0501044_0061348_1886_2284 | 132 |
| 33 | 3300049824 | Ga0501045_0094088 | Ga0501045_0094088_284_682 | 132 |
| 34 | 3300049824 | Ga0501045_0186559 | Ga0501045_0186559_437_835 | 132 |
| 35 | 3300053088 | Ga0500644_0063403 | Ga0500644_0063403_684_1082 | 132 |
| 36 | 3300053156 | Ga0500622_0000734 | Ga0500622_0000734_23187_23585 | 132 |
| 37 | iso_pu_bacteria | 2643221629 | 2644169826 | 132 |
| 38 | iso_pu_bacteria | 2643221662 | 2644350462 | 132 |
| 39 | iso_pu_bacteria | 2837651117 | 2837652036 | 132 |
| 40 | iso_pu_bacteria | 2508501122 | 2509111471 | 133 |
| 41 | iso_pu_bacteria | 2509276019 | 2509379610 | 133 |
| 42 | iso_pu_bacteria | 2509276033 | 2509442289 | 133 |
| 43 | iso_pu_bacteria | 2510065019 | 2510136116 | 133 |
| 44 | iso_pu_bacteria | 2510065057 | 2510306512 | 133 |
| 45 | iso_pu_bacteria | 2510461076 | 2510892881 | 133 |
| 46 | iso_pu_bacteria | 2511231052 | 2511499764 | 133 |
| 47 | iso_pu_bacteria | 2512047086 | 2512530187 | 133 |
| 48 | iso_pu_bacteria | 2512875026 | 2512975477 | 133 |
| 49 | iso_pu_bacteria | 2513237084 | 2513568417 | 133 |
| 50 | iso_pu_bacteria | 2513237086 | 2513584896 | 133 |
| 51 | iso_pu_bacteria | 2513237089 | 2513605873 | 133 |
| 52 | iso_pu_bacteria | 2513237091 | 2513618278 | 133 |
| 53 | iso_pu_bacteria | 2513237093 | 2513630726 | 133 |
| 54 | iso_pu_bacteria | 2513237103 | 2513711922 | 133 |
| 55 | iso_pu_bacteria | 2513237140 | 2513883029 | 133 |
| 56 | iso_pu_bacteria | 2513237143 | 2513903084 | 133 |
| 57 | iso_pu_bacteria | 2513237144 | 2513910477 | 133 |
| 58 | iso_pu_bacteria | 2513237146 | 2513924889 | 133 |
| 59 | iso_pu_bacteria | 2513237160 | 2514006828 | 133 |
| 60 | iso_pu_bacteria | 2513237162 | 2514018251 | 133 |
| 61 | iso_pu_bacteria | 2515075009 | 2515108957 | 133 |
| 62 | iso_pu_bacteria | 2515154107 | 2515611863 | 133 |
| 63 | iso_pu_bacteria | 2515154113 | 2515633038 | 133 |
| 64 | iso_pu_bacteria | 2515154114 | 2515640243 | 133 |
| 65 | iso_pu_bacteria | 2515154116 | 2515656324 | 133 |
| 66 | iso_pu_bacteria | 2516653046 | 2516897354 | 133 |
| 67 | iso_pu_bacteria | 2516653077 | 2517040898 | 133 |
| 68 | iso_pu_bacteria | 2517093000 | 2517098498 | 133 |
| 69 | iso_pu_bacteria | 2517487022 | 2517567069 | 133 |
| 70 | iso_pu_bacteria | 2524023207 | 2524453252 | 133 |
| 71 | iso_pu_bacteria | 2551306084 | 2551678535 | 133 |
| 72 | iso_pu_bacteria | 2551306084 | 2551681534 | 133 |
| 73 | iso_pu_bacteria | 2551306085 | 2551688910 | 133 |
| 74 | iso_pu_bacteria | 2551306086 | 2551695891 | 133 |
| 75 | iso_pu_bacteria | 2551306087 | 2551697596 | 133 |
| 76 | iso_pu_bacteria | 2551306089 | 2551714919 | 133 |
| 77 | iso_pu_bacteria | 2551306090 | 2551723432 | 133 |
| 78 | iso_pu_bacteria | 2551306091 | 2551730186 | 133 |
| 79 | iso_pu_bacteria | 2551306092 | 2551734294 | 133 |
| 80 | iso_pu_bacteria | 2551306093 | 2551742839 | 133 |
| 81 | iso_pu_bacteria | 2558860100 | 2558862914 | 133 |
| 82 | iso_pu_bacteria | 2558860100 | 2558866635 | 133 |
| 83 | iso_pu_bacteria | 2599185170 | 2599416450 | 133 |
| 84 | iso_pu_bacteria | 2615840624 | 2616297887 | 133 |
| 85 | iso_pu_bacteria | 2643221634 | 2644195207 | 133 |
| 86 | iso_pu_bacteria | 2643221643 | 2644241133 | 133 |
| 87 | iso_pu_bacteria | 2724679232 | 2725949385 | 133 |
| 88 | iso_pu_bacteria | 2765235802 | 2765464464 | 133 |
| 89 | iso_pu_bacteria | 2765235942 | 2766064606 | 133 |
| 90 | iso_pu_bacteria | 2775506902 | 2776267090 | 133 |
| 91 | iso_pu_bacteria | 2775506904 | 2776283435 | 133 |
| 92 | iso_pu_bacteria | 2791355091 | 2792621363 | 133 |
| 93 | iso_pu_bacteria | 2791355092 | 2792627952 | 133 |
| 94 | iso_pu_bacteria | 2791355094 | 2792643672 | 133 |
| 95 | iso_pu_bacteria | 2791355259 | 2793315015 | 133 |
| 96 | iso_pu_bacteria | 2802428858 | 2802720983 | 133 |
| 97 | iso_pu_bacteria | 2802428859 | 2802727474 | 133 |
| 98 | iso_pu_bacteria | 2802428860 | 2802733441 | 133 |
| 99 | iso_pu_bacteria | 2802428861 | 2802740165 | 133 |
| 100 | iso_pu_bacteria | 2802428862 | 2802746495 | 133 |
| 101 | iso_pu_bacteria | 2802428863 | 2802753231 | 133 |
| 102 | iso_pu_bacteria | 2838035591 | 2838036565 | 133 |
| 103 | iso_pu_bacteria | 2838661181 | 2838662455 | 133 |
| 104 | iso_pu_bacteria | 2839993093 | 2839997336 | 133 |
| 105 | iso_pu_bacteria | 2840764183 | 2840765802 | 133 |
| 106 | iso_pu_bacteria | 2842110456 | 2842113799 | 133 |
| 107 | iso_pu_bacteria | 2842205361 | 2842209929 | 133 |
| 108 | iso_pu_bacteria | 2842217011 | 2842219645 | 133 |
| 109 | iso_pu_bacteria | 2842278818 | 2842283383 | 133 |
| 110 | iso_pu_bacteria | 2842489311 | 2842494804 | 133 |
| 111 | iso_pu_bacteria | 2842495871 | 2842500840 | 133 |
| 112 | iso_pu_bacteria | 2847670302 | 2847674705 | 133 |
| 113 | iso_pu_bacteria | 2850079185 | 2850079394 | 133 |
| 114 | iso_pu_bacteria | 2855825444 | 2855830774 | 133 |
| 115 | iso_pu_bacteria | 2855839649 | 2855845454 | 133 |
| 116 | iso_pu_bacteria | 2856314179 | 2856317409 | 133 |
| 117 | iso_pu_bacteria | 2857516855 | 2857523131 | 133 |
| 118 | iso_pu_bacteria | 2858800743 | 2858805321 | 133 |
| 119 | iso_pu_bacteria | 2878035449 | 2878038447 | 133 |
| 120 | iso_pu_bacteria | 2881853255 | 2881860504 | 133 |
| 121 | iso_pu_bacteria | 2896384573 | 2896389749 | 133 |
| 122 | iso_pu_bacteria | 2906414383 | 2906417474 | 133 |
| 123 | iso_pu_bacteria | 2913295892 | 2913301661 | 133 |
| 124 | iso_pu_bacteria | 2915980308 | 2915983602 | 133 |
| 125 | iso_pu_bacteria | 2915986958 | 2915989753 | 133 |
| 126 | iso_pu_bacteria | 2915993759 | 2915997581 | 133 |
| 127 | iso_pu_bacteria | 2916000859 | 2916003644 | 133 |
| 128 | iso_pu_bacteria | 2916007675 | 2916011482 | 133 |
| 129 | iso_pu_bacteria | 2916014648 | 2916021148 | 133 |
| 130 | iso_pu_bacteria | 2916021584 | 2916025714 | 133 |
| 131 | iso_pu_bacteria | 2916028427 | 2916032488 | 133 |
| 132 | iso_pu_bacteria | 2916035215 | 2916039598 | 133 |
| 133 | iso_pu_bacteria | 2916041962 | 2916043855 | 133 |
| 134 | iso_pu_bacteria | 2916048683 | 2916053013 | 133 |
| 135 | iso_pu_bacteria | 2916055098 | 2916059331 | 133 |
| 136 | iso_pu_bacteria | 2916061851 | 2916063243 | 133 |
| 137 | iso_pu_bacteria | 2916068649 | 2916071959 | 133 |
| 138 | iso_pu_bacteria | 2916076590 | 2916082212 | 133 |
| 139 | iso_pu_bacteria | 2920760137 | 2920767145 | 133 |
| 140 | iso_pu_bacteria | 2921201388 | 2921201542 | 133 |
| 141 | iso_pu_bacteria | 2921208531 | 2921211485 | 133 |
| 142 | iso_pu_bacteria | 2921237296 | 2921243149 | 133 |
| 143 | iso_pu_bacteria | 2921244191 | 2921247414 | 133 |
| 144 | iso_pu_bacteria | 2921250672 | 2921252366 | 133 |
| 145 | iso_pu_bacteria | 2921257292 | 2921259143 | 133 |
| 146 | iso_pu_bacteria | 2921263974 | 2921268265 | 133 |
| 147 | iso_pu_bacteria | 2921282425 | 2921286564 | 133 |
| 148 | iso_pu_bacteria | 2921289301 | 2921293057 | 133 |
| 149 | iso_pu_bacteria | 2921296804 | 2921297058 | 133 |
| 150 | iso_pu_bacteria | 2924144063 | 2924149367 | 133 |
| 151 | iso_pu_bacteria | 2924150972 | 2924155143 | 133 |
| 152 | iso_pu_bacteria | 2924158325 | 2924162572 | 133 |
| 153 | iso_pu_bacteria | 2924165586 | 2924166874 | 133 |
| 154 | iso_pu_bacteria | 2924172951 | 2924176681 | 133 |
| 155 | iso_pu_bacteria | 2924179722 | 2924182622 | 133 |
| 156 | iso_pu_bacteria | 2924186466 | 2924188644 | 133 |
| 157 | iso_pu_bacteria | 2924193448 | 2924197077 | 133 |
| 158 | iso_pu_bacteria | 2924200457 | 2924206310 | 133 |
| 159 | iso_pu_bacteria | 2924207177 | 2924208790 | 133 |
| 160 | iso_pu_bacteria | 2924214083 | 2924218470 | 133 |
| 161 | iso_pu_bacteria | 2924221636 | 2924222210 | 133 |
| 162 | iso_pu_bacteria | 2924228884 | 2924231531 | 133 |
| 163 | iso_pu_bacteria | 2933586486 | 2933589565 | 133 |
| 164 | iso_pu_bacteria | 2936367885 | 2936374698 | 133 |
| 165 | iso_pu_bacteria | 2936375103 | 2936375867 | 133 |
| 166 | iso_pu_bacteria | 2936996657 | 2936998149 | 133 |
| 167 | iso_pu_bacteria | 2937002841 | 2937005277 | 133 |
| 168 | iso_pu_bacteria | 2937009748 | 2937011451 | 133 |
