F487478

General Info

Members Datasets Scaffolds Average Seq Length
984 318 1968 149

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1307023|Ga0436365_1307023_3795_4250
Length 151
Sequence MSAGGGADLNSEINVTPMVDIMLVLLIIFMVVTPFLQQGVTVAIPRDMNSPDVDPAIIKESSVVISIPNDGEYYIGKDKMEKADLGTKIEKMMKNKSDAERIVYVKSGVGVSYGNVVEVINVIRQQGIDKIGLVADKKKKGAXXPXXAPAG

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
196 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
197 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
198 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
199 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
203 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
204 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
205 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
206 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
207 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
208 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
209 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
213 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
227 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
228 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
229 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
230 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
231 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
232 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
233 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
234 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
241 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
242 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
243 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
244 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
245 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
246 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
247 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
248 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
249 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
250 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
251 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
252 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
253 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
254 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
255 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
256 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
257 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
258 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
259 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
260 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
261 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
262 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
263 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
264 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
265 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
266 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
267 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
268 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
269 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
270 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
271 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
272 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
273 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
274 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
275 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
276 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
277 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
280 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
281 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
284 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
285 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
286 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
287 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.39
Metatranscriptomes 6.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.73
Rhizosphere 97.76
Stem 0
Stem Tuber 0
Unclassified 1.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1307023 3300039437 Bacteria 4461
2 SwRhRL2b_contig_3792570 2162886007 Bacteria 1412
3 JGI24736J21556_1013917 3300001904 Bacteria 1296
4 JGI25406J46586_10003263 3300003203 Bacteria 7639
5 JGI25406J46586_10040563 3300003203 Unclassified 1649
6 JGI25406J46586_10071718 3300003203 Bacteria 1085
7 Ga0058859_10037811 3300004798 Bacteria 1816
8 Ga0058859_11787191 3300004798 Bacteria 879
9 Ga0058861_10006520 3300004800 Bacteria 2124
10 Ga0058861_11785577 3300004800 Bacteria 1295
11 Ga0058860_12206211 3300004801 Bacteria 3324
12 Ga0058862_12793453 3300004803 Bacteria 4084
13 Ga0065714_10002422 3300005288 Bacteria 18332
14 Ga0065704_10002802 3300005289 Bacteria 5189
15 Ga0065704_10078744 3300005289 Bacteria 4345
16 Ga0065704_10377713 3300005289 Bacteria 777
17 Ga0065712_10067912 3300005290 Bacteria 21528
18 Ga0065712_10159488 3300005290 Bacteria 1312
19 Ga0065712_10197587 3300005290 Bacteria 1121
20 Ga0065712_10214051 3300005290 Bacteria 1059
21 Ga0065712_10645250 3300005290 Bacteria 570
22 Ga0065715_10002757 3300005293 Bacteria 5526
23 Ga0065715_10013438 3300005293 Bacteria 2300
24 Ga0065715_10015070 3300005293 Bacteria 2642
25 Ga0065715_10044989 3300005293 Bacteria 1555
26 Ga0065715_10091505 3300005293 Bacteria 5744
27 Ga0065715_10097604 3300005293 Bacteria 3678
28 Ga0065715_10098699 3300005293 Bacteria 3510
29 Ga0065715_10110866 3300005293 Bacteria 2597
30 Ga0065715_10129505 3300005293 Bacteria 2044
31 Ga0065715_10209503 3300005293 Bacteria 1308
32 Ga0065715_10216859 3300005293 Bacteria 1265
33 Ga0065715_10282550 3300005293 Bacteria 1083
34 Ga0065715_10728982 3300005293 Bacteria 640
35 Ga0065707_10001055 3300005295 Bacteria 16264
36 Ga0065707_10004691 3300005295 Bacteria 3074
37 Ga0065707_10058057 3300005295 Bacteria 827
38 Ga0065707_10086778 3300005295 Bacteria 5296
39 Ga0065707_10096132 3300005295 Bacteria 3301
40 Ga0065707_10351689 3300005295 Bacteria 912
41 Ga0065707_10383195 3300005295 Bacteria 874
42 Ga0070676_10066987 3300005328 Bacteria 2146
43 Ga0070676_10102384 3300005328 Bacteria 1771
44 Ga0070676_10138298 3300005328 Bacteria 1548
45 Ga0070676_10821509 3300005328 Bacteria 687
46 Ga0070690_100006333 3300005330 Bacteria 6711
47 Ga0070690_100099843 3300005330 Bacteria 1923
48 Ga0070690_100235532 3300005330 Bacteria 1289
49 Ga0070670_100108680 3300005331 Bacteria 2390
50 Ga0070670_100264909 3300005331 Bacteria 1499
51 Ga0070670_100635315 3300005331 Bacteria 957
52 Ga0070677_10070423 3300005333 Bacteria 1470
53 Ga0068869_100052996 3300005334 Bacteria 2947
54 Ga0068869_100095847 3300005334 Bacteria 2239
55 Ga0068869_100379224 3300005334 Bacteria 1158
56 Ga0070666_10022084 3300005335 Bacteria 4129
57 Ga0070666_10117445 3300005335 Bacteria 1842
58 Ga0070666_10259346 3300005335 Bacteria 1232
59 Ga0070680_100042114 3300005336 Bacteria 3704
60 Ga0070680_100597912 3300005336 Bacteria 947
61 Ga0070682_100019241 3300005337 Bacteria 4002
62 Ga0070682_100125055 3300005337 Bacteria 1732
63 Ga0070682_100591324 3300005337 Bacteria 875
64 Ga0068868_100005906 3300005338 Bacteria 8636
65 Ga0068868_100030747 3300005338 Bacteria 4118
66 Ga0068868_100774799 3300005338 Bacteria 863
67 Ga0070689_100028230 3300005340 Bacteria 4239
68 Ga0070689_100097193 3300005340 Bacteria 2328
69 Ga0070689_100246324 3300005340 Bacteria 1473
70 Ga0070689_100300727 3300005340 Bacteria 1335
71 Ga0070687_100006516 3300005343 Bacteria 4789
72 Ga0070687_100011755 3300005343 Bacteria 3840
73 Ga0070687_100195573 3300005343 Bacteria 1222
74 Ga0070687_100314905 3300005343 Bacteria 998
75 Ga0070687_100762380 3300005343 Bacteria 682
76 Ga0070661_100004415 3300005344 Bacteria 9698
77 Ga0070692_10015021 3300005345 Bacteria 3653
78 Ga0070692_10032276 3300005345 Bacteria 2632
79 Ga0070692_10075094 3300005345 Bacteria 1809
80 Ga0070692_10211698 3300005345 Bacteria 1141
81 Ga0070669_100002945 3300005353 Bacteria 12272
82 Ga0070669_100011927 3300005353 Bacteria 6166
83 Ga0070669_100045403 3300005353 Bacteria 3202
84 Ga0070675_100021098 3300005354 Bacteria 5202
85 Ga0070675_100664457 3300005354 Bacteria 948
86 Ga0070675_101017975 3300005354 Bacteria 761
87 Ga0070675_101047017 3300005354 Bacteria 750
88 Ga0070671_100004218 3300005355 Bacteria 11372
89 Ga0070671_100088170 3300005355 Bacteria 2596
90 Ga0070671_100121770 3300005355 Bacteria 2196
91 Ga0070674_100039569 3300005356 Bacteria 3185
92 Ga0070673_100018397 3300005364 Bacteria 4989
93 Ga0070673_100172102 3300005364 Bacteria 1849
94 Ga0070673_100233912 3300005364 Bacteria 1595
95 Ga0070673_100423393 3300005364 Bacteria 1194
96 Ga0070673_100432623 3300005364 Bacteria 1181
97 Ga0070673_100459934 3300005364 Bacteria 1146
98 Ga0070673_100856479 3300005364 Bacteria 841
99 Ga0070673_101148137 3300005364 Bacteria 727
100 Ga0070688_100001878 3300005365 Bacteria 10524
101 Ga0070688_100531796 3300005365 Bacteria 891
102 Ga0070688_100674946 3300005365 Bacteria 798
103 Ga0070659_100007191 3300005366 Bacteria 8077
104 Ga0070659_101212006 3300005366 Bacteria 668
105 Ga0070703_10014268 3300005406 Bacteria 2262
106 Ga0070703_10065728 3300005406 Bacteria 1198
107 Ga0070701_10022224 3300005438 Bacteria 3039
108 Ga0070705_100016415 3300005440 Bacteria 3848
109 Ga0070705_100261528 3300005440 Bacteria 1220
