F487487

General Info

Members Datasets Scaffolds Average Seq Length
984 597 769 400

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2617270741|2617375859
Length 431
Sequence TDARSLTAMKQDRPKETKAETGKERVGGARRDAVRTALVVLGLCFTLAVLGRGLSESFTVFLKPISESLGWDRAQAVSIYSLTWLVSGMTAPLVGRLFDHSGPRLVYALGLLLLGSAFLIASQAQALWQFQLSIGICVGIGVGFIGNVPNSILLGRWFGPKLPTAMAVVYSAMGGGVLALLPASQLLIDHLGWRETYQLFGFAALGLLAPLLLLPWRMFAAGSPHVAKKSDPDFVDSGWTLASAMRHHAFWALFSTFFFTAVGMYAIAAQIVAYLIDAGFPPLQAATAWGFSGIVLVFGMLGVSALDGLIGRRPSVLLSYAISILGIVLLWLLQYYPNVILLTGFVVCFGSMMGSRGPLISATAMKIFRGKRVGTIFGTISIGSGLGSAFGSWSGGLIHDATHGYDLLLVFALASVILGMIPFLVVPALRE

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
20 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
21 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
22 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
23 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
24 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
25 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
26 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
27 2643221651 Afipia sp. Root123D2 Isolate Unclassified
28 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
29 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
30 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
31 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
32 2791355199
33 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
34 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
35 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
36 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
37 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
38 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
39 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
40 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
41 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
42 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
43 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
44 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
45 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
46 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
47 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
48 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
49 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
50 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
51 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
52 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
53 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
54 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
55 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
56 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
57 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
58 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
59 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
60 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
61 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
62 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
63 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
64 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
65 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
66 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
67 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
68 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
69 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
70 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
71 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
72 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
73 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
74 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
75 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
76 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
77 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
78 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
79 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
80 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
81 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
82 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
83 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
84 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
85 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
86 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
87 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
88 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
89 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
90 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
91 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
92 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
93 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
94 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
95 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
96 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
97 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
98 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
99 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
100 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
101 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
102 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
103 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
104 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
105 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
106 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
107 2922368715
108 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
109 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
110 2922425934
111 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
112 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
113 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
114 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
115 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
116 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
117 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
118 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
119 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
120 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
121 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
122 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
123 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
124 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
125 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
126 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
127 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
128 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
129 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
130 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
131 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
132 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
133 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
134 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
135 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
136 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
137 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
138 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
139 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
140 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
141 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
142 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
143 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
144 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
145 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
146 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
147 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
148 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
149 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
150 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
151 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
152 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
153 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
154 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
155 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
156 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
157 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
158 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
159 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
160 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
161 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
162 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
163 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
164 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
165 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
166 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
167 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
168 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
169 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
170 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
171 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
172 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
173 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
174 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
175 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
176 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
177 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
178 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
179 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
180 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
181 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
182 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
183 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
184 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
185 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
186 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
187 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
188 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
189 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
190 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
191 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
192 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
193 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
194 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
195 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
196 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
197 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
198 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
199 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
200 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
201 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
202 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
203 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
204 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
205 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
206 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
207 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
208 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
209 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
210 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
211 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
212 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
213 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
214 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
215 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
216 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
217 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
218 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
219 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
220 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
221 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
222 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
223 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
224 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
225 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
226 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
227 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
228 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
229 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
230 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
231 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
232 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
233 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
234 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
235 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
236 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
237 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
238 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
239 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
240 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
241 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
242 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
243 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
244 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
245 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
246 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
247 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
248 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
249 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
250 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
251 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
252 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
253 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
254 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
255 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
256 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
257 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
258 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
259 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
260 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
261 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
262 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
263 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
264 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
265 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
266 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
267 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
268 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
269 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
270 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
271 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
272 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
273 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
274 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
275 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
276 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
277 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
278 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
279 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
280 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
281 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
282 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
283 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
284 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
285 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
286 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