| 169 | iso_pu_bacteria | 2937016420 | 2937017241 | 133 |
| 170 | iso_pu_bacteria | 2937023124 | 2937026070 | 133 |
| 171 | iso_pu_bacteria | 2937029754 | 2937032019 | 133 |
| 172 | iso_pu_bacteria | 2937036028 | 2937038846 | 133 |
| 173 | iso_pu_bacteria | 2937042894 | 2937046585 | 133 |
| 174 | iso_pu_bacteria | 2937049772 | 2937055815 | 133 |
| 175 | iso_pu_bacteria | 2937056579 | 2937060675 | 133 |
| 176 | iso_pu_bacteria | 2937063883 | 2937067316 | 133 |
| 177 | iso_pu_bacteria | 2937071275 | 2937074497 | 133 |
| 178 | iso_pu_bacteria | 2937078374 | 2937081392 | 133 |
| 179 | iso_pu_bacteria | 2937084907 | 2937088871 | 133 |
| 180 | iso_pu_bacteria | 2937091812 | 2937095108 | 133 |
| 181 | iso_pu_bacteria | 2937098957 | 2937103769 | 133 |
| 182 | iso_pu_bacteria | 2937106411 | 2937109284 | 133 |
| 183 | iso_pu_bacteria | 2937113482 | 2937117364 | 133 |
| 184 | iso_pu_bacteria | 2937119839 | 2937120818 | 133 |
| 185 | iso_pu_bacteria | 2937126314 | 2937130657 | 133 |
| 186 | iso_pu_bacteria | 2957375807 | 2957375855 | 133 |
| 187 | iso_pu_bacteria | 2957382221 | 2957386751 | 133 |
| 188 | iso_pu_bacteria | 2957388812 | 2957391605 | 133 |
| 189 | iso_pu_bacteria | 2957395598 | 2957397542 | 133 |
| 190 | iso_pu_bacteria | 2957402308 | 2957407085 | 133 |
| 191 | iso_pu_bacteria | 2957408893 | 2957409330 | 133 |
| 192 | iso_pu_bacteria | 2957415311 | 2957418812 | 133 |
| 193 | iso_pu_bacteria | 2957422303 | 2957422804 | 133 |
| 194 | iso_pu_bacteria | 2957430029 | 2957435618 | 133 |
| 195 | iso_pu_bacteria | 2957437181 | 2957437944 | 133 |
| 196 | iso_pu_bacteria | 2957443900 | 2957444658 | 133 |
| 197 | iso_pu_bacteria | 2957450854 | 2957453023 | 133 |
| 198 | iso_pu_bacteria | 2957457609 | 2957463118 | 133 |
| 199 | iso_pu_bacteria | 2957464669 | 2957470460 | 133 |
| 200 | iso_pu_bacteria | 2957471148 | 2957476044 | 133 |
| 201 | iso_pu_bacteria | 2957478035 | 2957482177 | 133 |
| 202 | iso_pu_bacteria | 2957484790 | 2957489387 | 133 |
| 203 | iso_pu_bacteria | 2957491536 | 2957495393 | 133 |
| 204 | iso_pu_bacteria | 2957498199 | 2957502838 | 133 |
| 205 | iso_pu_bacteria | 2957505466 | 2957509003 | 133 |
| 206 | iso_pu_bacteria | 2960584000 | 2960587281 | 133 |
| 207 | iso_pu_bacteria | 2960591022 | 2960593990 | 133 |
| 208 | iso_pu_bacteria | 2960597568 | 2960600521 | 133 |
| 209 | iso_pu_bacteria | 2960603979 | 2960606897 | 133 |
| 210 | iso_pu_bacteria | 2960610863 | 2960612779 | 133 |
| 211 | iso_pu_bacteria | 2960617483 | 2960618426 | 133 |
| 212 | iso_pu_bacteria | 2960624210 | 2960628998 | 133 |
| 213 | iso_pu_bacteria | 2960631154 | 2960634293 | 133 |
| 214 | iso_pu_bacteria | 2960645483 | 2960651809 | 133 |
| 215 | iso_pu_bacteria | 2960652885 | 2960656110 | 133 |
| 216 | iso_pu_bacteria | 2960660292 | 2960661313 | 133 |
| 217 | iso_pu_bacteria | 2960667422 | 2960670622 | 133 |
| 218 | iso_pu_bacteria | 2960674078 | 2960676171 | 133 |
| 219 | iso_pu_bacteria | 2960680706 | 2960683015 | 133 |
| 220 | iso_pu_bacteria | 2960687367 | 2960689717 | 133 |
| 221 | iso_pu_bacteria | 2960693952 | 2960697727 | 133 |
| 222 | iso_pu_bacteria | 2964607997 | 2964612333 | 133 |
| 223 | iso_pu_bacteria | 2964615318 | 2964617219 | 133 |
| 224 | iso_pu_bacteria | 2964621998 | 2964625688 | 133 |
| 225 | iso_pu_bacteria | 2964628898 | 2964630117 | 133 |
| 226 | iso_pu_bacteria | 2964636051 | 2964637934 | 133 |
| 227 | iso_pu_bacteria | 2964643177 | 2964647112 | 133 |
| 228 | iso_pu_bacteria | 2964649959 | 2964654435 | 133 |
| 229 | iso_pu_bacteria | 2964656573 | 2964660934 | 133 |
| 230 | iso_pu_bacteria | 2964663802 | 2964664842 | 133 |
| 231 | iso_pu_bacteria | 2964670856 | 2964675198 | 133 |
| 232 | iso_pu_bacteria | 2964678106 | 2964683155 | 133 |
| 233 | iso_pu_bacteria | 2964685014 | 2964691179 | 133 |
| 234 | iso_pu_bacteria | 2964691889 | 2964694020 | 133 |
| 235 | iso_pu_bacteria | 2964698721 | 2964699707 | 133 |
| 236 | iso_pu_bacteria | 2964705432 | 2964709072 | 133 |
| 237 | iso_pu_bacteria | 2964712639 | 2964716421 | 133 |
| 238 | iso_pu_bacteria | 2967664464 | 2967668841 | 133 |
| 239 | iso_pu_bacteria | 2967671571 | 2967675732 | 133 |
| 240 | iso_pu_bacteria | 2967678726 | 2967683524 | 133 |
| 241 | iso_pu_bacteria | 2967686174 | 2967688230 | 133 |
| 242 | iso_pu_bacteria | 2967693043 | 2967697314 | 133 |
| 243 | iso_pu_bacteria | 2967699805 | 2967701329 | 133 |
| 244 | iso_pu_bacteria | 2967706974 | 2967707544 | 133 |
| 245 | iso_pu_bacteria | 2967714385 | 2967719289 | 133 |
| 246 | iso_pu_bacteria | 2967721400 | 2967724060 | 133 |
| 247 | iso_pu_bacteria | 2967728569 | 2967730182 | 133 |
| 248 | iso_pu_bacteria | 2967735183 | 2967739636 | 133 |
| 249 | iso_pu_bacteria | 2967742019 | 2967742419 | 133 |
| 250 | iso_pu_bacteria | 2967748971 | 2967751755 | 133 |
| 251 | iso_pu_bacteria | 2967755722 | 2967759469 | 133 |
| 252 | iso_pu_bacteria | 2967762386 | 2967764309 | 133 |
| 253 | iso_pu_bacteria | 2967769361 | 2967773918 | 133 |
| 254 | iso_pu_bacteria | 2967775926 | 2967781811 | 133 |
| 255 | iso_pu_bacteria | 2970019648 | 2970024230 | 133 |
| 256 | iso_pu_bacteria | 2970026789 | 2970027767 | 133 |
| 257 | iso_pu_bacteria | 2970033650 | 2970039352 | 133 |
| 258 | iso_pu_bacteria | 2970040964 | 2970043647 | 133 |
| 259 | iso_pu_bacteria | 2970047711 | 2970052270 | 133 |
| 260 | iso_pu_bacteria | 2970054988 | 2970057481 | 133 |
| 261 | iso_pu_bacteria | 2970061556 | 2970065799 | 133 |
| 262 | iso_pu_bacteria | 2970068827 | 2970071482 | 133 |
| 263 | iso_pu_bacteria | 2970076120 | 2970080347 | 133 |
| 264 | iso_pu_bacteria | 2970088815 | 2970093352 | 133 |
| 265 | iso_pu_bacteria | 2970095765 | 2970098980 | 133 |
| 266 | iso_pu_bacteria | 2970102677 | 2970105430 | 133 |
| 267 | iso_pu_bacteria | 2970109326 | 2970112673 | 133 |
| 268 | iso_pu_bacteria | 2970116247 | 2970119200 | 133 |
| 269 | iso_pu_bacteria | 2970122695 | 2970127759 | 133 |
| 270 | iso_pu_bacteria | 2970129317 | 2970133254 | 133 |
| 271 | iso_pu_bacteria | 2970136068 | 2970140398 | 133 |
| 272 | iso_pu_bacteria | 2970143518 | 2970149202 | 133 |
| 273 | iso_pu_bacteria | 2970149975 | 2970153501 | 133 |
| 274 | iso_pu_bacteria | 2970156795 | 2970163819 | 133 |
| 275 | iso_pu_bacteria | 2970164137 | 2970164994 | 133 |
| 276 | iso_pu_bacteria | 2970170962 | 2970177241 | 133 |
| 277 | iso_pu_bacteria | 2970177841 | 2970184228 | 133 |
| 278 | iso_pu_bacteria | 2970184632 | 2970191390 | 133 |
| 279 | iso_pu_bacteria | 2970191845 | 2970194579 | 133 |
| 280 | iso_pu_bacteria | 2977516862 | 2977520169 | 133 |
| 281 | iso_pu_bacteria | 2977523885 | 2977527598 | 133 |
| 282 | iso_pu_bacteria | 2977530762 | 2977533594 | 133 |
| 283 | iso_pu_bacteria | 2977537788 | 2977542860 | 133 |
| 284 | iso_pu_bacteria | 2977544691 | 2977548609 | 133 |
| 285 | iso_pu_bacteria | 2977551784 | 2977556434 | 133 |
| 286 | iso_pu_bacteria | 2977558990 | 2977562279 | 133 |
| 287 | iso_pu_bacteria | 2977565890 | 2977568403 | 133 |
| 288 | iso_pu_bacteria | 2977572785 | 2977576137 | 133 |
| 289 | iso_pu_bacteria | 2977579622 | 2977582107 | 133 |
| 290 | iso_pu_bacteria | 2996310559 | 2996316551 | 133 |
| 291 | iso_pu_bacteria | 639633055 | 639645357 | 133 |
| 292 | iso_pu_bacteria | 648276728 | 648737948 | 133 |
| 293 | iso_pu_bacteria | 8003992118 | 8003998148 | 133 |
| 294 | iso_pu_bacteria | 8003999396 | 8004005658 | 133 |
| 295 | iso_pu_bacteria | 8005289223 | 8005290827 | 133 |
| 296 | iso_pu_bacteria | 8005301065 | 8005301295 | 133 |
| 297 | iso_pu_bacteria | 8005376324 | 8005380541 | 133 |
| 298 | iso_pu_bacteria | 8005460587 | 8005467552 | 133 |
| 299 | iso_pu_bacteria | 8005556819 | 8005559467 | 133 |
| 300 | iso_pu_bacteria | 8005563573 | 8005566486 | 133 |
| 301 | iso_pu_bacteria | 8005688590 | 8005688890 | 133 |
| 302 | iso_pu_bacteria | 8018127388 | 8018132314 | 133 |
| 303 | iso_pu_bacteria | 8018163183 | 8018163760 | 133 |
| 304 | iso_pu_bacteria | 8024479707 | 8024481424 | 133 |
| 305 | iso_pu_bacteria | 8054558443 | 8054560633 | 133 |