110 Ga0070705_100306745 3300005440 Bacteria 1140
111 Ga0070705_100855671 3300005440 Bacteria 728
112 Ga0070700_100013034 3300005441 Bacteria 4662
113 Ga0070700_100018058 3300005441 Bacteria 4048
114 Ga0070700_100334029 3300005441 Bacteria 1118
115 Ga0070694_100005562 3300005444 Bacteria 7633
116 Ga0070694_100025291 3300005444 Bacteria 3841
117 Ga0070694_100119373 3300005444 Bacteria 1890
118 Ga0070694_100128151 3300005444 Bacteria 1830
119 Ga0070694_100210485 3300005444 Bacteria 1454
120 Ga0070694_100236668 3300005444 Bacteria 1376
121 Ga0070694_100297038 3300005444 Bacteria 1236
122 Ga0070694_100450934 3300005444 Bacteria 1016
123 Ga0070694_100777654 3300005444 Bacteria 783
124 Ga0070694_100869485 3300005444 Bacteria 743
125 Ga0070708_100000434 3300005445 Bacteria 31168
126 Ga0070708_100841344 3300005445 Bacteria 862
127 Ga0070663_101215272 3300005455 Bacteria 663
128 Ga0070678_100051479 3300005456 Bacteria 2986
129 Ga0070662_100234207 3300005457 Bacteria 1470
130 Ga0070662_100625776 3300005457 Bacteria 907
131 Ga0070681_10000210 3300005458 Bacteria 45431
132 Ga0070681_10014405 3300005458 Bacteria 7870
133 Ga0068867_100009338 3300005459 Bacteria 6922
134 Ga0068867_100032431 3300005459 Bacteria 3778
135 Ga0068867_100263636 3300005459 Bacteria 1406
136 Ga0068867_100284494 3300005459 Bacteria 1357
137 Ga0068867_100380174 3300005459 Bacteria 1186
138 Ga0068867_100643069 3300005459 Bacteria 930
139 Ga0068867_101007656 3300005459 Bacteria 755
140 Ga0068867_101531394 3300005459 Bacteria 622
141 Ga0070685_10044660 3300005466 Bacteria 2537
142 Ga0070706_100005802 3300005467 Bacteria 11734
143 Ga0070706_100408519 3300005467 Bacteria 1264
144 Ga0070707_100370770 3300005468 Bacteria 1391
145 Ga0070707_100490648 3300005468 Bacteria 1190
146 Ga0070707_101708610 3300005468 Bacteria 596
147 Ga0070698_100003232 3300005471 Bacteria 17943
148 Ga0070698_100004708 3300005471 Bacteria 14986
149 Ga0070698_100007556 3300005471 Bacteria 11756
150 Ga0070698_100008950 3300005471 Bacteria 10773
151 Ga0070698_100655783 3300005471 Bacteria 991
152 Ga0070699_100003953 3300005518 Bacteria 13102
153 Ga0070699_100017226 3300005518 Bacteria 6206
154 Ga0070699_100057062 3300005518 Bacteria 3382
155 Ga0070699_100181851 3300005518 Bacteria 1866
156 Ga0070699_100220534 3300005518 Bacteria 1690
157 Ga0070699_100846004 3300005518 Bacteria 838
158 Ga0070699_100973028 3300005518 Bacteria 778
159 Ga0070679_100000055 3300005530 Bacteria 84504
160 Ga0070679_100011367 3300005530 Bacteria 8481
161 Ga0070679_100030730 3300005530 Bacteria 5305
162 Ga0070684_100929473 3300005535 Bacteria 815
163 Ga0070697_100003858 3300005536 Bacteria 11513
164 Ga0070697_100184378 3300005536 Bacteria 1770
165 Ga0070697_100312298 3300005536 Bacteria 1353
166 Ga0070697_100458596 3300005536 Bacteria 1111
167 Ga0068853_100026045 3300005539 Bacteria 4910
168 Ga0068853_100167766 3300005539 Bacteria 1985
169 Ga0068853_100628945 3300005539 Bacteria 1020
170 Ga0068853_100761502 3300005539 Bacteria 926
171 Ga0068853_101150642 3300005539 Bacteria 749
172 Ga0070672_100498200 3300005543 Bacteria 1054
173 Ga0070672_100866621 3300005543 Bacteria 797
174 Ga0070686_100005090 3300005544 Bacteria 7258
175 Ga0070686_100005367 3300005544 Bacteria 7088
176 Ga0070695_100044100 3300005545 Bacteria 2838
177 Ga0070695_100105378 3300005545 Bacteria 1905
178 Ga0070695_100298524 3300005545 Bacteria 1190
179 Ga0070695_100304227 3300005545 Bacteria 1180
180 Ga0070695_100407973 3300005545 Bacteria 1032
181 Ga0070696_100004598 3300005546 Bacteria 9212
182 Ga0070696_100044023 3300005546 Bacteria 3090
183 Ga0070696_100113232 3300005546 Bacteria 1956
184 Ga0070696_100218922 3300005546 Bacteria 1428
185 Ga0070696_100272918 3300005546 Bacteria 1286
186 Ga0070696_100402440 3300005546 Bacteria 1071
187 Ga0070696_100513735 3300005546 Bacteria 955
188 Ga0070696_100830855 3300005546 Unclassified 762
189 Ga0070696_100860764 3300005546 Bacteria 750
190 Ga0070696_101263498 3300005546 Bacteria 626
191 Ga0070696_101383503 3300005546 Bacteria 599
192 Ga0070693_100001720 3300005547 Bacteria 9950
193 Ga0070693_100021995 3300005547 Bacteria 3384
194 Ga0070693_100111318 3300005547 Bacteria 1685
195 Ga0070693_100146361 3300005547 Bacteria 1492
196 Ga0070693_100404860 3300005547 Bacteria 947
197 Ga0070665_100129895 3300005548 Bacteria 2521
198 Ga0070665_101254248 3300005548 Bacteria 752
199 Ga0070704_100024057 3300005549 Bacteria 3991
200 Ga0070704_100122058 3300005549 Bacteria 2004
201 Ga0070704_100259998 3300005549 Bacteria 1430
202 Ga0070704_100323137 3300005549 Bacteria 1294
203 Ga0070704_101886176 3300005549 Bacteria 554
204 Ga0068855_100704032 3300005563 Bacteria 1081
205 Ga0070664_100002394 3300005564 Bacteria 15063
206 Ga0070664_100112274 3300005564 Bacteria 2380
207 Ga0070664_100686940 3300005564 Bacteria 953
208 Ga0068857_100002985 3300005577 Bacteria 13949
209 Ga0068857_100079866 3300005577 Bacteria 2920
210 Ga0068857_100128156 3300005577 Bacteria 2287
211 Ga0068857_100353960 3300005577 Bacteria 1360
212 Ga0068857_100389349 3300005577 Bacteria 1295
213 Ga0068857_100527483 3300005577 Bacteria 1110
214 Ga0068857_100720717 3300005577 Bacteria 948
215 Ga0068857_100778510 3300005577 Bacteria 913
216 Ga0068857_100926987 3300005577 Bacteria 836
217 Ga0068854_100072054 3300005578 Bacteria 2529
218 Ga0068854_100161615 3300005578 Bacteria 1735
219 Ga0068854_100411412 3300005578 Bacteria 1121
220 Ga0068854_100651579 3300005578 Bacteria 904
221 Ga0068854_100666131 3300005578 Bacteria 895
222 Ga0068854_100737144 3300005578 Bacteria 854
223 Ga0068854_100880650 3300005578 Bacteria 786
224 Ga0068854_101155070 3300005578 Bacteria 692
225 Ga0068854_101512382 3300005578 Bacteria 610
226 Ga0068856_100018428 3300005614 Bacteria 6766
227 Ga0068856_100585758 3300005614 Bacteria 1137
228 Ga0070702_100002052 3300005615 Bacteria 8515
229 Ga0070702_100053906 3300005615 Bacteria 2311
230 Ga0070702_100054066 3300005615 Bacteria 2308
231 Ga0070702_100068508 3300005615 Bacteria 2088
232 Ga0070702_100153437 3300005615 Bacteria 1481
233 Ga0070702_100224608 3300005615 Bacteria 1258
234 Ga0070702_100542676 3300005615 Bacteria 862
235 Ga0070702_100641879 3300005615 Bacteria 802
236 Ga0070702_100980501 3300005615 Bacteria 668
237 Ga0068852_100083227 3300005616 Bacteria 2845
238 Ga0068852_100392323 3300005616 Bacteria 1364
239 Ga0068852_100710453 3300005616 Bacteria 1016
240 Ga0068859_100027309 3300005617 Bacteria 5725
241 Ga0068859_100027316 3300005617 Bacteria 5724
242 Ga0068859_100043438 3300005617 Bacteria 4516
243 Ga0068859_100118654 3300005617 Bacteria 2711
244 Ga0068859_100179701 3300005617 Bacteria 2198
245 Ga0068859_100246322 3300005617 Bacteria 1877
246 Ga0068859_100278919 3300005617 Bacteria 1764
247 Ga0068859_100290863 3300005617 Bacteria 1727
248 Ga0068859_100410365 3300005617 Bacteria 1450
249 Ga0068859_100489294 3300005617 Bacteria 1325
250 Ga0068859_102017121 3300005617 Bacteria 637
251 Ga0068864_100003101 3300005618 Bacteria 13726
252 Ga0068864_100006026 3300005618 Bacteria 9953
253 Ga0068864_100017144 3300005618 Bacteria 6040
254 Ga0068864_100072511 3300005618 Bacteria 3001
255 Ga0068864_100110037 3300005618 Bacteria 2453
256 Ga0068864_100420964 3300005618 Bacteria 1273
257 Ga0068864_100483763 3300005618 Bacteria 1188
258 Ga0068864_100485313 3300005618 Bacteria 1187
259 Ga0068864_100518976 3300005618 Bacteria 1148
260 Ga0068864_100654015 3300005618 Bacteria 1024
261 Ga0068864_100746975 3300005618 Bacteria 958
262 Ga0068864_100792791 3300005618 Bacteria 931
263 Ga0068864_100975693 3300005618 Bacteria 839
264 Ga0068864_101150038 3300005618 Bacteria 774
265 Ga0068866_10035038 3300005718 Bacteria 2449
266 Ga0068866_10047301 3300005718 Bacteria 2168
267 Ga0068861_100013847 3300005719 Bacteria 5651
268 Ga0068861_100015358 3300005719 Bacteria 5395
269 Ga0068861_100186192 3300005719 Bacteria 1731
270 Ga0068861_100296486 3300005719 Bacteria 1398
271 Ga0068861_101348841 3300005719 Bacteria 695
272 Ga0068861_101517866 3300005719 Bacteria 658
273 Ga0068851_10103012 3300005834 Bacteria 1516
274 Ga0068851_10213304 3300005834 Bacteria 1082
275 Ga0068870_10010327 3300005840 Bacteria 4287
276 Ga0068870_10024019 3300005840 Bacteria 3013
277 Ga0068870_10065138 3300005840 Bacteria 1970
278 Ga0068870_10606030 3300005840 Bacteria 745
279 Ga0068863_100025624 3300005841 Bacteria 5623
280 Ga0068863_100074733 3300005841 Bacteria 3206
281 Ga0068863_100083043 3300005841 Bacteria 3035
282 Ga0068863_100721401 3300005841 Bacteria 992
283 Ga0068863_100964366 3300005841 Bacteria 854
284 Ga0068863_101475057 3300005841 Bacteria 688
285 Ga0068858_100010496 3300005842 Bacteria 8776
286 Ga0068858_100017272 3300005842 Bacteria 6769
287 Ga0068858_100097923 3300005842 Bacteria 2734
288 Ga0068858_100102356 3300005842 Bacteria 2672
289 Ga0068858_100339870 3300005842 Bacteria 1437
290 Ga0068858_100341701 3300005842 Bacteria 1433
291 Ga0068858_100943008 3300005842 Bacteria 845
292 Ga0068860_100009743 3300005843 Bacteria 9537
293 Ga0068860_100012631 3300005843 Bacteria 8310
294 Ga0068860_100014598 3300005843 Bacteria 7686
295 Ga0068860_100022086 3300005843 Bacteria 6160
296 Ga0068860_100024200 3300005843 Bacteria 5871
297 Ga0068860_100102563 3300005843 Bacteria 2730
298 Ga0068860_100104739 3300005843 Bacteria 2701
299 Ga0068860_100318668 3300005843 Bacteria 1526
300 Ga0068860_100651957 3300005843 Bacteria 1061
301 Ga0068860_100683416 3300005843 Unclassified 1036
302 Ga0068862_100005138 3300005844 Bacteria 11002