287 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
289 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
290 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
291 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
292 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
293 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
294 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
295 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
338 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
339 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
340 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
341 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
342 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
346 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
347 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
348 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
349 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
350 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
352 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
353 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
354 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
355 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
356 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
357 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
358 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
359 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
360 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
361 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
362 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
363 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
364 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
365 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
366 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
367 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
368 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
369 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
370 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
371 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
372 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
373 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
374 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
375 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
376 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
377 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
378 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
379 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
380 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
381 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
382 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
383 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
384 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
385 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
386 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
387 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
388 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
389 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
390 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
391 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
392 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
393 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
394 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
395 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
396 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
397 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
398 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
399 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
400 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
401 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
402 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
403 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
404 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
405 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
406 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
407 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
408 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
409 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
410 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
411 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
412 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
413 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
414 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
415 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
416 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
417 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
418 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
419 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
420 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
421 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
422 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
423 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
424 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
425 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
426 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
427 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
428 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
429 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
430 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
431 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
432 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
433 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
434 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
435 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
436 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
437 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
438 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
439 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
440 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
441 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
442 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
443 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
444 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
445 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
446 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
447 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
448 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
449 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
450 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
451 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
452 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
453 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
454 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
455 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
456 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
457 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
458 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
459 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
460 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
461 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
462 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
463 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
464 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
465 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
466 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
467 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
468 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
469 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
470 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
471 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
472 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
473 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
474 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
475 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
476 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
477 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
478 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
479 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
480 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
481 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
482 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
483 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
484 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
485 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
486 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
487 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
488 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
489 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
490 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
491 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
492 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
493 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
494 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
495 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
496 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
497 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
498 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
499 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
500 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
501 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
502 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
503 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
504 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
505 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
506 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
507 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
508 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
509 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
510 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
511 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
512 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
513 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
514 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
515 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
516 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
517 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
518 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
519 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
520 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
521 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
522 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
523 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
524 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
525 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
526 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
527 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
528 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
529 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
530 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
531 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
532 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
533 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
534 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
535 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
536 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
537 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
538 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
539 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
540 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
541 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
542 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
543 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
544 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
545 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
546 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
547 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
548 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
549 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
550 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
551 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
552 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
553 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
554 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
555 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
556 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
557 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
558 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
559 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
560 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
561 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
562 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
563 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
564 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
565 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
566 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
567 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
568 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
569 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
570 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
571 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
572 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
573 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
574 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
575 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
576 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
577 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
578 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
579 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
580 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
581 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
582 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
583 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
584 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
585 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
586 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
587 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
588 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
589 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
590 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
591 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
592 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
593 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
594 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
595 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
596 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
597 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.29
Metatranscriptomes 0.1
Isolates 21.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.02
Nodule 17.17
Rhizoplane 5.79
Rhizosphere 50.51
Stem 0
Stem Tuber 0
Unclassified 12.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000184 3300003203 Bacteria 28132
2 JGI25406J46586_10000336 3300003203 Bacteria 21175
3 JGI25153J46596_10000472 3300003215 Bacteria 25779
4 JGI25153J46596_10007154 3300003215 Bacteria 5535
5 JGI25153J46596_10009819 3300003215 Bacteria 4396
6 JGI25153J46596_10011461 3300003215 Bacteria 3917
7 rootH2_10185342 3300003320 Bacteria 2527
8 JGI25160J50197_1008449 3300003354 Bacteria 3921