| 306 | iso_pu_bacteria | 8057874678 | 8057881285 | 133 |
| 307 | 3300060353 | Ga0501082_0732117 | Ga0501082_0732117_57_467 | 134 |
| 308 | iso_pu_bacteria | 2503198000 | 2503199713 | 134 |
| 309 | iso_pu_bacteria | 2508501123 | 2509116654 | 134 |
| 310 | iso_pu_bacteria | 2508501127 | 2509142468 | 134 |
| 311 | iso_pu_bacteria | 2509276022 | 2509394642 | 134 |
| 312 | iso_pu_bacteria | 2510065059 | 2510318779 | 134 |
| 313 | iso_pu_bacteria | 2512875016 | 2512932871 | 134 |
| 314 | iso_pu_bacteria | 2512875024 | 2512960892 | 134 |
| 315 | iso_pu_bacteria | 2513237090 | 2513608982 | 134 |
| 316 | iso_pu_bacteria | 2513237164 | 2514036664 | 134 |
| 317 | iso_pu_bacteria | 2513237305 | 2514417287 | 134 |
| 318 | iso_pu_bacteria | 2588253730 | 2588518927 | 134 |
| 319 | iso_pu_bacteria | 2597489875 | 2597811081 | 134 |
| 320 | iso_pu_bacteria | 2599185301 | 2599939861 | 134 |
| 321 | iso_pu_bacteria | 2643221595 | 2643987610 | 134 |
| 322 | iso_pu_bacteria | 2643221627 | 2644157869 | 134 |
| 323 | iso_pu_bacteria | 2687453392 | 2688596965 | 134 |
| 324 | iso_pu_bacteria | 2693429783 | 2694630224 | 134 |
| 325 | iso_pu_bacteria | 2693429784 | 2694634304 | 134 |
| 326 | iso_pu_bacteria | 2721755686 | 2723574115 | 134 |
| 327 | iso_pu_bacteria | 2756170246 | 2756670929 | 134 |
| 328 | iso_pu_bacteria | 2791355123 | 2792748282 | 134 |
| 329 | iso_pu_bacteria | 2841734538 | 2841737461 | 134 |
| 330 | iso_pu_bacteria | 2844002411 | 2844008980 | 134 |
| 331 | iso_pu_bacteria | 2844009547 | 2844012306 | 134 |
| 332 | iso_pu_bacteria | 2847686936 | 2847690814 | 134 |
| 333 | iso_pu_bacteria | 2856320880 | 2856322802 | 134 |
| 334 | iso_pu_bacteria | 2856328259 | 2856328732 | 134 |
| 335 | iso_pu_bacteria | 2856334872 | 2856338337 | 134 |
| 336 | iso_pu_bacteria | 2856342000 | 2856349199 | 134 |
| 337 | iso_pu_bacteria | 2856349417 | 2856355333 | 134 |
| 338 | iso_pu_bacteria | 2856364286 | 2856366856 | 134 |
| 339 | iso_pu_bacteria | 2857349434 | 2857352256 | 134 |
| 340 | iso_pu_bacteria | 2857367948 | 2857370919 | 134 |
| 341 | iso_pu_bacteria | 2869162929 | 2869168560 | 134 |
| 342 | iso_pu_bacteria | 2869234852 | 2869241876 | 134 |
| 343 | iso_pu_bacteria | 2869242130 | 2869249188 | 134 |
| 344 | iso_pu_bacteria | 2869249662 | 2869249923 | 134 |
| 345 | iso_pu_bacteria | 2869256925 | 2869262910 | 134 |
| 346 | iso_pu_bacteria | 2869271264 | 2869276240 | 134 |
| 347 | iso_pu_bacteria | 2869278585 | 2869285654 | 134 |
| 348 | iso_pu_bacteria | 2869285874 | 2869287732 | 134 |
| 349 | iso_pu_bacteria | 2871429161 | 2871435680 | 134 |
| 350 | iso_pu_bacteria | 2871451962 | 2871452876 | 134 |
| 351 | iso_pu_bacteria | 2871459585 | 2871460250 | 134 |
| 352 | iso_pu_bacteria | 2871466892 | 2871473271 | 134 |
| 353 | iso_pu_bacteria | 2871474448 | 2871480886 | 134 |
| 354 | iso_pu_bacteria | 2871481445 | 2871487422 | 134 |
| 355 | iso_pu_bacteria | 2871488783 | 2871493521 | 134 |
| 356 | iso_pu_bacteria | 2871495908 | 2871496545 | 134 |
| 357 | iso_pu_bacteria | 2874102143 | 2874105294 | 134 |
| 358 | iso_pu_bacteria | 2874109183 | 2874115111 | 134 |
| 359 | iso_pu_bacteria | 2874116593 | 2874119247 | 134 |
| 360 | iso_pu_bacteria | 2874123672 | 2874128945 | 134 |
| 361 | iso_pu_bacteria | 2874131515 | 2874132900 | 134 |
| 362 | iso_pu_bacteria | 2874139085 | 2874142008 | 134 |
| 363 | iso_pu_bacteria | 2874146452 | 2874151363 | 134 |
| 364 | iso_pu_bacteria | 2874155637 | 2874158997 | 134 |
| 365 | iso_pu_bacteria | 2874162495 | 2874163033 | 134 |
| 366 | iso_pu_bacteria | 2874168670 | 2874175074 | 134 |
| 367 | iso_pu_bacteria | 2876363079 | 2876364879 | 134 |
| 368 | iso_pu_bacteria | 2876369609 | 2876377285 | 134 |
| 369 | iso_pu_bacteria | 2876377896 | 2876384965 | 134 |
| 370 | iso_pu_bacteria | 2876386047 | 2876387078 | 134 |
| 371 | iso_pu_bacteria | 2876392853 | 2876397707 | 134 |
| 372 | iso_pu_bacteria | 2876399893 | 2876405591 | 134 |
| 373 | iso_pu_bacteria | 2876406927 | 2876413853 | 134 |
| 374 | iso_pu_bacteria | 2876413966 | 2876417416 | 134 |
| 375 | iso_pu_bacteria | 2876420981 | 2876426023 | 134 |
| 376 | iso_pu_bacteria | 2878738818 | 2878744808 | 134 |
| 377 | iso_pu_bacteria | 2878745973 | 2878749243 | 134 |
| 378 | iso_pu_bacteria | 2878753008 | 2878757563 | 134 |
| 379 | iso_pu_bacteria | 2878760144 | 2878760773 | 134 |
| 380 | iso_pu_bacteria | 2878767105 | 2878767602 | 134 |
| 381 | iso_pu_bacteria | 2878774303 | 2878780501 | 134 |
| 382 | iso_pu_bacteria | 2878781027 | 2878784099 | 134 |
| 383 | iso_pu_bacteria | 2878788777 | 2878794337 | 134 |
| 384 | iso_pu_bacteria | 2881147464 | 2881149589 | 134 |
| 385 | iso_pu_bacteria | 2881155292 | 2881160770 | 134 |
| 386 | iso_pu_bacteria | 2881161766 | 2881166468 | 134 |
| 387 | iso_pu_bacteria | 2881845957 | 2881849487 | 134 |
| 388 | iso_pu_bacteria | 2881861095 | 2881863132 | 134 |
| 389 | iso_pu_bacteria | 2882632389 | 2882639382 | 134 |
| 390 | iso_pu_bacteria | 2882912400 | 2882918379 | 134 |
| 391 | iso_pu_bacteria | 2885305155 | 2885307949 | 134 |
| 392 | iso_pu_bacteria | 2885312484 | 2885313129 | 134 |
| 393 | iso_pu_bacteria | 2885318864 | 2885319416 | 134 |
| 394 | iso_pu_bacteria | 2885326080 | 2885326733 | 134 |
| 395 | iso_pu_bacteria | 2885334103 | 2885340994 | 134 |
| 396 | iso_pu_bacteria | 2885342637 | 2885349640 | 134 |
| 397 | iso_pu_bacteria | 2885350715 | 2885356107 | 134 |
| 398 | iso_pu_bacteria | 2888350351 | 2888354697 | 134 |
| 399 | iso_pu_bacteria | 2889010040 | 2889016312 | 134 |
| 400 | iso_pu_bacteria | 2889016732 | 2889018665 | 134 |
| 401 | iso_pu_bacteria | 2889790730 | 2889794441 | 134 |
| 402 | iso_pu_bacteria | 2889914905 | 2889914952 | 134 |
| 403 | iso_pu_bacteria | 2903448605 | 2903449659 | 134 |
| 404 | iso_pu_bacteria | 2903492973 | 2903498707 | 134 |
| 405 | iso_pu_bacteria | 2903492973 | 2903501293 | 134 |
| 406 | iso_pu_bacteria | 2903521522 | 2903522385 | 134 |
| 407 | iso_pu_bacteria | 2903528002 | 2903528764 | 134 |
| 408 | iso_pu_bacteria | 2903540706 | 2903541339 | 134 |
| 409 | iso_pu_bacteria | 2904659560 | 2904664358 | 134 |
| 410 | iso_pu_bacteria | 2906308376 | 2906310281 | 134 |
| 411 | iso_pu_bacteria | 2906321335 | 2906324346 | 134 |
| 412 | iso_pu_bacteria | 2906328253 | 2906333160 | 134 |
| 413 | iso_pu_bacteria | 2906354277 | 2906355227 | 134 |
| 414 | iso_pu_bacteria | 2906363423 | 2906365979 | 134 |
| 415 | iso_pu_bacteria | 2906378014 | 2906384877 | 134 |
| 416 | iso_pu_bacteria | 2906386501 | 2906387085 | 134 |
| 417 | iso_pu_bacteria | 2906401398 | 2906407987 | 134 |
| 418 | iso_pu_bacteria | 2906408224 | 2906414050 | 134 |
| 419 | iso_pu_bacteria | 2906427513 | 2906431559 | 134 |
| 420 | iso_pu_bacteria | 2922151315 | 2922153687 | 134 |
| 421 | iso_pu_bacteria | 2922158528 | 2922159041 | 134 |
| 422 | iso_pu_bacteria | 2922172374 | 2922172651 | 134 |
| 423 | iso_pu_bacteria | 2922185730 | 2922188374 | 134 |
| 424 | iso_pu_bacteria | 2924710171 | 2924712191 | 134 |
| 425 | iso_pu_bacteria | 2924718760 | 2924722536 | 134 |
| 426 | iso_pu_bacteria | 2924726620 | 2924730221 | 134 |
| 427 | iso_pu_bacteria | 2924733363 | 2924733919 | 134 |
| 428 | iso_pu_bacteria | 2924748358 | 2924749217 | 134 |
| 429 | iso_pu_bacteria | 2924754689 | 2924762399 | 134 |
| 430 | iso_pu_bacteria | 2924762789 | 2924767249 | 134 |
| 431 | iso_pu_bacteria | 2924776078 | 2924782839 | 134 |
| 432 | iso_pu_bacteria | 2924784321 | 2924786858 | 134 |
| 433 | iso_pu_bacteria | 2937813078 | 2937817105 | 134 |
| 434 | iso_pu_bacteria | 2937822353 | 2937822549 | 134 |
| 435 | iso_pu_bacteria | 2937836603 | 2937840303 | 134 |
| 436 | iso_pu_bacteria | 2937843397 | 2937847025 | 134 |
| 437 | iso_pu_bacteria | 2937848649 | 2937852484 | 134 |
| 438 | iso_pu_bacteria | 2937861824 | 2937867976 | 134 |
| 439 | iso_pu_bacteria | 2937868953 | 2937870534 | 134 |
| 440 | iso_pu_bacteria | 2937891427 | 2937892976 | 134 |
| 441 | iso_pu_bacteria | 2937972304 | 2937977571 | 134 |
| 442 | iso_pu_bacteria | 2937980651 | 2937983029 | 134 |