303 Ga0068862_100018320 3300005844 Bacteria 5831
304 Ga0068862_100228949 3300005844 Bacteria 1685
305 Ga0068862_100235752 3300005844 Bacteria 1662
306 Ga0068862_100867565 3300005844 Bacteria 885
307 Ga0068862_100961964 3300005844 Bacteria 842
308 Ga0068862_101472665 3300005844 Bacteria 686
309 Ga0068862_101726938 3300005844 Bacteria 634
310 Ga0081539_10000525 3300005985 Bacteria 79633
311 Ga0081539_10000752 3300005985 Bacteria 64385
312 Ga0081539_10001813 3300005985 Bacteria 33764
313 Ga0070716_100262208 3300006173 Bacteria 1183
314 Ga0070716_100585771 3300006173 Bacteria 837
315 Ga0070712_100923557 3300006175 Bacteria 753
316 Ga0097621_100000830 3300006237 Bacteria 21817
317 Ga0097621_100017533 3300006237 Bacteria 5439
318 Ga0097621_100033487 3300006237 Bacteria 4092
319 Ga0097621_100071218 3300006237 Bacteria 2872
320 Ga0097621_101508131 3300006237 Bacteria 638
321 Ga0068871_100004696 3300006358 Bacteria 9549
322 Ga0068871_100005337 3300006358 Bacteria 9009
323 Ga0068871_100008257 3300006358 Bacteria 7485
324 Ga0068871_100074769 3300006358 Bacteria 2795
325 Ga0068871_100679936 3300006358 Bacteria 941
326 Ga0075428_100117386 3300006844 Bacteria 2899
327 Ga0075428_100194946 3300006844 Bacteria 2191
328 Ga0075430_100006779 3300006846 Bacteria 9658
329 Ga0075431_100035449 3300006847 Bacteria 5137
330 Ga0075433_10010708 3300006852 Bacteria 7376
331 Ga0075433_10043208 3300006852 Bacteria 3911
332 Ga0075433_10050227 3300006852 Bacteria 3630
333 Ga0075433_10063503 3300006852 Bacteria 3235
334 Ga0075433_10382535 3300006852 Bacteria 1242
335 Ga0075433_10430086 3300006852 Bacteria 1164
336 Ga0075434_100037024 3300006871 Bacteria 4828
337 Ga0075434_100136110 3300006871 Bacteria 2476
338 Ga0075434_100636716 3300006871 Bacteria 1085
339 Ga0075429_100027042 3300006880 Bacteria 4981
340 Ga0075429_100135130 3300006880 Bacteria 2158
341 Ga0075429_100207443 3300006880 Bacteria 1717
342 Ga0075429_101276089 3300006880 Bacteria 641
343 Ga0068865_100281587 3300006881 Bacteria 1324
344 Ga0068865_100302861 3300006881 Bacteria 1280
345 Ga0068865_100401947 3300006881 Bacteria 1122
346 Ga0068865_100428571 3300006881 Bacteria 1089
347 Ga0075436_100132687 3300006914 Bacteria 1747
348 Ga0097620_100027309 3300006931 Bacteria 5725
349 Ga0097620_100027318 3300006931 Bacteria 5724
350 Ga0097620_100043436 3300006931 Bacteria 4516
351 Ga0097620_100103636 3300006931 Bacteria 2903
352 Ga0097620_100118653 3300006931 Bacteria 2711
353 Ga0097620_100179689 3300006931 Bacteria 2198
354 Ga0097620_100246313 3300006931 Bacteria 1877
355 Ga0097620_100278916 3300006931 Bacteria 1764
356 Ga0097620_100290835 3300006931 Bacteria 1727
357 Ga0097620_100410354 3300006931 Bacteria 1450
358 Ga0097620_100489291 3300006931 Bacteria 1325
359 Ga0097620_102016064 3300006931 Bacteria 637
360 Ga0075435_100060456 3300007076 Bacteria 3072
361 Ga0075435_100213734 3300007076 Bacteria 1636
362 Ga0105251_10027247 3300009011 Bacteria 2900
363 Ga0105251_10618530 3300009011 Bacteria 515
364 Ga0105250_10090639 3300009092 Bacteria 1243
365 Ga0105250_10122119 3300009092 Bacteria 1071
366 Ga0105250_10445161 3300009092 Bacteria 581
367 Ga0105250_10497488 3300009092 Unclassified 553
368 Ga0105240_10057890 3300009093 Bacteria 4839
369 Ga0111539_10002867 3300009094 Bacteria 22888
370 Ga0111539_10078817 3300009094 Bacteria 3874
371 Ga0105245_10009331 3300009098 Bacteria 8556
372 Ga0105245_11539012 3300009098 Bacteria 716
373 Ga0105247_10255012 3300009101 Bacteria 1200
374 Ga0105247_10272603 3300009101 Bacteria 1164
375 Ga0105247_10403876 3300009101 Bacteria 974
376 Ga0105247_10698225 3300009101 Bacteria 763
377 Ga0105247_11158998 3300009101 Bacteria 613
378 Ga0105247_11259072 3300009101 Bacteria 592
379 Ga0114129_10004615 3300009147 Bacteria 19448
380 Ga0114129_10019363 3300009147 Bacteria 9693
381 Ga0114129_10068750 3300009147 Bacteria 4938
382 Ga0114129_10096603 3300009147 Bacteria 4090
383 Ga0114129_10103124 3300009147 Bacteria 3944
384 Ga0114129_10432029 3300009147 Bacteria 1730
385 Ga0114129_10458817 3300009147 Bacteria 1670
386 Ga0114129_10464217 3300009147 Bacteria 1659
387 Ga0114129_10682285 3300009147 Bacteria 1322
388 Ga0114129_10697809 3300009147 Bacteria 1305
389 Ga0114129_11412598 3300009147 Bacteria 858
390 Ga0105243_10009599 3300009148 Bacteria 7368
391 Ga0105243_10098488 3300009148 Bacteria 2422
392 Ga0105243_10114730 3300009148 Bacteria 2261
393 Ga0105243_10197742 3300009148 Bacteria 1761
394 Ga0105243_10319607 3300009148 Bacteria 1414
395 Ga0105243_10378941 3300009148 Bacteria 1308
396 Ga0105243_10657151 3300009148 Bacteria 1017
397 Ga0105241_10059308 3300009174 Bacteria 2942
398 Ga0105241_10099448 3300009174 Bacteria 2310
399 Ga0105241_10263108 3300009174 Bacteria 1466
400 Ga0105241_10380254 3300009174 Bacteria 1234
401 Ga0105241_10578992 3300009174 Bacteria 1012
402 Ga0105241_10805653 3300009174 Bacteria 866
403 Ga0105241_10941541 3300009174 Bacteria 805
404 Ga0105241_11480046 3300009174 Bacteria 653
405 Ga0105242_10014709 3300009176 Bacteria 6059
406 Ga0105242_10159525 3300009176 Bacteria 1973
407 Ga0105242_10444664 3300009176 Bacteria 1220
408 Ga0105242_11463034 3300009176 Bacteria 713
409 Ga0105242_11890177 3300009176 Bacteria 637
410 Ga0105242_12330793 3300009176 Bacteria 582
411 Ga0105248_10003263 3300009177 Bacteria 17988
412 Ga0105248_10013986 3300009177 Bacteria 8829
413 Ga0105248_10018293 3300009177 Bacteria 7737
414 Ga0105248_10356807 3300009177 Bacteria 1646
415 Ga0105248_10473237 3300009177 Bacteria 1412
416 Ga0105248_11207229 3300009177 Unclassified 855
417 Ga0105248_12359859 3300009177 Bacteria 606
418 Ga0105248_12848561 3300009177 Bacteria 551
419 Ga0105237_10001880 3300009545 Bacteria 26792
420 Ga0105237_10118114 3300009545 Bacteria 2646
421 Ga0105238_10003824 3300009551 Bacteria 14956
422 Ga0105238_10195503 3300009551 Bacteria 1998
423 Ga0105249_10067266 3300009553 Bacteria 3300
424 Ga0105249_10077307 3300009553 Bacteria 3086
425 Ga0105249_10087354 3300009553 Bacteria 2909
426 Ga0105249_10262098 3300009553 Bacteria 1718
427 Ga0105249_10708475 3300009553 Bacteria 1067
428 Ga0105249_11144262 3300009553 Bacteria 849
429 Ga0105239_10211992 3300010375 Bacteria 2171
430 Ga0105239_10294427 3300010375 Bacteria 1828
431 Ga0105239_10535677 3300010375 Bacteria 1333
432 Ga0105246_10019552 3300011119 Bacteria 4330
433 Ga0105246_10061554 3300011119 Bacteria 2612
434 Ga0105246_10151987 3300011119 Bacteria 1753
435 Ga0105246_10286300 3300011119 Bacteria 1324
436 Ga0105246_10573274 3300011119 Bacteria 971
437 Ga0105246_10614690 3300011119 Bacteria 941
438 Ga0105246_10767580 3300011119 Bacteria 852
439 Ga0105246_11504815 3300011119 Bacteria 632
440 Ga0157315_1054827 3300012508 Bacteria 546
441 Ga0157373_10204452 3300013100 Bacteria 1392
442 Ga0157373_10266452 3300013100 Bacteria 1213
443 Ga0157371_10757546 3300013102 Unclassified 729
444 Ga0157371_10839228 3300013102 Bacteria 694
445 Ga0157374_10023107 3300013296 Bacteria 5556
446 Ga0157374_10177062 3300013296 Bacteria 2082
447 Ga0157378_10018643 3300013297 Bacteria 6102
448 Ga0157378_10034991 3300013297 Bacteria 4441
449 Ga0157378_10052482 3300013297 Bacteria 3628
450 Ga0157378_10064261 3300013297 Bacteria 3282
451 Ga0157378_10722848 3300013297 Bacteria 1017
452 Ga0157378_11183640 3300013297 Bacteria 803
453 Ga0157378_11906548 3300013297 Bacteria 643
454 Ga0157378_12866399 3300013297 Bacteria 534
455 Ga0163162_10005313 3300013306 Bacteria 12435
456 Ga0163162_10009964 3300013306 Bacteria 9243
457 Ga0163162_10019508 3300013306 Bacteria 6653
458 Ga0163162_10039437 3300013306 Bacteria 4720
459 Ga0163162_10074385 3300013306 Bacteria 3456
460 Ga0163162_10167850 3300013306 Bacteria 2319
461 Ga0163162_10180244 3300013306 Bacteria 2238
462 Ga0163162_10299015 3300013306 Bacteria 1741
463 Ga0163162_10610646 3300013306 Bacteria 1216
464 Ga0163162_10893570 3300013306 Bacteria 1002
465 Ga0157372_10145865 3300013307 Bacteria 2729
466 Ga0157372_10578422 3300013307 Bacteria 1309
467 Ga0157372_10938931 3300013307 Unclassified 1003
468 Ga0157372_11517891 3300013307 Bacteria 772
469 Ga0157372_12121415 3300013307 Bacteria 646
470 Ga0157375_10028620 3300013308 Bacteria 5227
471 Ga0157375_10043540 3300013308 Bacteria 4355
472 Ga0157375_10159047 3300013308 Bacteria 2400
473 Ga0157375_10196215 3300013308 Bacteria 2174
474 Ga0157375_10237720 3300013308 Bacteria 1981
475 Ga0157375_10461091 3300013308 Bacteria 1436
476 Ga0157375_10541485 3300013308 Bacteria 1326
477 Ga0157375_10634170 3300013308 Bacteria 1226
478 Ga0157375_10794243 3300013308 Bacteria 1095
479 Ga0157375_12373467 3300013308 Bacteria 633
480 Ga0163163_10008090 3300014325 Bacteria 9316
481 Ga0163163_10018411 3300014325 Bacteria 6537
482 Ga0163163_10021125 3300014325 Bacteria 6141
483 Ga0163163_10022427 3300014325 Bacteria 5979
484 Ga0163163_10038050 3300014325 Bacteria 4684
485 Ga0163163_10076457 3300014325 Bacteria 3343
486 Ga0163163_10101754 3300014325 Bacteria 2896
487 Ga0163163_10248087 3300014325 Bacteria 1831
488 Ga0163163_10315739 3300014325 Bacteria 1616
489 Ga0157380_10006696 3300014326 Bacteria 8138
490 Ga0157380_10017913 3300014326 Bacteria 5251
491 Ga0157380_10046789 3300014326 Bacteria 3399
492 Ga0157380_10202387 3300014326 Bacteria 1763
493 Ga0157380_10659579 3300014326 Unclassified 1045
494 Ga0157380_11897526 3300014326 Bacteria 656
495 Ga0157377_10098979 3300014745 Bacteria 1734
496 Ga0157377_10332837 3300014745 Bacteria 1013
497 Ga0157379_10206924 3300014968 Bacteria 1775