9 JGI25160J50197_1013575 3300003354 Bacteria 2769
10 JGI25404J52841_10009355 3300003659 Bacteria 2095
11 JGI25404J52841_10013197 3300003659 Bacteria 1791
12 Ga0055524_1012750 3300003775 Bacteria 3209
13 Ga0055531_10014195 3300003794 Bacteria 3607
14 Ga0065165_1003559 3300005262 Bacteria 10766
15 Ga0065165_1003853 3300005262 Bacteria 9962
16 Ga0065165_1023466 3300005262 Bacteria 2092
17 Ga0070658_10084260 3300005327 Bacteria 2614
18 Ga0070658_10104900 3300005327 Bacteria 2338
19 Ga0070683_100009532 3300005329 Bacteria 8311
20 Ga0070683_100114038 3300005329 Bacteria 2551
21 Ga0068869_100058278 3300005334 Bacteria 2823
22 Ga0068869_100187937 3300005334 Bacteria 1623
23 Ga0070680_100044899 3300005336 Bacteria 3591
24 Ga0068868_100078904 3300005338 Bacteria 2636
25 Ga0068868_100091388 3300005338 Bacteria 2453
26 Ga0070660_100125651 3300005339 Bacteria 2049
27 Ga0070661_100156637 3300005344 Bacteria 1723
28 Ga0070668_100048788 3300005347 Bacteria 3256
29 Ga0070668_100059718 3300005347 Bacteria 2951
30 Ga0070669_100214716 3300005353 Bacteria 1519
31 Ga0070671_100004701 3300005355 Bacteria 10844
32 Ga0070671_100157974 3300005355 Bacteria 1916
33 Ga0070659_100168316 3300005366 Bacteria 1794
34 Ga0070667_100035638 3300005367 Bacteria 4170
35 Ga0070667_100238619 3300005367 Bacteria 1623
36 Ga0070709_10000102 3300005434 Bacteria 60511
37 Ga0070709_10011282 3300005434 Bacteria 4974
38 Ga0070709_10022724 3300005434 Bacteria 3673
39 Ga0070709_10047008 3300005434 Bacteria 2686
40 Ga0070714_100053595 3300005435 Bacteria 3443
41 Ga0070714_100076029 3300005435 Bacteria 2915
42 Ga0070714_100091738 3300005435 Bacteria 2662
43 Ga0070714_100096146 3300005435 Bacteria 2602
44 Ga0070713_100005904 3300005436 Bacteria 8418
45 Ga0070713_100006847 3300005436 Bacteria 7944
46 Ga0070713_100010719 3300005436 Bacteria 6637
47 Ga0070710_10002844 3300005437 Bacteria 8253
48 Ga0070710_10005257 3300005437 Bacteria 6135
49 Ga0070710_10031795 3300005437 Bacteria 2852
50 Ga0070711_100017553 3300005439 Bacteria 4559
51 Ga0070711_100033045 3300005439 Bacteria 3443
52 Ga0070705_100027569 3300005440 Bacteria 3103
53 Ga0070700_100084931 3300005441 Bacteria 2052
54 Ga0070694_100065621 3300005444 Bacteria 2487
55 Ga0070663_100028292 3300005455 Bacteria 3815
56 Ga0070663_100046444 3300005455 Bacteria 3073
57 Ga0070663_100060665 3300005455 Bacteria 2721
58 Ga0070663_100092057 3300005455 Bacteria 2247
59 Ga0070678_100067493 3300005456 Bacteria 2662
60 Ga0070678_100156222 3300005456 Bacteria 1843
61 Ga0070662_100061873 3300005457 Bacteria 2734
62 Ga0070662_100179425 3300005457 Bacteria 1668
63 Ga0070681_10009309 3300005458 Bacteria 9663
64 Ga0070681_10012590 3300005458 Bacteria 8394
65 Ga0070681_10181378 3300005458 Bacteria 2027
66 Ga0070698_100144639 3300005471 Bacteria 2328
67 Ga0070699_100175387 3300005518 Bacteria 1901
68 Ga0070679_100013660 3300005530 Bacteria 7777
69 Ga0070679_100029868 3300005530 Bacteria 5378
70 Ga0070679_100030872 3300005530 Bacteria 5294
71 Ga0070684_100003609 3300005535 Bacteria 11644
72 Ga0070684_100018139 3300005535 Bacteria 5791
73 Ga0070697_100041267 3300005536 Bacteria 3734
74 Ga0068853_100004914 3300005539 Bacteria 10405
75 Ga0068853_100213983 3300005539 Bacteria 1758
76 Ga0070672_100225250 3300005543 Bacteria 1573
77 Ga0070686_100047604 3300005544 Bacteria 2712
78 Ga0070696_100133178 3300005546 Bacteria 1811
79 Ga0070693_100138609 3300005547 Bacteria 1529
80 Ga0070693_100150468 3300005547 Bacteria 1474
81 Ga0070665_100069509 3300005548 Bacteria 3529
82 Ga0070704_100018929 3300005549 Bacteria 4416
83 Ga0070704_100243182 3300005549 Bacteria 1474
84 Ga0068855_100061729 3300005563 Bacteria 4378
85 Ga0068855_100080511 3300005563 Bacteria 3776
86 Ga0068855_100120954 3300005563 Bacteria 2996
87 Ga0068855_100144489 3300005563 Bacteria 2710
88 Ga0068855_100174262 3300005563 Bacteria 2435
89 Ga0068855_100218281 3300005563 Bacteria 2140
90 Ga0070664_100230359 3300005564 Bacteria 1660
91 Ga0068854_100011758 3300005578 Bacteria 5713
92 Ga0068854_100051014 3300005578 Bacteria 2963
93 Ga0068856_100051967 3300005614 Bacteria 4040
94 Ga0070702_100146246 3300005615 Bacteria 1511
95 Ga0068852_100027112 3300005616 Bacteria 4665
96 Ga0068852_100049957 3300005616 Bacteria 3581
97 Ga0068852_100144505 3300005616 Bacteria 2205
98 Ga0068859_100105836 3300005617 Bacteria 2872
99 Ga0068861_100056654 3300005719 Bacteria 2992
100 Ga0068858_100082338 3300005842 Bacteria 2991
101 Ga0068858_100089935 3300005842 Bacteria 2857
102 Ga0068858_100195671 3300005842 Bacteria 1910
103 Ga0068860_100071321 3300005843 Bacteria 3301
104 Ga0068862_100140859 3300005844 Bacteria 2140
105 Ga0081455_10008967 3300005937 Bacteria 10335
106 Ga0081455_10009252 3300005937 Bacteria 10148
107 Ga0081455_10025478 3300005937 Bacteria 5458
108 Ga0081455_10088942 3300005937 Bacteria 2508
109 Ga0081455_10113541 3300005937 Bacteria 2148
110 Ga0081538_10080385 3300005981 Bacteria 1739
111 Ga0081540_1001267 3300005983 Bacteria 22006
112 Ga0081540_1002872 3300005983 Bacteria 13927
113 Ga0081540_1005621 3300005983 Bacteria 9335
114 Ga0081540_1011786 3300005983 Bacteria 5814
115 Ga0081540_1023528 3300005983 Bacteria 3599
116 Ga0081540_1033892 3300005983 Bacteria 2764
117 Ga0081540_1040640 3300005983 Bacteria 2422
118 Ga0081540_1051449 3300005983 Bacteria 2037
119 Ga0081539_10000498 3300005985 Bacteria 82216
120 Ga0081539_10000616 3300005985 Bacteria 72108
121 Ga0081539_10035267 3300005985 Bacteria 3010
122 Ga0070717_10001174 3300006028 Bacteria 17704
123 Ga0070717_10145536 3300006028 Bacteria 2046
124 Ga0070717_10172338 3300006028 Bacteria 1883
125 Ga0075365_10015338 3300006038 Bacteria 4633
126 Ga0075365_10020672 3300006038 Bacteria 4087
127 Ga0075365_10040718 3300006038 Bacteria 3031
128 Ga0075363_100002023 3300006048 Bacteria 8086
129 Ga0075363_100009408 3300006048 Bacteria 4594
130 Ga0075363_100029679 3300006048 Bacteria 2825
131 Ga0075364_10005940 3300006051 Bacteria 7137
132 Ga0075364_10007239 3300006051 Bacteria 6576
133 Ga0075364_10086166 3300006051 Bacteria 2081
134 Ga0070715_10000252 3300006163 Bacteria 12883
135 Ga0070716_100003040 3300006173 Bacteria 7828
136 Ga0070712_100025518 3300006175 Bacteria 3929
137 Ga0070712_100036929 3300006175 Bacteria 3327
138 Ga0075367_10006510 3300006178 Bacteria 5905
139 Ga0075367_10040192 3300006178 Bacteria 2730
140 Ga0075367_10040661 3300006178 Bacteria 2715
141 Ga0075369_10018548 3300006186 Bacteria 2834
142 Ga0075366_10002977 3300006195 Bacteria 8823
143 Ga0097621_100047370 3300006237 Bacteria 3484
144 Ga0097621_100063211 3300006237 Bacteria 3041
145 Ga0075370_10017005 3300006353 Bacteria 3922
146 Ga0075370_10033274 3300006353 Bacteria 2886
147 Ga0075370_10044078 3300006353 Bacteria 2522
148 Ga0075370_10046929 3300006353 Bacteria 2445
149 Ga0075431_100074996 3300006847 Bacteria 3491
150 Ga0075434_100089199 3300006871 Bacteria 3085
151 Ga0075429_100000132 3300006880 Bacteria 44733
152 Ga0097620_100105836 3300006931 Bacteria 2872
153 Ga0099825_1016421 3300006941 Bacteria 6377
154 Ga0099824_1028516 3300006942 Bacteria 2519
155 Ga0099822_1048187 3300006943 Bacteria 1898
156 Ga0099795_10058226 3300007788 Bacteria 1426
157 Ga0105240_10004952 3300009093 Bacteria 20030
158 Ga0105240_10066851 3300009093 Bacteria 4458
159 Ga0105240_10174717 3300009093 Bacteria 2540
160 Ga0111539_10121232 3300009094 Bacteria 3064
161 Ga0105245_10094683 3300009098 Bacteria 2754
162 Ga0105245_10135797 3300009098 Bacteria 2311
163 Ga0105247_10005849 3300009101 Bacteria 7690
164 Ga0105247_10016255 3300009101 Bacteria 4458
165 Ga0105247_10021929 3300009101 Bacteria 3843
166 Ga0105247_10069139 3300009101 Bacteria 2203
167 Ga0105247_10084044 3300009101 Bacteria 2011
168 Ga0114129_10050862 3300009147 Bacteria 5819
169 Ga0105243_10113540 3300009148 Bacteria 2272
170 Ga0105243_10133915 3300009148 Bacteria 2106
171 Ga0105241_10037913 3300009174 Bacteria 3633
172 Ga0105241_10058874 3300009174 Bacteria 2951
173 Ga0105248_10016551 3300009177 Bacteria 8122
174 Ga0105237_10003659 3300009545 Bacteria 18128
175 Ga0105237_10004418 3300009545 Bacteria 16296
176 Ga0105237_10009663 3300009545 Bacteria 10323
177 Ga0105237_10009894 3300009545 Bacteria 10181
178 Ga0105237_10123798 3300009545 Bacteria 2580
179 Ga0105238_10041931 3300009551 Bacteria 4635
180 Ga0105238_10083394 3300009551 Bacteria 3185
181 Ga0105238_10087971 3300009551 Bacteria 3093
182 Ga0105238_10170728 3300009551 Bacteria 2150
183 Ga0105238_10371647 3300009551 Bacteria 1420
184 Ga0105249_10184315 3300009553 Bacteria 2033
185 Ga0099796_10050126 3300010159 Bacteria 1446
186 Ga0105239_10020953 3300010375 Bacteria 7212
187 Ga0105239_10035144 3300010375 Bacteria 5504
188 Ga0105239_10041301 3300010375 Bacteria 5055
189 Ga0105239_10095523 3300010375 Bacteria 3284
190 Ga0105239_10129175 3300010375 Bacteria 2809
191 Ga0105239_10142500 3300010375 Bacteria 2672
192 Ga0105239_10216194 3300010375 Bacteria 2149
193 Ga0105239_10285612 3300010375 Bacteria 1858
194 Ga0105239_10364661 3300010375 Bacteria 1632
195 Ga0105246_10001247 3300011119 Bacteria 14936
196 Ga0105246_10019166 3300011119 Bacteria 4367
197 Ga0105246_10099285 3300011119 Bacteria 2116
198 Ga0157370_10030373 3300013104 Bacteria 5295
199 Ga0157370_10065320 3300013104 Bacteria 3443
200 Ga0157369_10010593 3300013105 Bacteria 10493
201 Ga0157369_10073217 3300013105 Bacteria 3676
202 Ga0157369_10270003 3300013105 Bacteria 1773
203 Ga0157374_10071827 3300013296 Bacteria 3264
204 Ga0157374_10115183 3300013296 Bacteria 2589
205 Ga0157374_10132743 3300013296 Bacteria 2411
206 Ga0157378_10131399 3300013297 Bacteria 2318
207 Ga0157378_10247944 3300013297 Bacteria 1704
208 Ga0163162_10313414 3300013306 Bacteria 1701
209 Ga0157375_10011135 3300013308 Bacteria 7932
210 Ga0157375_10063169 3300013308 Bacteria 3682
211 Ga0157375_10267843 3300013308 Bacteria 1870
212 Ga0157375_10336175 3300013308 Bacteria 1675
213 Ga0163163_10139140 3300014325 Bacteria 2470
214 Ga0163163_10158802 3300014325 Bacteria 2306
215 Ga0163163_10254338 3300014325 Bacteria 1807
216 Ga0157377_10073748 3300014745 Bacteria 1979
217 Ga0157376_10109771 3300014969 Bacteria 2426
218 Ga0157376_10112877 3300014969 Bacteria 2395
219 Ga0157376_10138515 3300014969 Bacteria 2180
220 Ga0214544_1000002 3300021320 Bacteria 753857
221 Ga0214542_1000001 3300021321 Bacteria 1018696
222 Ga0214545_1000001 3300021324 Bacteria 1092817
223 Ga0214543_1000001 3300021327 Bacteria 776921
224 Ga0213876_10000590 3300021384 Bacteria 27043
225 Ga0213871_10017557 3300021441 Bacteria 1740
226 Ga0209677_104330 3300025253 Bacteria 4146
227 Ga0209677_106437 3300025253 Bacteria 2778
228 Ga0209148_1000356 3300025254 Bacteria 58774
229 Ga0209233_1002211 3300025261 Bacteria 7301
230 Ga0209455_1006478 3300025272 Bacteria 3448
231 Ga0209564_1001009 3300025295 Bacteria 35025
232 Ga0209564_1004524 3300025295 Bacteria 8457
233 Ga0209564_1009791 3300025295 Bacteria 4504
234 Ga0209564_1013332 3300025295 Bacteria 3504
235 Ga0209758_1000021 3300025297 Bacteria 697691
236 Ga0209758_1001565 3300025297 Bacteria 26240
237 Ga0209758_1001632 3300025297 Bacteria 25487
238 Ga0209758_1002055 3300025297 Bacteria 21535
239 Ga0209758_1002161 3300025297 Bacteria 20656
240 Ga0209758_1003008 3300025297 Bacteria 16134
241 Ga0209758_1010422 3300025297 Bacteria 5564
242 Ga0209758_1024250 3300025297 Bacteria 2709
243 Ga0209758_1046179 3300025297 Bacteria 1573
244 Ga0209256_1006522 3300025299 Bacteria 6132
245 Ga0207426_1000960 3300025302 Bacteria 28422
246 Ga0207426_1004043 3300025302 Bacteria 7425
247 Ga0209257_1002332 3300025304 Bacteria 19132
248 Ga0207697_10012252 3300025315 Bacteria 3600
249 Ga0207692_10000536 3300025898 Bacteria 13447
250 Ga0207692_10060299 3300025898 Bacteria 1962
251 Ga0207710_10017555 3300025900 Bacteria 3035
252 Ga0207688_10101608 3300025901 Bacteria 1661
253 Ga0207647_10034398 3300025904 Bacteria 3235
254 Ga0207699_10000329 3300025906 Bacteria 25152
255 Ga0207699_10004254 3300025906 Bacteria 6850
256 Ga0207699_10055637 3300025906 Bacteria 2355
257 Ga0207645_10174029 3300025907 Bacteria 1411
258 Ga0207643_10004479 3300025908 Bacteria 7509
259 Ga0207643_10115491 3300025908 Bacteria 1585
260 Ga0207707_10003700 3300025912 Bacteria 13551
261 Ga0207707_10017820 3300025912 Bacteria 6194
262 Ga0207707_10059199 3300025912 Bacteria 3333
263 Ga0207707_10123202 3300025912 Bacteria 2267
264 Ga0207695_10000015 3300025913 Bacteria 803205
265 Ga0207671_10010345 3300025914 Bacteria 7706
266 Ga0207671_10015556 3300025914 Bacteria 5952
267 Ga0207671_10029471 3300025914 Bacteria 4098
268 Ga0207693_10001037 3300025915 Bacteria 24874
269 Ga0207693_10002117 3300025915 Bacteria 17313
270 Ga0207693_10016504 3300025915 Bacteria 5900
271 Ga0207693_10027266 3300025915 Bacteria 4517
272 Ga0207663_10000301 3300025916 Bacteria 21423
273 Ga0207657_10001921 3300025919 Bacteria 22438
274 Ga0207652_10003203 3300025921 Bacteria 13599
275 Ga0207652_10006908 3300025921 Bacteria 9143
276 Ga0207652_10015612 3300025921 Bacteria 6181
277 Ga0207652_10024462 3300025921 Bacteria 5010
278 Ga0207694_10042937 3300025924 Bacteria 3489
279 Ga0207694_10068849 3300025924 Bacteria 2764
280 Ga0207694_10107515 3300025924 Bacteria 2216
281 Ga0207694_10274753 3300025924 Bacteria 1383
282 Ga0207650_10114635 3300025925 Bacteria 2091
283 Ga0207687_10054079 3300025927 Bacteria 2807
284 Ga0207687_10062521 3300025927 Bacteria 2633
285 Ga0207700_10104913 3300025928 Bacteria 2262
286 Ga0207664_10008827 3300025929 Bacteria 7049
287 Ga0207644_10031249 3300025931 Bacteria 3709
288 Ga0207644_10240176 3300025931 Bacteria 1442
289 Ga0207706_10155317 3300025933 Bacteria 2013
290 Ga0207706_10256337 3300025933 Bacteria 1527
291 Ga0207709_10027079 3300025935 Bacteria 3298
292 Ga0207670_10027910 3300025936 Bacteria 3576
293 Ga0207704_10024216 3300025938 Bacteria 3287
294 Ga0207704_10106799 3300025938 Bacteria 1881
295 Ga0207665_10000192 3300025939 Bacteria 41165
296 Ga0207665_10004009 3300025939 Bacteria 9833
297 Ga0207711_10058908 3300025941 Bacteria 3306
298 Ga0207689_10054697 3300025942 Bacteria 3286
299 Ga0207661_10002109 3300025944 Bacteria 13678
300 Ga0207667_10012927 3300025949 Bacteria 9587
301 Ga0207667_10058611 3300025949 Bacteria 4037
302 Ga0207667_10078107 3300025949 Bacteria 3431
303 Ga0207667_10143404 3300025949 Bacteria 2459
304 Ga0207712_10171530 3300025961 Bacteria 1696
305 Ga0207668_10025896 3300025972 Bacteria 3802
306 Ga0207668_10176155 3300025972 Bacteria 1682
307 Ga0207640_10067664 3300025981 Bacteria 2391
308 Ga0207640_10121675 3300025981 Bacteria 1871
309 Ga0207677_10013741 3300026023 Bacteria 4701
310 Ga0207677_10206025 3300026023 Bacteria 1567
311 Ga0207678_10006923 3300026067 Bacteria 10061
312 Ga0207678_10016384 3300026067 Bacteria 6508
313 Ga0207678_10022701 3300026067 Bacteria 5496
314 Ga0207678_10066350 3300026067 Bacteria 3099
315 Ga0207678_10066781 3300026067 Bacteria 3088
316 Ga0207678_10069814 3300026067 Bacteria 3012
317 Ga0207678_10092941 3300026067 Bacteria 2578
318 Ga0207708_10080938 3300026075 Bacteria 2496
319 Ga0207702_10000442 3300026078 Bacteria 47074
320 Ga0207702_10121254 3300026078 Bacteria 2340
321 Ga0207702_10132952 3300026078 Bacteria 2241
322 Ga0207702_10305768 3300026078 Bacteria 1510
323 Ga0207641_10212686 3300026088 Bacteria 1789
324 Ga0207674_10054183 3300026116 Bacteria 4085
325 Ga0207674_10186565 3300026116 Bacteria 2024
326 Ga0207675_100058151 3300026118 Bacteria 3608
327 Ga0207675_100139309 3300026118 Bacteria 2304
328 Ga0207683_10059450 3300026121 Bacteria 3357
329 Ga0207683_10073369 3300026121 Bacteria 3027
330 Ga0207683_10073884 3300026121 Bacteria 3016
331 Ga0207683_10119960 3300026121 Bacteria 2360
332 Ga0207683_10183071 3300026121 Bacteria 1900
333 Ga0207698_10012058 3300026142 Bacteria 5636
334 Ga0207698_10019664 3300026142 Bacteria 4629
335 Ga0209389_1000008 3300027296 Bacteria 227385
336 Ga0209389_1000121 3300027296 Bacteria 70490
337 Ga0209589_1002735 3300027357 Bacteria 30739
338 Ga0209489_103445 3300027361 Bacteria 30849
339 Ga0209489_108921 3300027361 Bacteria 13078