| 443 | iso_pu_bacteria | 2937994558 | 2937995195 | 134 |
| 444 | iso_pu_bacteria | 2938014810 | 2938016181 | 134 |
| 445 | iso_pu_bacteria | 2958034702 | 2958041669 | 134 |
| 446 | iso_pu_bacteria | 2958041894 | 2958047949 | 134 |
| 447 | iso_pu_bacteria | 2958064165 | 2958070662 | 134 |
| 448 | iso_pu_bacteria | 2958071322 | 2958071512 | 134 |
| 449 | iso_pu_bacteria | 2958084443 | 2958090788 | 134 |
| 450 | iso_pu_bacteria | 2958092219 | 2958095897 | 134 |
| 451 | iso_pu_bacteria | 2958100919 | 2958102443 | 134 |
| 452 | iso_pu_bacteria | 2958108152 | 2958113402 | 134 |
| 453 | iso_pu_bacteria | 2958115193 | 2958120910 | 134 |
| 454 | iso_pu_bacteria | 2958122699 | 2958128982 | 134 |
| 455 | iso_pu_bacteria | 2958130278 | 2958132134 | 134 |
| 456 | iso_pu_bacteria | 2958137437 | 2958138032 | 134 |
| 457 | iso_pu_bacteria | 2958144490 | 2958148753 | 134 |
| 458 | iso_pu_bacteria | 2958158011 | 2958164491 | 134 |
| 459 | iso_pu_bacteria | 2958165035 | 2958165540 | 134 |
| 460 | iso_pu_bacteria | 2958172287 | 2958174261 | 134 |
| 461 | iso_pu_bacteria | 2958179912 | 2958181948 | 134 |
| 462 | iso_pu_bacteria | 2961077736 | 2961079792 | 134 |
| 463 | iso_pu_bacteria | 2961114664 | 2961119357 | 134 |
| 464 | iso_pu_bacteria | 2961127735 | 2961132268 | 134 |
| 465 | iso_pu_bacteria | 2961163497 | 2961163999 | 134 |
| 466 | iso_pu_bacteria | 2961170736 | 2961175110 | 134 |
| 467 | iso_pu_bacteria | 2961183825 | 2961188402 | 134 |
| 468 | iso_pu_bacteria | 2963644680 | 2963646335 | 134 |
| 469 | iso_pu_bacteria | 2965018300 | 2965018935 | 134 |
| 470 | iso_pu_bacteria | 2965025482 | 2965027034 | 134 |
| 471 | iso_pu_bacteria | 2965032056 | 2965040199 | 134 |
| 472 | iso_pu_bacteria | 2965040258 | 2965046270 | 134 |
| 473 | iso_pu_bacteria | 2965047637 | 2965051211 | 134 |
| 474 | iso_pu_bacteria | 2965062239 | 2965062848 | 134 |
| 475 | iso_pu_bacteria | 2965089291 | 2965090429 | 134 |
| 476 | iso_pu_bacteria | 2965110997 | 2965117064 | 134 |
| 477 | iso_pu_bacteria | 2965119406 | 2965125246 | 134 |
| 478 | iso_pu_bacteria | 2967996073 | 2967999889 | 134 |
| 479 | iso_pu_bacteria | 2968003550 | 2968008248 | 134 |
| 480 | iso_pu_bacteria | 2968016561 | 2968020460 | 134 |
| 481 | iso_pu_bacteria | 2968083720 | 2968087139 | 134 |
| 482 | iso_pu_bacteria | 2968091066 | 2968091313 | 134 |
| 483 | iso_pu_bacteria | 2968097103 | 2968103141 | 134 |
| 484 | iso_pu_bacteria | 2968110612 | 2968115612 | 134 |
| 485 | iso_pu_bacteria | 2968117919 | 2968118985 | 134 |
| 486 | iso_pu_bacteria | 2968128360 | 2968128931 | 134 |
| 487 | iso_pu_bacteria | 2968138860 | 2968143471 | 134 |
| 488 | iso_pu_bacteria | 2968171901 | 2968172402 | 134 |
| 489 | iso_pu_bacteria | 2970469710 | 2970473757 | 134 |
| 490 | iso_pu_bacteria | 2970489779 | 2970490430 | 134 |
| 491 | iso_pu_bacteria | 2970503327 | 2970507698 | 134 |
| 492 | iso_pu_bacteria | 2970510686 | 2970516848 | 134 |
| 493 | iso_pu_bacteria | 2970524798 | 2970527093 | 134 |
| 494 | iso_pu_bacteria | 2970532167 | 2970534771 | 134 |
| 495 | iso_pu_bacteria | 2970540015 | 2970544534 | 134 |
| 496 | iso_pu_bacteria | 2970547951 | 2970548274 | 134 |
| 497 | iso_pu_bacteria | 2970554993 | 2970555626 | 134 |
| 498 | iso_pu_bacteria | 2970593180 | 2970600270 | 134 |
| 499 | iso_pu_bacteria | 2970619444 | 2970620168 | 134 |
| 500 | iso_pu_bacteria | 2970627176 | 2970633166 | 134 |
| 501 | iso_pu_bacteria | 2977821940 | 2977826720 | 134 |
| 502 | iso_pu_bacteria | 2977843712 | 2977847396 | 134 |
| 503 | iso_pu_bacteria | 2977851361 | 2977854158 | 134 |
| 504 | iso_pu_bacteria | 2977858184 | 2977861731 | 134 |
| 505 | iso_pu_bacteria | 2977864932 | 2977871926 | 134 |
| 506 | iso_pu_bacteria | 2977872689 | 2977873982 | 134 |
| 507 | iso_pu_bacteria | 2977907340 | 2977908170 | 134 |
| 508 | iso_pu_bacteria | 2977915119 | 2977921922 | 134 |
| 509 | iso_pu_bacteria | 2977922695 | 2977925276 | 134 |
| 510 | iso_pu_bacteria | 2977935797 | 2977940644 | 134 |
| 511 | iso_pu_bacteria | 2977942078 | 2977945675 | 134 |
| 512 | iso_pu_bacteria | 2977950692 | 2977954028 | 134 |
| 513 | iso_pu_bacteria | 2977957713 | 2977964756 | 134 |
| 514 | iso_pu_bacteria | 2977971508 | 2977973945 | 134 |
| 515 | iso_pu_bacteria | 2977986579 | 2977991286 | 134 |
| 516 | iso_pu_bacteria | 2979710463 | 2979715664 | 134 |
| 517 | iso_pu_bacteria | 2979742915 | 2979745631 | 134 |
| 518 | iso_pu_bacteria | 2979764755 | 2979771261 | 134 |
| 519 | iso_pu_bacteria | 2979779861 | 2979782193 | 134 |
| 520 | iso_pu_bacteria | 2979808191 | 2979812882 | 134 |
| 521 | iso_pu_bacteria | 2987636660 | 2987639440 | 134 |
| 522 | iso_pu_bacteria | 2987645492 | 2987648061 | 134 |
| 523 | iso_pu_bacteria | 2987652177 | 2987653913 | 134 |
| 524 | iso_pu_bacteria | 2987659509 | 2987660007 | 134 |
| 525 | iso_pu_bacteria | 2987666974 | 2987673447 | 134 |
| 526 | iso_pu_bacteria | 2987673487 | 2987680283 | 134 |
| 527 | iso_pu_bacteria | 2996341866 | 2996342789 | 134 |
| 528 | iso_pu_bacteria | 2996348954 | 2996352920 | 134 |
| 529 | iso_pu_bacteria | 2996386984 | 2996393294 | 134 |
| 530 | iso_pu_bacteria | 3000135777 | 3000139311 | 134 |
| 531 | iso_pu_bacteria | 3004167301 | 3004167352 | 134 |
| 532 | iso_pu_bacteria | 3004188549 | 3004189055 | 134 |
| 533 | iso_pu_bacteria | 3004195979 | 3004196619 | 134 |
| 534 | iso_pu_bacteria | 3004203850 | 3004204316 | 134 |
| 535 | iso_pu_bacteria | 3004211236 | 3004217770 | 134 |
| 536 | iso_pu_bacteria | 3004218560 | 3004221182 | 134 |
| 537 | iso_pu_bacteria | 3004232784 | 3004232811 | 134 |
| 538 | iso_pu_bacteria | 3004239961 | 3004243379 | 134 |
| 539 | iso_pu_bacteria | 3004268573 | 3004269931 | 134 |
| 540 | iso_pu_bacteria | 3004275668 | 3004279602 | 134 |
| 541 | iso_pu_bacteria | 3004289098 | 3004290609 | 134 |
| 542 | iso_pu_bacteria | 3004334049 | 3004336059 | 134 |
| 543 | iso_pu_bacteria | 637000159 | 637075955 | 134 |
| 544 | iso_pu_bacteria | 649633066 | 649871523 | 134 |
| 545 | iso_pu_bacteria | 8004300914 | 8004301845 | 134 |
| 546 | iso_pu_bacteria | 8004312739 | 8004314682 | 134 |
| 547 | iso_pu_bacteria | 8004361976 | 8004362268 | 134 |
| 548 | iso_pu_bacteria | 8004374579 | 8004379136 | 134 |
| 549 | iso_pu_bacteria | 8004387939 | 8004389517 | 134 |
| 550 | iso_pu_bacteria | 8004395343 | 8004402194 | 134 |
| 551 | iso_pu_bacteria | 8004445564 | 8004451788 | 134 |
| 552 | iso_pu_bacteria | 8004633249 | 8004637405 | 134 |
| 553 | iso_pu_bacteria | 8004640170 | 8004644029 | 134 |
| 554 | iso_pu_bacteria | 8004703790 | 8004712338 | 134 |
| 555 | iso_pu_bacteria | 8004714634 | 8004717915 | 134 |
| 556 | iso_pu_bacteria | 8004727605 | 8004734036 | 134 |
| 557 | iso_pu_bacteria | 8055617313 | 8055619182 | 134 |
| 558 | 3300028794 | Ga0307515_10001956 | Ga0307515_1000195641 | 135 |
| 559 | 3300037418 | Ga0395900_1016906 | Ga0395900_1016906_178_585 | 135 |
| 560 | 3300037471 | Ga0395905_0015692 | Ga0395905_0015692_1891_2298 | 135 |
| 561 | 3300037471 | Ga0395905_0133797 | Ga0395905_0133797_1557_1964 | 135 |
| 562 | 3300041462 | Ga0451806_075586 | Ga0451806_075586_222_629 | 135 |
| 563 | 3300041492 | Ga0451835_0921118 | Ga0451835_0921118_17_424 | 135 |
| 564 | 3300046460 | Ga0495638_0012184 | Ga0495638_0012184_2614_3021 | 135 |
| 565 | 3300053090 | Ga0500646_0353370 | Ga0500646_0353370_44_451 | 135 |
| 566 | iso_pu_bacteria | 3003930520 | 3003931264 | 135 |
| 567 | 3300003320 | rootH2_10028209 | rootH2_100282092 | 136 |
| 568 | 3300005339 | Ga0070660_100552396 | Ga0070660_1005523962 | 136 |
| 569 | 3300005530 | Ga0070679_100713333 | Ga0070679_1007133332 | 136 |
| 570 | 3300005539 | Ga0068853_100186085 | Ga0068853_1001860853 | 136 |
| 571 | 3300006042 | Ga0075368_10588066 | Ga0075368_105880661 | 136 |
| 572 | 3300006048 | Ga0075363_100586664 | Ga0075363_1005866642 | 136 |
| 573 | 3300006178 | Ga0075367_10816648 | Ga0075367_108166481 | 136 |
| 574 | 3300006237 | Ga0097621_101618810 | Ga0097621_1016188102 | 136 |
| 575 | 3300006353 | Ga0075370_10022024 | Ga0075370_100220242 | 136 |