498 Ga0157379_10455746 3300014968 Bacteria 1181
499 Ga0157379_11805751 3300014968 Bacteria 601
500 Ga0157376_10024662 3300014969 Bacteria 4726
501 Ga0157376_10257075 3300014969 Bacteria 1634
502 Ga0163161_10008025 3300017792 Bacteria 7302
503 Ga0163161_10066876 3300017792 Bacteria 2625
504 Ga0163161_10345090 3300017792 Bacteria 1182
505 Ga0163161_10707692 3300017792 Bacteria 839
506 Ga0213876_10046675 3300021384 Bacteria 2290
507 Ga0207697_10004398 3300025315 Bacteria 6735
508 Ga0207656_10049296 3300025321 Bacteria 1815
509 Ga0207653_10068944 3300025885 Bacteria 1206
510 Ga0207653_10128711 3300025885 Bacteria 917
511 Ga0207642_10031904 3300025899 Bacteria 2212
512 Ga0207642_10180353 3300025899 Bacteria 1150
513 Ga0207710_10335150 3300025900 Bacteria 769
514 Ga0207680_10098641 3300025903 Bacteria 1873
515 Ga0207680_10254404 3300025903 Bacteria 1214
516 Ga0207680_10254885 3300025903 Bacteria 1213
517 Ga0207647_10038006 3300025904 Bacteria 3048
518 Ga0207647_10074173 3300025904 Bacteria 2050
519 Ga0207647_10254231 3300025904 Bacteria 1007
520 Ga0207647_10301804 3300025904 Bacteria 912
521 Ga0207645_10179666 3300025907 Bacteria 1388
522 Ga0207645_10285407 3300025907 Bacteria 1097
523 Ga0207645_10327447 3300025907 Bacteria 1023
524 Ga0207645_10360890 3300025907 Bacteria 973
525 Ga0207643_10001161 3300025908 Bacteria 15657
526 Ga0207643_10009888 3300025908 Bacteria 5126
527 Ga0207643_10170491 3300025908 Bacteria 1313
528 Ga0207684_10069446 3300025910 Bacteria 2994
529 Ga0207684_10210995 3300025910 Bacteria 1675
530 Ga0207684_10669794 3300025910 Bacteria 883
531 Ga0207654_10176590 3300025911 Bacteria 1391
532 Ga0207654_10247806 3300025911 Bacteria 1193
533 Ga0207654_10284505 3300025911 Bacteria 1119
534 Ga0207654_10460281 3300025911 Bacteria 893
535 Ga0207654_10471164 3300025911 Bacteria 883
536 Ga0207654_10647557 3300025911 Bacteria 757
537 Ga0207654_10841674 3300025911 Bacteria 664
538 Ga0207707_10000003 3300025912 Bacteria 642592
539 Ga0207707_10011914 3300025912 Bacteria 7566
540 Ga0207707_10037209 3300025912 Bacteria 4252
541 Ga0207707_10038820 3300025912 Bacteria 4161
542 Ga0207671_10102825 3300025914 Bacteria 2166
543 Ga0207671_10148139 3300025914 Bacteria 1812
544 Ga0207671_10151155 3300025914 Bacteria 1794
545 Ga0207660_10022999 3300025917 Bacteria 4206
546 Ga0207660_10049904 3300025917 Bacteria 2970
547 Ga0207660_10060459 3300025917 Bacteria 2724
548 Ga0207660_10371277 3300025917 Bacteria 1149
549 Ga0207660_10926009 3300025917 Bacteria 711
550 Ga0207662_10007339 3300025918 Bacteria 5997
551 Ga0207662_10012416 3300025918 Bacteria 4744
552 Ga0207662_10173779 3300025918 Bacteria 1383
553 Ga0207662_10196949 3300025918 Bacteria 1302
554 Ga0207662_10683694 3300025918 Bacteria 718
555 Ga0207657_10311162 3300025919 Bacteria 1247
556 Ga0207649_10138281 3300025920 Bacteria 1663
557 Ga0207652_10000111 3300025921 Bacteria 88571
558 Ga0207652_10023302 3300025921 Bacteria 5128
559 Ga0207646_10039875 3300025922 Bacteria 4226
560 Ga0207646_10079475 3300025922 Bacteria 2932
561 Ga0207646_10194196 3300025922 Bacteria 1833
562 Ga0207646_10312957 3300025922 Bacteria 1419
563 Ga0207646_10453032 3300025922 Bacteria 1158
564 Ga0207681_10014084 3300025923 Bacteria 4959
565 Ga0207681_10143603 3300025923 Bacteria 1780
566 Ga0207681_10365594 3300025923 Bacteria 1158
567 Ga0207681_10498575 3300025923 Bacteria 997
568 Ga0207681_10561429 3300025923 Bacteria 940
569 Ga0207694_10009026 3300025924 Bacteria 7525
570 Ga0207694_10053170 3300025924 Bacteria 3140
571 Ga0207650_10055602 3300025925 Bacteria 2938
572 Ga0207650_10142538 3300025925 Bacteria 1885
573 Ga0207650_10147705 3300025925 Bacteria 1853
574 Ga0207650_10506359 3300025925 Bacteria 1009
575 Ga0207650_10547562 3300025925 Bacteria 970
576 Ga0207687_10028454 3300025927 Bacteria 3754
577 Ga0207644_10003524 3300025931 Bacteria 10130
578 Ga0207644_10087925 3300025931 Bacteria 2310
579 Ga0207644_10155250 3300025931 Bacteria 1774
580 Ga0207644_10676995 3300025931 Bacteria 860
581 Ga0207690_10027861 3300025932 Bacteria 3574
582 Ga0207690_10365488 3300025932 Bacteria 1144
583 Ga0207690_10414375 3300025932 Bacteria 1077
584 Ga0207690_11137878 3300025932 Bacteria 651
585 Ga0207706_10224869 3300025933 Bacteria 1643
586 Ga0207706_10295799 3300025933 Bacteria 1411
587 Ga0207706_10630420 3300025933 Bacteria 919
588 Ga0207686_10006693 3300025934 Bacteria 6210
589 Ga0207686_10019977 3300025934 Bacteria 3820
590 Ga0207686_10321748 3300025934 Bacteria 1156
591 Ga0207709_10003915 3300025935 Bacteria 8699
592 Ga0207709_10045296 3300025935 Bacteria 2663
593 Ga0207709_10443209 3300025935 Bacteria 1002
594 Ga0207709_10549627 3300025935 Bacteria 908
595 Ga0207709_10679382 3300025935 Bacteria 822
596 Ga0207709_11804164 3300025935 Bacteria 509
597 Ga0207670_10001579 3300025936 Bacteria 11929
598 Ga0207670_10014887 3300025936 Bacteria 4632
599 Ga0207670_10214703 3300025936 Bacteria 1469
600 Ga0207670_10229400 3300025936 Bacteria 1425
601 Ga0207670_10238353 3300025936 Bacteria 1400
602 Ga0207670_11446969 3300025936 Bacteria 584
603 Ga0207669_10063356 3300025937 Bacteria 2282
604 Ga0207704_10007935 3300025938 Bacteria 5047
605 Ga0207704_10124706 3300025938 Bacteria 1770
606 Ga0207704_10395274 3300025938 Bacteria 1089
607 Ga0207704_11792261 3300025938 Bacteria 528
608 Ga0207665_10091659 3300025939 Bacteria 2107
609 Ga0207665_10242375 3300025939 Bacteria 1329
610 Ga0207665_10524495 3300025939 Bacteria 918
611 Ga0207691_10000477 3300025940 Bacteria 39677
612 Ga0207691_10319397 3300025940 Bacteria 1332
613 Ga0207711_10005008 3300025941 Bacteria 11238
614 Ga0207711_10014670 3300025941 Bacteria 6511
615 Ga0207711_10119219 3300025941 Bacteria 2354
616 Ga0207711_10403606 3300025941 Bacteria 1270
617 Ga0207689_10005848 3300025942 Bacteria 10903
618 Ga0207689_10010574 3300025942 Bacteria 7946
619 Ga0207689_10042165 3300025942 Bacteria 3776
620 Ga0207689_10085022 3300025942 Bacteria 2600
621 Ga0207689_10450861 3300025942 Bacteria 1075
622 Ga0207689_10555117 3300025942 Bacteria 965
623 Ga0207689_10784519 3300025942 Bacteria 804
624 Ga0207661_10797169 3300025944 Bacteria 870
625 Ga0207679_10011805 3300025945 Bacteria 5675
626 Ga0207679_10028138 3300025945 Bacteria 3897
627 Ga0207679_10499396 3300025945 Bacteria 1085
628 Ga0207679_10696109 3300025945 Bacteria 922
629 Ga0207667_11075903 3300025949 Bacteria 788
630 Ga0207667_11093963 3300025949 Bacteria 781
631 Ga0207651_10009300 3300025960 Bacteria 5369
632 Ga0207651_10397024 3300025960 Bacteria 1172
633 Ga0207651_10669056 3300025960 Bacteria 912
634 Ga0207651_10885671 3300025960 Bacteria 794
635 Ga0207651_10888970 3300025960 Bacteria 793
636 Ga0207651_10931576 3300025960 Bacteria 774
637 Ga0207651_10994973 3300025960 Bacteria 749
638 Ga0207651_11013269 3300025960 Bacteria 742
639 Ga0207712_10003132 3300025961 Bacteria 10544
640 Ga0207712_10207773 3300025961 Bacteria 1557
641 Ga0207712_10513174 3300025961 Bacteria 1026
642 Ga0207712_10584295 3300025961 Bacteria 964
643 Ga0207640_10109992 3300025981 Bacteria 1951
644 Ga0207640_10155084 3300025981 Bacteria 1687
645 Ga0207640_10337405 3300025981 Bacteria 1206
646 Ga0207640_10512091 3300025981 Bacteria 1001
647 Ga0207640_10631049 3300025981 Bacteria 911
648 Ga0207640_11114477 3300025981 Bacteria 699
649 Ga0207640_11994667 3300025981 Bacteria 526
650 Ga0207640_12028702 3300025981 Bacteria 521
651 Ga0207658_10982552 3300025986 Bacteria 770
652 Ga0207677_10059210 3300026023 Bacteria 2641
653 Ga0207677_10363703 3300026023 Bacteria 1216
654 Ga0207677_10596070 3300026023 Bacteria 969
655 Ga0207677_10609086 3300026023 Bacteria 959
656 Ga0207703_10058832 3300026035 Bacteria 3138
657 Ga0207703_10323158 3300026035 Bacteria 1413
658 Ga0207703_10404150 3300026035 Bacteria 1268
659 Ga0207703_10425964 3300026035 Bacteria 1235
660 Ga0207703_10720607 3300026035 Bacteria 949
661 Ga0207703_11000477 3300026035 Bacteria 802
662 Ga0207639_10027973 3300026041 Bacteria 4111
663 Ga0207639_10036584 3300026041 Bacteria 3639
664 Ga0207639_10533999 3300026041 Bacteria 1075
665 Ga0207639_10562857 3300026041 Bacteria 1048
666 Ga0207708_10000031 3300026075 Bacteria 155478
667 Ga0207708_10002033 3300026075 Bacteria 14916
668 Ga0207708_10066903 3300026075 Bacteria 2748
669 Ga0207708_10552686 3300026075 Bacteria 971
670 Ga0207708_10895150 3300026075 Bacteria 768
671 Ga0207702_10073234 3300026078 Bacteria 2953
672 Ga0207702_10609338 3300026078 Bacteria 1072
673 Ga0207641_10054032 3300026088 Bacteria 3406
674 Ga0207641_10057959 3300026088 Bacteria 3295
675 Ga0207641_10094844 3300026088 Bacteria 2617
676 Ga0207641_10101535 3300026088 Bacteria 2535
677 Ga0207641_10373949 3300026088 Bacteria 1363
678 Ga0207641_10557169 3300026088 Bacteria 1118
679 Ga0207641_11539247 3300026088 Bacteria 667
680 Ga0207648_10015784 3300026089 Bacteria 6927
681 Ga0207648_10040537 3300026089 Bacteria 4092
682 Ga0207648_10088821 3300026089 Bacteria 2699
683 Ga0207648_10111393 3300026089 Bacteria 2403
684 Ga0207648_10278442 3300026089 Bacteria 1496
685 Ga0207648_11427640 3300026089 Bacteria 651
686 Ga0207676_10012964 3300026095 Bacteria 5986
687 Ga0207676_10021972 3300026095 Bacteria 4687
688 Ga0207676_10058190 3300026095 Bacteria 3048
689 Ga0207676_10088976 3300026095 Bacteria 2529
690 Ga0207676_10105151 3300026095 Bacteria 2349
691 Ga0207676_10199797 3300026095 Bacteria 1765
692 Ga0207676_10202958 3300026095 Bacteria 1753
693 Ga0207676_10203664 3300026095 Bacteria 1750
694 Ga0207676_10311189 3300026095 Bacteria 1442