340 Ga0209700_100036 3300027363 Bacteria 187888
341 Ga0207428_10216341 3300027907 Bacteria 1438
342 Ga0268266_10000908 3300028379 Bacteria 38174
343 Ga0268266_10024076 3300028379 Bacteria 5181
344 Ga0268265_10239314 3300028380 Bacteria 1600
345 Ga0268264_10000043 3300028381 Bacteria 371761
346 Ga0268264_10094816 3300028381 Bacteria 2581
347 Ga0265337_1004905 3300028556 Bacteria 5450
348 Ga0265326_10010973 3300028558 Bacteria 2681
349 Ga0265334_10010788 3300028573 Bacteria 3857
350 Ga0265336_10001480 3300028666 Bacteria 10665
351 Ga0265338_10021085 3300028800 Bacteria 6812
352 Ga0265760_10038306 3300031090 Bacteria 1425
353 Ga0265330_10014850 3300031235 Bacteria 3610
354 Ga0265330_10040965 3300031235 Bacteria 2055
355 Ga0265340_10010814 3300031247 Bacteria 4873
356 Ga0265339_10001608 3300031249 Bacteria 16708
357 Ga0265331_10064937 3300031250 Bacteria 1717
358 Ga0307513_10051435 3300031456 Bacteria 4445
359 Ga0307508_10000804 3300031616 Bacteria 36884
360 Ga0265342_10031018 3300031712 Bacteria 3308
361 Ga0307516_10007456 3300031730 Bacteria 12580
362 Ga0307516_10115914 3300031730 Bacteria 2475
363 Ga0307405_10068232 3300031731 Bacteria 2275
364 Ga0307413_10051937 3300031824 Bacteria 2473
365 Ga0307406_10145612 3300031901 Bacteria 1683
366 Ga0307416_100327268 3300032002 Bacteria 1538
367 Ga0307411_10075982 3300032005 Bacteria 2295
368 Ga0307415_100020529 3300032126 Bacteria 4036
369 Ga0307510_10005974 3300033180 Bacteria 14526
370 Ga0315911_1000001 3300033442 Bacteria 1088602
371 Ga0373953_0000341 3300035117 Bacteria 12562
372 Ga0373954_0007912 3300035118 Bacteria 4655
373 Ga0373956_0001242 3300035119 Bacteria 10553
374 Ga0373956_0021183 3300035119 Bacteria 2771
375 Ga0373943_0001453 3300035170 Bacteria 10708
376 Ga0373946_0043256 3300035171 Bacteria 1855
377 Ga0373955_0001173 3300035172 Bacteria 11136
378 Ga0373955_0031752 3300035172 Bacteria 2768
379 Ga0373931_0000842 3300035691 Bacteria 12897
380 Ga0373935_0000674 3300035692 Bacteria 18014
381 Ga0373935_0201618 3300035692 Bacteria 1375
382 Ga0373927_0001261 3300035695 Bacteria 19204
383 Ga0373927_0047842 3300035695 Bacteria 2766
384 Ga0373933_0000475 3300035724 Bacteria 25100
385 Ga0373933_0002955 3300035724 Bacteria 9482
386 Ga0373933_0112380 3300035724 Bacteria 1700
387 Ga0373947_0008138 3300035725 Bacteria 6045
388 Ga0373937_0000939 3300036401 Bacteria 24742
389 Ga0373937_0066085 3300036401 Bacteria 3329
390 Ga0373937_0097512 3300036401 Bacteria 2727
391 Ga0373925_0014285 3300037068 Bacteria 5745
392 Ga0373925_0095313 3300037068 Bacteria 2279
393 Ga0373925_0185017 3300037068 Bacteria 1651
394 Ga0395899_0016993 3300037312 Bacteria 5545
395 Ga0395900_0000361 3300037418 Bacteria 65918
396 Ga0395900_0302847 3300037418 Bacteria 1584
397 Ga0395898_0076112 3300037466 Bacteria 3241
398 Ga0395898_0104858 3300037466 Bacteria 2711
399 Ga0395905_0005448 3300037471 Bacteria 12989
400 Ga0395905_0013311 3300037471 Bacteria 7887
401 Ga0395905_0019208 3300037471 Bacteria 6481
402 Ga0395905_0286430 3300037471 Bacteria 1534
403 Ga0436365_0209497 3300039437 Bacteria 14782
404 Ga0436365_0388031 3300039437 Bacteria 2051
405 Ga0436360_0661734 3300039438 Bacteria 5272
406 Ga0436361_0037682 3300039447 Bacteria 4855
407 Ga0436363_0599741 3300039450 Bacteria 1276
408 Ga0436362_0191008 3300039453 Bacteria 2563
409 Ga0451853_2946802 3300041512 Bacteria 1469
410 Ga0466972_0000271 3300044658 Bacteria 32697
411 Ga0466972_0004782 3300044658 Bacteria 6785
412 Ga0466965_0021010 3300044683 Bacteria 3140
413 Ga0466966_0001434 3300044684 Bacteria 15335
414 Ga0466961_0000859 3300044693 Bacteria 18957
415 Ga0466964_0092781 3300044706 Bacteria 1317
416 Ga0466968_0006041 3300044735 Bacteria 4546
417 Ga0466957_0017976 3300044842 Bacteria 4147
418 Ga0466957_0181271 3300044842 Bacteria 1376
419 Ga0466960_0030663 3300044901 Bacteria 2476
420 Ga0466960_0035372 3300044901 Bacteria 2334
421 Ga0466959_0021119 3300045049 Bacteria 4800
422 Ga0466967_0074195 3300045976 Bacteria 3054
423 Ga0495592_0000290 3300046454 Bacteria 42996
424 Ga0495592_0036269 3300046454 Bacteria 3714
425 Ga0495592_0040196 3300046454 Bacteria 3510
426 Ga0495603_0000616 3300046455 Bacteria 19946
427 Ga0495603_0006838 3300046455 Bacteria 6843
428 Ga0495629_0000176 3300046459 Bacteria 56922
429 Ga0495629_0004741 3300046459 Bacteria 10187
430 Ga0495629_0186278 3300046459 Bacteria 1437
431 Ga0495638_0022055 3300046460 Bacteria 4184
432 Ga0495638_0026815 3300046460 Bacteria 3733
433 Ga0495641_0007040 3300046461 Bacteria 7130
434 Ga0495651_0000756 3300046462 Bacteria 24989
435 Ga0495651_0014893 3300046462 Bacteria 6012
436 Ga0495651_0110169 3300046462 Bacteria 2037
437 Ga0495651_0159037 3300046462 Bacteria 1620
438 Ga0495653_0000437 3300046463 Bacteria 32802
439 Ga0495653_0104777 3300046463 Bacteria 2043
440 Ga0495580_0031138 3300046472 Bacteria 3858
441 Ga0495582_0007557 3300046473 Bacteria 6012
442 Ga0495662_0000028 3300046476 Bacteria 51556
443 Ga0495664_0042170 3300046477 Bacteria 2702
444 Ga0495594_0000020 3300046499 Bacteria 80534
445 Ga0495607_0026823 3300046501 Bacteria 3570
446 Ga0495606_0001226 3300046507 Bacteria 35910
447 Ga0495606_0029416 3300046507 Bacteria 3857
448 Ga0495606_0091769 3300046507 Bacteria 1867
449 Ga0495608_0003577 3300046511 Bacteria 11141
450 Ga0495608_0019187 3300046511 Bacteria 4709
451 Ga0495608_0058675 3300046511 Bacteria 2537
452 Ga0495610_0045938 3300046512 Bacteria 2158
453 Ga0495616_0055999 3300046513 Bacteria 1949
454 Ga0495618_0102678 3300046514 Bacteria 1830
455 Ga0495628_0007919 3300046516 Bacteria 9154
456 Ga0495628_0017267 3300046516 Bacteria 6009
457 Ga0495628_0070005 3300046516 Bacteria 2735
458 Ga0495630_0059526 3300046517 Bacteria 2866
459 Ga0495637_0019276 3300046520 Bacteria 3156
460 Ga0495643_0042337 3300046522 Bacteria 2481
461 Ga0495644_0022395 3300046523 Bacteria 2408
462 Ga0495648_0000843 3300046524 Bacteria 32321
463 Ga0495648_0001140 3300046524 Bacteria 26907
464 Ga0495648_0059059 3300046524 Bacteria 2290
465 Ga0495666_0043234 3300046526 Bacteria 2177
466 Ga0495652_0032669 3300046529 Bacteria 4549
467 Ga0495652_0063119 3300046529 Bacteria 3120
468 Ga0495652_0125161 3300046529 Bacteria 2043
469 Ga0495654_0008249 3300046530 Bacteria 5764
470 Ga0495665_0000057 3300046531 Bacteria 44876
471 Ga0495665_0025930 3300046531 Bacteria 3148
472 Ga0495640_0001737 3300046533 Bacteria 17271
473 Ga0495640_0004570 3300046533 Bacteria 11032
474 Ga0495640_0042774 3300046533 Bacteria 3158
475 Ga0495587_0004432 3300046536 Bacteria 9248
476 Ga0495587_0017003 3300046536 Bacteria 4522
477 Ga0495587_0046610 3300046536 Bacteria 2572
478 Ga0495622_0049072 3300046557 Bacteria 1960
479 Ga0495633_0029330 3300046558 Bacteria 2677
480 Ga0495667_0001700 3300046559 Bacteria 14618
481 Ga0495667_0032862 3300046559 Bacteria 3473
482 Ga0495656_0001311 3300046615 Bacteria 8098
483 Ga0495656_0012780 3300046615 Bacteria 3107
484 Ga0495656_0028118 3300046615 Bacteria 2253
485 Ga0495668_0046384 3300046616 Bacteria 2414
486 Ga0495634_0004094 3300046642 Bacteria 11548
487 Ga0495634_0054602 3300046642 Bacteria 2673
488 Ga0495634_0090014 3300046642 Bacteria 1994
489 Ga0495634_0149963 3300046642 Bacteria 1475
490 Ga0495611_0041774 3300046648 Bacteria 2046
491 Ga0495625_0159272 3300046660 Bacteria 1513
492 Ga0495635_0000276 3300046663 Bacteria 32999
493 Ga0495635_0001593 3300046663 Bacteria 15272
494 Ga0495635_0029431 3300046663 Bacteria 3819
495 Ga0495659_0007697 3300046664 Bacteria 3415
496 Ga0495661_0011562 3300046665 Bacteria 5985
497 Ga0495588_0021350 3300046674 Bacteria 3190
498 Ga0495657_0000218 3300046675 Bacteria 51627
499 Ga0495657_0053555 3300046675 Bacteria 2699
500 Ga0495599_0000775 3300046678 Bacteria 17973
501 Ga0495599_0045761 3300046678 Bacteria 2744
502 Ga0495623_0001412 3300046679 Bacteria 16279
503 Ga0495623_0011483 3300046679 Bacteria 5734
504 Ga0495623_0019902 3300046679 Bacteria 4339
505 Ga0495646_0055702 3300046680 Bacteria 2373
506 Ga0495646_0089917 3300046680 Bacteria 1775
507 Ga0495647_0003084 3300046681 Bacteria 5321
508 Ga0495658_0000461 3300046683 Bacteria 22556
509 Ga0495669_0012577 3300046684 Bacteria 3604
510 Ga0495669_0064849 3300046684 Bacteria 1657
511 Ga0495613_0006727 3300046689 Bacteria 8583
512 Ga0495613_0033158 3300046689 Bacteria 3838
513 Ga0495624_0002019 3300046690 Bacteria 15457
514 Ga0495624_0047452 3300046690 Bacteria 2729
515 Ga0495600_0000276 3300046809 Bacteria 27996
516 Ga0495600_0007598 3300046809 Bacteria 6640
517 Ga0495600_0013420 3300046809 Bacteria 5148
518 Ga0495600_0050621 3300046809 Bacteria 2711
519 Ga0495600_0084976 3300046809 Bacteria 2065
520 Ga0495660_0015170 3300046810 Bacteria 4454
521 Ga0495581_0017517 3300047315 Bacteria 4161
522 Ga0495604_0003092 3300047317 Bacteria 13315
523 Ga0495604_0041925 3300047317 Bacteria 3588
524 Ga0495604_0051921 3300047317 Bacteria 3176
525 Ga0495604_0163189 3300047317 Bacteria 1573
526 Ga0495604_0171877 3300047317 Bacteria 1523
527 Ga0495674_0003938 3300047319 Bacteria 14403
528 Ga0495674_0027657 3300047319 Bacteria 5180
529 Ga0495674_0235689 3300047319 Bacteria 1509
530 Ga0495672_0018828 3300047320 Bacteria 4573
531 Ga0495680_0000955 3300047322 Bacteria 32123
532 Ga0495680_0022137 3300047322 Bacteria 5306
533 Ga0495680_0027520 3300047322 Bacteria 4669
534 Ga0495683_0092315 3300047323 Bacteria 1465
535 Ga0495675_0000603 3300047444 Bacteria 23136
536 Ga0495675_0052049 3300047444 Bacteria 2600
537 Ga0495684_0000023 3300047471 Bacteria 133626
538 Ga0495684_0024873 3300047471 Bacteria 4605
539 Ga0495686_0024768 3300047472 Bacteria 3939
540 Ga0495686_0089296 3300047472 Bacteria 1873
541 Ga0495593_0000165 3300047673 Bacteria 33774
542 Ga0495593_0000193 3300047673 Bacteria 32074
543 Ga0495593_0065045 3300047673 Bacteria 1902
544 Ga0495602_0007460 3300048088 Bacteria 11440
545 Ga0495602_0020088 3300048088 Bacteria 6607
546 Ga0495602_0030792 3300048088 Bacteria 5084
547 Ga0495602_0106403 3300048088 Bacteria 2290
548 Ga0495602_0158161 3300048088 Bacteria 1772
549 Ga0495614_0019552 3300048089 Bacteria 2931
550 Ga0496101_0016777 3300048904 Bacteria 4957
551 Ga0496102_0009493 3300048905 Bacteria 8365
552 Ga0496102_0029666 3300048905 Bacteria 4895
553 Ga0496102_0040342 3300048905 Bacteria 4222
554 Ga0496102_0229331 3300048905 Bacteria 1751
555 Ga0496103_0007167 3300048906 Bacteria 6650
556 Ga0496103_0021773 3300048906 Bacteria 3858
557 Ga0496103_0040592 3300048906 Bacteria 2859
558 Ga0496104_0010283 3300048907 Bacteria 8355
559 Ga0496104_0010601 3300048907 Bacteria 8232
560 Ga0496104_0147787 3300048907 Bacteria 2257
561 Ga0496104_0151914 3300048907 Bacteria 2222
562 Ga0496105_0000723 3300048908 Bacteria 22379
563 Ga0496105_0004107 3300048908 Bacteria 10912
564 Ga0496105_0006361 3300048908 Bacteria 9071
565 Ga0496105_0057180 3300048908 Bacteria 3221
566 Ga0496105_0219052 3300048908 Bacteria 1550
567 Ga0496106_0000363 3300048909 Bacteria 32218
568 Ga0496106_0005109 3300048909 Bacteria 9722
569 Ga0496106_0011404 3300048909 Bacteria 6577
570 Ga0496106_0067366 3300048909 Bacteria 2729
571 Ga0496106_0075342 3300048909 Bacteria 2584
572 Ga0496107_0007846 3300048910 Bacteria 7370
573 Ga0496107_0011212 3300048910 Bacteria 6238
574 Ga0496108_0000864 3300048911 Bacteria 23664
575 Ga0496108_0009868 3300048911 Bacteria 7738
576 Ga0496108_0022827 3300048911 Bacteria 5148
577 Ga0496108_0058747 3300048911 Bacteria 3233
578 Ga0496108_0176073 3300048911 Bacteria 1852
579 Ga0496108_0188820 3300048911 Bacteria 1785
580 Ga0496109_0010326 3300048912 Bacteria 7974
581 Ga0496109_0022146 3300048912 Bacteria 5625
582 Ga0496109_0026426 3300048912 Bacteria 5177
583 Ga0496109_0058468 3300048912 Bacteria 3522
584 Ga0496109_0105934 3300048912 Bacteria 2612
585 Ga0496109_0112246 3300048912 Bacteria 2535
586 Ga0496110_0011326 3300048913 Bacteria 7295
587 Ga0496110_0034431 3300048913 Bacteria 4387
588 Ga0496111_0049335 3300048914 Bacteria 3035
589 Ga0496112_0000031 3300048915 Bacteria 120022
590 Ga0496112_0002164 3300048915 Bacteria 15617
591 Ga0496112_0007314 3300048915 Bacteria 9793
592 Ga0496112_0017574 3300048915 Bacteria 6723
593 Ga0496112_0020901 3300048915 Bacteria 6213
594 Ga0496112_0134156 3300048915 Bacteria 2446
595 Ga0496112_0374843 3300048915 Bacteria 1364
596 Ga0496113_0005785 3300048916 Bacteria 7752
597 Ga0496113_0066893 3300048916 Bacteria 2723
598 Ga0496113_0085599 3300048916 Bacteria 2421
599 Ga0496113_0171863 3300048916 Bacteria 1716
600 Ga0496114_0009385 3300048917 Bacteria 7768
601 Ga0496114_0110369 3300048917 Bacteria 2356
602 Ga0496114_0200041 3300048917 Bacteria 1750
603 Ga0496114_0303766 3300048917 Bacteria 1409
604 Ga0496115_0012752 3300048918 Bacteria 6336
605 Ga0496115_0181715 3300048918 Bacteria 1738
606 Ga0496116_0003452 3300048919 Bacteria 15598
607 Ga0496116_0015358 3300048919 Bacteria 6056
608 Ga0496117_0016367 3300048920 Bacteria 6261
609 Ga0496117_0017616 3300048920 Bacteria 5959
610 Ga0496117_0037483 3300048920 Bacteria 3611
611 Ga0496117_0055425 3300048920 Bacteria 2770
612 Ga0496117_0058908 3300048920 Bacteria 2657
613 Ga0496117_0082195 3300048920 Bacteria 2111
614 Ga0496118_0002080 3300048921 Bacteria 28152
615 Ga0496118_0014018 3300048921 Bacteria 7529
616 Ga0496118_0055661 3300048921 Bacteria 2982
617 Ga0496118_0065142 3300048921 Bacteria 2668
618 Ga0496118_0066231 3300048921 Bacteria 2638
619 Ga0496118_0119126 3300048921 Bacteria 1727
620 Ga0496118_0160122 3300048921 Bacteria 1393
621 Ga0496119_0015145 3300048922 Bacteria 5967
622 Ga0496119_0025227 3300048922 Bacteria 4157
623 Ga0496119_0108714 3300048922 Bacteria 1543
624 Ga0496120_0008406 3300048923 Bacteria 7493
625 Ga0496121_0000183 3300048924 Bacteria 139168
626 Ga0496121_0000407 3300048924 Bacteria 85728
627 Ga0496121_0007107 3300048924 Bacteria 13589
628 Ga0496121_0016722 3300048924 Bacteria 7548
629 Ga0496121_0024365 3300048924 Bacteria 5789
630 Ga0496121_0033967 3300048924 Bacteria 4602
631 Ga0496121_0055635 3300048924 Bacteria 3294
632 Ga0496121_0070768 3300048924 Bacteria 2808
633 Ga0496121_0090672 3300048924 Bacteria 2389
634 Ga0496121_0135072 3300048924 Bacteria 1839
635 Ga0496122_0071410 3300048925 Bacteria 2474
636 Ga0496122_0103444 3300048925 Bacteria 1895
637 Ga0496122_0147682 3300048925 Bacteria 1458
638 Ga0496123_0016093 3300048926 Bacteria 6094
639 Ga0496123_0062021 3300048926 Bacteria 2398
640 Ga0496124_0016544 3300048927 Bacteria 7003
641 Ga0496124_0154946 3300048927 Bacteria 1793
642 Ga0496125_0000090 3300048928 Bacteria 214433
643 Ga0496125_0001219 3300048928 Bacteria 38596
644 Ga0496125_0013265 3300048928 Bacteria 8110
645 Ga0496125_0019582 3300048928 Bacteria 6377
646 Ga0496125_0032940 3300048928 Bacteria 4594
647 Ga0496125_0033676 3300048928 Bacteria 4529
648 Ga0496126_0001554 3300048929 Bacteria 35268
649 Ga0496126_0006937 3300048929 Bacteria 12540
650 Ga0496126_0009113 3300048929 Bacteria 10595
651 Ga0496126_0015750 3300048929 Bacteria 7597
652 Ga0496126_0039511 3300048929 Bacteria 4377
653 Ga0496126_0058272 3300048929 Bacteria 3482
654 Ga0496126_0059868 3300048929 Bacteria 3428
655 Ga0496126_0068780 3300048929 Bacteria 3160
656 Ga0496126_0092193 3300048929 Bacteria 2662
657 Ga0496126_0112364 3300048929 Bacteria 2372
658 Ga0496126_0138020 3300048929 Bacteria 2101
659 Ga0496126_0149120 3300048929 Bacteria 2006
660 Ga0501034_0057589 3300049571 Bacteria 3907
661 Ga0501046_0039052 3300049580 Bacteria 3805
662 Ga0501047_0021187 3300049581 Bacteria 6242
663 Ga0501070_0024056 3300049586 Bacteria 5107
664 Ga0501074_0028751 3300049590 Bacteria 4027
665 Ga0501080_0022340 3300049742 Bacteria 5860
666 Ga0501035_0072507 3300049822 Bacteria 3048
667 Ga0501044_0013127 3300049823 Bacteria 8968
668 Ga0501044_0140993 3300049823 Bacteria 2399
669 nmdc:mga03n38_174_c1 3300050490 Bacteria 14331
670 nmdc:mga00v17_86593_c1 3300050491 Bacteria 1963
671 nmdc:mga0yw44_1291_c1 3300050492 Bacteria 9896
672 nmdc:mga0yw44_7776_c1 3300050492 Bacteria 5299
673 nmdc:mga0yw44_9410_c1 3300050492 Bacteria 4939
674 nmdc:mga0k408_30969_c1 3300050493 Bacteria 3052
675 nmdc:mga0k408_70060_c1 3300050493 Bacteria 2047