| 576 | 3300009098 | Ga0105245_10319392 | Ga0105245_103193922 | 136 |
| 577 | 3300010375 | Ga0105239_11331550 | Ga0105239_113315502 | 136 |
| 578 | 3300013297 | Ga0157378_10042568 | Ga0157378_100425683 | 136 |
| 579 | 3300026041 | Ga0207639_10043661 | Ga0207639_100436613 | 136 |
| 580 | 3300027866 | Ga0209813_10265884 | Ga0209813_102658841 | 136 |
| 581 | 3300027876 | Ga0209974_10287731 | Ga0209974_102877311 | 136 |
| 582 | 3300028379 | Ga0268266_11799320 | Ga0268266_117993201 | 136 |
| 583 | 3300028577 | Ga0265318_10006422 | Ga0265318_100064221 | 136 |
| 584 | 3300031249 | Ga0265339_10408694 | Ga0265339_104086942 | 136 |
| 585 | 3300031344 | Ga0265316_10541105 | Ga0265316_105411052 | 136 |
| 586 | 3300031595 | Ga0265313_10175580 | Ga0265313_101755802 | 136 |
| 587 | 3300031824 | Ga0307413_11662331 | Ga0307413_116623311 | 136 |
| 588 | 3300031995 | Ga0307409_102147767 | Ga0307409_1021477671 | 136 |
| 589 | 3300032004 | Ga0307414_11131611 | Ga0307414_111316112 | 136 |
| 590 | 3300037068 | Ga0373925_0909383 | Ga0373925_0909383_65_478 | 136 |
| 591 | 3300037418 | Ga0395900_0256309 | Ga0395900_0256309_572_985 | 136 |
| 592 | 3300041997 | Ga0439431_0143712 | Ga0439431_0143712_118_528 | 136 |
| 593 | 3300042006 | Ga0439432_163993 | Ga0439432_163993_105_515 | 136 |
| 594 | 3300048924 | Ga0496121_0129424 | Ga0496121_0129424_1348_1758 | 136 |
| 595 | 3300048924 | Ga0496121_0670015 | Ga0496121_0670015_38_448 | 136 |
| 596 | 3300049571 | Ga0501034_0126713 | Ga0501034_0126713_2019_2429 | 136 |
| 597 | 3300049571 | Ga0501034_0293836 | Ga0501034_0293836_450_860 | 136 |
| 598 | 3300049690 | Ga0501261_068866 | Ga0501261_068866_69_479 | 136 |
| 599 | 3300050490 | nmdc:mga03n38_271022_c1 | nmdc:mga03n38_271022_c1_161_571 | 136 |
| 600 | 3300050493 | nmdc:mga0k408_521497_c1 | nmdc:mga0k408_521497_c1_103_513 | 136 |
| 601 | 3300050494 | nmdc:mga06z11_630962_c1 | nmdc:mga06z11_630962_c1_137_547 | 136 |
| 602 | 3300050495 | nmdc:mga04h51_298587_c1 | nmdc:mga04h51_298587_c1_14_427 | 136 |
| 603 | 3300053139 | Ga0500568_0073172 | Ga0500568_0073172_597_1007 | 136 |
| 604 | 3300053730 | Ga0500645_174566 | Ga0500645_174566_89_499 | 136 |
| 605 | 3300054114 | Ga0501084_0221979 | Ga0501084_0221979_111_521 | 136 |
| 606 | iso_pu_bacteria | 2996336353 | 2996341632 | 136 |
| 607 | 3300002987 | JGI25159J45721_1000461 | JGI25159J45721_100046118 | 137 |
| 608 | 3300003354 | JGI25160J50197_1000248 | JGI25160J50197_100024818 | 137 |
| 609 | 3300003374 | JGI25161J50226_1000183 | JGI25161J50226_100018326 | 137 |
| 610 | 3300004625 | Ga0055543_1000245 | Ga0055543_100024526 | 137 |
| 611 | 3300005262 | Ga0065165_1001012 | Ga0065165_100101218 | 137 |
| 612 | 3300005327 | Ga0070658_10942686 | Ga0070658_109426861 | 137 |
| 613 | 3300005344 | Ga0070661_100001089 | Ga0070661_1000010895 | 137 |
| 614 | 3300005367 | Ga0070667_100348158 | Ga0070667_1003481582 | 137 |
| 615 | 3300005539 | Ga0068853_100006106 | Ga0068853_1000061069 | 137 |
| 616 | 3300005563 | Ga0068855_100252035 | Ga0068855_1002520353 | 137 |
| 617 | 3300005577 | Ga0068857_100124242 | Ga0068857_1001242423 | 137 |
| 618 | 3300005578 | Ga0068854_100019081 | Ga0068854_1000190812 | 137 |
| 619 | 3300005614 | Ga0068856_100034379 | Ga0068856_1000343794 | 137 |
| 620 | 3300005616 | Ga0068852_100007354 | Ga0068852_1000073545 | 137 |
| 621 | 3300005834 | Ga0068851_10000365 | Ga0068851_100003657 | 137 |
| 622 | 3300005834 | Ga0068851_10467013 | Ga0068851_104670132 | 137 |
| 623 | 3300006042 | Ga0075368_10006791 | Ga0075368_100067916 | 137 |
| 624 | 3300006042 | Ga0075368_10060503 | Ga0075368_100605031 | 137 |
| 625 | 3300006048 | Ga0075363_100074111 | Ga0075363_1000741112 | 137 |
| 626 | 3300006048 | Ga0075363_100362481 | Ga0075363_1003624812 | 137 |
| 627 | 3300006178 | Ga0075367_10043744 | Ga0075367_100437442 | 137 |
| 628 | 3300006195 | Ga0075366_10124451 | Ga0075366_101244512 | 137 |
| 629 | 3300006846 | Ga0075430_100381615 | Ga0075430_1003816152 | 137 |
| 630 | 3300006946 | Ga0079104_1014584 | Ga0079104_10145843 | 137 |
| 631 | 3300006946 | Ga0079104_1016005 | Ga0079104_10160052 | 137 |
| 632 | 3300009093 | Ga0105240_10066593 | Ga0105240_100665933 | 137 |
| 633 | 3300009174 | Ga0105241_10036083 | Ga0105241_100360833 | 137 |
| 634 | 3300009545 | Ga0105237_10207731 | Ga0105237_102077313 | 137 |
| 635 | 3300009545 | Ga0105237_11851660 | Ga0105237_118516601 | 137 |
| 636 | 3300009551 | Ga0105238_10038235 | Ga0105238_100382353 | 137 |
| 637 | 3300009551 | Ga0105238_10594859 | Ga0105238_105948592 | 137 |
| 638 | 3300009765 | Ga0123341_1000002 | Ga0123341_100000234 | 137 |
| 639 | 3300009766 | Ga0123342_1030249 | Ga0123342_10302493 | 137 |
| 640 | 3300010375 | Ga0105239_10050615 | Ga0105239_100506153 | 137 |
| 641 | 3300010375 | Ga0105239_10137640 | Ga0105239_101376403 | 137 |
| 642 | 3300010375 | Ga0105239_10597182 | Ga0105239_105971822 | 137 |
| 643 | 3300013296 | Ga0157374_10197245 | Ga0157374_101972452 | 137 |
| 644 | 3300013307 | Ga0157372_12446487 | Ga0157372_124464871 | 137 |
| 645 | 3300014325 | Ga0163163_10235476 | Ga0163163_102354762 | 137 |
| 646 | 3300015261 | Ga0182006_1031178 | Ga0182006_10311782 | 137 |
| 647 | 3300015262 | Ga0182007_10028924 | Ga0182007_100289243 | 137 |
| 648 | 3300021320 | Ga0214544_1000010 | Ga0214544_1000010231 | 137 |
| 649 | 3300021321 | Ga0214542_1000023 | Ga0214542_100002320 | 137 |
| 650 | 3300021321 | Ga0214542_1019114 | Ga0214542_10191142 | 137 |
| 651 | 3300021327 | Ga0214543_1000019 | Ga0214543_100001995 | 137 |
| 652 | 3300021327 | Ga0214543_1000156 | Ga0214543_100015629 | 137 |
| 653 | 3300022739 | Ga0228711_1000056 | Ga0228711_100005648 | 137 |
| 654 | 3300022740 | Ga0228710_1000229 | Ga0228710_100022929 | 137 |
| 655 | 3300025284 | Ga0209130_1000098 | Ga0209130_1000098123 | 137 |
| 656 | 3300025302 | Ga0207426_1000069 | Ga0207426_1000069137 | 137 |
| 657 | 3300025321 | Ga0207656_10029735 | Ga0207656_100297352 | 137 |
| 658 | 3300025909 | Ga0207705_10206070 | Ga0207705_102060702 | 137 |
| 659 | 3300025911 | Ga0207654_10270039 | Ga0207654_102700392 | 137 |
| 660 | 3300025913 | Ga0207695_10096031 | Ga0207695_100960313 | 137 |
| 661 | 3300025913 | Ga0207695_10399632 | Ga0207695_103996322 | 137 |
| 662 | 3300025914 | Ga0207671_10011147 | Ga0207671_100111479 | 137 |
| 663 | 3300025914 | Ga0207671_10082216 | Ga0207671_100822163 | 137 |
| 664 | 3300025920 | Ga0207649_10016189 | Ga0207649_100161894 | 137 |
| 665 | 3300025924 | Ga0207694_10221861 | Ga0207694_102218612 | 137 |
| 666 | 3300025942 | Ga0207689_10943409 | Ga0207689_109434092 | 137 |
| 667 | 3300025944 | Ga0207661_10303869 | Ga0207661_103038692 | 137 |
| 668 | 3300025981 | Ga0207640_10016463 | Ga0207640_100164635 | 137 |
| 669 | 3300026041 | Ga0207639_10024149 | Ga0207639_100241493 | 137 |
| 670 | 3300026078 | Ga0207702_10076518 | Ga0207702_100765183 | 137 |
| 671 | 3300026116 | Ga0207674_10043491 | Ga0207674_100434915 | 137 |
| 672 | 3300026142 | Ga0207698_10094232 | Ga0207698_100942323 | 137 |
| 673 | 3300026142 | Ga0207698_10743370 | Ga0207698_107433702 | 137 |
| 674 | 3300027111 | Ga0209281_1000272 | Ga0209281_100027227 | 137 |
| 675 | 3300027111 | Ga0209281_1000709 | Ga0209281_100070916 | 137 |
| 676 | 3300027666 | Ga0209282_1000055 | Ga0209282_100005528 | 137 |
| 677 | 3300027866 | Ga0209813_10016156 | Ga0209813_100161563 | 137 |
| 678 | 3300031456 | Ga0307513_10245401 | Ga0307513_102454012 | 137 |
| 679 | 3300031967 | Ga0315914_1000095 | Ga0315914_100009550 | 137 |
| 680 | 3300031995 | Ga0307409_101499315 | Ga0307409_1014993152 | 137 |
| 681 | 3300031995 | Ga0307409_102741992 | Ga0307409_1027419921 | 137 |
| 682 | 3300032004 | Ga0307414_12291093 | Ga0307414_122910931 | 137 |
| 683 | 3300033180 | Ga0307510_10282945 | Ga0307510_102829452 | 137 |
| 684 | 3300033430 | Ga0315913_1000019 | Ga0315913_100001927 | 137 |
| 685 | 3300033464 | Ga0315915_1000023 | Ga0315915_100002350 | 137 |
| 686 | 3300041413 | Ga0439465_0017138 | Ga0439465_0017138_1720_2133 | 137 |