695 Ga0207676_10450298 3300026095 Bacteria 1213
696 Ga0207676_10723631 3300026095 Bacteria 966
697 Ga0207676_10929761 3300026095 Bacteria 854
698 Ga0207676_11024147 3300026095 Bacteria 814
699 Ga0207674_10002848 3300026116 Bacteria 21514
700 Ga0207674_10019234 3300026116 Bacteria 7404
701 Ga0207674_10135421 3300026116 Bacteria 2425
702 Ga0207674_10177274 3300026116 Bacteria 2084
703 Ga0207674_10307013 3300026116 Bacteria 1536
704 Ga0207674_10957443 3300026116 Bacteria 825
705 Ga0207674_10959652 3300026116 Bacteria 824
706 Ga0207674_11111710 3300026116 Bacteria 760
707 Ga0207674_11340278 3300026116 Bacteria 685
708 Ga0207675_100002631 3300026118 Bacteria 17750
709 Ga0207675_100005062 3300026118 Bacteria 12687
710 Ga0207675_100010125 3300026118 Bacteria 8837
711 Ga0207675_100026432 3300026118 Bacteria 5403
712 Ga0207675_100118002 3300026118 Bacteria 2509
713 Ga0207675_100383518 3300026118 Bacteria 1382
714 Ga0207675_100693224 3300026118 Bacteria 1027
715 Ga0207675_100718868 3300026118 Bacteria 1008
716 Ga0207675_100754254 3300026118 Bacteria 985
717 Ga0207683_10052843 3300026121 Bacteria 3561
718 Ga0207698_10064066 3300026142 Bacteria 2880
719 Ga0207698_10215814 3300026142 Bacteria 1730
720 Ga0207698_10409129 3300026142 Bacteria 1299
721 Ga0207698_10486378 3300026142 Bacteria 1198
722 Ga0207428_10031798 3300027907 Bacteria 4348
723 Ga0207428_10051718 3300027907 Bacteria 3283
724 Ga0268266_11016254 3300028379 Bacteria 802
725 Ga0268265_10013659 3300028380 Bacteria 5524
726 Ga0268265_10166756 3300028380 Bacteria 1878
727 Ga0268265_10305047 3300028380 Bacteria 1435
728 Ga0268265_10531475 3300028380 Bacteria 1113
729 Ga0268265_10684549 3300028380 Bacteria 989
730 Ga0268265_10694469 3300028380 Bacteria 982
731 Ga0268265_11158474 3300028380 Bacteria 769
732 Ga0268264_10009711 3300028381 Bacteria 7967
733 Ga0268264_10016639 3300028381 Bacteria 6022
734 Ga0268264_10018157 3300028381 Bacteria 5752
735 Ga0268264_10049415 3300028381 Bacteria 3499
736 Ga0268264_10103770 3300028381 Bacteria 2476
737 Ga0268264_10222778 3300028381 Bacteria 1737
738 Ga0268264_10228470 3300028381 Bacteria 1717
739 Ga0268264_10575916 3300028381 Bacteria 1107
740 Ga0268264_11957937 3300028381 Unclassified 595
741 Ga0268264_12108648 3300028381 Bacteria 572
742 Ga0314311_1062212 3300030733 Bacteria 780
743 Ga0307408_100039622 3300031548 Bacteria 3332
744 Ga0307408_100077101 3300031548 Bacteria 2481
745 Ga0307408_100191700 3300031548 Bacteria 1647
746 Ga0307408_100394480 3300031548 Bacteria 1187
747 Ga0307405_10003279 3300031731 Bacteria 7394
748 Ga0307405_10018000 3300031731 Bacteria 3889
749 Ga0307413_10099804 3300031824 Bacteria 1915
750 Ga0307410_10085008 3300031852 Bacteria 2232
751 Ga0307410_10411152 3300031852 Bacteria 1095
752 Ga0307406_10004102 3300031901 Bacteria 7929
753 Ga0307406_10417471 3300031901 Bacteria 1068
754 Ga0307407_10076836 3300031903 Bacteria 2006
755 Ga0307412_10028099 3300031911 Bacteria 3515
756 Ga0307412_10273117 3300031911 Bacteria 1324
757 Ga0307409_100773404 3300031995 Bacteria 966
758 Ga0307409_101752990 3300031995 Bacteria 650
759 Ga0307416_100030271 3300032002 Bacteria 4059
760 Ga0307416_100150193 3300032002 Bacteria 2135
761 Ga0307416_100297070 3300032002 Bacteria 1603
762 Ga0307416_100582481 3300032002 Bacteria 1196
763 Ga0307416_100712114 3300032002 Bacteria 1094
764 Ga0307414_10010176 3300032004 Bacteria 5443
765 Ga0307414_10040845 3300032004 Bacteria 3136
766 Ga0307414_10208288 3300032004 Bacteria 1596
767 Ga0307411_10010212 3300032005 Bacteria 4992
768 Ga0307411_10245655 3300032005 Bacteria 1404
769 Ga0307415_100012728 3300032126 Bacteria 4876
770 Ga0307415_100134979 3300032126 Bacteria 1875
771 Ga0307415_100426211 3300032126 Bacteria 1140
772 Ga0373950_0034924 3300034818 Bacteria 944
773 Ga0373940_0011170 3300035088 Bacteria 2128
774 Ga0373951_0036714 3300035091 Bacteria 1170
775 Ga0373941_0017945 3300035115 Bacteria 1947
776 Ga0373941_0095594 3300035115 Bacteria 1027
777 Ga0373962_0254553 3300035242 Bacteria 611
778 Ga0395898_0068344 3300037466 Bacteria 3438
779 Ga0395898_0340665 3300037466 Bacteria 1430
780 Ga0395898_0822419 3300037466 Bacteria 869
781 Ga0395898_1138800 3300037466 Bacteria 713
782 Ga0395901_0336904 3300038443 Bacteria 1559
783 Ga0395901_0492554 3300038443 Bacteria 1249
784 Ga0395901_1497344 3300038443 Bacteria 631
785 Ga0242422_01480 3300038699 Bacteria 1623
786 Ga0242420_000184 3300038996 Bacteria 6457
787 Ga0242420_008298 3300038996 Bacteria 1681
788 Ga0439448_0017555 3300042005 Bacteria 2186
789 Ga0439455_0003715 3300042012 Bacteria 2948
790 Ga0439462_0185510 3300042015 Unclassified 590
791 Ga0450889_011206 3300042144 Bacteria 931
792 Ga0439458_0003267 3300042157 Bacteria 3823
793 Ga0439464_0019369 3300042439 Bacteria 1858
794 Ga0451576_0323910 3300045051 Bacteria 1613
795 Ga0451576_0474669 3300045051 Bacteria 1314
796 Ga0451576_0687292 3300045051 Bacteria 1075
797 Ga0451576_1086003 3300045051 Bacteria 838
798 Ga0451576_1123780 3300045051 Bacteria 822
799 Ga0451576_1316931 3300045051 Bacteria 753
800 Ga0495629_0610891 3300046459 Bacteria 729
801 Ga0495582_0084713 3300046473 Bacteria 1762
802 Ga0495643_0075106 3300046522 Bacteria 1769
803 Ga0496102_0028231 3300048905 Bacteria 5011
804 Ga0496102_0361972 3300048905 Bacteria 1366
805 Ga0496102_1125390 3300048905 Bacteria 705
806 Ga0496103_0246767 3300048906 Bacteria 1149
807 Ga0496104_0478394 3300048907 Bacteria 1157
808 Ga0496106_0011978 3300048909 Bacteria 6400
809 Ga0496106_0030722 3300048909 Bacteria 4004
810 Ga0496107_0356859 3300048910 Bacteria 1088
811 Ga0496107_0478284 3300048910 Bacteria 924
812 Ga0496108_0749006 3300048911 Bacteria 845
813 Ga0496108_0949638 3300048911 Bacteria 736
814 Ga0496109_0153641 3300048912 Bacteria 2156
815 Ga0496109_0863662 3300048912 Bacteria 843
816 Ga0496110_0331259 3300048913 Bacteria 1387
817 Ga0496110_0828863 3300048913 Bacteria 830
818 Ga0496113_0354171 3300048916 Bacteria 1178
819 Ga0496113_0355995 3300048916 Bacteria 1174
820 Ga0501306_010797 3300049127 Bacteria 1155
821 Ga0501308_001972 3300049128 Bacteria 1740
822 Ga0501305_009445 3300049161 Bacteria 1282
823 Ga0501290_050852 3300049513 Bacteria 645
824 Ga0501291_001456 3300049514 Bacteria 2747
825 Ga0501291_008736 3300049514 Bacteria 1405
826 Ga0501295_051012 3300049518 Bacteria 885
827 Ga0501296_006885 3300049519 Bacteria 1297
828 Ga0501297_006478 3300049520 Bacteria 1250
829 Ga0501298_000983 3300049521 Bacteria 4044
830 Ga0501299_000297 3300049522 Bacteria 5710
831 Ga0501299_000697 3300049522 Bacteria 4026
832 Ga0501299_074961 3300049522 Bacteria 741
833 Ga0501300_025353 3300049523 Bacteria 869
834 Ga0501311_026950 3300049527 Bacteria 813
835 Ga0501312_002844 3300049528 Bacteria 1904
836 Ga0501320_001693 3300049536 Bacteria 1660
837 Ga0501323_001368 3300049539 Bacteria 2142
838 Ga0501038_0002622 3300049574 Bacteria 16807
839 Ga0501069_0446878 3300049585 Bacteria 768
840 Ga0501198_002778 3300049649 Bacteria 2370
841 Ga0501199_055524 3300049650 Bacteria 543
842 Ga0501202_001018 3300049652 Bacteria 4352
843 Ga0501202_002826 3300049652 Bacteria 2942
844 Ga0501206_008643 3300049653 Bacteria 1348
845 Ga0501207_004544 3300049654 Bacteria 1892
846 Ga0501207_041225 3300049654 Bacteria 803
847 Ga0501209_052879 3300049656 Bacteria 1113
848 Ga0501214_001393 3300049659 Bacteria 1874
849 Ga0501216_004877 3300049660 Bacteria 2005
850 Ga0501216_009170 3300049660 Bacteria 1573
851 Ga0501216_011681 3300049660 Bacteria 1430
852 Ga0501217_000622 3300049661 Bacteria 5969
853 Ga0501217_003473 3300049661 Bacteria 3184
854 Ga0501223_008765 3300049663 Bacteria 2059
855 Ga0501223_012526 3300049663 Bacteria 1694
856 Ga0501223_051891 3300049663 Bacteria 796
857 Ga0501224_002326 3300049664 Bacteria 2575
858 Ga0501224_010686 3300049664 Bacteria 1345
859 Ga0501227_001243 3300049665 Bacteria 5705
860 Ga0501227_007224 3300049665 Bacteria 2375
861 Ga0501230_003468 3300049667 Bacteria 2100
862 Ga0501230_007218 3300049667 Bacteria 1642
863 Ga0501233_002790 3300049668 Bacteria 3102
864 Ga0501233_014414 3300049668 Bacteria 1615
865 Ga0501233_034132 3300049668 Bacteria 1165
866 Ga0501235_003009 3300049669 Bacteria 3636
867 Ga0501235_007571 3300049669 Bacteria 2364
868 Ga0501236_000668 3300049670 Bacteria 3825
869 Ga0501238_017165 3300049671 Bacteria 1007
870 Ga0501239_004109 3300049672 Bacteria 1414
871 Ga0501242_001478 3300049674 Bacteria 2366
872 Ga0501249_027953 3300049679 Bacteria 1249
873 Ga0501249_045454 3300049679 Bacteria 1002
874 Ga0501251_025129 3300049681 Bacteria 816
875 Ga0501253_087565 3300049683 Bacteria 712
876 Ga0501256_003379 3300049685 Bacteria 1325
877 Ga0501257_075110 3300049686 Bacteria 867
878 Ga0501258_000783 3300049687 Bacteria 2334
879 Ga0501259_012384 3300049688 Bacteria 1422
880 Ga0501261_022349 3300049690 Bacteria 915
881 Ga0501221_026000 3300049704 Bacteria 1187
882 Ga0501221_027089 3300049704 Bacteria 1169
883 Ga0501225_0002914 3300049705 Bacteria 5253
884 Ga0501225_0015440 3300049705 Bacteria 2125
885 Ga0501225_0040486 3300049705 Bacteria 1284
886 Ga0501234_003125 3300049707 Bacteria 2602
887 Ga0501262_084832 3300049759 Bacteria 533
888 Ga0501265_010403 3300049762 Bacteria 1135
889 Ga0501268_005286 3300049765 Bacteria 1852
890 Ga0501274_008791 3300049771 Bacteria 911
891 Ga0501279_008509 3300049775 Bacteria 1371
892 Ga0501283_007046 3300049779 Bacteria 1590
893 Ga0501204_002519 3300049850 Bacteria 1868
894 Ga0501204_006460 3300049850 Bacteria 1302