676 nmdc:mga06z11_5916_c1 3300050494 Bacteria 4942
677 nmdc:mga07m45_17273_c1 3300050496 Bacteria 3872
678 nmdc:mga07m45_33961_c1 3300050496 Bacteria 2834
679 nmdc:mga07m45_93681_c1 3300050496 Bacteria 1722
680 nmdc:mga05p37_9508_c1 3300050507 Bacteria 11511
681 nmdc:mga09592_1568_c1 3300050508 Bacteria 18391
682 nmdc:mga0qj67_121052_c1 3300050509 Bacteria 2117
683 nmdc:mga06r32_21476_c1 3300050510 Bacteria 5959
684 nmdc:mga08y16_224811_c1 3300050511 Bacteria 1942
685 nmdc:mga0n895_124296_c1 3300050512 Bacteria 2603
686 nmdc:mga0n895_234549_c1 3300050512 Bacteria 1862
687 nmdc:mga0rr50_121048_c1 3300050513 Bacteria 2083
688 nmdc:mga0a205_304703_c1 3300050515 Bacteria 1465
689 nmdc:mga0sz30_2779_c1 3300050516 Bacteria 6245
690 Ga0495601_0110534 3300053077 Bacteria 1780
691 Ga0500635_0002899 3300053080 Bacteria 4268
692 Ga0500635_0017317 3300053080 Bacteria 2156
693 Ga0495655_0011671 3300053083 Bacteria 1772
694 Ga0495619_0000111 3300053085 Bacteria 61304
695 Ga0495619_0015570 3300053085 Bacteria 4812
696 Ga0495619_0155705 3300053085 Bacteria 1577
697 Ga0500578_0049948 3300053086 Bacteria 2683
698 Ga0500643_000015 3300053087 Bacteria 310312
699 Ga0500644_0031506 3300053088 Bacteria 1686
700 Ga0500581_084177 3300053089 Bacteria 1584
701 Ga0500646_0005404 3300053090 Bacteria 3233
702 Ga0500646_0024811 3300053090 Bacteria 1616
703 Ga0500583_0012287 3300053092 Bacteria 3260
704 Ga0500651_0001806 3300053093 Bacteria 10963
705 Ga0500651_0005132 3300053093 Bacteria 7449
706 Ga0500566_0000164 3300053094 Bacteria 33959
707 Ga0500566_0001312 3300053094 Bacteria 14507
708 Ga0500566_0003015 3300053094 Bacteria 10070
709 Ga0500640_023116 3300053095 Bacteria 2690
710 Ga0500641_0006524 3300053096 Bacteria 4138
711 Ga0500650_0035637 3300053098 Bacteria 2280
712 Ga0500554_000672 3300053102 Bacteria 6929
713 Ga0500555_002428 3300053103 Bacteria 5405
714 Ga0500556_0000004 3300053104 Bacteria 666287
715 Ga0500556_0059293 3300053104 Bacteria 1405
716 Ga0500557_000110 3300053105 Bacteria 23691
717 Ga0500572_000432 3300053111 Bacteria 14752
718 Ga0500572_001734 3300053111 Bacteria 5660
719 Ga0500592_000312 3300053116 Bacteria 8332
720 Ga0500592_003427 3300053116 Bacteria 2533
721 Ga0500595_001401 3300053119 Bacteria 12942
722 Ga0500595_001778 3300053119 Bacteria 11218
723 Ga0500595_019193 3300053119 Bacteria 2485
724 Ga0500607_032628 3300053121 Bacteria 2857
725 Ga0500607_053181 3300053121 Bacteria 2147
726 Ga0500608_001947 3300053122 Bacteria 7386
727 Ga0500614_000855 3300053123 Bacteria 7677
728 Ga0500642_0000036 3300053130 Bacteria 104249
729 Ga0500642_0000086 3300053130 Bacteria 48427
730 Ga0500642_0070172 3300053130 Bacteria 1592
731 Ga0500652_000506 3300053131 Bacteria 13706
732 Ga0500559_0000381 3300053136 Bacteria 32402
733 Ga0500559_0001772 3300053136 Bacteria 11842
734 Ga0500559_0004916 3300053136 Bacteria 6223
735 Ga0500559_0015884 3300053136 Bacteria 3178
736 Ga0500559_0025315 3300053136 Bacteria 2525
737 Ga0500568_0000556 3300053139 Bacteria 27442
738 Ga0500568_0001659 3300053139 Bacteria 13967
739 Ga0500568_0008824 3300053139 Bacteria 4833
740 Ga0500568_0027954 3300053139 Bacteria 2355
741 Ga0500577_0000074 3300053142 Bacteria 23109
742 Ga0500589_071695 3300053147 Bacteria 1565
743 Ga0500603_000674 3300053150 Bacteria 8318
744 Ga0500603_002103 3300053150 Bacteria 4408
745 Ga0500604_0002050 3300053151 Bacteria 5559
746 Ga0500604_0006501 3300053151 Bacteria 3092
747 Ga0500616_0000014 3300053153 Bacteria 637918
748 Ga0500622_0008898 3300053156 Bacteria 5589
749 Ga0500622_0010430 3300053156 Bacteria 5099
750 Ga0500622_0071977 3300053156 Bacteria 1746
751 Ga0500627_0014140 3300053158 Bacteria 3049
752 Ga0500627_0019817 3300053158 Bacteria 2687
753 Ga0500630_002325 3300053159 Bacteria 9178
754 Ga0500638_005986 3300053162 Bacteria 4923
755 Ga0500638_025986 3300053162 Bacteria 2802
756 Ga0500639_000001 3300053163 Bacteria 244795
757 Ga0500636_0000151 3300053177 Bacteria 35998
758 Ga0500636_0004887 3300053177 Bacteria 7608
759 Ga0500636_0043275 3300053177 Bacteria 2659
760 Ga0500637_0000379 3300053178 Bacteria 16832
761 Ga0500637_0001765 3300053178 Bacteria 9335
762 Ga0500637_0109008 3300053178 Bacteria 1606
763 Ga0500625_000186 3300053729 Bacteria 13797
764 Ga0500645_012939 3300053730 Bacteria 2687
765 Ga0500599_000262 3300053736 Bacteria 5043
766 Ga0500601_000153 3300053737 Bacteria 14318
767 Ga0500661_001344 3300055283 Bacteria 4586
768 Ga0500661_005340 3300055283 Bacteria 2404
769 Ga0500661_010983 3300055283 Bacteria 1643

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005549 Ga0070704_100243182 Ga0070704_1002431822 315
2 3300046513 Ga0495616_0055999 Ga0495616_0055999_849_1904 315
3 3300006847 Ga0075431_100074996 Ga0075431_1000749963 330
4 3300006880 Ga0075429_100000132 Ga0075429_10000013212 330
5 3300009147 Ga0114129_10050862 Ga0114129_100508624 330
6 3300050507 nmdc:mga05p37_9508_c1 nmdc:mga05p37_9508_c1_3562_4782 330
7 3300050508 nmdc:mga09592_1568_c1 nmdc:mga09592_1568_c1_2645_3865 330
8 3300050510 nmdc:mga06r32_21476_c1 nmdc:mga06r32_21476_c1_1854_3074 330
9 3300005440 Ga0070705_100027569 Ga0070705_1000275693 331
10 3300005444 Ga0070694_100065621 Ga0070694_1000656212 331
11 3300005549 Ga0070704_100018929 Ga0070704_1000189295 331
12 3300026121 Ga0207683_10073884 Ga0207683_100738844 350
13 3300031090 Ga0265760_10038306 Ga0265760_100383061 351
14 3300046557 Ga0495622_0049072 Ga0495622_0049072_42_1199 351
15 3300053083 Ga0495655_0011671 Ga0495655_0011671_24_1175 353
16 3300053150 Ga0500603_002103 Ga0500603_002103_1356_2606 356
17 3300053178 Ga0500637_0001765 Ga0500637_0001765_1152_2402 356
18 3300053089 Ga0500581_084177 Ga0500581_084177_315_1547 357
19 iso_pu_bacteria 8016522445 8016529708 359
20 3300010375 Ga0105239_10285612 Ga0105239_102856122 360
21 3300013105 Ga0157369_10073217 Ga0157369_100732172 362
22 3300035692 Ga0373935_0201618 Ga0373935_0201618_55_1302 362
23 3300037068 Ga0373925_0014285 Ga0373925_0014285_2663_3910 362
24 3300028556 Ga0265337_1004905 Ga0265337_10049052 363
25 3300028558 Ga0265326_10010973 Ga0265326_100109732 363
26 3300028666 Ga0265336_10001480 Ga0265336_100014804 363
27 3300028800 Ga0265338_10021085 Ga0265338_100210852 363
28 3300035724 Ga0373933_0000475 Ga0373933_0000475_14775_16022 364
29 3300048924 Ga0496121_0033967 Ga0496121_0033967_3404_4561 366
30 3300006038 Ga0075365_10020672 Ga0075365_100206724 367
31 3300046455 Ga0495603_0006838 Ga0495603_0006838_1670_2920 367
32 3300049822 Ga0501035_0072507 Ga0501035_0072507_67_1236 367
33 3300053080 Ga0500635_0002899 Ga0500635_0002899_1384_2634 367
34 3300053102 Ga0500554_000672 Ga0500554_000672_773_2023 367
35 3300005518 Ga0070699_100175387 Ga0070699_1001753872 368
36 3300005546 Ga0070696_100133178 Ga0070696_1001331782 368
37 3300005547 Ga0070693_100150468 Ga0070693_1001504681 368
38 3300014969 Ga0157376_10138515 Ga0157376_101385152 368
39 3300025261 Ga0209233_1002211 Ga0209233_10022115 368
40 3300037471 Ga0395905_0005448 Ga0395905_0005448_4067_5350 368
41 3300048908 Ga0496105_0219052 Ga0496105_0219052_88_1335 368
42 3300048924 Ga0496121_0135072 Ga0496121_0135072_112_1359 368
43 3300003215 JGI25153J46596_10009819 JGI25153J46596_100098192 369
44 3300005347 Ga0070668_100059718 Ga0070668_1000597182 369
45 3300005367 Ga0070667_100238619 Ga0070667_1002386192 369
46 3300005435 Ga0070714_100096146 Ga0070714_1000961462 369
47 3300005455 Ga0070663_100046444 Ga0070663_1000464442 369
48 3300005456 Ga0070678_100067493 Ga0070678_1000674932 369
49 3300005543 Ga0070672_100225250 Ga0070672_1002252501 369
50 3300005547 Ga0070693_100138609 Ga0070693_1001386091 369
51 3300005548 Ga0070665_100069509 Ga0070665_1000695093 369
52 3300005563 Ga0068855_100144489 Ga0068855_1001444892 369
53 3300005719 Ga0068861_100056654 Ga0068861_1000566542 369
54 3300005842 Ga0068858_100195671 Ga0068858_1001956712 369
55 3300005844 Ga0068862_100140859 Ga0068862_1001408592 369
56 3300006048 Ga0075363_100002023 Ga0075363_1000020236 369
57 3300006178 Ga0075367_10006510 Ga0075367_100065104 369
58 3300006353 Ga0075370_10033274 Ga0075370_100332742 369
59 3300006353 Ga0075370_10044078 Ga0075370_100440783 369
60 3300013306 Ga0163162_10313414 Ga0163162_103134142 369
61 3300025253 Ga0209677_104330 Ga0209677_1043303 369
62 3300025924 Ga0207694_10042937 Ga0207694_100429372 369
63 3300025972 Ga0207668_10025896 Ga0207668_100258962 369
64 3300026023 Ga0207677_10206025 Ga0207677_102060252 369
65 3300026067 Ga0207678_10006923 Ga0207678_100069232 369
66 3300026118 Ga0207675_100058151 Ga0207675_1000581512 369
67 3300026121 Ga0207683_10059450 Ga0207683_100594502 369
68 3300028379 Ga0268266_10000908 Ga0268266_100009088 369
69 3300028379 Ga0268266_10024076 Ga0268266_100240762 369
70 3300028380 Ga0268265_10239314 Ga0268265_102393142 369
71 3300031730 Ga0307516_10115914 Ga0307516_101159142 369
72 3300031731 Ga0307405_10068232 Ga0307405_100682322 369
73 3300031824 Ga0307413_10051937 Ga0307413_100519371 369
74 3300032005 Ga0307411_10075982 Ga0307411_100759822 369
75 3300032126 Ga0307415_100020529 Ga0307415_1000205292 369
76 3300037466 Ga0395898_0076112 Ga0395898_0076112_803_2074 369
77 3300037471 Ga0395905_0013311 Ga0395905_0013311_5557_6822 369
78 3300046507 Ga0495606_0029416 Ga0495606_0029416_2552_3799 369
79 3300046684 Ga0495669_0064849 Ga0495669_0064849_326_1573 369
80 3300048907 Ga0496104_0147787 Ga0496104_0147787_471_1718 369
81 3300048917 Ga0496114_0200041 Ga0496114_0200041_111_1358 369
82 3300050490 nmdc:mga03n38_174_c1 nmdc:mga03n38_174_c1_6108_7355 369
83 3300050492 nmdc:mga0yw44_7776_c1 nmdc:mga0yw44_7776_c1_264_1511 369
84 3300050494 nmdc:mga06z11_5916_c1 nmdc:mga06z11_5916_c1_3521_4768 369
85 3300050496 nmdc:mga07m45_93681_c1 nmdc:mga07m45_93681_c1_265_1512 369
86 3300053090 Ga0500646_0024811 Ga0500646_0024811_252_1499 369
87 3300053147 Ga0500589_071695 Ga0500589_071695_207_1454 369
88 3300005353 Ga0070669_100214716 Ga0070669_1002147161 370
89 3300005457 Ga0070662_100179425 Ga0070662_1001794252 370
90 3300005842 Ga0068858_100089935 Ga0068858_1000899353 370
91 3300005843 Ga0068860_100071321 Ga0068860_1000713212 370
92 3300005983 Ga0081540_1002872 Ga0081540_10028728 370
93 3300009551 Ga0105238_10170728 Ga0105238_101707281 370
94 3300010159 Ga0099796_10050126 Ga0099796_100501261 370
95 3300010375 Ga0105239_10035144 Ga0105239_100351442 370
96 3300010375 Ga0105239_10216194 Ga0105239_102161942 370
97 3300025931 Ga0207644_10240176 Ga0207644_102401761 370
98 3300025961 Ga0207712_10171530 Ga0207712_101715302 370
99 3300026078 Ga0207702_10132952 Ga0207702_101329522 370
100 3300026121 Ga0207683_10119960 Ga0207683_101199601 370
101 3300027907 Ga0207428_10216341 Ga0207428_102163411 370
102 3300031456 Ga0307513_10051435 Ga0307513_100514352 370
103 3300035691 Ga0373931_0000842 Ga0373931_0000842_1292_2539 370
104 3300041512 Ga0451853_2946802 Ga0451853_2946802_163_1434 370
105 3300045049 Ga0466959_0021119 Ga0466959_0021119_945_2192 370
106 3300048904 Ga0496101_0016777 Ga0496101_0016777_2645_3892 370
107 3300048905 Ga0496102_0009493 Ga0496102_0009493_236_1483 370
108 3300048906 Ga0496103_0040592 Ga0496103_0040592_517_1764 370
109 3300048908 Ga0496105_0004107 Ga0496105_0004107_9285_10532 370
110 3300048909 Ga0496106_0011404 Ga0496106_0011404_638_1885 370
111 3300048911 Ga0496108_0022827 Ga0496108_0022827_2929_4176 370
112 3300048912 Ga0496109_0026426 Ga0496109_0026426_39_1286 370
113 3300048915 Ga0496112_0020901 Ga0496112_0020901_138_1385 370
114 3300048916 Ga0496113_0005785 Ga0496113_0005785_1671_2918 370
115 3300048917 Ga0496114_0009385 Ga0496114_0009385_2992_4239 370
116 3300048918 Ga0496115_0012752 Ga0496115_0012752_334_1581 370
117 3300053105 Ga0500557_000110 Ga0500557_000110_6651_7880 370
118 3300053729 Ga0500625_000186 Ga0500625_000186_5862_7091 370
119 3300003203 JGI25406J46586_10000336 JGI25406J46586_1000033614 371
120 3300003354 JGI25160J50197_1013575 JGI25160J50197_10135752 371
121 3300005262 Ga0065165_1003853 Ga0065165_10038539 371
122 3300005329 Ga0070683_100009532 Ga0070683_1000095323 371
123 3300005436 Ga0070713_100010719 Ga0070713_1000107192 371
124 3300005441 Ga0070700_100084931 Ga0070700_1000849312 371
125 3300005458 Ga0070681_10009309 Ga0070681_100093094 371
126 3300005535 Ga0070684_100003609 Ga0070684_1000036092 371
127 3300005563 Ga0068855_100218281 Ga0068855_1002182812 371
128 3300005615 Ga0070702_100146246 Ga0070702_1001462462 371
129 3300005985 Ga0081539_10000498 Ga0081539_1000049861 371
130 3300006028 Ga0070717_10001174 Ga0070717_1000117412 371
131 3300006028 Ga0070717_10172338 Ga0070717_101723382 371
132 3300006237 Ga0097621_100063211 Ga0097621_1000632111 371
133 3300010375 Ga0105239_10142500 Ga0105239_101425003 371
134 3300010375 Ga0105239_10364661 Ga0105239_103646611 371
135 3300011119 Ga0105246_10099285 Ga0105246_100992852 371
136 3300013308 Ga0157375_10267843 Ga0157375_102678432 371
137 3300013308 Ga0157375_10336175 Ga0157375_103361752 371
138 3300014325 Ga0163163_10139140 Ga0163163_101391402 371
139 3300025297 Ga0209758_1003008 Ga0209758_10030087 371
140 3300025907 Ga0207645_10174029 Ga0207645_101740291 371
141 3300025912 Ga0207707_10017820 Ga0207707_100178204 371
142 3300025933 Ga0207706_10256337 Ga0207706_102563371 371
143 3300025936 Ga0207670_10027910 Ga0207670_100279102 371
144 3300025938 Ga0207704_10024216 Ga0207704_100242162 371
145 3300025938 Ga0207704_10106799 Ga0207704_101067992 371
146 3300025944 Ga0207661_10002109 Ga0207661_100021092 371
147 3300026067 Ga0207678_10066781 Ga0207678_100667812 371
148 3300026075 Ga0207708_10080938 Ga0207708_100809382 371
149 3300033180 Ga0307510_10005974 Ga0307510_100059748 371
150 3300037068 Ga0373925_0185017 Ga0373925_0185017_146_1393 371
151 3300044842 Ga0466957_0181271 Ga0466957_0181271_62_1309 371
152 3300046615 Ga0495656_0028118 Ga0495656_0028118_279_1526 371
153 3300048908 Ga0496105_0057180 Ga0496105_0057180_798_2045 371
154 3300048911 Ga0496108_0188820 Ga0496108_0188820_86_1333 371
155 3300048915 Ga0496112_0002164 Ga0496112_0002164_8951_10198 371
156 3300003659 JGI25404J52841_10009355 JGI25404J52841_100093552 372
157 3300003659 JGI25404J52841_10013197 JGI25404J52841_100131972 372
158 3300005458 Ga0070681_10012590 Ga0070681_100125902 372
159 3300005530 Ga0070679_100013660 Ga0070679_1000136602 372
160 3300005530 Ga0070679_100030872 Ga0070679_1000308722 372
161 3300005937 Ga0081455_10088942 Ga0081455_100889423 372
162 3300005983 Ga0081540_1001267 Ga0081540_100126712 372
163 3300005983 Ga0081540_1040640 Ga0081540_10406402 372
164 3300007788 Ga0099795_10058226 Ga0099795_100582261 372
165 3300021384 Ga0213876_10000590 Ga0213876_100005902 372
166 3300025912 Ga0207707_10059199 Ga0207707_100591992 372
167 3300025921 Ga0207652_10006908 Ga0207652_100069087 372
168 3300025921 Ga0207652_10015612 Ga0207652_100156123 372
169 3300035118 Ga0373954_0007912 Ga0373954_0007912_994_2241 372
170 3300035172 Ga0373955_0031752 Ga0373955_0031752_291_1538 372
171 3300046472 Ga0495580_0031138 Ga0495580_0031138_1122_2369 372
172 3300046501 Ga0495607_0026823 Ga0495607_0026823_1987_3219 372
173 3300046512 Ga0495610_0045938 Ga0495610_0045938_411_1643 372
174 3300046520 Ga0495637_0019276 Ga0495637_0019276_824_2056 372
175 3300046522 Ga0495643_0042337 Ga0495643_0042337_779_2011 372
176 3300046524 Ga0495648_0059059 Ga0495648_0059059_588_1820 372
177 3300046530 Ga0495654_0008249 Ga0495654_0008249_1041_2273 372
178 3300046531 Ga0495665_0025930 Ga0495665_0025930_499_1746 372
179 3300046642 Ga0495634_0149963 Ga0495634_0149963_79_1326 372
180 3300046689 Ga0495613_0033158 Ga0495613_0033158_2232_3479 372
181 3300047673 Ga0495593_0065045 Ga0495593_0065045_324_1571 372
182 3300048909 Ga0496106_0000363 Ga0496106_0000363_4383_5630 372
183 3300048910 Ga0496107_0011212 Ga0496107_0011212_281_1528 372
184 3300048912 Ga0496109_0105934 Ga0496109_0105934_431_1678 372
185 3300048915 Ga0496112_0017574 Ga0496112_0017574_4533_5780 372
186 3300048924 Ga0496121_0070768 Ga0496121_0070768_38_1270 372
187 3300048925 Ga0496122_0103444 Ga0496122_0103444_197_1438 372
188 3300048929 Ga0496126_0015750 Ga0496126_0015750_2189_3430 372