| 687 | 3300041453 | Ga0451797_0003339 | Ga0451797_0003339_45_458 | 137 |
| 688 | 3300041453 | Ga0451797_0955447 | Ga0451797_0955447_61_474 | 137 |
| 689 | 3300041486 | Ga0451807_2300357 | Ga0451807_2300357_106_522 | 137 |
| 690 | 3300041491 | Ga0451833_0178365 | Ga0451833_0178365_18_431 | 137 |
| 691 | 3300041492 | Ga0451835_0861054 | Ga0451835_0861054_88_501 | 137 |
| 692 | 3300041494 | Ga0451837_1679461 | Ga0451837_1679461_76_489 | 137 |
| 693 | 3300041496 | Ga0451839_0326841 | Ga0451839_0326841_473_886 | 137 |
| 694 | 3300041496 | Ga0451839_0542047 | Ga0451839_0542047_1182_1595 | 137 |
| 695 | 3300041498 | Ga0451841_0564111 | Ga0451841_0564111_1908_2321 | 137 |
| 696 | 3300041501 | Ga0451845_0306592 | Ga0451845_0306592_1582_1995 | 137 |
| 697 | 3300041503 | Ga0451847_0471708 | Ga0451847_0471708_856_1269 | 137 |
| 698 | 3300041505 | Ga0451849_1148107 | Ga0451849_1148107_599_1012 | 137 |
| 699 | 3300041507 | Ga0451851_1221558 | Ga0451851_1221558_1879_2292 | 137 |
| 700 | 3300041509 | Ga0451843_0368501 | Ga0451843_0368501_116_529 | 137 |
| 701 | 3300041999 | Ga0439433_0097307 | Ga0439433_0097307_226_639 | 137 |
| 702 | 3300042004 | Ga0439445_0130328 | Ga0439445_0130328_124_537 | 137 |
| 703 | 3300042006 | Ga0439432_020307 | Ga0439432_020307_589_1002 | 137 |
| 704 | 3300042007 | Ga0439449_0026019 | Ga0439449_0026019_154_567 | 137 |
| 705 | 3300046460 | Ga0495638_0123166 | Ga0495638_0123166_95_514 | 137 |
| 706 | 3300046460 | Ga0495638_0214620 | Ga0495638_0214620_535_951 | 137 |
| 707 | 3300046460 | Ga0495638_0423459 | Ga0495638_0423459_194_607 | 137 |
| 708 | 3300046507 | Ga0495606_0218044 | Ga0495606_0218044_346_759 | 137 |
| 709 | 3300047323 | Ga0495683_0145001 | Ga0495683_0145001_352_765 | 137 |
| 710 | 3300048911 | Ga0496108_0240447 | Ga0496108_0240447_834_1247 | 137 |
| 711 | 3300048915 | Ga0496112_0001731 | Ga0496112_0001731_15115_15528 | 137 |
| 712 | 3300048916 | Ga0496113_0147244 | Ga0496113_0147244_141_554 | 137 |
| 713 | 3300048922 | Ga0496119_0010974 | Ga0496119_0010974_2769_3182 | 137 |
| 714 | 3300048922 | Ga0496119_0232531 | Ga0496119_0232531_297_710 | 137 |
| 715 | 3300048924 | Ga0496121_0167571 | Ga0496121_0167571_959_1372 | 137 |
| 716 | 3300048924 | Ga0496121_0397933 | Ga0496121_0397933_84_497 | 137 |
| 717 | 3300048928 | Ga0496125_0066554 | Ga0496125_0066554_952_1365 | 137 |
| 718 | 3300049581 | Ga0501047_0470021 | Ga0501047_0470021_281_694 | 137 |
| 719 | 3300050489 | nmdc:mga03683_443758_c1 | nmdc:mga03683_443758_c1_74_487 | 137 |
| 720 | 3300050490 | nmdc:mga03n38_70345_c1 | nmdc:mga03n38_70345_c1_932_1345 | 137 |
| 721 | 3300050492 | nmdc:mga0yw44_177287_c1 | nmdc:mga0yw44_177287_c1_54_467 | 137 |
| 722 | 3300050493 | nmdc:mga0k408_546564_c1 | nmdc:mga0k408_546564_c1_128_541 | 137 |
| 723 | 3300050493 | nmdc:mga0k408_561971_c1 | nmdc:mga0k408_561971_c1_189_602 | 137 |
| 724 | 3300050494 | nmdc:mga06z11_299164_c1 | nmdc:mga06z11_299164_c1_250_663 | 137 |
| 725 | 3300050495 | nmdc:mga04h51_57680_c1 | nmdc:mga04h51_57680_c1_302_715 | 137 |
| 726 | 3300053092 | Ga0500583_0463455 | Ga0500583_0463455_84_497 | 137 |
| 727 | 3300053096 | Ga0500641_0187048 | Ga0500641_0187048_442_855 | 137 |
| 728 | 3300053124 | Ga0500617_236154 | Ga0500617_236154_138_551 | 137 |
| 729 | 3300053131 | Ga0500652_333538 | Ga0500652_333538_39_452 | 137 |
| 730 | 3300053146 | Ga0500588_0058270 | Ga0500588_0058270_534_947 | 137 |
| 731 | iso_pu_bacteria | 2960637947 | 2960643398 | 137 |
| 732 | iso_pu_bacteria | 2964719344 | 2964724819 | 137 |
| 733 | 3300002741 | JGI25157J39369_1002201 | JGI25157J39369_10022015 | 138 |
| 734 | 3300003214 | JGI25165J46597_1000034 | JGI25165J46597_100003479 | 138 |
| 735 | 3300003762 | Ga0055542_1001063 | Ga0055542_100106316 | 138 |
| 736 | 3300003762 | Ga0055542_1035206 | Ga0055542_10352061 | 138 |
| 737 | 3300003763 | Ga0055529_1003010 | Ga0055529_10030103 | 138 |
| 738 | 3300005329 | Ga0070683_100399870 | Ga0070683_1003998702 | 138 |
| 739 | 3300005334 | Ga0068869_100559938 | Ga0068869_1005599382 | 138 |
| 740 | 3300005339 | Ga0070660_100168327 | Ga0070660_1001683272 | 138 |
| 741 | 3300005356 | Ga0070674_100024016 | Ga0070674_1000240163 | 138 |
| 742 | 3300005356 | Ga0070674_101191248 | Ga0070674_1011912482 | 138 |
| 743 | 3300005356 | Ga0070674_101310060 | Ga0070674_1013100602 | 138 |
| 744 | 3300005364 | Ga0070673_100268827 | Ga0070673_1002688272 | 138 |
| 745 | 3300005366 | Ga0070659_101326089 | Ga0070659_1013260892 | 138 |
| 746 | 3300005455 | Ga0070663_100832400 | Ga0070663_1008324002 | 138 |
| 747 | 3300005457 | Ga0070662_101337753 | Ga0070662_1013377532 | 138 |
| 748 | 3300005459 | Ga0068867_100107653 | Ga0068867_1001076533 | 138 |
| 749 | 3300005459 | Ga0068867_100272240 | Ga0068867_1002722401 | 138 |
| 750 | 3300005467 | Ga0070706_100890647 | Ga0070706_1008906471 | 138 |
| 751 | 3300005530 | Ga0070679_102103818 | Ga0070679_1021038181 | 138 |
| 752 | 3300005535 | Ga0070684_100705097 | Ga0070684_1007050972 | 138 |
| 753 | 3300005539 | Ga0068853_100009175 | Ga0068853_1000091754 | 138 |
| 754 | 3300005539 | Ga0068853_100508722 | Ga0068853_1005087222 | 138 |
| 755 | 3300005548 | Ga0070665_100237090 | Ga0070665_1002370902 | 138 |
| 756 | 3300005548 | Ga0070665_101413680 | Ga0070665_1014136801 | 138 |
| 757 | 3300005548 | Ga0070665_101885244 | Ga0070665_1018852442 | 138 |
| 758 | 3300005549 | Ga0070704_101670473 | Ga0070704_1016704731 | 138 |
| 759 | 3300005563 | Ga0068855_100331519 | Ga0068855_1003315192 | 138 |
| 760 | 3300005563 | Ga0068855_101100257 | Ga0068855_1011002572 | 138 |
| 761 | 3300005563 | Ga0068855_101165797 | Ga0068855_1011657972 | 138 |
| 762 | 3300005578 | Ga0068854_100214546 | Ga0068854_1002145462 | 138 |
| 763 | 3300005616 | Ga0068852_100511857 | Ga0068852_1005118572 | 138 |
| 764 | 3300006038 | Ga0075365_10002114 | Ga0075365_100021146 | 138 |
| 765 | 3300006038 | Ga0075365_10036263 | Ga0075365_100362632 | 138 |
| 766 | 3300006038 | Ga0075365_11074739 | Ga0075365_110747392 | 138 |
| 767 | 3300006042 | Ga0075368_10072602 | Ga0075368_100726022 | 138 |
| 768 | 3300006048 | Ga0075363_100044193 | Ga0075363_1000441933 | 138 |
| 769 | 3300006048 | Ga0075363_100205752 | Ga0075363_1002057521 | 138 |
| 770 | 3300006048 | Ga0075363_100361637 | Ga0075363_1003616371 | 138 |
| 771 | 3300006177 | Ga0075362_10164715 | Ga0075362_101647152 | 138 |
| 772 | 3300006177 | Ga0075362_10392812 | Ga0075362_103928122 | 138 |
| 773 | 3300006178 | Ga0075367_10057338 | Ga0075367_100573382 | 138 |
| 774 | 3300006178 | Ga0075367_10184904 | Ga0075367_101849042 | 138 |
| 775 | 3300006186 | Ga0075369_10024082 | Ga0075369_100240822 | 138 |
| 776 | 3300006186 | Ga0075369_10297875 | Ga0075369_102978752 | 138 |
| 777 | 3300006195 | Ga0075366_10349889 | Ga0075366_103498891 | 138 |
| 778 | 3300006353 | Ga0075370_10150186 | Ga0075370_101501862 | 138 |
| 779 | 3300006353 | Ga0075370_10611464 | Ga0075370_106114641 | 138 |
| 780 | 3300006844 | Ga0075428_100686712 | Ga0075428_1006867122 | 138 |
| 781 | 3300006846 | Ga0075430_100171599 | Ga0075430_1001715992 | 138 |
| 782 | 3300006847 | Ga0075431_100008602 | Ga0075431_1000086025 | 138 |
| 783 | 3300006871 | Ga0075434_100486499 | Ga0075434_1004864992 | 138 |
| 784 | 3300006881 | Ga0068865_100225653 | Ga0068865_1002256532 | 138 |
| 785 | 3300009093 | Ga0105240_11826999 | Ga0105240_118269991 | 138 |
| 786 | 3300009093 | Ga0105240_12053865 | Ga0105240_120538651 | 138 |
| 787 | 3300009148 | Ga0105243_11671647 | Ga0105243_116716471 | 138 |
| 788 | 3300009148 | Ga0105243_11822633 | Ga0105243_118226332 | 138 |
| 789 | 3300009148 | Ga0105243_12595170 | Ga0105243_125951701 | 138 |
| 790 | 3300009174 | Ga0105241_10281116 | Ga0105241_102811162 | 138 |
| 791 | 3300009174 | Ga0105241_10616650 | Ga0105241_106166501 | 138 |
| 792 | 3300009545 | Ga0105237_10054607 | Ga0105237_100546073 | 138 |
| 793 | 3300009545 | Ga0105237_11189679 | Ga0105237_111896792 | 138 |
| 794 | 3300009551 | Ga0105238_10426000 | Ga0105238_104260002 | 138 |
| 795 | 3300009551 | Ga0105238_10979796 | Ga0105238_109797962 | 138 |