895 Ga0501226_000823 3300049853 Bacteria 4152
896 nmdc:mga05p37_215186_c1 3300050507 Bacteria 2321
897 nmdc:mga05p37_221274_c1 3300050507 Bacteria 2284
898 nmdc:mga05p37_23100_c1 3300050507 Bacteria 7545
899 nmdc:mga05p37_232105_c1 3300050507 Bacteria 2222
900 nmdc:mga05p37_267871_c1 3300050507 Bacteria 2042
901 nmdc:mga05p37_42645_c1 3300050507 Bacteria 5576
902 nmdc:mga05p37_564013_c1 3300050507 Bacteria 1293
903 nmdc:mga09592_1027475_c1 3300050508 Bacteria 688
904 nmdc:mga09592_116043_c1 3300050508 Bacteria 2298
905 nmdc:mga09592_215967_c1 3300050508 Bacteria 1662
906 nmdc:mga09592_835223_c1 3300050508 Bacteria 777
907 nmdc:mga0qj67_428276_c1 3300050509 Bacteria 1067
908 nmdc:mga06r32_114304_c1 3300050510 Bacteria 2658
909 nmdc:mga06r32_1251298_c1 3300050510 Bacteria 687
910 nmdc:mga06r32_573671_c1 3300050510 Unclassified 1101
911 nmdc:mga08y16_189926_c1 3300050511 Unclassified 2131
912 nmdc:mga08y16_288283_c1 3300050511 Bacteria 1693
913 nmdc:mga08y16_3253_c1 3300050511 Bacteria 16814
914 nmdc:mga08y16_545630_c1 3300050511 Bacteria 1174
915 nmdc:mga08y16_62682_c1 3300050511 Bacteria 3883
916 nmdc:mga0n895_109113_c1 3300050512 Bacteria 2783
917 nmdc:mga0n895_32213_c1 3300050512 Bacteria 5030
918 nmdc:mga0n895_36502_c1 3300050512 Bacteria 4746
919 nmdc:mga0n895_74391_c1 3300050512 Bacteria 3374
920 nmdc:mga0rr50_75156_c1 3300050513 Bacteria 2589
921 nmdc:mga0rr50_843233_c1 3300050513 Bacteria 782
922 nmdc:mga08x19_122164_c1 3300050514 Bacteria 1747
923 nmdc:mga08x19_238682_c1 3300050514 Bacteria 1252
924 nmdc:mga0a205_13472_c1 3300050515 Bacteria 5261
925 nmdc:mga0a205_18164_c1 3300050515 Bacteria 6607
926 nmdc:mga0a205_189444_c1 3300050515 Bacteria 1950
927 nmdc:mga0a205_20545_c1 3300050515 Bacteria 6232
928 nmdc:mga0a205_253740_c1 3300050515 Bacteria 1638
929 nmdc:mga0a205_330026_c1 3300050515 Bacteria 1395
930 nmdc:mga0a205_52263_c1 3300050515 Bacteria 3944
931 nmdc:mga0a205_73586_c1 3300050515 Bacteria 3301
932 nmdc:mga0a205_819469_c1 3300050515 Bacteria 778
933 Ga0587093_040652 3300059478 Bacteria 704
934 Ga0587066_057241 3300059490 Bacteria 785
935 Ga0587070_042635 3300059491 Bacteria 875
936 Ga0587070_079163 3300059491 Bacteria 717
937 Ga0587070_171910 3300059491 Bacteria 558
938 Ga0587073_0052745 3300059492 Bacteria 927
939 Ga0587077_011752 3300059493 Bacteria 1384
940 Ga0587077_044493 3300059493 Bacteria 904
941 Ga0587080_114275 3300059503 Bacteria 592
942 Ga0587082_027991 3300059504 Bacteria 964
943 Ga0587082_039567 3300059504 Bacteria 859
944 Ga0587082_069691 3300059504 Bacteria 712
945 Ga0587083_0013855 3300059505 Bacteria 1379
946 Ga0587083_0017805 3300059505 Bacteria 1276
947 Ga0587085_022398 3300059506 Bacteria 974
948 Ga0587086_003493 3300059507 Bacteria 1586
949 Ga0587086_010430 3300059507 Bacteria 1124
950 Ga0587086_083103 3300059507 Bacteria 567
951 Ga0587088_008569 3300059508 Bacteria 1450
952 Ga0587088_041144 3300059508 Bacteria 871
953 Ga0587089_036904 3300059509 Bacteria 742
954 Ga0587089_097908 3300059509 Bacteria 529
955 Ga0587092_040087 3300059512 Bacteria 812
956 Ga0587098_069643 3300059604 Bacteria 568
957 Ga0587125_050279 3300059607 Bacteria 586
958 Ga0587109_024971 3300059624 Bacteria 1095
959 Ga0587109_040170 3300059624 Bacteria 924
960 Ga0587113_013037 3300059625 Bacteria 798
961 Ga0587117_050641 3300059627 Bacteria 688
962 Ga0587062_055522 3300059639 Bacteria 682
963 Ga0587067_001716 3300059640 Bacteria 2449
964 Ga0587067_044363 3300059640 Bacteria 876
965 Ga0587068_026847 3300059641 Bacteria 977
966 Ga0587068_037026 3300059641 Bacteria 870
967 Ga0587069_019803 3300059642 Bacteria 998
968 Ga0587072_063821 3300059643 Bacteria 764
969 Ga0587072_131146 3300059643 Bacteria 590
970 Ga0587075_147796 3300059644 Bacteria 506
971 Ga0587076_009599 3300059645 Bacteria 1378
972 Ga0587078_027988 3300059646 Bacteria 747
973 Ga0587078_051659 3300059646 Bacteria 604
974 Ga0587079_038643 3300059647 Bacteria 954
975 Ga0587079_090284 3300059647 Bacteria 716
976 Ga0587079_091630 3300059647 Bacteria 712
977 Ga0587079_125155 3300059647 Bacteria 640
978 Ga0587107_058456 3300059652 Bacteria 674
979 Ga0587114_089703 3300059655 Bacteria 584
980 Ga0587060_016947 3300060243 Bacteria 671
981 Ga0587071_060657 3300060344 Bacteria 803
982 Ga0587071_080008 3300060344 Bacteria 726
983 Ga0587071_181853 3300060344 Bacteria 540
984 Ga0587111_0030223 3300060346 Bacteria 1102
985 Ga0436365_1307023
986 SwRhRL2b_contig_3792570
987 JGI24736J21556_1013917
988 JGI25406J46586_10003263
989 JGI25406J46586_10040563
990 JGI25406J46586_10071718
991 Ga0058859_10037811
992 Ga0058859_11787191
993 Ga0058861_10006520
994 Ga0058861_11785577
995 Ga0058860_12206211
996 Ga0058862_12793453
997 Ga0065714_10002422
998 Ga0065704_10002802
999 Ga0065704_10078744
1000 Ga0065704_10377713
1001 Ga0065712_10067912
1002 Ga0065712_10159488
1003 Ga0065712_10197587
1004 Ga0065712_10214051
1005 Ga0065712_10645250
1006 Ga0065715_10002757
1007 Ga0065715_10013438
1008 Ga0065715_10015070
1009 Ga0065715_10044989
1010 Ga0065715_10091505
1011 Ga0065715_10097604
1012 Ga0065715_10098699
1013 Ga0065715_10110866
1014 Ga0065715_10129505
1015 Ga0065715_10209503
1016 Ga0065715_10216859
1017 Ga0065715_10282550
1018 Ga0065715_10728982
1019 Ga0065707_10001055
1020 Ga0065707_10004691
1021 Ga0065707_10058057
1022 Ga0065707_10086778
1023 Ga0065707_10096132
1024 Ga0065707_10351689
1025 Ga0065707_10383195
1026 Ga0070676_10066987
1027 Ga0070676_10102384
1028 Ga0070676_10138298
1029 Ga0070676_10821509
1030 Ga0070690_100006333
1031 Ga0070690_100099843
1032 Ga0070690_100235532
1033 Ga0070670_100108680
1034 Ga0070670_100264909
1035 Ga0070670_100635315
1036 Ga0070677_10070423
1037 Ga0068869_100052996
1038 Ga0068869_100095847
1039 Ga0068869_100379224
1040 Ga0070666_10022084
1041 Ga0070666_10117445
1042 Ga0070666_10259346
1043 Ga0070680_100042114
1044 Ga0070680_100597912
1045 Ga0070682_100019241
1046 Ga0070682_100125055
1047 Ga0070682_100591324
1048 Ga0068868_100005906
1049 Ga0068868_100030747
1050 Ga0068868_100774799
1051 Ga0070689_100028230
1052 Ga0070689_100097193
1053 Ga0070689_100246324
1054 Ga0070689_100300727
1055 Ga0070687_100006516
1056 Ga0070687_100011755
1057 Ga0070687_100195573
1058 Ga0070687_100314905
1059 Ga0070687_100762380
1060 Ga0070661_100004415
1061 Ga0070692_10015021
1062 Ga0070692_10032276
1063 Ga0070692_10075094
1064 Ga0070692_10211698
1065 Ga0070669_100002945
1066 Ga0070669_100011927
1067 Ga0070669_100045403
1068 Ga0070675_100021098
1069 Ga0070675_100664457
1070 Ga0070675_101017975
1071 Ga0070675_101047017
1072 Ga0070671_100004218
1073 Ga0070671_100088170
1074 Ga0070671_100121770
1075 Ga0070674_100039569
1076 Ga0070673_100018397
1077 Ga0070673_100172102
1078 Ga0070673_100233912
1079 Ga0070673_100423393
1080 Ga0070673_100432623
1081 Ga0070673_100459934
1082 Ga0070673_100856479
1083 Ga0070673_101148137
1084 Ga0070688_100001878
1085 Ga0070688_100531796
1086 Ga0070688_100674946
1087 Ga0070659_100007191
1088 Ga0070659_101212006
1089 Ga0070703_10014268
1090 Ga0070703_10065728
1091 Ga0070701_10022224
1092 Ga0070705_100016415
1093 Ga0070705_100261528
1094 Ga0070705_100306745
1095 Ga0070705_100855671
1096 Ga0070700_100013034
1097 Ga0070700_100018058
1098 Ga0070700_100334029
1099 Ga0070694_100005562
1100 Ga0070694_100025291
1101 Ga0070694_100119373
1102 Ga0070694_100128151
1103 Ga0070694_100210485
1104 Ga0070694_100236668
1105 Ga0070694_100297038
1106 Ga0070694_100450934
1107 Ga0070694_100777654
1108 Ga0070694_100869485
1109 Ga0070708_100000434
1110 Ga0070708_100841344
1111 Ga0070663_101215272
1112 Ga0070678_100051479
1113 Ga0070662_100234207
1114 Ga0070662_100625776
1115 Ga0070681_10000210
1116 Ga0070681_10014405
1117 Ga0068867_100009338
1118 Ga0068867_100032431
1119 Ga0068867_100263636
1120 Ga0068867_100284494
1121 Ga0068867_100380174
1122 Ga0068867_100643069
1123 Ga0068867_101007656
1124 Ga0068867_101531394
1125 Ga0070685_10044660
1126 Ga0070706_100005802
1127 Ga0070706_100408519
1128 Ga0070707_100370770
1129 Ga0070707_100490648
1130 Ga0070707_101708610
1131 Ga0070698_100003232
1132 Ga0070698_100004708
1133 Ga0070698_100007556
1134 Ga0070698_100008950
1135 Ga0070698_100655783
1136 Ga0070699_100003953
1137 Ga0070699_100017226
1138 Ga0070699_100057062
1139 Ga0070699_100181851
1140 Ga0070699_100220534
1141 Ga0070699_100846004
1142 Ga0070699_100973028
1143 Ga0070679_100000055
1144 Ga0070679_100011367
1145 Ga0070679_100030730
1146 Ga0070684_100929473
1147 Ga0070697_100003858
1148 Ga0070697_100184378
1149 Ga0070697_100312298
1150 Ga0070697_100458596
1151 Ga0068853_100026045
1152 Ga0068853_100167766
1153 Ga0068853_100628945
1154 Ga0068853_100761502
1155 Ga0068853_101150642
1156 Ga0070672_100498200
1157 Ga0070672_100866621
1158 Ga0070686_100005090
1159 Ga0070686_100005367
1160 Ga0070695_100044100
1161 Ga0070695_100105378
1162 Ga0070695_100298524
1163 Ga0070695_100304227
1164 Ga0070695_100407973
1165 Ga0070696_100004598
1166 Ga0070696_100044023
1167 Ga0070696_100113232
1168 Ga0070696_100218922
1169 Ga0070696_100272918
1170 Ga0070696_100402440
1171 Ga0070696_100513735
1172 Ga0070696_100830855
1173 Ga0070696_100860764
1174 Ga0070696_101263498
1175 Ga0070696_101383503
1176 Ga0070693_100001720
1177 Ga0070693_100021995
1178 Ga0070693_100111318
1179 Ga0070693_100146361
1180 Ga0070693_100404860
1181 Ga0070665_100129895
1182 Ga0070665_101254248
1183 Ga0070704_100024057
1184 Ga0070704_100122058
1185 Ga0070704_100259998
1186 Ga0070704_100323137
1187 Ga0070704_101886176
1188 Ga0068855_100704032