189 3300048929 Ga0496126_0039511 Ga0496126_0039511_1842_3074 372
190 3300053088 Ga0500644_0031506 Ga0500644_0031506_417_1649 372
191 3300053093 Ga0500651_0005132 Ga0500651_0005132_5353_6585 372
192 3300053094 Ga0500566_0000164 Ga0500566_0000164_31881_33128 372
193 3300053095 Ga0500640_023116 Ga0500640_023116_1173_2420 372
194 3300053096 Ga0500641_0006524 Ga0500641_0006524_2231_3463 372
195 3300053098 Ga0500650_0035637 Ga0500650_0035637_745_1977 372
196 3300053111 Ga0500572_001734 Ga0500572_001734_854_2101 372
197 3300053116 Ga0500592_000312 Ga0500592_000312_6178_7410 372
198 3300053123 Ga0500614_000855 Ga0500614_000855_5491_6738 372
199 3300053130 Ga0500642_0000036 Ga0500642_0000036_101553_102785 372
200 3300053136 Ga0500559_0004916 Ga0500559_0004916_1138_2385 372
201 3300053139 Ga0500568_0000556 Ga0500568_0000556_3969_5201 372
202 3300053150 Ga0500603_000674 Ga0500603_000674_6962_8209 372
203 3300053151 Ga0500604_0002050 Ga0500604_0002050_1841_3073 372
204 3300053158 Ga0500627_0014140 Ga0500627_0014140_784_2016 372
205 3300053159 Ga0500630_002325 Ga0500630_002325_6457_7704 372
206 3300053162 Ga0500638_025986 Ga0500638_025986_952_2199 372
207 3300053163 Ga0500639_000001 Ga0500639_000001_162945_164192 372
208 3300053730 Ga0500645_012939 Ga0500645_012939_1125_2357 372
209 3300005434 Ga0070709_10047008 Ga0070709_100470082 373
210 3300005435 Ga0070714_100076029 Ga0070714_1000760292 373
211 3300005436 Ga0070713_100006847 Ga0070713_1000068473 373
212 3300005437 Ga0070710_10031795 Ga0070710_100317952 373
213 3300006175 Ga0070712_100036929 Ga0070712_1000369293 373
214 3300006871 Ga0075434_100089199 Ga0075434_1000891992 373
215 3300009101 Ga0105247_10016255 Ga0105247_100162552 373
216 3300025898 Ga0207692_10060299 Ga0207692_100602992 373
217 3300025906 Ga0207699_10055637 Ga0207699_100556372 373
218 3300025908 Ga0207643_10115491 Ga0207643_101154911 373
219 3300025915 Ga0207693_10002117 Ga0207693_1000211710 373
220 3300025928 Ga0207700_10104913 Ga0207700_101049132 373
221 3300036401 Ga0373937_0097512 Ga0373937_0097512_479_1726 373
222 3300046809 Ga0495600_0084976 Ga0495600_0084976_689_1903 373
223 3300048926 Ga0496123_0062021 Ga0496123_0062021_1071_2306 373
224 3300048929 Ga0496126_0112364 Ga0496126_0112364_390_1637 373
225 3300050512 nmdc:mga0n895_124296_c1 nmdc:mga0n895_124296_c1_851_2101 373
226 3300053142 Ga0500577_0000074 Ga0500577_0000074_21095_22309 373
227 3300005458 Ga0070681_10181378 Ga0070681_101813782 374
228 3300009545 Ga0105237_10003659 Ga0105237_1000365913 374
229 3300010375 Ga0105239_10095523 Ga0105239_100955233 374
230 3300025302 Ga0207426_1000960 Ga0207426_100096014 374
231 3300025912 Ga0207707_10123202 Ga0207707_101232022 374
232 3300025914 Ga0207671_10015556 Ga0207671_100155562 374
233 3300026088 Ga0207641_10212686 Ga0207641_102126862 374
234 3300031730 Ga0307516_10007456 Ga0307516_1000745610 374
235 3300039437 Ga0436365_0209497 Ga0436365_0209497_8113_9360 374
236 3300048920 Ga0496117_0016367 Ga0496117_0016367_4223_5470 374
237 3300048921 Ga0496118_0002080 Ga0496118_0002080_5221_6468 374
238 3300048924 Ga0496121_0000183 Ga0496121_0000183_66244_67491 374
239 3300048927 Ga0496124_0016544 Ga0496124_0016544_3973_5220 374
240 3300048929 Ga0496126_0068780 Ga0496126_0068780_1663_2910 374
241 3300005434 Ga0070709_10011282 Ga0070709_100112822 375
242 3300005436 Ga0070713_100005904 Ga0070713_1000059046 375
243 3300006163 Ga0070715_10000252 Ga0070715_100002524 375
244 3300009551 Ga0105238_10087971 Ga0105238_100879713 375
245 3300025898 Ga0207692_10000536 Ga0207692_100005368 375
246 3300025906 Ga0207699_10004254 Ga0207699_100042542 375
247 3300025915 Ga0207693_10001037 Ga0207693_1000103718 375
248 3300025916 Ga0207663_10000301 Ga0207663_100003015 375
249 3300025939 Ga0207665_10000192 Ga0207665_1000019223 375
250 3300037312 Ga0395899_0016993 Ga0395899_0016993_131_1378 375
251 3300037418 Ga0395900_0000361 Ga0395900_0000361_28201_29448 375
252 3300037466 Ga0395898_0104858 Ga0395898_0104858_889_2136 375
253 3300047317 Ga0495604_0163189 Ga0495604_0163189_152_1399 375
254 3300003215 JGI25153J46596_10007154 JGI25153J46596_100071541 376
255 3300005262 Ga0065165_1003559 Ga0065165_10035598 376
256 3300005530 Ga0070679_100029868 Ga0070679_1000298683 376
257 3300005563 Ga0068855_100061729 Ga0068855_1000617294 376
258 3300005937 Ga0081455_10008967 Ga0081455_100089676 376
259 3300005937 Ga0081455_10025478 Ga0081455_100254783 376
260 3300005983 Ga0081540_1005621 Ga0081540_10056212 376
261 3300009093 Ga0105240_10066851 Ga0105240_100668512 376
262 3300013104 Ga0157370_10065320 Ga0157370_100653202 376
263 3300025297 Ga0209758_1010422 Ga0209758_10104224 376
264 3300025921 Ga0207652_10024462 Ga0207652_100244623 376
265 3300025949 Ga0207667_10058611 Ga0207667_100586114 376
266 3300039437 Ga0436365_0388031 Ga0436365_0388031_594_1844 376
267 3300039447 Ga0436361_0037682 Ga0436361_0037682_3349_4632 376
268 3300039450 Ga0436363_0599741 Ga0436363_0599741_16_1263 376
269 3300039453 Ga0436362_0191008 Ga0436362_0191008_711_1994 376
270 3300044684 Ga0466966_0001434 Ga0466966_0001434_9981_11225 376
271 3300044693 Ga0466961_0000859 Ga0466961_0000859_13474_14718 376
272 3300053092 Ga0500583_0012287 Ga0500583_0012287_778_2049 376
273 3300053103 Ga0500555_002428 Ga0500555_002428_880_2151 376
274 3300053116 Ga0500592_003427 Ga0500592_003427_678_1949 376
275 3300053119 Ga0500595_001778 Ga0500595_001778_1907_3154 376
276 3300053139 Ga0500568_0008824 Ga0500568_0008824_133_1404 376
277 3300053151 Ga0500604_0006501 Ga0500604_0006501_1182_2453 376
278 3300053158 Ga0500627_0019817 Ga0500627_0019817_979_2250 376
279 3300053162 Ga0500638_005986 Ga0500638_005986_1248_2495 376
280 3300053178 Ga0500637_0000379 Ga0500637_0000379_7670_8917 376
281 3300055283 Ga0500661_001344 Ga0500661_001344_2709_3956 376
282 3300003320 rootH2_10185342 rootH2_101853421 377
283 3300005334 Ga0068869_100058278 Ga0068869_1000582781 377
284 3300005434 Ga0070709_10022724 Ga0070709_100227242 377
285 3300005437 Ga0070710_10005257 Ga0070710_100052572 377
286 3300005439 Ga0070711_100033045 Ga0070711_1000330452 377
287 3300005937 Ga0081455_10113541 Ga0081455_101135412 377
288 3300005983 Ga0081540_1033892 Ga0081540_10338922 377
289 3300005983 Ga0081540_1051449 Ga0081540_10514492 377
290 3300006941 Ga0099825_1016421 Ga0099825_10164213 377
291 3300009551 Ga0105238_10083394 Ga0105238_100833942 377
292 3300009553 Ga0105249_10184315 Ga0105249_101843152 377
293 3300025924 Ga0207694_10068849 Ga0207694_100688492 377
294 3300025942 Ga0207689_10054697 Ga0207689_100546972 377
295 3300025972 Ga0207668_10176155 Ga0207668_101761552 377
296 3300027296 Ga0209389_1000008 Ga0209389_1000008225 377
297 3300027361 Ga0209489_108921 Ga0209489_10892112 377
298 3300027363 Ga0209700_100036 Ga0209700_100036112 377
299 3300028381 Ga0268264_10000043 Ga0268264_1000004390 377
300 3300046523 Ga0495644_0022395 Ga0495644_0022395_218_1465 377
301 3300046558 Ga0495633_0029330 Ga0495633_0029330_933_2180 377
302 3300046615 Ga0495656_0001311 Ga0495656_0001311_1721_2968 377
303 3300046615 Ga0495656_0012780 Ga0495656_0012780_329_1576 377
304 3300046664 Ga0495659_0007697 Ga0495659_0007697_990_2237 377
305 3300046684 Ga0495669_0012577 Ga0495669_0012577_634_1881 377
306 3300053085 Ga0495619_0015570 Ga0495619_0015570_1038_2285 377
307 iso_pu_bacteria 8016548790 8016553986 377
308 3300005434 Ga0070709_10000102 Ga0070709_1000010242 378
309 3300005435 Ga0070714_100053595 Ga0070714_1000535952 378
310 3300005437 Ga0070710_10002844 Ga0070710_100028442 378
311 3300005439 Ga0070711_100017553 Ga0070711_1000175532 378
312 3300005937 Ga0081455_10009252 Ga0081455_100092528 378
313 3300006028 Ga0070717_10145536 Ga0070717_101455362 378
314 3300006173 Ga0070716_100003040 Ga0070716_1000030402 378
315 3300006175 Ga0070712_100025518 Ga0070712_1000255182 378
316 3300006353 Ga0075370_10046929 Ga0075370_100469292 378
317 3300009098 Ga0105245_10135797 Ga0105245_101357972 378
318 3300013296 Ga0157374_10071827 Ga0157374_100718272 378
319 3300013297 Ga0157378_10247944 Ga0157378_102479442 378
320 3300013308 Ga0157375_10011135 Ga0157375_100111352 378
321 3300014325 Ga0163163_10254338 Ga0163163_102543382 378
322 3300025254 Ga0209148_1000356 Ga0209148_100035622 378
323 3300025295 Ga0209564_1004524 Ga0209564_10045243 378
324 3300025906 Ga0207699_10000329 Ga0207699_100003296 378
325 3300025915 Ga0207693_10016504 Ga0207693_100165042 378
326 3300025929 Ga0207664_10008827 Ga0207664_100088274 378
327 3300025939 Ga0207665_10004009 Ga0207665_100040092 378
328 3300031616 Ga0307508_10000804 Ga0307508_1000080419 378
329 3300035119 Ga0373956_0021183 Ga0373956_0021183_1306_2553 378
330 3300035695 Ga0373927_0047842 Ga0373927_0047842_782_1984 378
331 3300035724 Ga0373933_0112380 Ga0373933_0112380_99_1346 378
332 3300035725 Ga0373947_0008138 Ga0373947_0008138_2727_3929 378
333 3300036401 Ga0373937_0066085 Ga0373937_0066085_998_2245 378
334 3300037471 Ga0395905_0286430 Ga0395905_0286430_258_1499 378
335 3300044658 Ga0466972_0004782 Ga0466972_0004782_3521_4759 378
336 3300044735 Ga0466968_0006041 Ga0466968_0006041_1409_2647 378
337 3300044901 Ga0466960_0030663 Ga0466960_0030663_133_1371 378
338 3300046454 Ga0495592_0036269 Ga0495592_0036269_1384_2631 378
339 3300046462 Ga0495651_0159037 Ga0495651_0159037_220_1467 378
340 3300046511 Ga0495608_0019187 Ga0495608_0019187_1035_2282 378
341 3300046517 Ga0495630_0059526 Ga0495630_0059526_1188_2435 378
342 3300046533 Ga0495640_0042774 Ga0495640_0042774_1898_3145 378
343 3300046536 Ga0495587_0017003 Ga0495587_0017003_2681_3928 378
344 3300046559 Ga0495667_0032862 Ga0495667_0032862_1220_2467 378
345 3300046642 Ga0495634_0054602 Ga0495634_0054602_874_2121 378
346 3300046674 Ga0495588_0021350 Ga0495588_0021350_1559_2761 378
347 3300046679 Ga0495623_0011483 Ga0495623_0011483_1920_3167 378
348 3300046680 Ga0495646_0055702 Ga0495646_0055702_448_1695 378
349 3300046809 Ga0495600_0013420 Ga0495600_0013420_467_1714 378
350 3300047317 Ga0495604_0041925 Ga0495604_0041925_1917_3164 378
351 3300047322 Ga0495680_0027520 Ga0495680_0027520_1185_2432 378
352 3300047471 Ga0495684_0024873 Ga0495684_0024873_2575_3822 378
353 3300048088 Ga0495602_0030792 Ga0495602_0030792_2977_4224 378
354 3300048905 Ga0496102_0040342 Ga0496102_0040342_2021_3265 378
355 3300048906 Ga0496103_0007167 Ga0496103_0007167_841_2085 378
356 3300048907 Ga0496104_0010601 Ga0496104_0010601_4100_5344 378
357 3300048909 Ga0496106_0075342 Ga0496106_0075342_1016_2260 378
358 3300048911 Ga0496108_0009868 Ga0496108_0009868_1111_2355 378
359 3300048913 Ga0496110_0011326 Ga0496110_0011326_1935_3179 378
360 3300048914 Ga0496111_0049335 Ga0496111_0049335_1509_2753 378
361 3300053080 Ga0500635_0017317 Ga0500635_0017317_626_1882 378
362 3300053087 Ga0500643_000015 Ga0500643_000015_136517_137776 378
363 3300053104 Ga0500556_0059293 Ga0500556_0059293_25_1296 378
364 3300053121 Ga0500607_032628 Ga0500607_032628_416_1672 378
365 3300053136 Ga0500559_0015884 Ga0500559_0015884_546_1802 378
366 3300053177 Ga0500636_0000151 Ga0500636_0000151_6427_7683 378
367 3300053178 Ga0500637_0109008 Ga0500637_0109008_57_1313 378
368 3300053737 Ga0500601_000153 Ga0500601_000153_11359_12603 378
369 3300055283 Ga0500661_010983 Ga0500661_010983_387_1631 378
370 3300005338 Ga0068868_100078904 Ga0068868_1000789042 379
371 3300005347 Ga0070668_100048788 Ga0070668_1000487882 379
372 3300005457 Ga0070662_100061873 Ga0070662_1000618731 379
373 3300005544 Ga0070686_100047604 Ga0070686_1000476042 379
374 3300005563 Ga0068855_100080511 Ga0068855_1000805112 379
375 3300005564 Ga0070664_100230359 Ga0070664_1002303592 379
376 3300005616 Ga0068852_100027112 Ga0068852_1000271123 379
377 3300005842 Ga0068858_100082338 Ga0068858_1000823382 379
378 3300005983 Ga0081540_1011786 Ga0081540_10117864 379
379 3300005985 Ga0081539_10035267 Ga0081539_100352672 379
380 3300006048 Ga0075363_100029679 Ga0075363_1000296792 379
381 3300006178 Ga0075367_10040661 Ga0075367_100406612 379
382 3300006237 Ga0097621_100047370 Ga0097621_1000473702 379
383 3300009093 Ga0105240_10004952 Ga0105240_1000495212 379
384 3300009101 Ga0105247_10021929 Ga0105247_100219292 379
385 3300009101 Ga0105247_10084044 Ga0105247_100840442 379
386 3300009148 Ga0105243_10133915 Ga0105243_101339152 379
387 3300009174 Ga0105241_10037913 Ga0105241_100379132 379
388 3300009545 Ga0105237_10004418 Ga0105237_1000441812 379
389 3300009551 Ga0105238_10041931 Ga0105238_100419312 379
390 3300009551 Ga0105238_10371647 Ga0105238_103716471 379
391 3300010375 Ga0105239_10020953 Ga0105239_100209532 379
392 3300013296 Ga0157374_10132743 Ga0157374_101327432 379
393 3300013297 Ga0157378_10131399 Ga0157378_101313992 379
394 3300013308 Ga0157375_10063169 Ga0157375_100631692 379
395 3300014745 Ga0157377_10073748 Ga0157377_100737482 379
396 3300014969 Ga0157376_10109771 Ga0157376_101097712 379
397 3300025297 Ga0209758_1024250 Ga0209758_10242502 379
398 3300025901 Ga0207688_10101608 Ga0207688_101016081 379
399 3300025908 Ga0207643_10004479 Ga0207643_100044797 379
400 3300025913 Ga0207695_10000015 Ga0207695_10000015193 379
401 3300025914 Ga0207671_10010345 Ga0207671_100103457 379
402 3300025914 Ga0207671_10029471 Ga0207671_100294713 379
403 3300025924 Ga0207694_10107515 Ga0207694_101075152 379
404 3300025927 Ga0207687_10062521 Ga0207687_100625212 379
405 3300025933 Ga0207706_10155317 Ga0207706_101553172 379
406 3300025935 Ga0207709_10027079 Ga0207709_100270792 379
407 3300025981 Ga0207640_10121675 Ga0207640_101216752 379
408 3300026067 Ga0207678_10092941 Ga0207678_100929412 379
409 3300026116 Ga0207674_10054183 Ga0207674_100541832 379
410 3300026118 Ga0207675_100139309 Ga0207675_1001393092 379
411 3300026121 Ga0207683_10073369 Ga0207683_100733692 379
412 3300026142 Ga0207698_10012058 Ga0207698_100120583 379
413 3300028381 Ga0268264_10094816 Ga0268264_100948162 379
414 3300031901 Ga0307406_10145612 Ga0307406_101456121 379
415 3300032002 Ga0307416_100327268 Ga0307416_1003272682 379
416 3300037471 Ga0395905_0019208 Ga0395905_0019208_3810_5051 379
417 3300044683 Ga0466965_0021010 Ga0466965_0021010_1068_2327 379
418 3300044901 Ga0466960_0035372 Ga0466960_0035372_530_1789 379
419 3300046459 Ga0495629_0186278 Ga0495629_0186278_142_1386 379
420 3300046460 Ga0495638_0026815 Ga0495638_0026815_1683_2942 379
421 3300046462 Ga0495651_0110169 Ga0495651_0110169_194_1438 379
422 3300046529 Ga0495652_0063119 Ga0495652_0063119_401_1645 379
423 3300046529 Ga0495652_0125161 Ga0495652_0125161_135_1379 379
424 3300046648 Ga0495611_0041774 Ga0495611_0041774_320_1579 379
425 3300046660 Ga0495625_0159272 Ga0495625_0159272_25_1269 379
426 3300046663 Ga0495635_0001593 Ga0495635_0001593_8971_10215 379
427 3300046690 Ga0495624_0047452 Ga0495624_0047452_68_1312 379
428 3300046809 Ga0495600_0007598 Ga0495600_0007598_5327_6571 379
429 3300047317 Ga0495604_0171877 Ga0495604_0171877_105_1349 379
430 3300047323 Ga0495683_0092315 Ga0495683_0092315_208_1452 379
431 3300047472 Ga0495686_0089296 Ga0495686_0089296_37_1278 379
432 3300048905 Ga0496102_0229331 Ga0496102_0229331_339_1598 379
433 3300048907 Ga0496104_0010283 Ga0496104_0010283_2762_4006 379
434 3300048907 Ga0496104_0151914 Ga0496104_0151914_815_2074 379
435 3300048908 Ga0496105_0000723 Ga0496105_0000723_4058_5302 379
436 3300048908 Ga0496105_0006361 Ga0496105_0006361_116_1360 379
437 3300048911 Ga0496108_0058747 Ga0496108_0058747_1007_2254 379
438 3300048912 Ga0496109_0058468 Ga0496109_0058468_834_2081 379
439 3300048915 Ga0496112_0134156 Ga0496112_0134156_1075_2322 379
440 3300048916 Ga0496113_0066893 Ga0496113_0066893_652_1896 379
441 3300048917 Ga0496114_0110369 Ga0496114_0110369_355_1599 379
442 3300048919 Ga0496116_0015358 Ga0496116_0015358_3757_5016 379
443 3300048920 Ga0496117_0082195 Ga0496117_0082195_260_1507 379
444 3300048922 Ga0496119_0015145 Ga0496119_0015145_4239_5483 379
445 3300048923 Ga0496120_0008406 Ga0496120_0008406_1668_2912 379
446 3300048924 Ga0496121_0000407 Ga0496121_0000407_67480_68727 379
447 3300048924 Ga0496121_0090672 Ga0496121_0090672_397_1641 379
448 3300050492 nmdc:mga0yw44_9410_c1 nmdc:mga0yw44_9410_c1_2799_4058 379
449 3300050493 nmdc:mga0k408_70060_c1 nmdc:mga0k408_70060_c1_203_1450 379
450 3300050512 nmdc:mga0n895_234549_c1 nmdc:mga0n895_234549_c1_545_1792 379
451 3300050513 nmdc:mga0rr50_121048_c1 nmdc:mga0rr50_121048_c1_650_1897 379
452 3300050515 nmdc:mga0a205_304703_c1 nmdc:mga0a205_304703_c1_53_1312 379
453 3300053094 Ga0500566_0003015 Ga0500566_0003015_2687_3946 379
454 3300053119 Ga0500595_001401 Ga0500595_001401_5495_6742 379
455 3300053136 Ga0500559_0025315 Ga0500559_0025315_1127_2371 379
456 3300053139 Ga0500568_0001659 Ga0500568_0001659_8731_9978 379
457 3300053156 Ga0500622_0010430 Ga0500622_0010430_2208_3467 379
458 3300053736 Ga0500599_000262 Ga0500599_000262_2400_3659 379
459 3300055283 Ga0500661_005340 Ga0500661_005340_609_1853 379
460 3300003215 JGI25153J46596_10000472 JGI25153J46596_1000047218 380
461 3300003215 JGI25153J46596_10011461 JGI25153J46596_100114614 380
462 3300003354 JGI25160J50197_1008449 JGI25160J50197_10084494 380
463 3300003775 Ga0055524_1012750 Ga0055524_10127503 380
464 3300003794 Ga0055531_10014195 Ga0055531_100141954 380
465 3300005262 Ga0065165_1023466 Ga0065165_10234662 380
466 3300005355 Ga0070671_100004701 Ga0070671_1000047013 380
467 3300005366 Ga0070659_100168316 Ga0070659_1001683162 380
468 3300005367 Ga0070667_100035638 Ga0070667_1000356383 380
469 3300005455 Ga0070663_100060665 Ga0070663_1000606653 380
470 3300005539 Ga0068853_100213983 Ga0068853_1002139832 380
471 3300005563 Ga0068855_100174262 Ga0068855_1001742623 380
472 3300005578 Ga0068854_100051014 Ga0068854_1000510144 380
473 3300005983 Ga0081540_1023528 Ga0081540_10235282 380
474 3300006038 Ga0075365_10015338 Ga0075365_100153383 380
475 3300006038 Ga0075365_10040718 Ga0075365_100407186 380
476 3300006048 Ga0075363_100009408 Ga0075363_1000094082 380
477 3300006051 Ga0075364_10005940 Ga0075364_100059402 380
478 3300006051 Ga0075364_10086166 Ga0075364_100861662 380
479 3300006178 Ga0075367_10040192 Ga0075367_100401923 380
480 3300006186 Ga0075369_10018548 Ga0075369_100185482 380
481 3300006195 Ga0075366_10002977 Ga0075366_100029776 380
482 3300006353 Ga0075370_10017005 Ga0075370_100170053 380
483 3300009101 Ga0105247_10069139 Ga0105247_100691392 380
484 3300009148 Ga0105243_10113540 Ga0105243_101135402 380
485 3300009174 Ga0105241_10058874 Ga0105241_100588742 380
486 3300009177 Ga0105248_10016551 Ga0105248_100165515 380
487 3300009545 Ga0105237_10009663 Ga0105237_100096637 380
488 3300009545 Ga0105237_10123798 Ga0105237_101237982 380
489 3300010375 Ga0105239_10129175 Ga0105239_101291754 380
490 3300011119 Ga0105246_10019166 Ga0105246_100191664 380
491 3300013296 Ga0157374_10115183 Ga0157374_101151832 380
492 3300014325 Ga0163163_10158802 Ga0163163_101588022 380
493 3300025272 Ga0209455_1006478 Ga0209455_10064783 380
494 3300025295 Ga0209564_1013332 Ga0209564_10133321 380
495 3300025297 Ga0209758_1000021 Ga0209758_1000021606 380
496 3300025297 Ga0209758_1001632 Ga0209758_10016329 380
497 3300025297 Ga0209758_1002055 Ga0209758_100205510 380
498 3300025299 Ga0209256_1006522 Ga0209256_10065224 380
499 3300025302 Ga0207426_1004043 Ga0207426_10040437 380
500 3300025304 Ga0209257_1002332 Ga0209257_100233210 380
501 3300025315 Ga0207697_10012252 Ga0207697_100122524 380
502 3300025904 Ga0207647_10034398 Ga0207647_100343982 380
503 3300025941 Ga0207711_10058908 Ga0207711_100589081 380
504 3300025949 Ga0207667_10078107 Ga0207667_100781072 380
505 3300026067 Ga0207678_10016384 Ga0207678_100163842 380
506 3300026067 Ga0207678_10022701 Ga0207678_100227014 380
507 3300026078 Ga0207702_10121254 Ga0207702_101212542 380
508 3300026116 Ga0207674_10186565 Ga0207674_101865652 380
509 3300037418 Ga0395900_0302847 Ga0395900_0302847_250_1497 380
510 3300044842 Ga0466957_0017976 Ga0466957_0017976_567_1838 380
511 3300045976 Ga0466967_0074195 Ga0466967_0074195_683_1954 380
512 3300046462 Ga0495651_0014893 Ga0495651_0014893_3326_4585 380
513 3300046463 Ga0495653_0104777 Ga0495653_0104777_264_1523 380
514 3300046477 Ga0495664_0042170 Ga0495664_0042170_775_2034 380
515 3300046511 Ga0495608_0058675 Ga0495608_0058675_761_2020 380
516 3300046516 Ga0495628_0070005 Ga0495628_0070005_400_1659 380
517 3300046536 Ga0495587_0046610 Ga0495587_0046610_725_1984 380
518 3300046616 Ga0495668_0046384 Ga0495668_0046384_563_1834 380
519 3300046642 Ga0495634_0090014 Ga0495634_0090014_690_1949 380
520 3300046675 Ga0495657_0053555 Ga0495657_0053555_1127_2386 380
521 3300046678 Ga0495599_0045761 Ga0495599_0045761_818_2077 380
522 3300046679 Ga0495623_0019902 Ga0495623_0019902_2103_3362 380
523 3300046809 Ga0495600_0050621 Ga0495600_0050621_294_1553 380
524 3300047317 Ga0495604_0051921 Ga0495604_0051921_1788_3047 380
525 3300047319 Ga0495674_0235689 Ga0495674_0235689_234_1493 380
526 3300047322 Ga0495680_0022137 Ga0495680_0022137_2940_4199 380
527 3300047444 Ga0495675_0052049 Ga0495675_0052049_709_1968 380
528 3300047472 Ga0495686_0024768 Ga0495686_0024768_1737_2978 380
529 3300048088 Ga0495602_0020088 Ga0495602_0020088_4390_5649 380
530 3300048905 Ga0496102_0029666 Ga0496102_0029666_3218_4489 380
531 3300048906 Ga0496103_0021773 Ga0496103_0021773_194_1465 380
532 3300048909 Ga0496106_0005109 Ga0496106_0005109_6390_7637 380
533 3300048910 Ga0496107_0007846 Ga0496107_0007846_5954_7201 380
534 3300048911 Ga0496108_0000864 Ga0496108_0000864_17686_18933 380
535 3300048912 Ga0496109_0010326 Ga0496109_0010326_3557_4804 380
536 3300048912 Ga0496109_0112246 Ga0496109_0112246_683_1954 380
537 3300048913 Ga0496110_0034431 Ga0496110_0034431_2200_3447 380
538 3300048915 Ga0496112_0007314 Ga0496112_0007314_4687_5934 380
539 3300048916 Ga0496113_0085599 Ga0496113_0085599_1005_2276 380
540 3300048918 Ga0496115_0181715 Ga0496115_0181715_170_1417 380
541 3300048919 Ga0496116_0003452 Ga0496116_0003452_4856_6073 380
542 3300048920 Ga0496117_0017616 Ga0496117_0017616_1407_2624 380
543 3300048920 Ga0496117_0058908 Ga0496117_0058908_747_2018 380
544 3300048921 Ga0496118_0014018 Ga0496118_0014018_5121_6338 380
545 3300048921 Ga0496118_0119126 Ga0496118_0119126_44_1243 380
546 3300048924 Ga0496121_0055635 Ga0496121_0055635_158_1372 380
547 3300048928 Ga0496125_0019582 Ga0496125_0019582_3853_5124 380
548 3300048928 Ga0496125_0032940 Ga0496125_0032940_790_2007 380
549 3300048928 Ga0496125_0033676 Ga0496125_0033676_1327_2571 380
550 3300048929 Ga0496126_0009113 Ga0496126_0009113_1191_2432 380
551 3300048929 Ga0496126_0138020 Ga0496126_0138020_15_1214 380
552 3300050492 nmdc:mga0yw44_1291_c1 nmdc:mga0yw44_1291_c1_4098_5315 380
553 3300050493 nmdc:mga0k408_30969_c1 nmdc:mga0k408_30969_c1_935_2206 380
554 3300050496 nmdc:mga07m45_17273_c1 nmdc:mga07m45_17273_c1_1452_2723 380
555 3300050496 nmdc:mga07m45_33961_c1 nmdc:mga07m45_33961_c1_421_1692 380
556 3300050516 nmdc:mga0sz30_2779_c1 nmdc:mga0sz30_2779_c1_2777_3994 380
557 3300053077 Ga0495601_0110534 Ga0495601_0110534_187_1446 380
558 3300053121 Ga0500607_053181 Ga0500607_053181_477_1694 380
559 3300053130 Ga0500642_0000086 Ga0500642_0000086_36268_37539 380
560 3300053153 Ga0500616_0000014 Ga0500616_0000014_315932_317149 380
561 iso_pu_bacteria 8019576017 8019582546 380
562 3300005334 Ga0068869_100187937 Ga0068869_1001879372 381
563 3300005338 Ga0068868_100091388 Ga0068868_1000913882 381
564 3300005339 Ga0070660_100125651 Ga0070660_1001256511 381
565 3300005455 Ga0070663_100092057 Ga0070663_1000920572 381
566 3300005456 Ga0070678_100156222 Ga0070678_1001562222 381
567 3300005578 Ga0068854_100011758 Ga0068854_1000117584 381
568 3300005614 Ga0068856_100051967 Ga0068856_1000519673 381
569 3300005616 Ga0068852_100049957 Ga0068852_1000499571 381
570 3300006051 Ga0075364_10007239 Ga0075364_100072395 381
571 3300006942 Ga0099824_1028516 Ga0099824_10285161 381
572 3300006943 Ga0099822_1048187 Ga0099822_10481871 381
573 3300009098 Ga0105245_10094683 Ga0105245_100946832 381
574 3300025924 Ga0207694_10274753 Ga0207694_102747531 381
575 3300025927 Ga0207687_10054079 Ga0207687_100540792 381
576 3300025981 Ga0207640_10067664 Ga0207640_100676642 381
577 3300026023 Ga0207677_10013741 Ga0207677_100137412 381
578 3300026078 Ga0207702_10000442 Ga0207702_1000044223 381
579 3300026121 Ga0207683_10183071 Ga0207683_101830712 381
580 3300027296 Ga0209389_1000121 Ga0209389_100012151 381
581 3300027357 Ga0209589_1002735 Ga0209589_10027358 381
582 3300027361 Ga0209489_103445 Ga0209489_1034458 381
583 3300046524 Ga0495648_0000843 Ga0495648_0000843_29284_30498 381
584 3300046524 Ga0495648_0001140 Ga0495648_0001140_19568_20815 381
585 3300050491 nmdc:mga00v17_86593_c1 nmdc:mga00v17_86593_c1_627_1832 381
586 3300005355 Ga0070671_100157974 Ga0070671_1001579742 382
587 3300011119 Ga0105246_10001247 Ga0105246_100012472 382
588 3300014969 Ga0157376_10112877 Ga0157376_101128772 382
589 3300025253 Ga0209677_106437 Ga0209677_1064372 382
590 3300025297 Ga0209758_1046179 Ga0209758_10461791 382
591 3300025931 Ga0207644_10031249 Ga0207644_100312492 382
592 3300026067 Ga0207678_10069814 Ga0207678_100698142 382
593 3300026142 Ga0207698_10019664 Ga0207698_100196644 382
594 3300031249 Ga0265339_10001608 Ga0265339_100016085 382
595 3300039438 Ga0436360_0661734 Ga0436360_0661734_1399_2613 382
596 3300048921 Ga0496118_0055661 Ga0496118_0055661_822_2072 382
597 3300048924 Ga0496121_0024365 Ga0496121_0024365_688_1938 382
598 iso_pu_bacteria 2528768022 2528851198 382
599 iso_pu_bacteria 2791355196 2793062498 382
600 iso_pu_bacteria 2824661429 2824667440 382
601 iso_pu_bacteria 2824732956 2824739770 382
602 iso_pu_bacteria 2874620515 2874627201 382
603 iso_pu_bacteria 2879099564 2879103255 382
604 iso_pu_bacteria 2904666416 2904671279 382
605 iso_pu_bacteria 2908775508 2908780085 382
606 iso_pu_bacteria 2922368715 2922374276 382
607 iso_pu_bacteria 2929615660 2929617953 382
608 iso_pu_bacteria 2929624759 2929627634 382
609 iso_pu_bacteria 2932784394 2932788268 382
610 iso_pu_bacteria 2932809354 2932810586 382
611 iso_pu_bacteria 2932818245 2932821270 382
612 iso_pu_bacteria 2932828146 2932831263 382
613 iso_pu_bacteria 2933577622 2933579882 382
614 iso_pu_bacteria 2935616580 2935622944 382
615 iso_pu_bacteria 2935638405 2935642302 382
616 iso_pu_bacteria 2935665750 2935668394 382
617 iso_pu_bacteria 2935675223 2935680527 382
618 iso_pu_bacteria 2935684952 2935692801 382
619 iso_pu_bacteria 2935694250 2935700971 382
620 iso_pu_bacteria 2935703347 2935706252 382
621 iso_pu_bacteria 2935713505 2935721474 382
622 iso_pu_bacteria 2935722832 2935730392 382
623 iso_pu_bacteria 2935732158 2935740405 382
624 iso_pu_bacteria 2935741537 2935749669 382
625 iso_pu_bacteria 2935750917 2935759018 382
626 iso_pu_bacteria 2935760218 2935762650 382
627 iso_pu_bacteria 2935801545 2935803249 382
628 iso_pu_bacteria 2935810662 2935814569 382
629 iso_pu_bacteria 2935827899 2935831707 382
630 iso_pu_bacteria 2935837841 2935838575 382
631 iso_pu_bacteria 2935855204 2935861192 382
632 iso_pu_bacteria 2935864058 2935865730 382
633 iso_pu_bacteria 2935873716 2935878231 382
634 iso_pu_bacteria 2935992306 2935994542 382
635 iso_pu_bacteria 2936002035 2936007659 382
636 iso_pu_bacteria 2936037263 2936040126 382
637 iso_pu_bacteria 2940556831 2940564977 382
638 iso_pu_bacteria 2941538514 2941538757 382
639 iso_pu_bacteria 8016511872 8016513319 382
640 iso_pu_bacteria 8017057580 8017063110 382
641 iso_pu_bacteria 8019586578 8019590330 382
642 iso_pu_bacteria 8019597564 8019601018 382
643 iso_pu_bacteria 8019608314 8019617530 382
644 iso_pu_bacteria 8055742211 8055746457 382
645 3300021320 Ga0214544_1000002 Ga0214544_1000002524 383
646 3300021321 Ga0214542_1000001 Ga0214542_1000001874 383
647 3300021324 Ga0214545_1000001 Ga0214545_1000001940 383
648 3300021327 Ga0214543_1000001 Ga0214543_1000001253 383
649 3300025295 Ga0209564_1009791 Ga0209564_10097913 383
650 3300025297 Ga0209758_1001565 Ga0209758_100156516 383
651 3300033442 Ga0315911_1000001 Ga0315911_1000001236 383
652 3300048921 Ga0496118_0160122 Ga0496118_0160122_95_1327 383
653 3300048924 Ga0496121_0016722 Ga0496121_0016722_5572_6804 383
654 3300048925 Ga0496122_0147682 Ga0496122_0147682_211_1443 383
655 3300048928 Ga0496125_0013265 Ga0496125_0013265_5681_6913 383
656 3300053104 Ga0500556_0000004 Ga0500556_0000004_288592_289824 383
657 3300053156 Ga0500622_0008898 Ga0500622_0008898_3732_4964 383
658 3300005327 Ga0070658_10084260 Ga0070658_100842602 384
659 3300005563 Ga0068855_100120954 Ga0068855_1001209542 384
660 3300005616 Ga0068852_100144505 Ga0068852_1001445052 384
661 3300025949 Ga0207667_10143404 Ga0207667_101434042 384
662 3300026078 Ga0207702_10305768 Ga0207702_103057682 384
663 3300049571 Ga0501034_0057589 Ga0501034_0057589_2516_3763 384
664 3300049823 Ga0501044_0140993 Ga0501044_0140993_445_1692 384
665 3300005617 Ga0068859_100105836 Ga0068859_1001058362 385
666 3300006931 Ga0097620_100105836 Ga0097620_1001058362 385
667 3300009094 Ga0111539_10121232 Ga0111539_101212323 385
668 3300009101 Ga0105247_10005849 Ga0105247_100058492 385
669 3300025297 Ga0209758_1002161 Ga0209758_100216110 385
670 3300025900 Ga0207710_10017555 Ga0207710_100175553 385
671 3300048929 Ga0496126_0092193 Ga0496126_0092193_968_2215 385
672 3300050509 nmdc:mga0qj67_121052_c1 nmdc:mga0qj67_121052_c1_361_1575 385
673 3300050511 nmdc:mga08y16_224811_c1 nmdc:mga08y16_224811_c1_288_1508 385
674 3300005471 Ga0070698_100144639 Ga0070698_1001446392 386
675 3300025925 Ga0207650_10114635 Ga0207650_101146351 386
676 3300044706 Ga0466964_0092781 Ga0466964_0092781_37_1299 386
677 3300046460 Ga0495638_0022055 Ga0495638_0022055_472_1704 386
678 3300046507 Ga0495606_0091769 Ga0495606_0091769_462_1694 386
679 3300046665 Ga0495661_0011562 Ga0495661_0011562_2784_4016 386
680 3300046810 Ga0495660_0015170 Ga0495660_0015170_187_1419 386
681 3300047320 Ga0495672_0018828 Ga0495672_0018828_562_1797 386
682 3300048920 Ga0496117_0055425 Ga0496117_0055425_798_2030 386
683 3300048921 Ga0496118_0065142 Ga0496118_0065142_395_1627 386
684 3300048921 Ga0496118_0066231 Ga0496118_0066231_726_1985 386
685 3300048922 Ga0496119_0108714 Ga0496119_0108714_54_1286 386
686 3300048925 Ga0496122_0071410 Ga0496122_0071410_1232_2464 386
687 3300048926 Ga0496123_0016093 Ga0496123_0016093_1409_2641 386
688 3300048927 Ga0496124_0154946 Ga0496124_0154946_456_1688 386
689 3300048929 Ga0496126_0149120 Ga0496126_0149120_450_1721 386
690 3300049580 Ga0501046_0039052 Ga0501046_0039052_1981_3228 386
691 3300049581 Ga0501047_0021187 Ga0501047_0021187_2839_4086 386
692 3300049586 Ga0501070_0024056 Ga0501070_0024056_2737_3984 386
693 3300049590 Ga0501074_0028751 Ga0501074_0028751_2312_3559 386
694 3300049742 Ga0501080_0022340 Ga0501080_0022340_4172_5419 386
695 3300049823 Ga0501044_0013127 Ga0501044_0013127_2726_3973 386
696 3300053086 Ga0500578_0049948 Ga0500578_0049948_1253_2485 386
697 3300053090 Ga0500646_0005404 Ga0500646_0005404_180_1412 386
698 3300053131 Ga0500652_000506 Ga0500652_000506_4320_5552 386
699 3300053156 Ga0500622_0071977 Ga0500622_0071977_25_1257 386
700 iso_pu_bacteria 2824704595 2824713647 386
701 iso_pu_bacteria 2824753945 2824763189 386
702 iso_pu_bacteria 2824763712 2824767485 386
703 iso_pu_bacteria 2904711408 2904714511 386
704 3300053085 Ga0495619_0155705 Ga0495619_0155705_36_1280 387
705 3300053111 Ga0500572_000432 Ga0500572_000432_11544_12749 387
706 3300053136 Ga0500559_0000381 Ga0500559_0000381_7027_8232 387
707 iso_pu_bacteria 2602042107 2603859352 388
708 iso_pu_bacteria 2857524615 2857529235 388
709 iso_pu_bacteria 2893066018 2893071346 388
710 iso_pu_bacteria 2919073203 2919076743 388
711 3300005329 Ga0070683_100114038 Ga0070683_1001140382 389
712 3300005981 Ga0081538_10080385 Ga0081538_100803852 389
713 3300048929 Ga0496126_0058272 Ga0496126_0058272_2106_3374 389
714 3300044658 Ga0466972_0000271 Ga0466972_0000271_21988_23235 390
715 3300048909 Ga0496106_0067366 Ga0496106_0067366_837_2114 390
716 3300048917 Ga0496114_0303766 Ga0496114_0303766_28_1299 390
717 iso_pu_bacteria 3005710791 3005714799 390
718 3300005435 Ga0070714_100091738 Ga0070714_1000917382 391
719 3300025915 Ga0207693_10027266 Ga0207693_100272662 391
720 3300048928 Ga0496125_0000090 Ga0496125_0000090_150786_152012 391
721 3300048928 Ga0496125_0001219 Ga0496125_0001219_22501_23715 391
722 3300048929 Ga0496126_0006937 Ga0496126_0006937_1267_2514 391
723 3300053177 Ga0500636_0043275 Ga0500636_0043275_1124_2350 391
724 iso_pu_bacteria 2511231028 2511400300 391
725 iso_pu_bacteria 2513237094 2513639073 391
726 iso_pu_bacteria 2513237095 2513645951 391
727 iso_pu_bacteria 2513237104 2513719549 391
728 iso_pu_bacteria 2816332527 2818241002 391
729 iso_pu_bacteria 2842038055 2842039166 391
730 iso_pu_bacteria 2842045827 2842047887 391
731 iso_pu_bacteria 2888378607 2888383951 391
732 iso_pu_bacteria 8056673599 8056673964 391
733 3300005327 Ga0070658_10104900 Ga0070658_101049002 392
734 3300005336 Ga0070680_100044899 Ga0070680_1000448992 392
735 3300005344 Ga0070661_100156637 Ga0070661_1001566372 392
736 3300005535 Ga0070684_100018139 Ga0070684_1000181393 392
737 3300005539 Ga0068853_100004914 Ga0068853_1000049142 392
738 3300009093 Ga0105240_10174717 Ga0105240_101747172 392
739 3300009545 Ga0105237_10009894 Ga0105237_100098946 392
740 3300010375 Ga0105239_10041301 Ga0105239_100413012 392
741 3300013104 Ga0157370_10030373 Ga0157370_100303732 392
742 3300013105 Ga0157369_10010593 Ga0157369_100105932 392
743 3300025295 Ga0209564_1001009 Ga0209564_10010095 392
744 3300025912 Ga0207707_10003700 Ga0207707_100037005 392
745 3300025919 Ga0207657_10001921 Ga0207657_100019219 392
746 3300025921 Ga0207652_10003203 Ga0207652_100032036 392
747 3300025949 Ga0207667_10012927 Ga0207667_100129276 392
748 iso_pu_bacteria 2513237139 2513872677 392
749 iso_pu_bacteria 2513237161 2514011946 392
750 iso_pu_bacteria 2524023205 2524440469 392
751 iso_pu_bacteria 2617270735 2617348921 392
752 iso_pu_bacteria 2744054633 2745075262 392
753 iso_pu_bacteria 2802429603 2805915425 392
754 iso_pu_bacteria 2824671348 2824675812 392
755 iso_pu_bacteria 2824687955 2824693120 392
756 iso_pu_bacteria 2824696289 2824701710 392
757 iso_pu_bacteria 2824773399 2824777680 392
758 iso_pu_bacteria 2838122688 2838123848 392
759 iso_pu_bacteria 2841941048 2841944024 392
760 iso_pu_bacteria 2841949485 2841949947 392
761 iso_pu_bacteria 2841966195 2841966366 392
762 iso_pu_bacteria 2841974524 2841975100 392
763 iso_pu_bacteria 2841983080 2841983329 392
764 iso_pu_bacteria 2847939898 2847946470 392
765 iso_pu_bacteria 2876761206 2876767068 392
766 iso_pu_bacteria 3005718088 3005722229 392
767 3300021441 Ga0213871_10017557 Ga0213871_100175572 393
768 3300048922 Ga0496119_0025227 Ga0496119_0025227_2908_4128 393
769 3300048929 Ga0496126_0001554 Ga0496126_0001554_15991_17256 393
770 3300048929 Ga0496126_0059868 Ga0496126_0059868_610_1830 393
771 3300053139 Ga0500568_0027954 Ga0500568_0027954_530_1750 393
772 iso_pu_bacteria 2517093001 2517101333 393
773 iso_pu_bacteria 2643221651 2644291194 393
774 3300035117 Ga0373953_0000341 Ga0373953_0000341_2866_4149 394
775 3300046454 Ga0495592_0000290 Ga0495592_0000290_9684_10967 394
776 3300046529 Ga0495652_0032669 Ga0495652_0032669_2411_3694 394
777 3300048920 Ga0496117_0037483 Ga0496117_0037483_1211_2476 394
778 3300048924 Ga0496121_0007107 Ga0496121_0007107_10632_11897 394
779 3300053093 Ga0500651_0001806 Ga0500651_0001806_4648_5880 394
780 3300053119 Ga0500595_019193 Ga0500595_019193_648_1880 394
781 3300053130 Ga0500642_0070172 Ga0500642_0070172_180_1412 394
782 iso_pu_bacteria 2507262055 2507508681 394
783 iso_pu_bacteria 2508501009 2508542777 394
784 iso_pu_bacteria 2508501042 2508691462 394
785 iso_pu_bacteria 2513237092 2513623132 394
786 iso_pu_bacteria 2824600985 2824603476 394
787 iso_pu_bacteria 2824609381 2824614755 394
788 iso_pu_bacteria 2824653114 2824654740 394
789 iso_pu_bacteria 2824679649 2824686943 394
790 iso_pu_bacteria 2841957949 2841958573 394
791 iso_pu_bacteria 2844315083 2844318997 394
792 iso_pu_bacteria 2847930680 2847936118 394
793 iso_pu_bacteria 2849076700 2849079411 394
794 iso_pu_bacteria 2857509624 2857514417 394
795 iso_pu_bacteria 2874590934 2874593418 394
796 iso_pu_bacteria 2874612657 2874615215 394
797 iso_pu_bacteria 2874645413 2874648972 394
798 iso_pu_bacteria 2876771140 2876773165 394
799 iso_pu_bacteria 2876818435 2876822055 394
800 iso_pu_bacteria 2879074833 2879077210 394
801 iso_pu_bacteria 2879083081 2879090097 394
802 iso_pu_bacteria 2879127579 2879130021 394
803 iso_pu_bacteria 2879142872 2879147062 394
804 iso_pu_bacteria 2885366525 2885370567 394
805 iso_pu_bacteria 2885409591 2885412148 394
806 iso_pu_bacteria 2888388044 2888393903 394
807 iso_pu_bacteria 2888419890 2888424375 394
808 iso_pu_bacteria 2903727486 2903729079 394
809 iso_pu_bacteria 2906602504 2906610124 394
810 iso_pu_bacteria 2906626472 2906628577 394
811 iso_pu_bacteria 2906643746 2906650482 394
812 iso_pu_bacteria 2922393267 2922396410 394
813 iso_pu_bacteria 2935608549 2935608790 394
814 iso_pu_bacteria 2935648319 2935649945 394
815 iso_pu_bacteria 2935656913 2935661903 394
816 iso_pu_bacteria 2935819856 2935821951 394
817 iso_pu_bacteria 2935847175 2935847533 394
818 iso_pu_bacteria 2935908558 2935909200 394
819 iso_pu_bacteria 2935916978 2935919921 394
820 iso_pu_bacteria 2935926038 2935926226 394
821 iso_pu_bacteria 2935934488 2935934676 394
822 iso_pu_bacteria 2935942939 2935943126 394
823 iso_pu_bacteria 2935951376 2935951564 394
824 iso_pu_bacteria 2935959822 2935966384 394
825 iso_pu_bacteria 2935967501 2935967689 394
826 iso_pu_bacteria 2935975950 2935977113 394
827 iso_pu_bacteria 2935984226 2935988271 394
828 iso_pu_bacteria 2936011229 2936012572 394
829 iso_pu_bacteria 2936019824 2936021136 394
830 iso_pu_bacteria 2936028420 2936029865 394
831 iso_pu_bacteria 2936046547 2936047330 394
832 iso_pu_bacteria 2936055302 2936057512 394
833 iso_pu_bacteria 2941531003 2941532648 394
834 iso_pu_bacteria 3005506211 3005510236 394
835 iso_pu_bacteria 3005587118 3005591041 394
836 iso_pu_bacteria 3005594810 3005599140 394
837 iso_pu_bacteria 8006926726 8006929987 394
838 iso_pu_bacteria 8016583857 8016591898 394
839 iso_pu_bacteria 8016630954 8016640455 394
840 iso_pu_bacteria 8019619141 8019628032 394
841 iso_pu_bacteria 8019629233 8019634568 394
842 iso_pu_bacteria 8019638758 8019645147 394
843 iso_pu_bacteria 8019659431 8019662463 394
844 iso_pu_bacteria 8019678201 8019684131 394
845 iso_pu_bacteria 8019687851 8019689971 394
846 iso_pu_bacteria 8056689827 8056693610 394
847 iso_pu_bacteria 8056967851 8056967938 394
848 3300053094 Ga0500566_0001312 Ga0500566_0001312_12853_14085 395
849 3300053122 Ga0500608_001947 Ga0500608_001947_5783_7015 395
850 3300053136 Ga0500559_0001772 Ga0500559_0001772_530_1762 395
851 3300053177 Ga0500636_0004887 Ga0500636_0004887_3945_5177 395
852 iso_pu_bacteria 2508501128 2509150407 395
853 iso_pu_bacteria 2513237096 2513654640 395
854 iso_pu_bacteria 2513237098 2513680095 395
855 iso_pu_bacteria 2513237101 2513692425 395
856 iso_pu_bacteria 2513237141 2513888996 395
857 iso_pu_bacteria 2513237145 2513915180 395
858 iso_pu_bacteria 2524023210 2524469578 395
859 iso_pu_bacteria 2721755755 2723845190 395
860 iso_pu_bacteria 2791355197 2793072040 395
861 iso_pu_bacteria 2791355199 2793080889 395
862 iso_pu_bacteria 2874604998 2874605096 395
863 iso_pu_bacteria 2879110137 2879113593 395
864 iso_pu_bacteria 2885383462 2885385966 395
865 iso_pu_bacteria 2889033259 2889039939 395
866 iso_pu_bacteria 2903768456 2903773882 395
867 iso_pu_bacteria 2904690495 2904695910 395
868 iso_pu_bacteria 2908756301 2908761031 395
869 iso_pu_bacteria 2922361189 2922365261 395
870 iso_pu_bacteria 2922425934 2922430185 395
871 iso_pu_bacteria 3005474847 3005480128 395
872 iso_pu_bacteria 8006964411 8006965639 395
873 iso_pu_bacteria 8006984368 8006987147 395
874 iso_pu_bacteria 8006994254 8006998829 395
875 iso_pu_bacteria 8016530956 8016534931 395
876 iso_pu_bacteria 8016539877 8016548138 395
877 iso_pu_bacteria 8016557553 8016562360 395
878 iso_pu_bacteria 8016566248 8016573272 395
879 iso_pu_bacteria 8016595262 8016600165 395
880 iso_pu_bacteria 8016622563 8016626643 395
881 iso_pu_bacteria 8019530166 8019534690 395
882 iso_pu_bacteria 8019547302 8019553752 395
883 iso_pu_bacteria 8019555841 8019556845 395
884 iso_pu_bacteria 8019565922 8019568453 395
885 iso_pu_bacteria 8056681323 8056686604 395
886 iso_pu_bacteria 2513237137 2513855952 396
887 iso_pu_bacteria 2874628541 2874633307 396
888 iso_pu_bacteria 2935769743 2935773201 396
889 iso_pu_bacteria 2935777560 2935778448 396
890 iso_pu_bacteria 2935785616 2935790434 396
891 iso_pu_bacteria 2935793552 2935798163 396
892 iso_pu_bacteria 8016603502 8016610587 396
893 iso_pu_bacteria 8016613128 8016614343 396
894 iso_pu_bacteria 8019538911 8019544784 396
895 3300005455 Ga0070663_100028292 Ga0070663_1000282922 397
896 3300013105 Ga0157369_10270003 Ga0157369_102700031 397
897 3300026067 Ga0207678_10066350 Ga0207678_100663502 397
898 iso_pu_bacteria 2513237102 2513700157 398
899 iso_pu_bacteria 2824617872 2824626093 398
900 iso_pu_bacteria 2824626560 2824634424 398
901 iso_pu_bacteria 2824635225 2824642090 398
902 iso_pu_bacteria 2824644064 2824651060 398
903 iso_pu_bacteria 2824714736 2824721652 398
904 iso_pu_bacteria 2824723954 2824731187 398
905 iso_pu_bacteria 2881364244 2881367030 398
906 iso_pu_bacteria 2922386360 2922390884 398
907 3300005536 Ga0070697_100041267 Ga0070697_1000412673 399
908 3300028573 Ga0265334_10010788 Ga0265334_100107883 399
909 3300031235 Ga0265330_10014850 Ga0265330_100148502 399
910 3300031235 Ga0265330_10040965 Ga0265330_100409652 399
911 3300031247 Ga0265340_10010814 Ga0265340_100108144 399
912 3300031250 Ga0265331_10064937 Ga0265331_100649372 399
913 3300031712 Ga0265342_10031018 Ga0265342_100310182 399
914 3300035170 Ga0373943_0001453 Ga0373943_0001453_8946_10193 399
915 3300035171 Ga0373946_0043256 Ga0373946_0043256_295_1542 399
916 3300035692 Ga0373935_0000674 Ga0373935_0000674_12779_14026 399
917 3300035695 Ga0373927_0001261 Ga0373927_0001261_14384_15631 399
918 3300037068 Ga0373925_0095313 Ga0373925_0095313_945_2192 399
919 3300046454 Ga0495592_0040196 Ga0495592_0040196_206_1453 399
920 3300046455 Ga0495603_0000616 Ga0495603_0000616_16471_17718 399
921 3300046459 Ga0495629_0004741 Ga0495629_0004741_7996_9243 399
922 3300046461 Ga0495641_0007040 Ga0495641_0007040_2391_3638 399
923 3300046473 Ga0495582_0007557 Ga0495582_0007557_3594_4841 399
924 3300046476 Ga0495662_0000028 Ga0495662_0000028_13322_14569 399
925 3300046499 Ga0495594_0000020 Ga0495594_0000020_44471_45718 399
926 3300046516 Ga0495628_0017267 Ga0495628_0017267_3555_4802 399
927 3300046526 Ga0495666_0043234 Ga0495666_0043234_352_1599 399
928 3300046531 Ga0495665_0000057 Ga0495665_0000057_32727_33974 399
929 3300046533 Ga0495640_0001737 Ga0495640_0001737_9518_10765 399
930 3300046642 Ga0495634_0004094 Ga0495634_0004094_390_1637 399
931 3300046663 Ga0495635_0029431 Ga0495635_0029431_1235_2482 399
932 3300046680 Ga0495646_0089917 Ga0495646_0089917_273_1520 399
933 3300046681 Ga0495647_0003084 Ga0495647_0003084_3684_4931 399
934 3300046683 Ga0495658_0000461 Ga0495658_0000461_254_1501 399
935 3300046689 Ga0495613_0006727 Ga0495613_0006727_3279_4526 399
936 3300046690 Ga0495624_0002019 Ga0495624_0002019_13410_14657 399
937 3300047315 Ga0495581_0017517 Ga0495581_0017517_495_1742 399
938 3300047319 Ga0495674_0003938 Ga0495674_0003938_7064_8311 399
939 3300047673 Ga0495593_0000165 Ga0495593_0000165_2245_3492 399
940 3300048088 Ga0495602_0106403 Ga0495602_0106403_376_1623 399
941 3300048089 Ga0495614_0019552 Ga0495614_0019552_402_1649 399
942 3300048911 Ga0496108_0176073 Ga0496108_0176073_396_1643 399
943 3300048912 Ga0496109_0022146 Ga0496109_0022146_146_1393 399
944 3300048915 Ga0496112_0374843 Ga0496112_0374843_71_1318 399
945 3300048916 Ga0496113_0171863 Ga0496113_0171863_106_1353 399
946 iso_pu_bacteria 2881665667 2881671081 399
947 iso_pu_bacteria 2515154112 2515628267 400
948 iso_pu_bacteria 2824746037 2824751586 401
949 iso_pu_bacteria 2932794094 2932797584 401
950 iso_pu_bacteria 2932801729 2932802901 401
951 iso_pu_bacteria 2935883170 2935885241 401
952 iso_pu_bacteria 3005483717 3005487253 401
953 3300035119 Ga0373956_0001242 Ga0373956_0001242_6172_7455 402
954 3300035172 Ga0373955_0001173 Ga0373955_0001173_9716_10999 402
955 3300035724 Ga0373933_0002955 Ga0373933_0002955_4276_5559 402
956 3300036401 Ga0373937_0000939 Ga0373937_0000939_8932_10215 402
957 3300046459 Ga0495629_0000176 Ga0495629_0000176_18712_19995 402
958 3300046462 Ga0495651_0000756 Ga0495651_0000756_19501_20784 402
959 3300046463 Ga0495653_0000437 Ga0495653_0000437_23165_24448 402
960 3300046511 Ga0495608_0003577 Ga0495608_0003577_9276_10559 402
961 3300046514 Ga0495618_0102678 Ga0495618_0102678_334_1617 402
962 3300046516 Ga0495628_0007919 Ga0495628_0007919_4484_5767 402
963 3300046533 Ga0495640_0004570 Ga0495640_0004570_456_1739 402
964 3300046536 Ga0495587_0004432 Ga0495587_0004432_1490_2773 402
965 3300046559 Ga0495667_0001700 Ga0495667_0001700_8932_10215 402
966 3300046663 Ga0495635_0000276 Ga0495635_0000276_12029_13312 402
967 3300046675 Ga0495657_0000218 Ga0495657_0000218_5377_6660 402
968 3300046678 Ga0495599_0000775 Ga0495599_0000775_9352_10635 402
969 3300046679 Ga0495623_0001412 Ga0495623_0001412_4566_5849 402
970 3300046809 Ga0495600_0000276 Ga0495600_0000276_7894_9177 402
971 3300047317 Ga0495604_0003092 Ga0495604_0003092_7339_8622 402
972 3300047319 Ga0495674_0027657 Ga0495674_0027657_432_1715 402
973 3300047322 Ga0495680_0000955 Ga0495680_0000955_25465_26748 402
974 3300047444 Ga0495675_0000603 Ga0495675_0000603_12518_13801 402
975 3300047471 Ga0495684_0000023 Ga0495684_0000023_71832_73115 402
976 3300047673 Ga0495593_0000193 Ga0495593_0000193_7695_8978 402
977 3300048088 Ga0495602_0007460 Ga0495602_0007460_1196_2479 402
978 3300048088 Ga0495602_0158161 Ga0495602_0158161_88_1371 402
979 3300053085 Ga0495619_0000111 Ga0495619_0000111_39672_40955 402
980 iso_pu_bacteria 2617270741 2617375859 402
981 3300046507 Ga0495606_0001226 Ga0495606_0001226_20875_22131 404
982 3300048915 Ga0496112_0000031 Ga0496112_0000031_38925_40181 404
983 3300003203 JGI25406J46586_10000184 JGI25406J46586_100001848 405
984 3300005985 Ga0081539_10000616 Ga0081539_1000061616 405

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

41

392

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7da5-assembly1.cif.gz_A cryo-em structure of the human mct1 d309n mutant in complex with basigin-2 in the inward-open conformation. 0.8284 22 398
8hpk-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form 0.8152 23 400
6e9n-assembly2.cif.gz_B e. coli d-galactonate:proton symporter in the inward open form 0.8151 21 398
7yr5-assembly1.cif.gz_A embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state 0.8062 26 396
7da5-assembly1.cif.gz_A cryo-em structure of the human mct1 d309n mutant in complex with basigin-2 in the inward-open conformation. 0.8041 22 398
ID Description Score Start End Superfamily
af_Q7TM99_11_268_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.915 23 187 1.20.1250.20
af_Q7K1L4_44_268_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9126 22 186 1.20.1250.20
af_Q5NC32_11_193_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9103 22 189 1.20.1250.20
af_Q8BGC3_15_203_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9084 22 189 1.20.1250.20
af_E7FB53_46_237_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9035 22 186 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A5C8NTZ1-F1-model_v4 MFS transporter 0.9122 22 392 GO:0016020
GO:0022857
AF-A0A521VHY9-F1-model_v4 MFS transporter 0.9114 19 399 GO:0016020
GO:0022857
AF-A0A2E5KP56-F1-model_v4 MFS transporter 0.9073 15 403 GO:0016020
GO:0022857
AF-A0A1Z9H653-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9043 22 404 GO:0016020
GO:0022857
AF-A0A3B8RGZ2-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.8932 23 397 GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
83.57 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map