| 796 | 3300009553 | Ga0105249_11273321 | Ga0105249_112733212 | 138 |
| 797 | 3300010375 | Ga0105239_10207776 | Ga0105239_102077762 | 138 |
| 798 | 3300010375 | Ga0105239_10368082 | Ga0105239_103680822 | 138 |
| 799 | 3300010375 | Ga0105239_11885803 | Ga0105239_118858032 | 138 |
| 800 | 3300010375 | Ga0105239_12759595 | Ga0105239_127595951 | 138 |
| 801 | 3300010375 | Ga0105239_13007697 | Ga0105239_130076971 | 138 |
| 802 | 3300011119 | Ga0105246_10539373 | Ga0105246_105393732 | 138 |
| 803 | 3300011119 | Ga0105246_11016211 | Ga0105246_110162112 | 138 |
| 804 | 3300011119 | Ga0105246_11590128 | Ga0105246_115901282 | 138 |
| 805 | 3300013104 | Ga0157370_10075580 | Ga0157370_100755803 | 138 |
| 806 | 3300013104 | Ga0157370_11280226 | Ga0157370_112802261 | 138 |
| 807 | 3300013105 | Ga0157369_10188646 | Ga0157369_101886462 | 138 |
| 808 | 3300013296 | Ga0157374_11478086 | Ga0157374_114780861 | 138 |
| 809 | 3300013297 | Ga0157378_10528673 | Ga0157378_105286732 | 138 |
| 810 | 3300014325 | Ga0163163_11008438 | Ga0163163_110084382 | 138 |
| 811 | 3300014745 | Ga0157377_11344622 | Ga0157377_113446221 | 138 |
| 812 | 3300014969 | Ga0157376_10409571 | Ga0157376_104095712 | 138 |
| 813 | 3300014969 | Ga0157376_11842785 | Ga0157376_118427851 | 138 |
| 814 | 3300017792 | Ga0163161_10224288 | Ga0163161_102242882 | 138 |
| 815 | 3300025250 | Ga0209026_1000100 | Ga0209026_100010018 | 138 |
| 816 | 3300025254 | Ga0209148_1000069 | Ga0209148_1000069168 | 138 |
| 817 | 3300025254 | Ga0209148_1003960 | Ga0209148_10039603 | 138 |
| 818 | 3300025256 | Ga0209759_1000549 | Ga0209759_100054922 | 138 |
| 819 | 3300025261 | Ga0209233_1000028 | Ga0209233_100002883 | 138 |
| 820 | 3300025261 | Ga0209233_1014135 | Ga0209233_10141351 | 138 |
| 821 | 3300025272 | Ga0209455_1000135 | Ga0209455_100013519 | 138 |
| 822 | 3300025297 | Ga0209758_1014469 | Ga0209758_10144694 | 138 |
| 823 | 3300025901 | Ga0207688_10158858 | Ga0207688_101588582 | 138 |
| 824 | 3300025903 | Ga0207680_10176801 | Ga0207680_101768013 | 138 |
| 825 | 3300025904 | Ga0207647_10120437 | Ga0207647_101204372 | 138 |
| 826 | 3300025904 | Ga0207647_10134094 | Ga0207647_101340941 | 138 |
| 827 | 3300025907 | Ga0207645_10111210 | Ga0207645_101112103 | 138 |
| 828 | 3300025909 | Ga0207705_10120282 | Ga0207705_101202823 | 138 |
| 829 | 3300025910 | Ga0207684_10616503 | Ga0207684_106165032 | 138 |
| 830 | 3300025911 | Ga0207654_11132240 | Ga0207654_111322401 | 138 |
| 831 | 3300025913 | Ga0207695_10390991 | Ga0207695_103909912 | 138 |
| 832 | 3300025914 | Ga0207671_10048066 | Ga0207671_100480662 | 138 |
| 833 | 3300025919 | Ga0207657_10015036 | Ga0207657_100150362 | 138 |
| 834 | 3300025919 | Ga0207657_10118186 | Ga0207657_101181863 | 138 |
| 835 | 3300025920 | Ga0207649_10092468 | Ga0207649_100924682 | 138 |
| 836 | 3300025920 | Ga0207649_10515957 | Ga0207649_105159571 | 138 |
| 837 | 3300025924 | Ga0207694_10041236 | Ga0207694_100412363 | 138 |
| 838 | 3300025924 | Ga0207694_10447154 | Ga0207694_104471542 | 138 |
| 839 | 3300025932 | Ga0207690_10064234 | Ga0207690_100642342 | 138 |
| 840 | 3300025933 | Ga0207706_11007353 | Ga0207706_110073531 | 138 |
| 841 | 3300025937 | Ga0207669_10637924 | Ga0207669_106379242 | 138 |
| 842 | 3300025937 | Ga0207669_10691447 | Ga0207669_106914472 | 138 |
| 843 | 3300025937 | Ga0207669_10950921 | Ga0207669_109509212 | 138 |
| 844 | 3300025940 | Ga0207691_10090174 | Ga0207691_100901743 | 138 |
| 845 | 3300025944 | Ga0207661_10198497 | Ga0207661_101984972 | 138 |
| 846 | 3300025949 | Ga0207667_10935294 | Ga0207667_109352942 | 138 |
| 847 | 3300025949 | Ga0207667_11023867 | Ga0207667_110238672 | 138 |
| 848 | 3300025960 | Ga0207651_10493860 | Ga0207651_104938602 | 138 |
| 849 | 3300025981 | Ga0207640_10168202 | Ga0207640_101682022 | 138 |
| 850 | 3300025981 | Ga0207640_10525514 | Ga0207640_105255142 | 138 |
| 851 | 3300025981 | Ga0207640_10792726 | Ga0207640_107927262 | 138 |
| 852 | 3300026041 | Ga0207639_10214961 | Ga0207639_102149612 | 138 |
| 853 | 3300026041 | Ga0207639_11137361 | Ga0207639_111373612 | 138 |
| 854 | 3300026067 | Ga0207678_10245762 | Ga0207678_102457622 | 138 |
| 855 | 3300026067 | Ga0207678_10860983 | Ga0207678_108609832 | 138 |
| 856 | 3300026078 | Ga0207702_10976183 | Ga0207702_109761832 | 138 |
| 857 | 3300026088 | Ga0207641_10550009 | Ga0207641_105500092 | 138 |
| 858 | 3300026089 | Ga0207648_10134399 | Ga0207648_101343992 | 138 |
| 859 | 3300026089 | Ga0207648_10153697 | Ga0207648_101536973 | 138 |
| 860 | 3300026116 | Ga0207674_10042765 | Ga0207674_100427654 | 138 |
| 861 | 3300026116 | Ga0207674_12134905 | Ga0207674_121349051 | 138 |
| 862 | 3300026142 | Ga0207698_10512673 | Ga0207698_105126732 | 138 |
| 863 | 3300026142 | Ga0207698_10953417 | Ga0207698_109534172 | 138 |
| 864 | 3300026142 | Ga0207698_11872215 | Ga0207698_118722152 | 138 |
| 865 | 3300027866 | Ga0209813_10321086 | Ga0209813_103210862 | 138 |
| 866 | 3300027866 | Ga0209813_10449076 | Ga0209813_104490761 | 138 |
| 867 | 3300028379 | Ga0268266_10033856 | Ga0268266_100338564 | 138 |
| 868 | 3300028379 | Ga0268266_10110141 | Ga0268266_101101413 | 138 |
| 869 | 3300028379 | Ga0268266_10460688 | Ga0268266_104606882 | 138 |
| 870 | 3300028379 | Ga0268266_10480157 | Ga0268266_104801572 | 138 |
| 871 | 3300031548 | Ga0307408_100530996 | Ga0307408_1005309962 | 138 |
| 872 | 3300031911 | Ga0307412_10382383 | Ga0307412_103823832 | 138 |
| 873 | 3300031911 | Ga0307412_10481124 | Ga0307412_104811241 | 138 |
| 874 | 3300032002 | Ga0307416_100405938 | Ga0307416_1004059382 | 138 |
| 875 | 3300035398 | Ga0316574_0405782 | Ga0316574_0405782_197_613 | 138 |
| 876 | 3300037312 | Ga0395899_0084472 | Ga0395899_0084472_529_948 | 138 |
| 877 | 3300037418 | Ga0395900_0014410 | Ga0395900_0014410_7199_7618 | 138 |
| 878 | 3300037418 | Ga0395900_0180840 | Ga0395900_0180840_1271_1687 | 138 |
| 879 | 3300037418 | Ga0395900_0421129 | Ga0395900_0421129_568_984 | 138 |
| 880 | 3300037418 | Ga0395900_0517868 | Ga0395900_0517868_111_530 | 138 |
| 881 | 3300037418 | Ga0395900_1624718 | Ga0395900_1624718_66_482 | 138 |
| 882 | 3300037466 | Ga0395898_0546371 | Ga0395898_0546371_447_866 | 138 |
| 883 | 3300037471 | Ga0395905_0472963 | Ga0395905_0472963_44_460 | 138 |
| 884 | 3300037471 | Ga0395905_0482047 | Ga0395905_0482047_175_594 | 138 |
| 885 | 3300037471 | Ga0395905_1159852 | Ga0395905_1159852_161_577 | 138 |
| 886 | 3300038443 | Ga0395901_0076932 | Ga0395901_0076932_1284_1703 | 138 |
| 887 | 3300038443 | Ga0395901_0259129 | Ga0395901_0259129_1086_1502 | 138 |
| 888 | 3300038443 | Ga0395901_0282485 | Ga0395901_0282485_78_494 | 138 |
| 889 | 3300038443 | Ga0395901_1514489 | Ga0395901_1514489_104_520 | 138 |
| 890 | 3300041413 | Ga0439465_0207644 | Ga0439465_0207644_129_545 | 138 |
| 891 | 3300041413 | Ga0439465_0350353 | Ga0439465_0350353_84_500 | 138 |
| 892 | 3300041453 | Ga0451797_1415564 | Ga0451797_1415564_152_568 | 138 |
| 893 | 3300041512 | Ga0451853_0727081 | Ga0451853_0727081_35_460 | 138 |
| 894 | 3300042157 | Ga0439458_0171420 | Ga0439458_0171420_67_486 | 138 |
| 895 | 3300044658 | Ga0466972_0029385 | Ga0466972_0029385_811_1290 | 138 |
| 896 | 3300044658 | Ga0466972_0155721 | Ga0466972_0155721_133_549 | 138 |
| 897 | 3300044765 | Ga0466970_0764168 | Ga0466970_0764168_19_450 | 138 |
| 898 | 3300044901 | Ga0466960_0648551 | Ga0466960_0648551_66_482 | 138 |
| 899 | 3300046460 | Ga0495638_0476406 | Ga0495638_0476406_76_510 | 138 |
| 900 | 3300046460 | Ga0495638_0478465 | Ga0495638_0478465_196_615 | 138 |
| 901 | 3300046519 | Ga0495632_0390255 | Ga0495632_0390255_28_447 | 138 |
| 902 | 3300046522 | Ga0495643_0353655 | Ga0495643_0353655_61_477 | 138 |
| 903 | 3300046530 | Ga0495654_0130108 | Ga0495654_0130108_104_523 | 138 |
| 904 | 3300046616 | Ga0495668_0036681 | Ga0495668_0036681_1854_2270 | 138 |
| 905 | 3300046648 | Ga0495611_0401065 | Ga0495611_0401065_87_503 | 138 |
| 906 | 3300046660 | Ga0495625_0021804 | Ga0495625_0021804_3490_3906 | 138 |