1189 Ga0070664_100002394
1190 Ga0070664_100112274
1191 Ga0070664_100686940
1192 Ga0068857_100002985
1193 Ga0068857_100079866
1194 Ga0068857_100128156
1195 Ga0068857_100353960
1196 Ga0068857_100389349
1197 Ga0068857_100527483
1198 Ga0068857_100720717
1199 Ga0068857_100778510
1200 Ga0068857_100926987
1201 Ga0068854_100072054
1202 Ga0068854_100161615
1203 Ga0068854_100411412
1204 Ga0068854_100651579
1205 Ga0068854_100666131
1206 Ga0068854_100737144
1207 Ga0068854_100880650
1208 Ga0068854_101155070
1209 Ga0068854_101512382
1210 Ga0068856_100018428
1211 Ga0068856_100585758
1212 Ga0070702_100002052
1213 Ga0070702_100053906
1214 Ga0070702_100054066
1215 Ga0070702_100068508
1216 Ga0070702_100153437
1217 Ga0070702_100224608
1218 Ga0070702_100542676
1219 Ga0070702_100641879
1220 Ga0070702_100980501
1221 Ga0068852_100083227
1222 Ga0068852_100392323
1223 Ga0068852_100710453
1224 Ga0068859_100027309
1225 Ga0068859_100027316
1226 Ga0068859_100043438
1227 Ga0068859_100118654
1228 Ga0068859_100179701
1229 Ga0068859_100246322
1230 Ga0068859_100278919
1231 Ga0068859_100290863
1232 Ga0068859_100410365
1233 Ga0068859_100489294
1234 Ga0068859_102017121
1235 Ga0068864_100003101
1236 Ga0068864_100006026
1237 Ga0068864_100017144
1238 Ga0068864_100072511
1239 Ga0068864_100110037
1240 Ga0068864_100420964
1241 Ga0068864_100483763
1242 Ga0068864_100485313
1243 Ga0068864_100518976
1244 Ga0068864_100654015
1245 Ga0068864_100746975
1246 Ga0068864_100792791
1247 Ga0068864_100975693
1248 Ga0068864_101150038
1249 Ga0068866_10035038
1250 Ga0068866_10047301
1251 Ga0068861_100013847
1252 Ga0068861_100015358
1253 Ga0068861_100186192
1254 Ga0068861_100296486
1255 Ga0068861_101348841
1256 Ga0068861_101517866
1257 Ga0068851_10103012
1258 Ga0068851_10213304
1259 Ga0068870_10010327
1260 Ga0068870_10024019
1261 Ga0068870_10065138
1262 Ga0068870_10606030
1263 Ga0068863_100025624
1264 Ga0068863_100074733
1265 Ga0068863_100083043
1266 Ga0068863_100721401
1267 Ga0068863_100964366
1268 Ga0068863_101475057
1269 Ga0068858_100010496
1270 Ga0068858_100017272
1271 Ga0068858_100097923
1272 Ga0068858_100102356
1273 Ga0068858_100339870
1274 Ga0068858_100341701
1275 Ga0068858_100943008
1276 Ga0068860_100009743
1277 Ga0068860_100012631
1278 Ga0068860_100014598
1279 Ga0068860_100022086
1280 Ga0068860_100024200
1281 Ga0068860_100102563
1282 Ga0068860_100104739
1283 Ga0068860_100318668
1284 Ga0068860_100651957
1285 Ga0068860_100683416
1286 Ga0068862_100005138
1287 Ga0068862_100018320
1288 Ga0068862_100228949
1289 Ga0068862_100235752
1290 Ga0068862_100867565
1291 Ga0068862_100961964
1292 Ga0068862_101472665
1293 Ga0068862_101726938
1294 Ga0081539_10000525
1295 Ga0081539_10000752
1296 Ga0081539_10001813
1297 Ga0070716_100262208
1298 Ga0070716_100585771
1299 Ga0070712_100923557
1300 Ga0097621_100000830
1301 Ga0097621_100017533
1302 Ga0097621_100033487
1303 Ga0097621_100071218
1304 Ga0097621_101508131
1305 Ga0068871_100004696
1306 Ga0068871_100005337
1307 Ga0068871_100008257
1308 Ga0068871_100074769
1309 Ga0068871_100679936
1310 Ga0075428_100117386
1311 Ga0075428_100194946
1312 Ga0075430_100006779
1313 Ga0075431_100035449
1314 Ga0075433_10010708
1315 Ga0075433_10043208
1316 Ga0075433_10050227
1317 Ga0075433_10063503
1318 Ga0075433_10382535
1319 Ga0075433_10430086
1320 Ga0075434_100037024
1321 Ga0075434_100136110
1322 Ga0075434_100636716
1323 Ga0075429_100027042
1324 Ga0075429_100135130
1325 Ga0075429_100207443
1326 Ga0075429_101276089
1327 Ga0068865_100281587
1328 Ga0068865_100302861
1329 Ga0068865_100401947
1330 Ga0068865_100428571
1331 Ga0075436_100132687
1332 Ga0097620_100027309
1333 Ga0097620_100027318
1334 Ga0097620_100043436
1335 Ga0097620_100103636
1336 Ga0097620_100118653
1337 Ga0097620_100179689
1338 Ga0097620_100246313
1339 Ga0097620_100278916
1340 Ga0097620_100290835
1341 Ga0097620_100410354
1342 Ga0097620_100489291
1343 Ga0097620_102016064
1344 Ga0075435_100060456
1345 Ga0075435_100213734
1346 Ga0105251_10027247
1347 Ga0105251_10618530
1348 Ga0105250_10090639
1349 Ga0105250_10122119
1350 Ga0105250_10445161
1351 Ga0105250_10497488
1352 Ga0105240_10057890
1353 Ga0111539_10002867
1354 Ga0111539_10078817
1355 Ga0105245_10009331
1356 Ga0105245_11539012
1357 Ga0105247_10255012
1358 Ga0105247_10272603
1359 Ga0105247_10403876
1360 Ga0105247_10698225
1361 Ga0105247_11158998
1362 Ga0105247_11259072
1363 Ga0114129_10004615
1364 Ga0114129_10019363
1365 Ga0114129_10068750
1366 Ga0114129_10096603
1367 Ga0114129_10103124
1368 Ga0114129_10432029
1369 Ga0114129_10458817
1370 Ga0114129_10464217
1371 Ga0114129_10682285
1372 Ga0114129_10697809
1373 Ga0114129_11412598
1374 Ga0105243_10009599
1375 Ga0105243_10098488
1376 Ga0105243_10114730
1377 Ga0105243_10197742
1378 Ga0105243_10319607
1379 Ga0105243_10378941
1380 Ga0105243_10657151
1381 Ga0105241_10059308
1382 Ga0105241_10099448
1383 Ga0105241_10263108
1384 Ga0105241_10380254
1385 Ga0105241_10578992
1386 Ga0105241_10805653
1387 Ga0105241_10941541
1388 Ga0105241_11480046
1389 Ga0105242_10014709
1390 Ga0105242_10159525
1391 Ga0105242_10444664
1392 Ga0105242_11463034
1393 Ga0105242_11890177
1394 Ga0105242_12330793
1395 Ga0105248_10003263
1396 Ga0105248_10013986
1397 Ga0105248_10018293
1398 Ga0105248_10356807
1399 Ga0105248_10473237
1400 Ga0105248_11207229
1401 Ga0105248_12359859
1402 Ga0105248_12848561
1403 Ga0105237_10001880
1404 Ga0105237_10118114
1405 Ga0105238_10003824
1406 Ga0105238_10195503
1407 Ga0105249_10067266
1408 Ga0105249_10077307
1409 Ga0105249_10087354
1410 Ga0105249_10262098
1411 Ga0105249_10708475
1412 Ga0105249_11144262
1413 Ga0105239_10211992
1414 Ga0105239_10294427
1415 Ga0105239_10535677
1416 Ga0105246_10019552
1417 Ga0105246_10061554
1418 Ga0105246_10151987
1419 Ga0105246_10286300
1420 Ga0105246_10573274
1421 Ga0105246_10614690
1422 Ga0105246_10767580
1423 Ga0105246_11504815
1424 Ga0157315_1054827
1425 Ga0157373_10204452
1426 Ga0157373_10266452
1427 Ga0157371_10757546
1428 Ga0157371_10839228
1429 Ga0157374_10023107
1430 Ga0157374_10177062
1431 Ga0157378_10018643
1432 Ga0157378_10034991
1433 Ga0157378_10052482
1434 Ga0157378_10064261
1435 Ga0157378_10722848
1436 Ga0157378_11183640
1437 Ga0157378_11906548
1438 Ga0157378_12866399
1439 Ga0163162_10005313
1440 Ga0163162_10009964
1441 Ga0163162_10019508
1442 Ga0163162_10039437
1443 Ga0163162_10074385
1444 Ga0163162_10167850
1445 Ga0163162_10180244
1446 Ga0163162_10299015
1447 Ga0163162_10610646
1448 Ga0163162_10893570
1449 Ga0157372_10145865
1450 Ga0157372_10578422
1451 Ga0157372_10938931
1452 Ga0157372_11517891
1453 Ga0157372_12121415
1454 Ga0157375_10028620
1455 Ga0157375_10043540
1456 Ga0157375_10159047
1457 Ga0157375_10196215
1458 Ga0157375_10237720
1459 Ga0157375_10461091
1460 Ga0157375_10541485
1461 Ga0157375_10634170
1462 Ga0157375_10794243
1463 Ga0157375_12373467
1464 Ga0163163_10008090
1465 Ga0163163_10018411
1466 Ga0163163_10021125
1467 Ga0163163_10022427
1468 Ga0163163_10038050
1469 Ga0163163_10076457
1470 Ga0163163_10101754
1471 Ga0163163_10248087
1472 Ga0163163_10315739
1473 Ga0157380_10006696
1474 Ga0157380_10017913
1475 Ga0157380_10046789
1476 Ga0157380_10202387
1477 Ga0157380_10659579
1478 Ga0157380_11897526
1479 Ga0157377_10098979
1480 Ga0157377_10332837
1481 Ga0157379_10206924
1482 Ga0157379_10455746
1483 Ga0157379_11805751
1484 Ga0157376_10024662
1485 Ga0157376_10257075
1486 Ga0163161_10008025
1487 Ga0163161_10066876
1488 Ga0163161_10345090
1489 Ga0163161_10707692
1490 Ga0213876_10046675
1491 Ga0207697_10004398
1492 Ga0207656_10049296
1493 Ga0207653_10068944
1494 Ga0207653_10128711
1495 Ga0207642_10031904
1496 Ga0207642_10180353
1497 Ga0207710_10335150
1498 Ga0207680_10098641
1499 Ga0207680_10254404
1500 Ga0207680_10254885
1501 Ga0207647_10038006
1502 Ga0207647_10074173
1503 Ga0207647_10254231
1504 Ga0207647_10301804
1505 Ga0207645_10179666
1506 Ga0207645_10285407
1507 Ga0207645_10327447
1508 Ga0207645_10360890
1509 Ga0207643_10001161
1510 Ga0207643_10009888
1511 Ga0207643_10170491
1512 Ga0207684_10069446
1513 Ga0207684_10210995
1514 Ga0207684_10669794
1515 Ga0207654_10176590
1516 Ga0207654_10247806
1517 Ga0207654_10284505
1518 Ga0207654_10460281
1519 Ga0207654_10471164
1520 Ga0207654_10647557
1521 Ga0207654_10841674
1522 Ga0207707_10000003
1523 Ga0207707_10011914
1524 Ga0207707_10037209
1525 Ga0207707_10038820
1526 Ga0207671_10102825
1527 Ga0207671_10148139
1528 Ga0207671_10151155
1529 Ga0207660_10022999
1530 Ga0207660_10049904
1531 Ga0207660_10060459
1532 Ga0207660_10371277
1533 Ga0207660_10926009
1534 Ga0207662_10007339
1535 Ga0207662_10012416
1536 Ga0207662_10173779
1537 Ga0207662_10196949
1538 Ga0207662_10683694
1539 Ga0207657_10311162
1540 Ga0207649_10138281
1541 Ga0207652_10000111
1542 Ga0207652_10023302
1543 Ga0207646_10039875
1544 Ga0207646_10079475
1545 Ga0207646_10194196
1546 Ga0207646_10312957
1547 Ga0207646_10453032
1548 Ga0207681_10014084
1549 Ga0207681_10143603
1550 Ga0207681_10365594
1551 Ga0207681_10498575
1552 Ga0207681_10561429
1553 Ga0207694_10009026
1554 Ga0207694_10053170
1555 Ga0207650_10055602
1556 Ga0207650_10142538
1557 Ga0207650_10147705
1558 Ga0207650_10506359
1559 Ga0207650_10547562
1560 Ga0207687_10028454
1561 Ga0207644_10003524
1562 Ga0207644_10087925
1563 Ga0207644_10155250
1564 Ga0207644_10676995
1565 Ga0207690_10027861
1566 Ga0207690_10365488
1567 Ga0207690_10414375
1568 Ga0207690_11137878
1569 Ga0207706_10224869
1570 Ga0207706_10295799
1571 Ga0207706_10630420
1572 Ga0207686_10006693
1573 Ga0207686_10019977
1574 Ga0207686_10321748
1575 Ga0207709_10003915
1576 Ga0207709_10045296
1577 Ga0207709_10443209
1578 Ga0207709_10549627
1579 Ga0207709_10679382
1580 Ga0207709_11804164
1581 Ga0207670_10001579
1582 Ga0207670_10014887
1583 Ga0207670_10214703
1584 Ga0207670_10229400
1585 Ga0207670_10238353
1586 Ga0207670_11446969
1587 Ga0207669_10063356
1588 Ga0207704_10007935
1589 Ga0207704_10124706
1590 Ga0207704_10395274
1591 Ga0207704_11792261
1592 Ga0207665_10091659
1593 Ga0207665_10242375
1594 Ga0207665_10524495
1595 Ga0207691_10000477
1596 Ga0207691_10319397
1597 Ga0207711_10005008
1598 Ga0207711_10014670
1599 Ga0207711_10119219
1600 Ga0207711_10403606
1601 Ga0207689_10005848
1602 Ga0207689_10010574
1603 Ga0207689_10042165
1604 Ga0207689_10085022
1605 Ga0207689_10450861
1606 Ga0207689_10555117
1607 Ga0207689_10784519
1608 Ga0207661_10797169
1609 Ga0207679_10011805
1610 Ga0207679_10028138
1611 Ga0207679_10499396
1612 Ga0207679_10696109
1613 Ga0207667_11075903
1614 Ga0207667_11093963
1615 Ga0207651_10009300
1616 Ga0207651_10397024
1617 Ga0207651_10669056
1618 Ga0207651_10885671
1619 Ga0207651_10888970
1620 Ga0207651_10931576
1621 Ga0207651_10994973
1622 Ga0207651_11013269
1623 Ga0207712_10003132
1624 Ga0207712_10207773
1625 Ga0207712_10513174
1626 Ga0207712_10584295
1627 Ga0207640_10109992
1628 Ga0207640_10155084
1629 Ga0207640_10337405
1630 Ga0207640_10512091
1631 Ga0207640_10631049
1632 Ga0207640_11114477
1633 Ga0207640_11994667
1634 Ga0207640_12028702
1635 Ga0207658_10982552
1636 Ga0207677_10059210
1637 Ga0207677_10363703
1638 Ga0207677_10596070
1639 Ga0207677_10609086
1640 Ga0207703_10058832
1641 Ga0207703_10323158
1642 Ga0207703_10404150
1643 Ga0207703_10425964
1644 Ga0207703_10720607
1645 Ga0207703_11000477
1646 Ga0207639_10027973
1647 Ga0207639_10036584
1648 Ga0207639_10533999
1649 Ga0207639_10562857
1650 Ga0207708_10000031
1651 Ga0207708_10002033
1652 Ga0207708_10066903
1653 Ga0207708_10552686
1654 Ga0207708_10895150
1655 Ga0207702_10073234
1656 Ga0207702_10609338
1657 Ga0207641_10054032
1658 Ga0207641_10057959
1659 Ga0207641_10094844
1660 Ga0207641_10101535
1661 Ga0207641_10373949
1662 Ga0207641_10557169
1663 Ga0207641_11539247
1664 Ga0207648_10015784
1665 Ga0207648_10040537
1666 Ga0207648_10088821
1667 Ga0207648_10111393
1668 Ga0207648_10278442
1669 Ga0207648_11427640
1670 Ga0207676_10012964
1671 Ga0207676_10021972
1672 Ga0207676_10058190
1673 Ga0207676_10088976
1674 Ga0207676_10105151
1675 Ga0207676_10199797
1676 Ga0207676_10202958
1677 Ga0207676_10203664
1678 Ga0207676_10311189
1679 Ga0207676_10450298
1680 Ga0207676_10723631
1681 Ga0207676_10929761
1682 Ga0207676_11024147
1683 Ga0207674_10002848
1684 Ga0207674_10019234
1685 Ga0207674_10135421
1686 Ga0207674_10177274
1687 Ga0207674_10307013
1688 Ga0207674_10957443
1689 Ga0207674_10959652
1690 Ga0207674_11111710
1691 Ga0207674_11340278
1692 Ga0207675_100002631
1693 Ga0207675_100005062
1694 Ga0207675_100010125
1695 Ga0207675_100026432
1696 Ga0207675_100118002
1697 Ga0207675_100383518
1698 Ga0207675_100693224
1699 Ga0207675_100718868
1700 Ga0207675_100754254
1701 Ga0207683_10052843
1702 Ga0207698_10064066
1703 Ga0207698_10215814
1704 Ga0207698_10409129
1705 Ga0207698_10486378
1706 Ga0207428_10031798
1707 Ga0207428_10051718
1708 Ga0268266_11016254
1709 Ga0268265_10013659
1710 Ga0268265_10166756
1711 Ga0268265_10305047
1712 Ga0268265_10531475
1713 Ga0268265_10684549
1714 Ga0268265_10694469
1715 Ga0268265_11158474
1716 Ga0268264_10009711
1717 Ga0268264_10016639
1718 Ga0268264_10018157
1719 Ga0268264_10049415
1720 Ga0268264_10103770
1721 Ga0268264_10222778
1722 Ga0268264_10228470
1723 Ga0268264_10575916
1724 Ga0268264_11957937
1725 Ga0268264_12108648
1726 Ga0314311_1062212
1727 Ga0307408_100039622
1728 Ga0307408_100077101
1729 Ga0307408_100191700
1730 Ga0307408_100394480
1731 Ga0307405_10003279
1732 Ga0307405_10018000
1733 Ga0307413_10099804
1734 Ga0307410_10085008
1735 Ga0307410_10411152
1736 Ga0307406_10004102
1737 Ga0307406_10417471
1738 Ga0307407_10076836
1739 Ga0307412_10028099
1740 Ga0307412_10273117
1741 Ga0307409_100773404
1742 Ga0307409_101752990
1743 Ga0307416_100030271
1744 Ga0307416_100150193
1745 Ga0307416_100297070
1746 Ga0307416_100582481
1747 Ga0307416_100712114
1748 Ga0307414_10010176
1749 Ga0307414_10040845
1750 Ga0307414_10208288
1751 Ga0307411_10010212
1752 Ga0307411_10245655
1753 Ga0307415_100012728
1754 Ga0307415_100134979
1755 Ga0307415_100426211
1756 Ga0373950_0034924
1757 Ga0373940_0011170
1758 Ga0373951_0036714
1759 Ga0373941_0017945
1760 Ga0373941_0095594
1761 Ga0373962_0254553
1762 Ga0395898_0068344
1763 Ga0395898_0340665
1764 Ga0395898_0822419
1765 Ga0395898_1138800
1766 Ga0395901_0336904
1767 Ga0395901_0492554
1768 Ga0395901_1497344
1769 Ga0242422_01480
1770 Ga0242420_000184
1771 Ga0242420_008298
1772 Ga0439448_0017555
1773 Ga0439455_0003715
1774 Ga0439462_0185510
1775 Ga0450889_011206
1776 Ga0439458_0003267
1777 Ga0439464_0019369
1778 Ga0451576_0323910
1779 Ga0451576_0474669
1780 Ga0451576_0687292
1781 Ga0451576_1086003
1782 Ga0451576_1123780
1783 Ga0451576_1316931
1784 Ga0495629_0610891
1785 Ga0495582_0084713
1786 Ga0495643_0075106
1787 Ga0496102_0028231
1788 Ga0496102_0361972
1789 Ga0496102_1125390
1790 Ga0496103_0246767
1791 Ga0496104_0478394
1792 Ga0496106_0011978
1793 Ga0496106_0030722
1794 Ga0496107_0356859
1795 Ga0496107_0478284
1796 Ga0496108_0749006
1797 Ga0496108_0949638
1798 Ga0496109_0153641
1799 Ga0496109_0863662
1800 Ga0496110_0331259
1801 Ga0496110_0828863
1802 Ga0496113_0354171
1803 Ga0496113_0355995
1804 Ga0501306_010797
1805 Ga0501308_001972
1806 Ga0501305_009445
1807 Ga0501290_050852
1808 Ga0501291_001456
1809 Ga0501291_008736
1810 Ga0501295_051012
1811 Ga0501296_006885
1812 Ga0501297_006478
1813 Ga0501298_000983
1814 Ga0501299_000297
1815 Ga0501299_000697
1816 Ga0501299_074961
1817 Ga0501300_025353
1818 Ga0501311_026950
1819 Ga0501312_002844
1820 Ga0501320_001693
1821 Ga0501323_001368
1822 Ga0501038_0002622
1823 Ga0501069_0446878
1824 Ga0501198_002778
1825 Ga0501199_055524
1826 Ga0501202_001018
1827 Ga0501202_002826
1828 Ga0501206_008643
1829 Ga0501207_004544
1830 Ga0501207_041225
1831 Ga0501209_052879
1832 Ga0501214_001393
1833 Ga0501216_004877
1834 Ga0501216_009170
1835 Ga0501216_011681
1836 Ga0501217_000622
1837 Ga0501217_003473
1838 Ga0501223_008765
1839 Ga0501223_012526
1840 Ga0501223_051891
1841 Ga0501224_002326
1842 Ga0501224_010686
1843 Ga0501227_001243
1844 Ga0501227_007224
1845 Ga0501230_003468
1846 Ga0501230_007218
1847 Ga0501233_002790
1848 Ga0501233_014414
1849 Ga0501233_034132
1850 Ga0501235_003009
1851 Ga0501235_007571
1852 Ga0501236_000668
1853 Ga0501238_017165
1854 Ga0501239_004109
1855 Ga0501242_001478
1856 Ga0501249_027953
1857 Ga0501249_045454
1858 Ga0501251_025129
1859 Ga0501253_087565
1860 Ga0501256_003379
1861 Ga0501257_075110
1862 Ga0501258_000783
1863 Ga0501259_012384
1864 Ga0501261_022349
1865 Ga0501221_026000
1866 Ga0501221_027089
1867 Ga0501225_0002914
1868 Ga0501225_0015440
1869 Ga0501225_0040486
1870 Ga0501234_003125
1871 Ga0501262_084832
1872 Ga0501265_010403
1873 Ga0501268_005286
1874 Ga0501274_008791
1875 Ga0501279_008509
1876 Ga0501283_007046
1877 Ga0501204_002519
1878 Ga0501204_006460
1879 Ga0501226_000823
1880 nmdc:mga05p37_215186_c1
1881 nmdc:mga05p37_221274_c1
1882 nmdc:mga05p37_23100_c1
1883 nmdc:mga05p37_232105_c1
1884 nmdc:mga05p37_267871_c1
1885 nmdc:mga05p37_42645_c1
1886 nmdc:mga05p37_564013_c1
1887 nmdc:mga09592_1027475_c1
1888 nmdc:mga09592_116043_c1
1889 nmdc:mga09592_215967_c1
1890 nmdc:mga09592_835223_c1
1891 nmdc:mga0qj67_428276_c1
1892 nmdc:mga06r32_114304_c1
1893 nmdc:mga06r32_1251298_c1
1894 nmdc:mga06r32_573671_c1
1895 nmdc:mga08y16_189926_c1
1896 nmdc:mga08y16_288283_c1
1897 nmdc:mga08y16_3253_c1
1898 nmdc:mga08y16_545630_c1
1899 nmdc:mga08y16_62682_c1
1900 nmdc:mga0n895_109113_c1
1901 nmdc:mga0n895_32213_c1
1902 nmdc:mga0n895_36502_c1
1903 nmdc:mga0n895_74391_c1
1904 nmdc:mga0rr50_75156_c1
1905 nmdc:mga0rr50_843233_c1
1906 nmdc:mga08x19_122164_c1
1907 nmdc:mga08x19_238682_c1
1908 nmdc:mga0a205_13472_c1
1909 nmdc:mga0a205_18164_c1
1910 nmdc:mga0a205_189444_c1
1911 nmdc:mga0a205_20545_c1
1912 nmdc:mga0a205_253740_c1
1913 nmdc:mga0a205_330026_c1
1914 nmdc:mga0a205_52263_c1
1915 nmdc:mga0a205_73586_c1
1916 nmdc:mga0a205_819469_c1
1917 Ga0587093_040652
1918 Ga0587066_057241
1919 Ga0587070_042635
1920 Ga0587070_079163
1921 Ga0587070_171910
1922 Ga0587073_0052745
1923 Ga0587077_011752
1924 Ga0587077_044493
1925 Ga0587080_114275
1926 Ga0587082_027991
1927 Ga0587082_039567
1928 Ga0587082_069691
1929 Ga0587083_0013855
1930 Ga0587083_0017805
1931 Ga0587085_022398
1932 Ga0587086_003493
1933 Ga0587086_010430
1934 Ga0587086_083103
1935 Ga0587088_008569
1936 Ga0587088_041144
1937 Ga0587089_036904
1938 Ga0587089_097908
1939 Ga0587092_040087
1940 Ga0587098_069643
1941 Ga0587125_050279
1942 Ga0587109_024971
1943 Ga0587109_040170
1944 Ga0587113_013037
1945 Ga0587117_050641
1946 Ga0587062_055522
1947 Ga0587067_001716
1948 Ga0587067_044363
1949 Ga0587068_026847
1950 Ga0587068_037026
1951 Ga0587069_019803
1952 Ga0587072_063821
1953 Ga0587072_131146
1954 Ga0587075_147796
1955 Ga0587076_009599
1956 Ga0587078_027988
1957 Ga0587078_051659
1958 Ga0587079_038643
1959 Ga0587079_090284
1960 Ga0587079_091630
1961 Ga0587079_125155
1962 Ga0587107_058456
1963 Ga0587114_089703
1964 Ga0587060_016947
1965 Ga0587071_060657
1966 Ga0587071_080008
1967 Ga0587071_181853
1968 Ga0587111_0030223

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

7

138

0.91

Map