| 907 | 3300047472 | Ga0495686_0541580 | Ga0495686_0541580_79_495 | 138 |
| 908 | 3300048091 | Ga0495626_0259575 | Ga0495626_0259575_250_669 | 138 |
| 909 | 3300048908 | Ga0496105_0659412 | Ga0496105_0659412_143_562 | 138 |
| 910 | 3300048909 | Ga0496106_1056658 | Ga0496106_1056658_95_511 | 138 |
| 911 | 3300048911 | Ga0496108_0793576 | Ga0496108_0793576_263_679 | 138 |
| 912 | 3300048913 | Ga0496110_0293531 | Ga0496110_0293531_597_1016 | 138 |
| 913 | 3300048915 | Ga0496112_0607916 | Ga0496112_0607916_591_1007 | 138 |
| 914 | 3300048918 | Ga0496115_0121735 | Ga0496115_0121735_250_675 | 138 |
| 915 | 3300048918 | Ga0496115_0322285 | Ga0496115_0322285_813_1229 | 138 |
| 916 | 3300048920 | Ga0496117_0135687 | Ga0496117_0135687_312_731 | 138 |
| 917 | 3300048921 | Ga0496118_0345079 | Ga0496118_0345079_348_764 | 138 |
| 918 | 3300048922 | Ga0496119_0027484 | Ga0496119_0027484_519_935 | 138 |
| 919 | 3300048923 | Ga0496120_0002155 | Ga0496120_0002155_3356_3772 | 138 |
| 920 | 3300048923 | Ga0496120_0020849 | Ga0496120_0020849_1447_1863 | 138 |
| 921 | 3300048924 | Ga0496121_0154062 | Ga0496121_0154062_239_682 | 138 |
| 922 | 3300048925 | Ga0496122_0296413 | Ga0496122_0296413_230_646 | 138 |
| 923 | 3300048927 | Ga0496124_0114743 | Ga0496124_0114743_828_1247 | 138 |
| 924 | 3300048927 | Ga0496124_0386392 | Ga0496124_0386392_137_553 | 138 |
| 925 | 3300048928 | Ga0496125_0582133 | Ga0496125_0582133_55_474 | 138 |
| 926 | 3300048929 | Ga0496126_0152871 | Ga0496126_0152871_694_1113 | 138 |
| 927 | 3300048929 | Ga0496126_0211436 | Ga0496126_0211436_407_826 | 138 |
| 928 | 3300049568 | Ga0501031_0000008 | Ga0501031_0000008_4704_5120 | 138 |
| 929 | 3300049569 | Ga0501032_0000018 | Ga0501032_0000018_151174_151590 | 138 |
| 930 | 3300049570 | Ga0501033_0000032 | Ga0501033_0000032_151185_151601 | 138 |
| 931 | 3300049570 | Ga0501033_1059597 | Ga0501033_1059597_88_504 | 138 |
| 932 | 3300049571 | Ga0501034_0000103 | Ga0501034_0000103_4704_5120 | 138 |
| 933 | 3300049571 | Ga0501034_0832082 | Ga0501034_0832082_110_526 | 138 |
| 934 | 3300049571 | Ga0501034_1267285 | Ga0501034_1267285_134_562 | 138 |
| 935 | 3300049572 | Ga0501036_0000012 | Ga0501036_0000012_151185_151601 | 138 |
| 936 | 3300049573 | Ga0501037_0000018 | Ga0501037_0000018_4704_5120 | 138 |
| 937 | 3300049574 | Ga0501038_0000017 | Ga0501038_0000017_4704_5120 | 138 |
| 938 | 3300049575 | Ga0501039_0000024 | Ga0501039_0000024_4704_5120 | 138 |
| 939 | 3300049576 | Ga0501040_0040528 | Ga0501040_0040528_45_461 | 138 |
| 940 | 3300049579 | Ga0501043_0004332 | Ga0501043_0004332_4855_5271 | 138 |
| 941 | 3300049579 | Ga0501043_0210059 | Ga0501043_0210059_1029_1457 | 138 |
| 942 | 3300049579 | Ga0501043_0829557 | Ga0501043_0829557_109_525 | 138 |
| 943 | 3300049580 | Ga0501046_0779640 | Ga0501046_0779640_62_478 | 138 |
| 944 | 3300049581 | Ga0501047_0004558 | Ga0501047_0004558_4639_5055 | 138 |
| 945 | 3300049583 | Ga0501067_0391902 | Ga0501067_0391902_162_584 | 138 |
| 946 | 3300049585 | Ga0501069_1016217 | Ga0501069_1016217_40_459 | 138 |
| 947 | 3300049586 | Ga0501070_0026001 | Ga0501070_0026001_3308_3724 | 138 |
| 948 | 3300049589 | Ga0501073_0319039 | Ga0501073_0319039_477_896 | 138 |
| 949 | 3300049822 | Ga0501035_0000040 | Ga0501035_0000040_4662_5078 | 138 |
| 950 | 3300049822 | Ga0501035_0031169 | Ga0501035_0031169_159_575 | 138 |
| 951 | 3300049823 | Ga0501044_0000040 | Ga0501044_0000040_4704_5120 | 138 |
| 952 | 3300049823 | Ga0501044_0013108 | Ga0501044_0013108_1741_2157 | 138 |
| 953 | 3300050489 | nmdc:mga03683_114476_c1 | nmdc:mga03683_114476_c1_136_552 | 138 |
| 954 | 3300050489 | nmdc:mga03683_141469_c1 | nmdc:mga03683_141469_c1_386_805 | 138 |
| 955 | 3300050489 | nmdc:mga03683_405307_c1 | nmdc:mga03683_405307_c1_172_591 | 138 |
| 956 | 3300050490 | nmdc:mga03n38_15460_c1 | nmdc:mga03n38_15460_c1_2394_2810 | 138 |
| 957 | 3300050490 | nmdc:mga03n38_17735_c1 | nmdc:mga03n38_17735_c1_731_1150 | 138 |
| 958 | 3300050490 | nmdc:mga03n38_461833_c1 | nmdc:mga03n38_461833_c1_154_570 | 138 |
| 959 | 3300050490 | nmdc:mga03n38_656118_c1 | nmdc:mga03n38_656118_c1_65_481 | 138 |
| 960 | 3300050492 | nmdc:mga0yw44_1188482_c1 | nmdc:mga0yw44_1188482_c1_44_463 | 138 |
| 961 | 3300050492 | nmdc:mga0yw44_227875_c1 | nmdc:mga0yw44_227875_c1_497_916 | 138 |
| 962 | 3300050492 | nmdc:mga0yw44_87133_c1 | nmdc:mga0yw44_87133_c1_694_1113 | 138 |
| 963 | 3300050493 | nmdc:mga0k408_442392_c1 | nmdc:mga0k408_442392_c1_42_458 | 138 |
| 964 | 3300050495 | nmdc:mga04h51_190513_c1 | nmdc:mga04h51_190513_c1_236_652 | 138 |
| 965 | 3300050495 | nmdc:mga04h51_287868_c1 | nmdc:mga04h51_287868_c1_55_471 | 138 |
| 966 | 3300050496 | nmdc:mga07m45_41591_c1 | nmdc:mga07m45_41591_c1_595_1014 | 138 |
| 967 | 3300050509 | nmdc:mga0qj67_110919_c1 | nmdc:mga0qj67_110919_c1_633_1055 | 138 |
| 968 | 3300050510 | nmdc:mga06r32_15012_c1 | nmdc:mga06r32_15012_c1_2586_3008 | 138 |
| 969 | 3300050512 | nmdc:mga0n895_1252701_c1 | nmdc:mga0n895_1252701_c1_226_648 | 138 |
| 970 | 3300050515 | nmdc:mga0a205_419969_c1 | nmdc:mga0a205_419969_c1_174_596 | 138 |
| 971 | 3300050516 | nmdc:mga0sz30_192897_c1 | nmdc:mga0sz30_192897_c1_341_757 | 138 |
| 972 | 3300050516 | nmdc:mga0sz30_41876_c1 | nmdc:mga0sz30_41876_c1_429_848 | 138 |
| 973 | 3300053083 | Ga0495655_0269375 | Ga0495655_0269375_81_500 | 138 |
| 974 | 3300053087 | Ga0500643_190854 | Ga0500643_190854_58_474 | 138 |
| 975 | 3300053119 | Ga0500595_087247 | Ga0500595_087247_451_870 | 138 |
| 976 | 3300053122 | Ga0500608_076771 | Ga0500608_076771_749_1165 | 138 |
| 977 | 3300053134 | Ga0500658_0213663 | Ga0500658_0213663_299_718 | 138 |
| 978 | 3300053139 | Ga0500568_0000010 | Ga0500568_0000010_38766_39182 | 138 |
| 979 | 3300053139 | Ga0500568_0122876 | Ga0500568_0122876_160_576 | 138 |
| 980 | 3300053151 | Ga0500604_0022802 | Ga0500604_0022802_598_1017 | 138 |
| 981 | 3300053153 | Ga0500616_0141021 | Ga0500616_0141021_283_702 | 138 |
| 982 | 3300053155 | Ga0500620_000598 | Ga0500620_000598_3815_4234 | 138 |
| 983 | 3300053158 | Ga0500627_0417286 | Ga0500627_0417286_80_496 | 138 |
| 984 | 3300053727 | Ga0500611_012404 | Ga0500611_012404_524_943 | 138 |
| 985 | 3300060353 | Ga0501082_0145183 | Ga0501082_0145183_296_715 | 138 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7x85-assembly2.cif.gz_C | crystal structure of chicken cenp-c cupin domain | 0.9559 | 16 | 118 |
| 5uqp-assembly1.cif.gz_B | the crystal structure of cupin protein from rhodococcus jostii rha1 | 0.9323 | 38 | 118 |
| 7zvm-assembly1.cif.gz_A-2 | thermococcus barophilus phosphomannose isomerase protein structure at 1.6 a | 0.9301 | 36 | 117 |
| 5fq0-assembly2.cif.gz_D | the structure of kdgf from halomonas sp. | 0.914 | 20 | 123 |
| 4met-assembly1.cif.gz_A | assigning the epr fine structure parameters of the mn(ii) centers in bacillus subtilis oxalate decarboxylase by site-directed mutagenesis and dft/mm calculations | 0.8978 | 18 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9USR9_537_626_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9396 | 20 | 117 | 2.60.120.10 |
| af_A0A0R0L0M3_22_151_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9345 | 37 | 121 | 2.60.120.10 |
| af_Q03188_852_942_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9331 | 22 | 117 | 2.60.120.10 |
| af_A0A0R0KI49_145_251_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9279 | 49 | 121 | 2.60.120.10 |
| af_Q9USR9_537_626_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9196 | 20 | 117 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A659UIY6-F1-model_v4 | Cupin domain-containing protein | 0.9952 | 1 | 118 |
|
| AF-A0A659UIY6-F1-model_v4 | Cupin domain-containing protein | 0.9868 | 1 | 118 |
|
| AF-Q2JYS6-F1-model_v4 | Hypothetical conserved protein | 0.9735 | 1 | 138 |
|
| AF-A0A6H2H322-F1-model_v4 | Cupin domain-containing protein | 0.9678 | 7 | 137 |
|
| AF-Q2JYS6-F1-model_v4 | Hypothetical conserved protein | 0.9666 | 1 | 138 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar