F487396
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 981 | 396 | 968 | 360 |
Family's Representative Sequence
| Representative Sequence | 3300036712|Ga0316584_0051912|Ga0316584_0051912_381_1607 |
| Length | 408 |
| Sequence | MSMPRTFTQDPPVASVAQSSTTPRPDARGAFRRTLDSISDAISLTDPYTVPTRHWHRLEDGRLQCDACPRACKLREGQRGVCFVRGRIDDQVVLTSYGRSSGYCIDPIEKKPLNHFLPGTSVLSFGTAGCNLACRFCQNWDISKSKEVDRLADAAPPDGIASAALELGCASVAFTYNDPVIFVEYAVDTALACRDVGVRTVAVSAGYATDATRRELYSAVDAANIDLKGFTEDFYRHVAMGQLEPVLDTLRYIRHETDTWLEITTLLIPGMNDGDEELHELATWIRTELGPDVPLHFSAFHPDYKMRDVPPTPPATLTRARRIALDEGLQHVYTGNVHDREGDTTTCTECGTAVIERDWYELKGWHLTGDGRCRSCGAPLSGVFDGPPGEWGAKRVPVELRTGKARRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 2 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 3 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 4 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 5 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 6 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 7 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 8 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 9 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 10 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 11 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 124 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 125 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 183 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 184 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 185 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 192 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 193 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 195 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 196 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 197 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 198 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 203 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 204 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 205 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 207 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 209 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 210 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 211 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 212 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 213 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 216 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 217 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 218 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 220 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 221 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 222 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 223 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 224 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 225 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 226 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 227 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 228 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 229 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 230 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 231 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 233 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 239 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 240 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 244 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 245 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 247 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 248 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 249 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 250 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 252 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 253 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 255 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 256 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 257 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 258 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 259 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 260 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 261 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 262 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 263 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 264 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 265 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 266 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 267 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 268 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 269 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 270 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 271 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 272 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 273 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 274 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 275 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 276 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 277 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 278 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 279 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 280 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 281 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 282 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 283 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 284 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 285 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 286 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 287 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 288 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 289 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 321 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 322 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 323 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 326 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 327 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 328 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 329 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 330 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 331 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 358 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 359 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 367 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 368 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 369 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 370 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 371 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 372 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 382 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 384 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 387 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 388 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 389 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 390 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 391 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 394 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 395 | 8001522603 | Methylomicrobium sp. RS1 | Isolate | Unclassified |
| 396 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.74 |
| Metatranscriptomes | 1.94 |
| Isolates | 1.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.98 |
| Nodule | 0.31 |
| Rhizoplane | 3.16 |
| Rhizosphere | 89.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10045099 | 3300001990 | Bacteria | 1347 |
| 2 | Ga0065704_10023400 | 3300005289 | Bacteria | 1292 |
| 3 | Ga0070658_10197034 | 3300005327 | Bacteria | 1698 |
| 4 | Ga0070690_100003762 | 3300005330 | Bacteria | 8357 |
| 5 | Ga0070690_100016631 | 3300005330 | Bacteria | 4410 |
| 6 | Ga0070670_100000906 | 3300005331 | Bacteria | 23327 |
| 7 | Ga0070670_100103701 | 3300005331 | Bacteria | 2450 |
| 8 | Ga0068869_100019821 | 3300005334 | Bacteria | 4604 |
| 9 | Ga0070666_10012915 | 3300005335 | Bacteria | 5283 |
| 10 | Ga0070666_10015924 | 3300005335 | Bacteria | 4803 |
| 11 | Ga0070666_10059296 | 3300005335 | Bacteria | 2589 |
| 12 | Ga0070666_10167900 | 3300005335 | Bacteria | 1536 |
| 13 | Ga0070680_100050702 | 3300005336 | Bacteria | 3386 |
| 14 | Ga0070682_100208499 | 3300005337 | Bacteria | 1383 |
| 15 | Ga0068868_100005274 | 3300005338 | Bacteria | 9076 |
| 16 | Ga0068868_100008755 | 3300005338 | Bacteria | 7248 |
| 17 | Ga0068868_100037456 | 3300005338 | Bacteria | 3760 |
| 18 | Ga0068868_100259904 | 3300005338 | Bacteria | 1464 |
| 19 | Ga0070689_100018529 | 3300005340 | Bacteria | 5131 |
| 20 | Ga0070689_100035455 | 3300005340 | Bacteria | 3812 |
| 21 | Ga0070689_100114910 | 3300005340 | Bacteria | 2145 |
| 22 | Ga0070687_100059885 | 3300005343 | Bacteria | 2007 |
| 23 | Ga0070661_100038443 | 3300005344 | Bacteria | 3484 |
| 24 | Ga0070668_100026038 | 3300005347 | Bacteria | 4435 |
| 25 | Ga0070668_100102974 | 3300005347 | Bacteria | 2264 |
| 26 | Ga0070675_100022870 | 3300005354 | Bacteria | 4994 |
| 27 | Ga0070675_100088001 | 3300005354 | Bacteria | 2598 |
| 28 | Ga0070675_100116322 | 3300005354 | Bacteria | 2268 |
| 29 | Ga0070671_100004118 | 3300005355 | Bacteria | 11479 |
| 30 | Ga0070671_100051657 | 3300005355 | Bacteria | 3419 |
| 31 | Ga0070674_100025779 | 3300005356 | Bacteria | 3831 |
| 32 | Ga0070673_100001712 | 3300005364 | Bacteria | 13029 |
| 33 | Ga0070673_100003842 | 3300005364 | Bacteria | 9429 |
| 34 | Ga0070673_100009342 | 3300005364 | Bacteria | 6578 |
| 35 | Ga0070673_100379440 | 3300005364 | Bacteria | 1260 |
| 36 | Ga0070688_100077108 | 3300005365 | Bacteria | 2146 |
| 37 | Ga0070688_100200257 | 3300005365 | Bacteria | 1397 |
| 38 | Ga0070667_100006711 | 3300005367 | Bacteria | 9563 |
| 39 | Ga0070667_100035568 | 3300005367 | Bacteria | 4173 |
| 40 | Ga0070667_100058417 | 3300005367 | Bacteria | 3261 |
| 41 | Ga0070667_100071936 | 3300005367 | Bacteria | 2946 |
| 42 | Ga0070709_10008556 | 3300005434 | Bacteria | 5626 |
| 43 | Ga0070714_100033710 | 3300005435 | Bacteria | 4283 |
| 44 | Ga0070713_100072739 | 3300005436 | Bacteria | 2908 |
| 45 | Ga0070713_100352038 | 3300005436 | Bacteria | 1367 |
| 46 | Ga0070710_10010324 | 3300005437 | Bacteria | 4585 |
| 47 | Ga0070701_10038979 | 3300005438 | Bacteria | 2408 |
| 48 | Ga0070711_100030051 | 3300005439 | Bacteria | 3593 |
| 49 | Ga0070711_100170391 | 3300005439 | Bacteria | 1659 |
| 50 | Ga0070705_100042851 | 3300005440 | Bacteria | 2590 |
| 51 | Ga0070705_100233589 | 3300005440 | Bacteria | 1281 |
| 52 | Ga0070694_100069093 | 3300005444 | Bacteria | 2429 |
| 53 | Ga0070708_100140108 | 3300005445 | Bacteria | 2242 |
| 54 | Ga0070708_100236149 | 3300005445 | Bacteria | 1716 |
| 55 | Ga0070678_100008843 | 3300005456 | Bacteria | 6059 |
| 56 | Ga0070678_100124015 | 3300005456 | Bacteria | 2042 |
| 57 | Ga0070678_100358334 | 3300005456 | Bacteria | 1256 |
| 58 | Ga0070706_100001257 | 3300005467 | Bacteria | 27123 |
| 59 | Ga0070706_100002535 | 3300005467 | Bacteria | 18359 |
| 60 | Ga0070706_100081595 | 3300005467 | Bacteria | 2995 |
| 61 | Ga0070706_100145555 | 3300005467 | Bacteria | 2213 |
| 62 | Ga0070707_100000894 | 3300005468 | Bacteria | 29609 |
| 63 | Ga0070707_100085014 | 3300005468 | Bacteria | 3057 |
| 64 | Ga0070698_100000184 | 3300005471 | Bacteria | 59150 |
| 65 | Ga0070698_100004413 | 3300005471 | Bacteria | 15458 |
| 66 | Ga0070698_100052734 | 3300005471 | Bacteria | 4136 |
| 67 | Ga0070698_100082635 | 3300005471 | Bacteria | 3204 |
| 68 | Ga0070698_100150048 | 3300005471 | Bacteria | 2279 |
| 69 | Ga0070699_100003946 | 3300005518 | Bacteria | 13108 |
| 70 | Ga0070699_100056021 | 3300005518 | Bacteria | 3413 |
| 71 | Ga0070699_100064086 | 3300005518 | Bacteria | 3188 |
| 72 | Ga0070679_100059313 | 3300005530 | Bacteria | 3814 |
| 73 | Ga0070684_100001343 | 3300005535 | Bacteria | 17625 |
| 74 | Ga0070684_100017800 | 3300005535 | Bacteria | 5839 |
| 75 | Ga0070697_100005132 | 3300005536 | Bacteria | 10054 |
| 76 | Ga0070697_100005266 | 3300005536 | Bacteria | 9930 |
| 77 | Ga0068853_100040312 | 3300005539 | Bacteria | 3984 |
| 78 | Ga0070672_100015346 | 3300005543 | Bacteria | 5453 |
| 79 | Ga0070672_100037176 | 3300005543 | Bacteria | 3713 |
| 80 | Ga0070672_100266043 | 3300005543 | Bacteria | 1447 |
| 81 | Ga0070686_100044824 | 3300005544 | Bacteria | 2783 |
| 82 | Ga0070696_100122438 | 3300005546 | Bacteria | 1884 |
| 83 | Ga0070696_100127814 | 3300005546 | Bacteria | 1846 |
| 84 | Ga0070693_100130154 | 3300005547 | Bacteria | 1572 |
| 85 | Ga0070665_100018756 | 3300005548 | Bacteria | 6936 |
| 86 | Ga0070665_100200703 | 3300005548 | Bacteria | 1995 |
| 87 | Ga0070704_100041606 | 3300005549 | Bacteria | 3173 |
| 88 | Ga0068855_100180773 | 3300005563 | Bacteria | 2384 |
| 89 | Ga0068855_100341268 | 3300005563 | Bacteria | 1651 |
| 90 | Ga0070664_100009003 | 3300005564 | Bacteria | 8098 |
| 91 | Ga0070664_100071054 | 3300005564 | Bacteria | 2982 |
| 92 | Ga0068857_100060931 | 3300005577 | Bacteria | 3352 |
| 93 | Ga0068857_100182360 | 3300005577 | Bacteria | 1910 |
| 94 | Ga0068854_100000811 | 3300005578 | Bacteria | 18633 |
| 95 | Ga0068856_100002001 | 3300005614 | Bacteria | 21258 |
| 96 | Ga0068852_100059006 | 3300005616 | Bacteria | 3326 |
| 97 | Ga0068852_100169442 | 3300005616 | Bacteria | 2046 |
| 98 | Ga0068852_100296397 | 3300005616 | Bacteria | 1564 |
| 99 | Ga0068859_100009071 | 3300005617 | Bacteria | 10045 |
| 100 | Ga0068859_100026232 | 3300005617 | Bacteria | 5843 |
| 101 | Ga0068859_100031928 | 3300005617 | Bacteria | 5290 |
| 102 | Ga0068859_100037140 | 3300005617 | Bacteria | 4889 |
| 103 | Ga0068864_100000454 | 3300005618 | Bacteria | 35430 |
| 104 | Ga0068864_100007705 | 3300005618 | Bacteria | 8868 |
| 105 | Ga0068864_100027866 | 3300005618 | Bacteria | 4774 |
| 106 | Ga0068864_100094021 | 3300005618 | Bacteria | 2649 |
| 107 | Ga0068864_100097581 | 3300005618 | Bacteria | 2602 |
| 108 | Ga0068864_100147429 | 3300005618 | Bacteria | 2129 |
| 109 | Ga0068866_10005950 | 3300005718 | Bacteria | 5072 |
| 110 | Ga0068861_100000999 | 3300005719 | Bacteria | 17236 |
| 111 | Ga0068851_10097773 | 3300005834 | Bacteria | 1554 |
| 112 | Ga0068863_100006585 | 3300005841 | Bacteria | 11398 |
| 113 | Ga0068863_100015249 | 3300005841 | Bacteria | 7386 |
| 114 | Ga0068863_100017884 | 3300005841 | Bacteria | 6783 |
| 115 | Ga0068863_100022286 | 3300005841 | Bacteria | 6047 |
| 116 | Ga0068863_100035396 | 3300005841 | Bacteria | 4756 |
| 117 | Ga0068863_100058924 | 3300005841 | Bacteria | 3633 |
| 118 | Ga0068863_100133724 | 3300005841 | Bacteria | 2369 |
| 119 | Ga0068863_100195689 | 3300005841 | Bacteria | 1943 |
| 120 | Ga0068858_100006836 | 3300005842 | Bacteria | 11094 |
| 121 | Ga0068858_100016977 | 3300005842 | Bacteria | 6834 |
| 122 | Ga0068858_100024873 | 3300005842 | Bacteria | 5575 |
| 123 | Ga0068858_100069538 | 3300005842 | Bacteria | 3264 |
| 124 | Ga0068858_100143421 | 3300005842 | Bacteria | 2243 |
| 125 | Ga0068858_100201339 | 3300005842 | Bacteria | 1883 |
| 126 | Ga0068860_100034823 | 3300005843 | Bacteria | 4831 |
| 127 | Ga0068860_100043091 | 3300005843 | Bacteria | 4307 |
| 128 | Ga0068860_100058487 | 3300005843 | Bacteria | 3664 |
| 129 | Ga0068862_100005314 | 3300005844 | Bacteria | 10787 |
| 130 | Ga0081455_10003202 | 3300005937 | Bacteria | 18959 |
| 131 | Ga0081540_1048859 | 3300005983 | Bacteria | 2115 |
| 132 | Ga0081539_10008545 | 3300005985 | Bacteria | 8867 |
| 133 | Ga0075363_100121062 | 3300006048 | Bacteria | 1462 |
| 134 | Ga0075364_10019238 | 3300006051 | Bacteria | 4284 |
| 135 | Ga0075364_10070891 | 3300006051 | Bacteria | 2295 |
| 136 | Ga0075364_10088545 | 3300006051 | Bacteria | 2053 |
| 137 | Ga0070715_10009397 | 3300006163 | Bacteria | 3445 |
| 138 | Ga0070716_100013161 | 3300006173 | Bacteria | 4212 |
| 139 | Ga0070716_100038886 | 3300006173 | Bacteria | 2637 |
| 140 | Ga0070716_100079043 | 3300006173 | Bacteria | 1958 |
| 141 | Ga0070712_100012125 | 3300006175 | Bacteria | 5477 |
| 142 | Ga0070712_100025793 | 3300006175 | Bacteria | 3910 |
| 143 | Ga0070712_100048686 | 3300006175 | Bacteria | 2939 |
| 144 | Ga0070712_100104622 | 3300006175 | Bacteria | 2101 |
| 145 | Ga0075362_10007555 | 3300006177 | Bacteria | 4123 |
| 146 | Ga0075362_10086060 | 3300006177 | Bacteria | 1454 |
| 147 | Ga0075367_10003884 | 3300006178 | Bacteria | 7204 |
| 148 | Ga0075367_10039449 | 3300006178 | Bacteria | 2753 |
| 149 | Ga0075369_10004717 | 3300006186 | Bacteria | 5057 |
| 150 | Ga0075369_10006202 | 3300006186 | Bacteria | 4515 |
| 151 | Ga0075369_10006503 | 3300006186 | Bacteria | 4418 |
| 152 | Ga0075366_10014391 | 3300006195 | Bacteria | 4517 |
| 153 | Ga0075366_10084976 | 3300006195 | Bacteria | 1892 |
| 154 | Ga0097621_100046220 | 3300006237 | Bacteria | 3521 |
| 155 | Ga0097621_100068809 | 3300006237 | Bacteria | 2921 |
| 156 | Ga0097621_100287769 | 3300006237 | Bacteria | 1448 |
| 157 | Ga0075370_10000095 | 3300006353 | Bacteria | 27417 |
| 158 | Ga0075370_10000217 | 3300006353 | Bacteria | 20447 |
| 159 | Ga0075370_10059631 | 3300006353 | Bacteria | 2172 |
| 160 | Ga0068871_100027149 | 3300006358 | Bacteria | 4474 |
| 161 | Ga0068871_100070561 | 3300006358 | Bacteria | 2871 |
| 162 | Ga0075428_100006684 | 3300006844 | Bacteria | 12828 |
| 163 | Ga0075428_100006866 | 3300006844 | Bacteria | 12647 |
| 164 | Ga0075430_100001621 | 3300006846 | Bacteria | 18391 |
| 165 | Ga0075430_100034817 | 3300006846 | Bacteria | 4275 |
| 166 | Ga0075430_100036653 | 3300006846 | Bacteria | 4158 |
| 167 | Ga0075430_100051641 | 3300006846 | Bacteria | 3465 |
| 168 | Ga0075430_100060607 | 3300006846 | Bacteria | 3180 |
| 169 | Ga0075430_100124382 | 3300006846 | Bacteria | 2150 |
| 170 | Ga0075431_100001412 | 3300006847 | Bacteria | 22043 |
| 171 | Ga0075431_100004791 | 3300006847 | Bacteria | 13309 |
| 172 | Ga0075431_100012454 | 3300006847 | Bacteria | 8585 |
| 173 | Ga0075431_100022895 | 3300006847 | Bacteria | 6387 |
| 174 | Ga0075431_100036103 | 3300006847 | Bacteria | 5091 |
| 175 | Ga0075431_100044859 | 3300006847 | Bacteria | 4559 |
| 176 | Ga0075433_10279863 | 3300006852 | Bacteria | 1478 |
| 177 | Ga0075434_100000169 | 3300006871 | Bacteria | 41864 |
| 178 | Ga0075434_100154873 | 3300006871 | Bacteria | 2311 |
| 179 | Ga0075434_100292146 | 3300006871 | Bacteria | 1650 |
| 180 | Ga0075429_100003183 | 3300006880 | Bacteria | 13955 |
| 181 | Ga0075429_100011021 | 3300006880 | Bacteria | 7822 |
| 182 | Ga0075429_100021021 | 3300006880 | Bacteria | 5662 |
| 183 | Ga0075429_100021207 | 3300006880 | Bacteria | 5633 |
| 184 | Ga0075429_100055692 | 3300006880 | Bacteria | 3441 |
| 185 | Ga0075429_100262313 | 3300006880 | Bacteria | 1513 |
| 186 | Ga0075436_100001151 | 3300006914 | Bacteria | 17888 |
| 187 | Ga0075436_100005331 | 3300006914 | Bacteria | 8843 |
| 188 | Ga0075436_100017896 | 3300006914 | Bacteria | 4852 |
| 189 | Ga0075436_100128363 | 3300006914 | Bacteria | 1777 |
| 190 | Ga0097620_100009071 | 3300006931 | Bacteria | 10045 |
| 191 | Ga0097620_100026232 | 3300006931 | Bacteria | 5843 |
| 192 | Ga0097620_100031930 | 3300006931 | Bacteria | 5290 |
| 193 | Ga0097620_100037141 | 3300006931 | Bacteria | 4889 |
| 194 | Ga0075435_100047868 | 3300007076 | Bacteria | 3433 |
| 195 | Ga0075435_100084665 | 3300007076 | Bacteria | 2609 |
| 196 | Ga0075435_100107345 | 3300007076 | Bacteria | 2319 |
| 197 | Ga0075435_100123978 | 3300007076 | Bacteria | 2158 |
| 198 | Ga0099794_10047087 | 3300007265 | Bacteria | 2067 |
| 199 | Ga0105240_10005185 | 3300009093 | Bacteria | 19495 |
| 200 | Ga0105240_10072097 | 3300009093 | Bacteria | 4270 |
| 201 | Ga0111539_10004683 | 3300009094 | Bacteria | 17879 |
| 202 | Ga0111539_10007501 | 3300009094 | Bacteria | 13961 |
| 203 | Ga0111539_10026978 | 3300009094 | Bacteria | 7016 |
| 204 | Ga0111539_10061639 | 3300009094 | Bacteria | 4443 |
| 205 | Ga0111539_10189021 | 3300009094 | Bacteria | 2404 |
| 206 | Ga0114129_10002520 | 3300009147 | Bacteria | 25430 |
| 207 | Ga0114129_10011944 | 3300009147 | Bacteria | 12350 |
| 208 | Ga0114129_10101509 | 3300009147 | Bacteria | 3980 |
| 209 | Ga0114129_10218778 | 3300009147 | Bacteria | 2571 |
| 210 | Ga0114129_10689061 | 3300009147 | Bacteria | 1314 |
| 211 | Ga0105243_10049333 | 3300009148 | Bacteria | 3321 |
| 212 | Ga0105243_10150858 | 3300009148 | Bacteria | 1994 |
| 213 | Ga0105241_10030868 | 3300009174 | Bacteria | 4008 |
| 214 | Ga0105241_10170098 | 3300009174 | Bacteria | 1799 |
| 215 | Ga0105242_10000556 | 3300009176 | Bacteria | 29534 |
| 216 | Ga0105242_10013676 | 3300009176 | Bacteria | 6277 |
| 217 | Ga0105242_10032170 | 3300009176 | Bacteria | 4193 |
| 218 | Ga0105242_10429715 | 3300009176 | Bacteria | 1240 |
| 219 | Ga0105248_10004265 | 3300009177 | Bacteria | 15822 |
| 220 | Ga0105248_10021930 | 3300009177 | Bacteria | 7078 |
| 221 | Ga0105248_10057746 | 3300009177 | Bacteria | 4356 |
| 222 | Ga0105237_10067738 | 3300009545 | Bacteria | 3564 |
| 223 | Ga0105238_10109045 | 3300009551 | Bacteria | 2750 |
| 224 | Ga0105238_10150330 | 3300009551 | Bacteria | 2304 |
| 225 | Ga0105238_10323716 | 3300009551 | Bacteria | 1528 |
| 226 | Ga0105249_10032592 | 3300009553 | Bacteria | 4715 |
| 227 | Ga0105249_10268067 | 3300009553 | Bacteria | 1700 |
| 228 | Ga0105249_10318352 | 3300009553 | Bacteria | 1566 |
| 229 | Ga0099796_10004563 | 3300010159 | Bacteria | 3368 |
| 230 | Ga0105239_10068834 | 3300010375 | Bacteria | 3890 |
| 231 | Ga0105246_10031036 | 3300011119 | Bacteria | 3534 |
| 232 | Ga0157371_10053128 | 3300013102 | Bacteria | 2877 |
| 233 | Ga0157369_10004712 | 3300013105 | Bacteria | 16035 |
| 234 | Ga0157369_10081506 | 3300013105 | Bacteria | 3463 |
| 235 | Ga0157374_10080020 | 3300013296 | Bacteria | 3098 |
| 236 | Ga0157374_10193419 | 3300013296 | Bacteria | 1990 |
| 237 | Ga0157378_10045534 | 3300013297 | Bacteria | 3898 |
| 238 | Ga0163162_10070559 | 3300013306 | Bacteria | 3545 |
| 239 | Ga0163162_10070988 | 3300013306 | Bacteria | 3535 |
| 240 | Ga0163162_10079555 | 3300013306 | Bacteria | 3344 |
| 241 | Ga0157372_10078996 | 3300013307 | Bacteria | 3719 |
| 242 | Ga0157375_10013194 | 3300013308 | Bacteria | 7346 |
| 243 | Ga0157375_10059690 | 3300013308 | Bacteria | 3780 |
| 244 | Ga0157375_10201206 | 3300013308 | Bacteria | 2148 |
| 245 | Ga0157375_10701421 | 3300013308 | Bacteria | 1166 |
| 246 | Ga0163163_10003827 | 3300014325 | Bacteria | 12814 |
| 247 | Ga0163163_10005343 | 3300014325 | Bacteria | 11091 |
| 248 | Ga0163163_10027044 | 3300014325 | Bacteria | 5490 |
| 249 | Ga0163163_10053206 | 3300014325 | Bacteria | 3996 |
| 250 | Ga0157380_10036512 | 3300014326 | Bacteria | 3802 |
| 251 | Ga0182008_10124102 | 3300014497 | Bacteria | 1285 |
| 252 | Ga0157379_10019806 | 3300014968 | Bacteria | 5947 |
| 253 | Ga0157379_10050438 | 3300014968 | Bacteria | 3715 |
| 254 | Ga0157376_10008551 | 3300014969 | Bacteria | 7394 |
| 255 | Ga0157376_10086833 | 3300014969 | Bacteria | 2698 |
| 256 | Ga0157376_10155165 | 3300014969 | Bacteria | 2069 |
| 257 | Ga0163161_10012730 | 3300017792 | Bacteria | 5843 |
| 258 | Ga0206356_10062693 | 3300020070 | Bacteria | 3078 |
| 259 | Ga0206354_10232206 | 3300020081 | Bacteria | 1507 |
| 260 | Ga0213872_10003092 | 3300021361 | Bacteria | 9370 |
| 261 | Ga0213872_10006459 | 3300021361 | Bacteria | 5875 |
| 262 | Ga0213872_10010099 | 3300021361 | Bacteria | 4502 |
| 263 | Ga0213872_10031585 | 3300021361 | Bacteria | 2427 |
| 264 | Ga0213875_10053763 | 3300021388 | Bacteria | 1886 |
| 265 | Ga0224712_10034708 | 3300022467 | Bacteria | 1857 |
| 266 | Ga0209051_1007653 | 3300025303 | Bacteria | 5872 |
| 267 | Ga0207697_10093198 | 3300025315 | Bacteria | 1278 |
| 268 | Ga0207656_10017568 | 3300025321 | Bacteria | 2804 |
| 269 | Ga0207692_10000821 | 3300025898 | Bacteria | 11129 |
| 270 | Ga0207642_10022428 | 3300025899 | Bacteria | 2504 |
| 271 | Ga0207710_10067668 | 3300025900 | Bacteria | 1632 |
| 272 | Ga0207680_10034895 | 3300025903 | Bacteria | 2882 |
| 273 | Ga0207680_10061511 | 3300025903 | Bacteria | 2290 |
| 274 | Ga0207647_10017480 | 3300025904 | Bacteria | 4875 |
| 275 | Ga0207699_10000151 | 3300025906 | Bacteria | 44631 |
| 276 | Ga0207699_10011935 | 3300025906 | Bacteria | 4404 |
| 277 | Ga0207699_10131904 | 3300025906 | Bacteria | 1631 |
| 278 | Ga0207645_10001558 | 3300025907 | Bacteria | 18754 |
| 279 | Ga0207645_10083453 | 3300025907 | Bacteria | 2049 |
| 280 | Ga0207643_10018803 | 3300025908 | Bacteria | 3784 |
| 281 | Ga0207705_10030469 | 3300025909 | Bacteria | 3850 |
| 282 | Ga0207705_10168879 | 3300025909 | Bacteria | 1646 |
| 283 | Ga0207684_10000134 | 3300025910 | Bacteria | 133720 |
| 284 | Ga0207684_10000153 | 3300025910 | Bacteria | 120731 |
| 285 | Ga0207684_10005110 | 3300025910 | Bacteria | 12227 |
| 286 | Ga0207684_10025168 | 3300025910 | Bacteria | 5073 |
| 287 | Ga0207684_10060147 | 3300025910 | Bacteria | 3227 |
| 288 | Ga0207684_10133160 | 3300025910 | Bacteria | 2134 |
| 289 | Ga0207684_10163487 | 3300025910 | Bacteria | 1917 |
| 290 | Ga0207695_10003421 | 3300025913 | Bacteria | 22392 |
| 291 | Ga0207671_10087941 | 3300025914 | Bacteria | 2337 |
| 292 | Ga0207693_10000339 | 3300025915 | Bacteria | 43073 |
| 293 | Ga0207693_10005268 | 3300025915 | Bacteria | 10817 |
| 294 | Ga0207693_10008424 | 3300025915 | Bacteria | 8435 |
| 295 | Ga0207693_10077500 | 3300025915 | Bacteria | 2603 |
| 296 | Ga0207693_10102696 | 3300025915 | Bacteria | 2242 |
| 297 | Ga0207663_10008722 | 3300025916 | Bacteria | 5323 |
| 298 | Ga0207649_10135705 | 3300025920 | Bacteria | 1677 |
| 299 | Ga0207652_10037227 | 3300025921 | Bacteria | 4118 |
| 300 | Ga0207652_10055534 | 3300025921 | Bacteria | 3407 |
| 301 | Ga0207646_10031090 | 3300025922 | Bacteria | 4835 |
| 302 | Ga0207646_10046974 | 3300025922 | Bacteria | 3873 |
| 303 | Ga0207646_10210693 | 3300025922 | Bacteria | 1755 |
| 304 | Ga0207646_10263531 | 3300025922 | Bacteria | 1557 |
| 305 | Ga0207646_10274886 | 3300025922 | Bacteria | 1522 |
| 306 | Ga0207681_10032686 | 3300025923 | Bacteria | 3407 |
| 307 | Ga0207694_10084709 | 3300025924 | Bacteria | 2493 |
| 308 | Ga0207650_10009835 | 3300025925 | Bacteria | 6543 |
| 309 | Ga0207650_10164840 | 3300025925 | Bacteria | 1758 |
| 310 | Ga0207659_10009066 | 3300025926 | Bacteria | 6207 |
| 311 | Ga0207659_10033180 | 3300025926 | Bacteria | 3551 |
| 312 | Ga0207659_10063037 | 3300025926 | Bacteria | 2678 |
| 313 | Ga0207659_10068924 | 3300025926 | Bacteria | 2574 |
| 314 | Ga0207659_10128564 | 3300025926 | Bacteria | 1952 |
| 315 | Ga0207700_10036243 | 3300025928 | Bacteria | 3560 |
| 316 | Ga0207700_10207154 | 3300025928 | Bacteria | 1656 |
| 317 | Ga0207664_10030030 | 3300025929 | Bacteria | 4148 |
| 318 | Ga0207644_10002988 | 3300025931 | Bacteria | 10877 |
| 319 | Ga0207644_10118587 | 3300025931 | Bacteria | 2011 |
| 320 | Ga0207644_10167608 | 3300025931 | Bacteria | 1712 |
| 321 | Ga0207706_10059836 | 3300025933 | Bacteria | 3354 |
| 322 | Ga0207686_10012098 | 3300025934 | Bacteria | 4741 |
| 323 | Ga0207686_10070681 | 3300025934 | Bacteria | 2244 |
| 324 | Ga0207709_10001097 | 3300025935 | Bacteria | 19856 |
| 325 | Ga0207709_10082455 | 3300025935 | Bacteria | 2077 |
| 326 | Ga0207670_10033137 | 3300025936 | Bacteria | 3327 |
| 327 | Ga0207669_10022364 | 3300025937 | Bacteria | 3358 |
| 328 | Ga0207669_10028685 | 3300025937 | Bacteria | 3065 |
| 329 | Ga0207704_10017772 | 3300025938 | Bacteria | 3696 |
| 330 | Ga0207704_10022467 | 3300025938 | Bacteria | 3380 |
| 331 | Ga0207704_10248962 | 3300025938 | Bacteria | 1333 |
| 332 | Ga0207665_10025087 | 3300025939 | Bacteria | 3932 |
| 333 | Ga0207665_10039861 | 3300025939 | Bacteria | 3133 |
| 334 | Ga0207665_10075120 | 3300025939 | Bacteria | 2314 |
| 335 | Ga0207691_10003386 | 3300025940 | Bacteria | 15512 |
| 336 | Ga0207691_10033473 | 3300025940 | Bacteria | 4784 |
| 337 | Ga0207691_10050596 | 3300025940 | Bacteria | 3803 |
| 338 | Ga0207691_10164614 | 3300025940 | Bacteria | 1944 |
| 339 | Ga0207711_10022199 | 3300025941 | Bacteria | 5307 |
| 340 | Ga0207711_10042672 | 3300025941 | Bacteria | 3865 |
| 341 | Ga0207711_10046873 | 3300025941 | Bacteria | 3693 |
| 342 | Ga0207689_10005582 | 3300025942 | Bacteria | 11215 |
| 343 | Ga0207689_10108736 | 3300025942 | Bacteria | 2278 |
| 344 | Ga0207661_10003175 | 3300025944 | Bacteria | 11398 |
| 345 | Ga0207661_10022528 | 3300025944 | Bacteria | 4746 |
| 346 | Ga0207667_10040008 | 3300025949 | Bacteria | 4992 |
| 347 | Ga0207651_10245389 | 3300025960 | Bacteria | 1462 |
| 348 | Ga0207712_10004066 | 3300025961 | Bacteria | 9233 |
| 349 | Ga0207712_10058347 | 3300025961 | Bacteria | 2727 |
| 350 | Ga0207712_10256241 | 3300025961 | Bacteria | 1417 |
| 351 | Ga0207668_10038600 | 3300025972 | Bacteria | 3207 |
| 352 | Ga0207668_10075469 | 3300025972 | Bacteria | 2424 |
| 353 | Ga0207668_10196507 | 3300025972 | Bacteria | 1603 |
| 354 | Ga0207640_10042307 | 3300025981 | Bacteria | 2904 |
| 355 | Ga0207658_10016527 | 3300025986 | Bacteria | 5077 |
| 356 | Ga0207658_10047951 | 3300025986 | Bacteria | 3129 |
| 357 | Ga0207658_10069955 | 3300025986 | Bacteria | 2654 |
| 358 | Ga0207677_10019840 | 3300026023 | Bacteria | 4069 |
| 359 | Ga0207677_10114545 | 3300026023 | Bacteria | 2015 |
| 360 | Ga0207703_10002940 | 3300026035 | Bacteria | 14483 |
| 361 | Ga0207703_10007109 | 3300026035 | Bacteria | 8907 |
| 362 | Ga0207703_10017641 | 3300026035 | Bacteria | 5572 |
| 363 | Ga0207703_10031865 | 3300026035 | Bacteria | 4171 |
| 364 | Ga0207703_10086518 | 3300026035 | Bacteria | 2626 |
| 365 | Ga0207703_10210043 | 3300026035 | Bacteria | 1735 |
| 366 | Ga0207639_10130399 | 3300026041 | Bacteria | 2080 |
| 367 | Ga0207678_10145263 | 3300026067 | Bacteria | 2025 |
| 368 | Ga0207708_10176533 | 3300026075 | Bacteria | 1694 |
| 369 | Ga0207708_10182595 | 3300026075 | Bacteria | 1666 |
| 370 | Ga0207702_10004539 | 3300026078 | Bacteria | 12304 |
| 371 | Ga0207702_10006429 | 3300026078 | Bacteria | 10137 |
| 372 | Ga0207702_10292486 | 3300026078 | Bacteria | 1544 |
| 373 | Ga0207641_10009773 | 3300026088 | Bacteria | 7897 |
| 374 | Ga0207641_10028713 | 3300026088 | Bacteria | 4598 |
| 375 | Ga0207641_10112973 | 3300026088 | Bacteria | 2411 |
| 376 | Ga0207641_10117525 | 3300026088 | Bacteria | 2368 |
| 377 | Ga0207641_10168231 | 3300026088 | Bacteria | 1998 |
| 378 | Ga0207641_10264418 | 3300026088 | Bacteria | 1612 |
| 379 | Ga0207641_10279328 | 3300026088 | Bacteria | 1570 |
| 380 | Ga0207641_10418787 | 3300026088 | Bacteria | 1289 |
| 381 | Ga0207676_10002093 | 3300026095 | Bacteria | 14451 |
| 382 | Ga0207676_10016118 | 3300026095 | Bacteria | 5406 |
| 383 | Ga0207676_10252730 | 3300026095 | Bacteria | 1587 |
| 384 | Ga0207676_10312085 | 3300026095 | Bacteria | 1440 |
| 385 | Ga0207674_10081080 | 3300026116 | Bacteria | 3247 |
| 386 | Ga0207674_10094112 | 3300026116 | Bacteria | 2983 |
| 387 | Ga0207674_10299291 | 3300026116 | Bacteria | 1558 |
| 388 | Ga0207674_10510885 | 3300026116 | Bacteria | 1161 |
| 389 | Ga0207675_100120783 | 3300026118 | Bacteria | 2479 |
| 390 | Ga0207675_100206696 | 3300026118 | Bacteria | 1887 |
| 391 | Ga0207675_100263509 | 3300026118 | Bacteria | 1671 |
| 392 | Ga0207683_10008362 | 3300026121 | Bacteria | 8848 |
| 393 | Ga0207683_10077444 | 3300026121 | Bacteria | 2945 |
| 394 | Ga0207683_10086582 | 3300026121 | Bacteria | 2785 |
| 395 | Ga0207683_10140919 | 3300026121 | Bacteria | 2173 |
| 396 | Ga0207683_10349453 | 3300026121 | Bacteria | 1357 |
| 397 | Ga0207698_10050739 | 3300026142 | Bacteria | 3167 |
| 398 | Ga0207698_10289916 | 3300026142 | Bacteria | 1518 |
| 399 | Ga0207698_10330060 | 3300026142 | Bacteria | 1432 |
| 400 | Ga0209389_1000009 | 3300027296 | Bacteria | 226873 |
| 401 | Ga0209489_100050 | 3300027361 | Bacteria | 154669 |
| 402 | Ga0209700_100016 | 3300027363 | Bacteria | 252567 |
| 403 | Ga0209588_1017423 | 3300027671 | Bacteria | 2227 |
| 404 | Ga0209971_1014086 | 3300027682 | Bacteria | 1895 |
| 405 | Ga0207428_10003201 | 3300027907 | Bacteria | 16012 |
| 406 | Ga0207428_10007187 | 3300027907 | Bacteria | 10183 |
| 407 | Ga0268266_10003141 | 3300028379 | Bacteria | 16781 |
| 408 | Ga0268266_10268139 | 3300028379 | Bacteria | 1584 |
| 409 | Ga0268265_10322968 | 3300028380 | Bacteria | 1399 |
| 410 | Ga0268264_10020456 | 3300028381 | Bacteria | 5407 |
| 411 | Ga0268264_10049630 | 3300028381 | Bacteria | 3492 |
| 412 | Ga0268264_10123801 | 3300028381 | Bacteria | 2282 |
| 413 | Ga0268264_10133742 | 3300028381 | Bacteria | 2202 |
| 414 | Ga0268264_10198865 | 3300028381 | Bacteria | 1832 |
| 415 | Ga0265326_10001417 | 3300028558 | Bacteria | 8438 |
| 416 | Ga0265319_1020910 | 3300028563 | Bacteria | 2413 |
| 417 | Ga0265334_10002860 | 3300028573 | Bacteria | 7923 |
| 418 | Ga0265318_10001480 | 3300028577 | Bacteria | 13734 |
| 419 | Ga0265323_10001736 | 3300028653 | Bacteria | 10343 |
| 420 | Ga0265323_10003438 | 3300028653 | Bacteria | 6992 |
| 421 | Ga0265322_10004818 | 3300028654 | Bacteria | 3999 |
| 422 | Ga0307515_10094760 | 3300028794 | Bacteria | 3683 |
| 423 | Ga0265338_10000109 | 3300028800 | Bacteria | 152826 |
| 424 | Ga0265338_10011920 | 3300028800 | Bacteria | 9977 |
| 425 | Ga0265338_10038273 | 3300028800 | Bacteria | 4548 |
| 426 | Ga0265324_10000433 | 3300029957 | Bacteria | 29760 |
| 427 | Ga0265324_10000439 | 3300029957 | Bacteria | 29542 |
| 428 | Ga0265330_10001505 | 3300031235 | Bacteria | 13469 |
| 429 | Ga0265330_10002670 | 3300031235 | Bacteria | 9635 |
| 430 | Ga0265330_10008907 | 3300031235 | Bacteria | 4794 |
| 431 | Ga0265332_10000083 | 3300031238 | Bacteria | 83040 |
| 432 | Ga0265332_10049485 | 3300031238 | Bacteria | 1807 |
| 433 | Ga0265328_10000106 | 3300031239 | Bacteria | 39805 |
| 434 | Ga0265328_10003916 | 3300031239 | Bacteria | 6549 |
| 435 | Ga0265320_10009006 | 3300031240 | Bacteria | 6052 |
| 436 | Ga0265320_10039726 | 3300031240 | Bacteria | 2350 |
| 437 | Ga0265325_10008650 | 3300031241 | Bacteria | 5995 |
| 438 | Ga0265325_10010738 | 3300031241 | Bacteria | 5285 |
| 439 | Ga0265325_10015153 | 3300031241 | Bacteria | 4342 |
| 440 | Ga0265325_10030002 | 3300031241 | Bacteria | 2919 |
| 441 | Ga0265329_10003360 | 3300031242 | Bacteria | 6990 |
| 442 | Ga0265329_10039753 | 3300031242 | Bacteria | 1511 |
| 443 | Ga0265340_10001827 | 3300031247 | Bacteria | 12172 |
| 444 | Ga0265331_10000093 | 3300031250 | Bacteria | 123060 |
| 445 | Ga0265331_10000636 | 3300031250 | Bacteria | 30412 |
| 446 | Ga0265331_10005379 | 3300031250 | Bacteria | 7741 |
| 447 | Ga0265331_10010080 | 3300031250 | Bacteria | 5249 |
| 448 | Ga0265331_10031913 | 3300031250 | Bacteria | 2615 |
| 449 | Ga0265327_10000988 | 3300031251 | Bacteria | 40530 |
| 450 | Ga0265327_10001720 | 3300031251 | Bacteria | 25945 |
| 451 | Ga0265327_10001881 | 3300031251 | Bacteria | 24292 |
| 452 | Ga0265327_10013236 | 3300031251 | Bacteria | 5493 |
| 453 | Ga0265327_10028521 | 3300031251 | Bacteria | 3191 |
| 454 | Ga0265327_10037426 | 3300031251 | Bacteria | 2656 |
| 455 | Ga0265316_10000508 | 3300031344 | Bacteria | 43878 |
| 456 | Ga0265316_10004367 | 3300031344 | Bacteria | 14099 |
| 457 | Ga0265316_10012659 | 3300031344 | Bacteria | 7551 |
| 458 | Ga0265316_10014135 | 3300031344 | Bacteria | 7043 |
| 459 | Ga0265316_10031788 | 3300031344 | Bacteria | 4313 |
| 460 | Ga0265316_10051541 | 3300031344 | Bacteria | 3232 |
| 461 | Ga0265313_10000061 | 3300031595 | Bacteria | 107220 |
| 462 | Ga0316575_10000910 | 3300031665 | Bacteria | 9077 |
| 463 | Ga0316575_10004040 | 3300031665 | Bacteria | 5139 |
| 464 | Ga0316575_10025877 | 3300031665 | Bacteria | 2278 |
| 465 | Ga0316575_10035570 | 3300031665 | Bacteria | 1959 |
| 466 | Ga0316575_10040223 | 3300031665 | Bacteria | 1847 |
| 467 | Ga0316579_10004781 | 3300031691 | Bacteria | 5411 |
| 468 | Ga0265314_10000136 | 3300031711 | Bacteria | 109906 |
| 469 | Ga0265314_10000447 | 3300031711 | Bacteria | 55167 |
| 470 | Ga0265314_10001998 | 3300031711 | Bacteria | 21636 |
| 471 | Ga0265314_10002346 | 3300031711 | Bacteria | 19541 |
| 472 | Ga0265314_10031660 | 3300031711 | Bacteria | 3901 |
| 473 | Ga0265314_10071918 | 3300031711 | Bacteria | 2312 |
| 474 | Ga0265342_10012919 | 3300031712 | Bacteria | 5629 |
| 475 | Ga0316576_10000185 | 3300031727 | Bacteria | 26067 |
| 476 | Ga0316576_10000775 | 3300031727 | Bacteria | 15974 |
| 477 | Ga0316576_10003197 | 3300031727 | Bacteria | 9547 |
| 478 | Ga0316576_10009926 | 3300031727 | Bacteria | 6163 |
| 479 | Ga0316576_10019045 | 3300031727 | Bacteria | 4697 |
| 480 | Ga0316576_10020319 | 3300031727 | Bacteria | 4568 |
| 481 | Ga0316576_10022521 | 3300031727 | Bacteria | 4377 |
| 482 | Ga0316576_10035413 | 3300031727 | Bacteria | 3562 |
| 483 | Ga0316576_10035928 | 3300031727 | Bacteria | 3541 |
| 484 | Ga0316576_10040935 | 3300031727 | Bacteria | 3332 |
| 485 | Ga0316576_10048043 | 3300031727 | Bacteria | 3093 |
| 486 | Ga0316576_10068814 | 3300031727 | Bacteria | 2609 |
| 487 | Ga0316576_10070115 | 3300031727 | Bacteria | 2585 |
| 488 | Ga0316576_10075746 | 3300031727 | Bacteria | 2489 |
| 489 | Ga0316576_10077327 | 3300031727 | Bacteria | 2464 |
| 490 | Ga0316576_10100367 | 3300031727 | Bacteria | 2163 |
| 491 | Ga0316576_10104085 | 3300031727 | Bacteria | 2124 |
| 492 | Ga0316576_10106068 | 3300031727 | Bacteria | 2103 |
| 493 | Ga0316576_10167757 | 3300031727 | Bacteria | 1657 |
| 494 | Ga0316578_10000009 | 3300031728 | Bacteria | 44952 |
| 495 | Ga0316578_10001054 | 3300031728 | Bacteria | 10639 |
| 496 | Ga0316578_10009518 | 3300031728 | Bacteria | 4999 |
| 497 | Ga0316578_10010545 | 3300031728 | Bacteria | 4801 |
| 498 | Ga0316578_10014151 | 3300031728 | Bacteria | 4253 |
| 499 | Ga0316578_10014267 | 3300031728 | Bacteria | 4238 |
| 500 | Ga0316578_10015033 | 3300031728 | Bacteria | 4152 |
| 501 | Ga0316578_10015408 | 3300031728 | Bacteria | 4110 |
| 502 | Ga0316578_10031100 | 3300031728 | Bacteria | 3039 |
| 503 | Ga0316578_10035608 | 3300031728 | Bacteria | 2862 |
| 504 | Ga0316578_10036047 | 3300031728 | Bacteria | 2846 |
| 505 | Ga0316578_10038031 | 3300031728 | Bacteria | 2773 |
| 506 | Ga0316578_10073172 | 3300031728 | Bacteria | 2031 |
| 507 | Ga0316578_10173251 | 3300031728 | Bacteria | 1300 |
| 508 | Ga0307516_10010810 | 3300031730 | Bacteria | 9987 |
| 509 | Ga0307405_10082564 | 3300031731 | Bacteria | 2104 |
| 510 | Ga0307405_10125312 | 3300031731 | Bacteria | 1765 |
| 511 | Ga0316577_10002145 | 3300031733 | Bacteria | 9653 |
| 512 | Ga0316577_10046875 | 3300031733 | Bacteria | 2413 |
| 513 | Ga0316577_10072529 | 3300031733 | Bacteria | 1922 |
| 514 | Ga0316577_10083601 | 3300031733 | Bacteria | 1785 |
| 515 | Ga0316577_10129019 | 3300031733 | Bacteria | 1422 |
| 516 | Ga0307413_10007356 | 3300031824 | Bacteria | 5108 |
| 517 | Ga0307413_10098219 | 3300031824 | Bacteria | 1927 |
| 518 | Ga0307413_10215345 | 3300031824 | Bacteria | 1398 |
| 519 | Ga0307410_10073541 | 3300031852 | Bacteria | 2377 |
| 520 | Ga0307406_10309963 | 3300031901 | Bacteria | 1216 |
| 521 | Ga0307407_10036396 | 3300031903 | Bacteria | 2712 |
| 522 | Ga0307407_10053359 | 3300031903 | Bacteria | 2326 |
| 523 | Ga0307407_10091684 | 3300031903 | Bacteria | 1864 |
| 524 | Ga0307407_10221988 | 3300031903 | Bacteria | 1278 |
| 525 | Ga0307409_100004292 | 3300031995 | Bacteria | 7974 |
| 526 | Ga0307409_100023190 | 3300031995 | Bacteria | 4294 |
| 527 | Ga0307409_100124196 | 3300031995 | Bacteria | 2192 |
| 528 | Ga0307409_100132326 | 3300031995 | Bacteria | 2134 |
| 529 | Ga0307409_100134882 | 3300031995 | Bacteria | 2116 |
| 530 | Ga0307409_100484803 | 3300031995 | Bacteria | 1200 |
| 531 | Ga0307416_100001236 | 3300032002 | Bacteria | 13784 |
| 532 | Ga0307416_100028930 | 3300032002 | Bacteria | 4130 |
| 533 | Ga0307416_100048452 | 3300032002 | Bacteria | 3371 |
| 534 | Ga0307416_100089060 | 3300032002 | Bacteria | 2641 |
| 535 | Ga0307416_100165575 | 3300032002 | Bacteria | 2050 |
| 536 | Ga0307416_100268724 | 3300032002 | Bacteria | 1672 |
| 537 | Ga0307416_100497365 | 3300032002 | Bacteria | 1283 |
| 538 | Ga0307411_10002945 | 3300032005 | Bacteria | 7728 |
| 539 | Ga0307411_10081513 | 3300032005 | Bacteria | 2228 |
| 540 | Ga0307411_10104615 | 3300032005 | Bacteria | 2011 |
| 541 | Ga0307415_100003696 | 3300032126 | Bacteria | 7830 |
| 542 | Ga0307415_100042383 | 3300032126 | Bacteria | 3029 |
| 543 | Ga0307415_100258218 | 3300032126 | Bacteria | 1420 |
| 544 | Ga0316583_10015714 | 3300032133 | Bacteria | 2725 |
| 545 | Ga0316585_10008848 | 3300032137 | Bacteria | 2925 |
| 546 | Ga0316585_10033923 | 3300032137 | Bacteria | 1611 |
| 547 | Ga0316585_10050710 | 3300032137 | Bacteria | 1332 |
| 548 | Ga0316580_10000523 | 3300032139 | Bacteria | 8884 |
| 549 | Ga0316580_10006681 | 3300032139 | Bacteria | 3410 |
| 550 | Ga0316580_10014380 | 3300032139 | Bacteria | 2417 |
| 551 | Ga0316580_10020582 | 3300032139 | Bacteria | 2033 |
| 552 | Ga0316593_10001400 | 3300032168 | Bacteria | 5297 |
| 553 | Ga0316593_10005726 | 3300032168 | Bacteria | 3306 |
| 554 | Ga0316593_10008151 | 3300032168 | Bacteria | 2909 |
| 555 | Ga0316593_10021162 | 3300032168 | Bacteria | 2031 |
| 556 | Ga0316593_10021597 | 3300032168 | Bacteria | 2014 |
| 557 | Ga0307507_10022327 | 3300033179 | Bacteria | 6998 |
| 558 | Ga0316592_1001415 | 3300033524 | Bacteria | 3847 |
| 559 | Ga0316586_1004449 | 3300033527 | Bacteria | 1915 |
| 560 | Ga0316588_1004450 | 3300033528 | Bacteria | 2655 |
| 561 | Ga0316588_1005395 | 3300033528 | Bacteria | 2487 |
| 562 | Ga0316588_1007960 | 3300033528 | Bacteria | 2168 |
| 563 | Ga0316588_1017806 | 3300033528 | Bacteria | 1586 |
| 564 | Ga0316587_1001928 | 3300033529 | Bacteria | 2680 |
| 565 | Ga0316587_1014958 | 3300033529 | Bacteria | 1284 |
| 566 | Ga0316587_1018704 | 3300033529 | Bacteria | 1168 |
| 567 | Ga0316596_1013240 | 3300033541 | Bacteria | 2035 |
| 568 | Ga0316596_1014493 | 3300033541 | Bacteria | 1955 |
| 569 | Ga0373926_0005213 | 3300035083 | Bacteria | 4278 |
| 570 | Ga0373934_0002111 | 3300035086 | Bacteria | 7290 |
| 571 | Ga0373954_0000284 | 3300035118 | Bacteria | 18310 |
| 572 | Ga0373956_0000996 | 3300035119 | Bacteria | 11720 |
| 573 | Ga0373956_0139692 | 3300035119 | Bacteria | 1137 |
| 574 | Ga0373955_0066479 | 3300035172 | Bacteria | 2004 |
| 575 | Ga0316574_0001201 | 3300035398 | Bacteria | 12021 |
| 576 | Ga0316574_0002122 | 3300035398 | Bacteria | 9833 |
| 577 | Ga0316574_0003293 | 3300035398 | Bacteria | 8303 |
| 578 | Ga0316574_0003902 | 3300035398 | Bacteria | 7750 |
| 579 | Ga0316574_0003963 | 3300035398 | Bacteria | 7707 |
| 580 | Ga0316574_0007850 | 3300035398 | Bacteria | 5882 |
| 581 | Ga0316574_0012529 | 3300035398 | Bacteria | 4852 |
| 582 | Ga0316574_0013379 | 3300035398 | Bacteria | 4715 |
| 583 | Ga0316574_0017743 | 3300035398 | Bacteria | 4172 |
| 584 | Ga0316574_0042760 | 3300035398 | Bacteria | 2797 |
| 585 | Ga0316574_0055240 | 3300035398 | Bacteria | 2482 |
| 586 | Ga0316574_0064009 | 3300035398 | Bacteria | 2313 |
| 587 | Ga0316574_0064475 | 3300035398 | Bacteria | 2305 |
| 588 | Ga0316574_0096268 | 3300035398 | Bacteria | 1891 |
| 589 | Ga0316574_0111736 | 3300035398 | Bacteria | 1752 |
| 590 | Ga0316574_0135563 | 3300035398 | Bacteria | 1585 |
| 591 | Ga0316574_0154653 | 3300035398 | Bacteria | 1478 |
| 592 | Ga0316574_0158357 | 3300035398 | Bacteria | 1459 |
| 593 | Ga0316574_0161734 | 3300035398 | Bacteria | 1442 |
| 594 | Ga0373924_0002671 | 3300035410 | Bacteria | 6013 |
| 595 | Ga0373924_0038118 | 3300035410 | Bacteria | 1959 |
| 596 | Ga0373931_0046143 | 3300035691 | Bacteria | 2303 |
| 597 | Ga0373935_0003679 | 3300035692 | Bacteria | 8944 |
| 598 | Ga0373935_0034934 | 3300035692 | Bacteria | 3135 |
| 599 | Ga0373935_0153412 | 3300035692 | Bacteria | 1565 |
| 600 | Ga0373927_0028535 | 3300035695 | Bacteria | 3641 |
| 601 | Ga0373927_0040395 | 3300035695 | Bacteria | 3026 |
| 602 | Ga0373933_0009642 | 3300035724 | Bacteria | 5276 |
| 603 | Ga0373933_0155183 | 3300035724 | Bacteria | 1451 |
| 604 | Ga0373947_0000740 | 3300035725 | Bacteria | 19574 |
| 605 | Ga0373937_0079023 | 3300036401 | Bacteria | 3040 |
| 606 | Ga0373937_0130992 | 3300036401 | Bacteria | 2342 |
| 607 | Ga0373937_0147931 | 3300036401 | Bacteria | 2199 |
| 608 | Ga0373937_0308532 | 3300036401 | Bacteria | 1496 |
| 609 | Ga0316582_0018517 | 3300036647 | Bacteria | 4055 |
| 610 | Ga0316582_0042542 | 3300036647 | Unclassified | 2846 |
| 611 | Ga0316582_0044199 | 3300036647 | Bacteria | 2799 |
| 612 | Ga0316582_0046563 | 3300036647 | Bacteria | 2735 |
| 613 | Ga0316582_0051069 | 3300036647 | Bacteria | 2622 |
| 614 | Ga0316582_0055054 | 3300036647 | Bacteria | 2534 |
| 615 | Ga0316582_0055368 | 3300036647 | Bacteria | 2528 |
| 616 | Ga0316582_0059869 | 3300036647 | Bacteria | 2440 |
| 617 | Ga0316582_0101088 | 3300036647 | Bacteria | 1910 |
| 618 | Ga0316582_0316630 | 3300036647 | Bacteria | 1072 |
| 619 | Ga0316584_0001897 | 3300036712 | Bacteria | 13001 |
| 620 | Ga0316584_0013099 | 3300036712 | Bacteria | 5862 |
| 621 | Ga0316584_0013283 | 3300036712 | Bacteria | 5826 |
| 622 | Ga0316584_0014220 | 3300036712 | Bacteria | 5660 |
| 623 | Ga0316584_0016020 | 3300036712 | Bacteria | 5369 |
| 624 | Ga0316584_0016776 | 3300036712 | Bacteria | 5254 |
| 625 | Ga0316584_0029909 | 3300036712 | Bacteria | 4022 |
| 626 | Ga0316584_0035379 | 3300036712 | Bacteria | 3705 |
| 627 | Ga0316584_0048622 | 3300036712 | Bacteria | 3169 |
| 628 | Ga0316584_0051912 | 3300036712 | Bacteria | 3067 |
| 629 | Ga0316584_0060909 | 3300036712 | Bacteria | 2827 |
| 630 | Ga0316584_0065573 | 3300036712 | Bacteria | 2720 |
| 631 | Ga0316584_0087928 | 3300036712 | Bacteria | 2326 |
| 632 | Ga0316584_0090466 | 3300036712 | Bacteria | 2291 |
| 633 | Ga0316584_0100478 | 3300036712 | Bacteria | 2166 |
| 634 | Ga0316584_0174556 | 3300036712 | Bacteria | 1592 |
| 635 | Ga0316584_0198278 | 3300036712 | Bacteria | 1482 |
| 636 | Ga0316584_0268650 | 3300036712 | Bacteria | 1242 |
| 637 | Ga0373925_0013087 | 3300037068 | Bacteria | 6006 |
| 638 | Ga0373925_0014962 | 3300037068 | Bacteria | 5609 |
| 639 | Ga0373925_0025412 | 3300037068 | Bacteria | 4326 |
| 640 | Ga0373925_0062685 | 3300037068 | Bacteria | 2796 |
| 641 | Ga0395899_0117861 | 3300037312 | Bacteria | 1904 |
| 642 | Ga0395900_0061724 | 3300037418 | Bacteria | 3853 |
| 643 | Ga0395898_0121693 | 3300037466 | Bacteria | 2500 |
| 644 | Ga0395898_0232976 | 3300037466 | Bacteria | 1756 |
| 645 | Ga0395905_0000090 | 3300037471 | Bacteria | 152117 |
| 646 | Ga0395905_0027816 | 3300037471 | Bacteria | 5331 |
| 647 | Ga0395905_0042860 | 3300037471 | Bacteria | 4246 |
| 648 | Ga0395905_0050933 | 3300037471 | Bacteria | 3878 |
| 649 | Ga0395905_0133205 | 3300037471 | Bacteria | 2337 |
| 650 | Ga0395905_0142817 | 3300037471 | Bacteria | 2252 |
| 651 | Ga0395905_0195530 | 3300037471 | Bacteria | 1896 |
| 652 | Ga0316581_0015139 | 3300037588 | Bacteria | 2200 |
| 653 | Ga0436364_0410612 | 3300037853 | Bacteria | 5972 |
| 654 | Ga0436364_1086943 | 3300037853 | Bacteria | 2961 |
| 655 | Ga0395901_0001398 | 3300038443 | Bacteria | 25218 |
| 656 | Ga0395901_0024823 | 3300038443 | Bacteria | 6152 |
| 657 | Ga0400490_50633 | 3300038726 | Bacteria | 48494 |
| 658 | Ga0400491_16945 | 3300038727 | Bacteria | 5211 |
| 659 | Ga0400488_53777 | 3300038741 | Bacteria | 2885 |
| 660 | Ga0400483_027323 | 3300039062 | Bacteria | 4433 |
| 661 | Ga0400483_061984 | 3300039062 | Bacteria | 5747 |
| 662 | Ga0400483_063435 | 3300039062 | Bacteria | 25413 |
| 663 | Ga0400483_075120 | 3300039062 | Bacteria | 14732 |
| 664 | Ga0400483_142661 | 3300039062 | Bacteria | 5275 |
| 665 | Ga0400483_163069 | 3300039062 | Bacteria | 15145 |
| 666 | Ga0400483_166407 | 3300039062 | Bacteria | 1694 |
| 667 | Ga0400483_189406 | 3300039062 | Bacteria | 6677 |
| 668 | Ga0400483_212256 | 3300039062 | Bacteria | 21400 |
| 669 | Ga0400483_274218 | 3300039062 | Bacteria | 4101 |
| 670 | Ga0400487_18541 | 3300039110 | Bacteria | 14059 |
| 671 | Ga0400487_20179 | 3300039110 | Bacteria | 60838 |
| 672 | Ga0436365_0391497 | 3300039437 | Bacteria | 3038 |
| 673 | Ga0436365_1362540 | 3300039437 | Bacteria | 3066 |
| 674 | Ga0436361_0162216 | 3300039447 | Bacteria | 10644 |
| 675 | Ga0436361_0408050 | 3300039447 | Bacteria | 13949 |
| 676 | Ga0436361_0687968 | 3300039447 | Bacteria | 7055 |
| 677 | Ga0436361_0950210 | 3300039447 | Bacteria | 3736 |
| 678 | Ga0436361_0976615 | 3300039447 | Bacteria | 1634 |
| 679 | Ga0436361_0995760 | 3300039447 | Bacteria | 3068 |
| 680 | Ga0436361_1012027 | 3300039447 | Bacteria | 2074 |
| 681 | Ga0436361_1218959 | 3300039447 | Bacteria | 6548 |
| 682 | Ga0436362_0536411 | 3300039453 | Bacteria | 2073 |
| 683 | Ga0439439_0004069 | 3300041406 | Bacteria | 3268 |
| 684 | Ga0439466_0035089 | 3300041411 | Bacteria | 1697 |
| 685 | Ga0439431_0009831 | 3300041997 | Bacteria | 2163 |
| 686 | Ga0439431_0014286 | 3300041997 | Bacteria | 1840 |
| 687 | Ga0439441_007345 | 3300042001 | Bacteria | 1772 |
| 688 | Ga0439445_0011025 | 3300042004 | Bacteria | 2148 |
| 689 | Ga0439432_009430 | 3300042006 | Bacteria | 3404 |
| 690 | Ga0439449_0002444 | 3300042007 | Bacteria | 7263 |
| 691 | Ga0439462_0015414 | 3300042015 | Bacteria | 1970 |
| 692 | Ga0450906_004112 | 3300042145 | Bacteria | 3078 |
| 693 | Ga0439446_0021158 | 3300042156 | Bacteria | 1837 |
| 694 | Ga0439434_0006109 | 3300042435 | Bacteria | 3512 |
| 695 | Ga0451577_0001417 | 3300042876 | Bacteria | 31981 |
| 696 | Ga0451577_0003021 | 3300042876 | Bacteria | 19154 |
| 697 | Ga0451577_0023295 | 3300042876 | Bacteria | 5647 |
| 698 | Ga0451577_0035928 | 3300042876 | Bacteria | 4463 |
| 699 | Ga0451577_0093041 | 3300042876 | Bacteria | 2692 |
| 700 | Ga0451577_0188976 | 3300042876 | Bacteria | 1858 |
| 701 | Ga0453683_0001483 | 3300044673 | Bacteria | 20077 |
| 702 | Ga0453683_0002876 | 3300044673 | Bacteria | 13025 |
| 703 | Ga0453683_0008630 | 3300044673 | Bacteria | 6834 |
| 704 | Ga0453683_0067817 | 3300044673 | Bacteria | 2230 |
| 705 | Ga0466965_0035114 | 3300044683 | Bacteria | 2455 |
| 706 | Ga0466966_0149487 | 3300044684 | Bacteria | 1425 |
| 707 | Ga0453684_0000006 | 3300044712 | Bacteria | 1364191 |
| 708 | Ga0453684_0000027 | 3300044712 | Bacteria | 778857 |
| 709 | Ga0453684_0000029 | 3300044712 | Bacteria | 757969 |
| 710 | Ga0453684_0000847 | 3300044712 | Bacteria | 103142 |
| 711 | Ga0453684_0000969 | 3300044712 | Bacteria | 94503 |
| 712 | Ga0453684_0002999 | 3300044712 | Bacteria | 39284 |
| 713 | Ga0453684_0009614 | 3300044712 | Bacteria | 16861 |
| 714 | Ga0453684_0016369 | 3300044712 | Bacteria | 11604 |
| 715 | Ga0453684_0020712 | 3300044712 | Bacteria | 9896 |
| 716 | Ga0453684_0054458 | 3300044712 | Bacteria | 5210 |
| 717 | Ga0453684_0080090 | 3300044712 | Bacteria | 4080 |
| 718 | Ga0453684_0082591 | 3300044712 | Bacteria | 4002 |
| 719 | Ga0453684_0085048 | 3300044712 | Bacteria | 3932 |
| 720 | Ga0453684_0154167 | 3300044712 | Bacteria | 2726 |
| 721 | Ga0453684_0273625 | 3300044712 | Bacteria | 1928 |
| 722 | Ga0453684_0344330 | 3300044712 | Bacteria | 1682 |
| 723 | Ga0466957_0045844 | 3300044842 | Bacteria | 2652 |
| 724 | Ga0466960_0023445 | 3300044901 | Bacteria | 2771 |
| 725 | Ga0466960_0049913 | 3300044901 | Bacteria | 2016 |
| 726 | Ga0451576_0000029 | 3300045051 | Bacteria | 404449 |
| 727 | Ga0451576_0000219 | 3300045051 | Bacteria | 141949 |
| 728 | Ga0451576_0000483 | 3300045051 | Bacteria | 88050 |
| 729 | Ga0451576_0002900 | 3300045051 | Bacteria | 24470 |
| 730 | Ga0451576_0004162 | 3300045051 | Bacteria | 19049 |
| 731 | Ga0451576_0004755 | 3300045051 | Bacteria | 17429 |
| 732 | Ga0451576_0005937 | 3300045051 | Bacteria | 15127 |
| 733 | Ga0451576_0021596 | 3300045051 | Bacteria | 6995 |
| 734 | Ga0451576_0038947 | 3300045051 | Bacteria | 5031 |
| 735 | Ga0451576_0040519 | 3300045051 | Bacteria | 4929 |
| 736 | Ga0451576_0101011 | 3300045051 | Bacteria | 2999 |
| 737 | Ga0451576_0139185 | 3300045051 | Bacteria | 2532 |
| 738 | Ga0466967_0326688 | 3300045976 | Bacteria | 1480 |
| 739 | Ga0495592_0082814 | 3300046454 | Bacteria | 2318 |
| 740 | Ga0495590_0001807 | 3300046457 | Bacteria | 9062 |
| 741 | Ga0495641_0016725 | 3300046461 | Bacteria | 3853 |
| 742 | Ga0495651_0003692 | 3300046462 | Bacteria | 11727 |
| 743 | Ga0495580_0000277 | 3300046472 | Bacteria | 41482 |
| 744 | Ga0495580_0022054 | 3300046472 | Bacteria | 4692 |
| 745 | Ga0495662_0005209 | 3300046476 | Bacteria | 6518 |
| 746 | Ga0495608_0011389 | 3300046511 | Bacteria | 6189 |
| 747 | Ga0495608_0021836 | 3300046511 | Bacteria | 4390 |
| 748 | Ga0495608_0147857 | 3300046511 | Bacteria | 1498 |
| 749 | Ga0495618_0048665 | 3300046514 | Bacteria | 2676 |
| 750 | Ga0495628_0013619 | 3300046516 | Bacteria | 6837 |
| 751 | Ga0495663_0029949 | 3300046525 | Bacteria | 1610 |
| 752 | Ga0495666_0120431 | 3300046526 | Bacteria | 1229 |
| 753 | Ga0495665_0014376 | 3300046531 | Bacteria | 4270 |
| 754 | Ga0495586_0011145 | 3300046535 | Bacteria | 4777 |
| 755 | Ga0495621_0010777 | 3300046539 | Bacteria | 2809 |
| 756 | Ga0495597_0041970 | 3300046542 | Bacteria | 2041 |
| 757 | Ga0495667_0002820 | 3300046559 | Bacteria | 11609 |
| 758 | Ga0495656_0000108 | 3300046615 | Bacteria | 33050 |
| 759 | Ga0495634_0134521 | 3300046642 | Bacteria | 1573 |
| 760 | Ga0495635_0033171 | 3300046663 | Bacteria | 3581 |
| 761 | Ga0495657_0002668 | 3300046675 | Bacteria | 14912 |
| 762 | Ga0495657_0089781 | 3300046675 | Bacteria | 1973 |
| 763 | Ga0495646_0095193 | 3300046680 | Bacteria | 1714 |
| 764 | Ga0495647_0003619 | 3300046681 | Bacteria | 4958 |
| 765 | Ga0495647_0010396 | 3300046681 | Bacteria | 3168 |
| 766 | Ga0495647_0070205 | 3300046681 | Bacteria | 1401 |
| 767 | Ga0495658_0048513 | 3300046683 | Bacteria | 2394 |
| 768 | Ga0495658_0193574 | 3300046683 | Bacteria | 1265 |
| 769 | Ga0495600_0133935 | 3300046809 | Bacteria | 1610 |
| 770 | Ga0495604_0100946 | 3300047317 | Bacteria | 2120 |
| 771 | Ga0495636_0089846 | 3300047318 | Bacteria | 1332 |
| 772 | Ga0495687_000500 | 3300047443 | Bacteria | 47248 |
| 773 | Ga0495675_0182716 | 3300047444 | Bacteria | 1283 |
| 774 | Ga0495684_0036162 | 3300047471 | Bacteria | 3787 |
| 775 | Ga0495684_0036614 | 3300047471 | Bacteria | 3761 |
| 776 | Ga0495684_0049532 | 3300047471 | Bacteria | 3209 |
| 777 | Ga0495684_0216699 | 3300047471 | Bacteria | 1405 |
| 778 | Ga0496100_0119016 | 3300048903 | Bacteria | 1845 |
| 779 | Ga0496100_0248520 | 3300048903 | Bacteria | 1315 |
| 780 | Ga0496101_0002757 | 3300048904 | Bacteria | 10786 |
| 781 | Ga0496101_0020182 | 3300048904 | Bacteria | 4557 |
| 782 | Ga0496104_0069539 | 3300048907 | Bacteria | 3346 |
| 783 | Ga0496104_0108391 | 3300048907 | Bacteria | 2662 |
| 784 | Ga0496105_0003923 | 3300048908 | Bacteria | 11123 |
| 785 | Ga0496105_0154328 | 3300048908 | Bacteria | 1886 |
| 786 | Ga0496106_0013966 | 3300048909 | Bacteria | 5939 |
| 787 | Ga0496108_0006306 | 3300048911 | Bacteria | 9613 |
| 788 | Ga0496108_0027054 | 3300048911 | Bacteria | 4732 |
| 789 | Ga0496108_0035004 | 3300048911 | Bacteria | 4173 |
| 790 | Ga0496108_0094726 | 3300048911 | Bacteria | 2541 |
| 791 | Ga0496108_0263247 | 3300048911 | Bacteria | 1501 |
| 792 | Ga0496108_0411674 | 3300048911 | Bacteria | 1181 |
| 793 | Ga0496109_0017015 | 3300048912 | Bacteria | 6363 |
| 794 | Ga0496109_0038622 | 3300048912 | Bacteria | 4317 |
| 795 | Ga0496109_0100982 | 3300048912 | Bacteria | 2677 |
| 796 | Ga0496110_0020809 | 3300048913 | Bacteria | 5541 |
| 797 | Ga0496110_0098626 | 3300048913 | Bacteria | 2619 |
| 798 | Ga0496111_0064345 | 3300048914 | Bacteria | 2660 |
| 799 | Ga0496112_0082650 | 3300048915 | Bacteria | 3176 |
| 800 | Ga0496112_0128530 | 3300048915 | Bacteria | 2504 |
| 801 | Ga0496112_0175868 | 3300048915 | Bacteria | 2105 |
| 802 | Ga0496113_0020502 | 3300048916 | Bacteria | 4648 |
| 803 | Ga0496113_0081507 | 3300048916 | Bacteria | 2480 |
| 804 | Ga0496114_0000953 | 3300048917 | Bacteria | 21637 |
| 805 | Ga0496114_0010629 | 3300048917 | Bacteria | 7323 |
| 806 | Ga0496114_0037383 | 3300048917 | Bacteria | 4015 |
| 807 | Ga0496115_0029355 | 3300048918 | Bacteria | 4319 |
| 808 | Ga0496115_0055372 | 3300048918 | Bacteria | 3186 |
| 809 | Ga0495682_0011325 | 3300049460 | Bacteria | 3434 |
| 810 | Ga0501031_0000192 | 3300049568 | Bacteria | 34424 |
| 811 | Ga0501031_0024609 | 3300049568 | Bacteria | 3924 |
| 812 | Ga0501031_0058405 | 3300049568 | Bacteria | 2514 |
| 813 | Ga0501031_0200781 | 3300049568 | Bacteria | 1301 |
| 814 | Ga0501032_0009318 | 3300049569 | Bacteria | 7110 |
| 815 | Ga0501032_0068724 | 3300049569 | Bacteria | 2364 |
| 816 | Ga0501032_0115477 | 3300049569 | Bacteria | 1775 |
| 817 | Ga0501033_0004357 | 3300049570 | Bacteria | 11345 |
| 818 | Ga0501033_0005975 | 3300049570 | Bacteria | 9556 |
| 819 | Ga0501034_0003674 | 3300049571 | Bacteria | 17345 |
| 820 | Ga0501034_0003691 | 3300049571 | Bacteria | 17300 |
| 821 | Ga0501034_0217159 | 3300049571 | Bacteria | 1866 |
| 822 | Ga0501034_0396322 | 3300049571 | Bacteria | 1304 |
| 823 | Ga0501034_0429352 | 3300049571 | Bacteria | 1241 |
| 824 | Ga0501036_0037673 | 3300049572 | Bacteria | 4091 |
| 825 | Ga0501036_0041567 | 3300049572 | Bacteria | 3889 |
| 826 | Ga0501036_0247043 | 3300049572 | Bacteria | 1496 |
| 827 | Ga0501036_0424112 | 3300049572 | Bacteria | 1109 |
| 828 | Ga0501037_0004553 | 3300049573 | Bacteria | 10082 |
| 829 | Ga0501037_0053143 | 3300049573 | Bacteria | 2963 |
| 830 | Ga0501038_0015594 | 3300049574 | Bacteria | 6907 |
| 831 | Ga0501039_0070352 | 3300049575 | Bacteria | 2718 |
| 832 | Ga0501039_0131586 | 3300049575 | Bacteria | 1963 |
| 833 | Ga0501039_0157073 | 3300049575 | Bacteria | 1787 |
| 834 | Ga0501039_0263343 | 3300049575 | Bacteria | 1355 |
| 835 | Ga0501040_0024604 | 3300049576 | Bacteria | 4042 |
| 836 | Ga0501040_0067360 | 3300049576 | Bacteria | 2467 |
| 837 | Ga0501041_0017992 | 3300049577 | Bacteria | 4206 |
| 838 | Ga0501041_0111194 | 3300049577 | Bacteria | 1699 |
| 839 | Ga0501042_0039246 | 3300049578 | Bacteria | 3364 |
| 840 | Ga0501042_0061024 | 3300049578 | Bacteria | 2694 |
| 841 | Ga0501043_0012886 | 3300049579 | Bacteria | 6536 |
| 842 | Ga0501043_0076676 | 3300049579 | Bacteria | 2626 |
| 843 | Ga0501046_0040269 | 3300049580 | Bacteria | 3735 |
| 844 | Ga0501046_0048623 | 3300049580 | Bacteria | 3358 |
| 845 | Ga0501046_0254064 | 3300049580 | Bacteria | 1293 |
| 846 | Ga0501047_0018444 | 3300049581 | Bacteria | 6690 |
| 847 | Ga0501047_0034783 | 3300049581 | Bacteria | 4865 |
| 848 | Ga0501047_0074774 | 3300049581 | Bacteria | 3261 |
| 849 | Ga0501048_0053638 | 3300049582 | Bacteria | 2866 |
| 850 | Ga0501048_0149792 | 3300049582 | Bacteria | 1650 |
| 851 | Ga0501048_0156413 | 3300049582 | Bacteria | 1612 |
| 852 | Ga0501068_0001460 | 3300049584 | Bacteria | 12572 |
| 853 | Ga0501068_0039776 | 3300049584 | Bacteria | 2820 |
| 854 | Ga0501069_0014398 | 3300049585 | Bacteria | 4229 |
| 855 | Ga0501069_0039046 | 3300049585 | Bacteria | 2622 |
| 856 | Ga0501070_0003217 | 3300049586 | Bacteria | 14206 |
| 857 | Ga0501070_0017006 | 3300049586 | Bacteria | 6102 |
| 858 | Ga0501070_0046091 | 3300049586 | Bacteria | 3625 |
| 859 | Ga0501071_0047415 | 3300049587 | Bacteria | 3087 |
| 860 | Ga0501071_0098342 | 3300049587 | Bacteria | 2155 |
| 861 | Ga0501072_0015168 | 3300049588 | Bacteria | 5908 |
| 862 | Ga0501072_0188160 | 3300049588 | Bacteria | 1647 |
| 863 | Ga0501073_0007822 | 3300049589 | Bacteria | 7937 |
| 864 | Ga0501073_0010531 | 3300049589 | Bacteria | 6772 |
| 865 | Ga0501073_0054843 | 3300049589 | Bacteria | 2790 |
| 866 | Ga0501074_0013206 | 3300049590 | Bacteria | 6006 |
| 867 | Ga0501074_0052250 | 3300049590 | Bacteria | 2950 |
| 868 | Ga0501074_0063148 | 3300049590 | Bacteria | 2668 |
| 869 | Ga0501074_0098935 | 3300049590 | Bacteria | 2088 |
| 870 | Ga0501075_0038883 | 3300049591 | Bacteria | 3558 |
| 871 | Ga0501076_0004696 | 3300049592 | Bacteria | 9744 |
| 872 | Ga0501076_0011413 | 3300049592 | Bacteria | 6616 |
| 873 | Ga0501076_0124670 | 3300049592 | Bacteria | 2087 |
| 874 | Ga0501076_0128297 | 3300049592 | Bacteria | 2056 |
| 875 | Ga0501077_0017709 | 3300049593 | Bacteria | 4500 |
| 876 | Ga0501217_000641 | 3300049661 | Bacteria | 5900 |
| 877 | Ga0501227_000165 | 3300049665 | Bacteria | 12660 |
| 878 | Ga0501079_0020121 | 3300049741 | Bacteria | 5100 |
| 879 | Ga0501079_0037957 | 3300049741 | Bacteria | 3715 |
| 880 | Ga0501079_0040238 | 3300049741 | Bacteria | 3605 |
| 881 | Ga0501079_0104952 | 3300049741 | Bacteria | 2192 |
| 882 | Ga0501080_0000758 | 3300049742 | Bacteria | 26165 |
| 883 | Ga0501080_0002718 | 3300049742 | Bacteria | 15506 |
| 884 | Ga0501080_0011298 | 3300049742 | Bacteria | 8172 |
| 885 | Ga0501080_0161903 | 3300049742 | Bacteria | 2066 |
| 886 | Ga0501081_0034320 | 3300049743 | Bacteria | 3451 |
| 887 | Ga0501083_0005573 | 3300049744 | Bacteria | 8919 |
| 888 | Ga0501083_0063940 | 3300049744 | Bacteria | 2453 |
| 889 | Ga0501035_0007596 | 3300049822 | Bacteria | 10128 |
| 890 | Ga0501035_0017135 | 3300049822 | Bacteria | 6675 |
| 891 | Ga0501035_0017319 | 3300049822 | Bacteria | 6645 |
| 892 | Ga0501044_0000176 | 3300049823 | Bacteria | 79132 |
| 893 | Ga0501044_0004147 | 3300049823 | Bacteria | 16277 |
| 894 | Ga0501044_0411864 | 3300049823 | Bacteria | 1263 |
| 895 | Ga0501045_0013593 | 3300049824 | Bacteria | 5752 |
| 896 | nmdc:mga03683_65265_c1 | 3300050489 | Bacteria | 1546 |
| 897 | nmdc:mga03683_8691_c1 | 3300050489 | Bacteria | 3580 |
| 898 | nmdc:mga00v17_115499_c1 | 3300050491 | Bacteria | 1706 |
| 899 | nmdc:mga00v17_24569_c1 | 3300050491 | Bacteria | 3496 |
| 900 | nmdc:mga00v17_28697_c1 | 3300050491 | Bacteria | 3261 |
| 901 | nmdc:mga00v17_35818_c1 | 3300050491 | Bacteria | 2956 |
| 902 | nmdc:mga0yw44_26981_c1 | 3300050492 | Bacteria | 3285 |
| 903 | nmdc:mga0k408_142757_c1 | 3300050493 | Bacteria | 1425 |
| 904 | nmdc:mga0k408_20984_c1 | 3300050493 | Bacteria | 3666 |
| 905 | nmdc:mga06z11_32407_c1 | 3300050494 | Bacteria | 2548 |
| 906 | nmdc:mga07m45_13215_c1 | 3300050496 | Bacteria | 4376 |
| 907 | nmdc:mga07m45_197_c1 | 3300050496 | Bacteria | 23906 |
| 908 | nmdc:mga07m45_750_c1 | 3300050496 | Bacteria | 13883 |
| 909 | nmdc:mga07m45_8392_c1 | 3300050496 | Bacteria | 5308 |
| 910 | nmdc:mga05p37_22826_c1 | 3300050507 | Bacteria | 7588 |
| 911 | nmdc:mga05p37_33910_c1 | 3300050507 | Bacteria | 3077 |
| 912 | nmdc:mga05p37_43553_c1 | 3300050507 | Bacteria | 5522 |
| 913 | nmdc:mga05p37_86_c1 | 3300050507 | Bacteria | 81974 |
| 914 | nmdc:mga09592_12091_c1 | 3300050508 | Bacteria | 7025 |
| 915 | nmdc:mga09592_160573_c1 | 3300050508 | Bacteria | 1941 |
| 916 | nmdc:mga09592_25_c1 | 3300050508 | Bacteria | 44492 |
| 917 | nmdc:mga09592_36377_c1 | 3300050508 | Bacteria | 4123 |
| 918 | nmdc:mga09592_4214_c1 | 3300050508 | Bacteria | 11615 |
| 919 | nmdc:mga09592_4372_c1 | 3300050508 | Bacteria | 11425 |
| 920 | nmdc:mga09592_92882_c1 | 3300050508 | Bacteria | 2579 |
| 921 | nmdc:mga0qj67_164_c1 | 3300050509 | Bacteria | 44665 |
| 922 | nmdc:mga0qj67_33698_c1 | 3300050509 | Bacteria | 3997 |
| 923 | nmdc:mga0qj67_46733_c1 | 3300050509 | Bacteria | 3418 |
| 924 | nmdc:mga0qj67_58216_c1 | 3300050509 | Bacteria | 3064 |
| 925 | nmdc:mga06r32_15043_c1 | 3300050510 | Bacteria | 7025 |
| 926 | nmdc:mga06r32_19661_c1 | 3300050510 | Bacteria | 6203 |
| 927 | nmdc:mga06r32_21156_c1 | 3300050510 | Bacteria | 6003 |
| 928 | nmdc:mga06r32_281_c1 | 3300050510 | Bacteria | 42391 |
| 929 | nmdc:mga06r32_35827_c1 | 3300050510 | Bacteria | 4683 |
| 930 | nmdc:mga06r32_65612_c1 | 3300050510 | Bacteria | 3502 |
| 931 | nmdc:mga08y16_148070_c1 | 3300050511 | Bacteria | 2440 |
| 932 | nmdc:mga08y16_18553_c1 | 3300050511 | Bacteria | 7330 |
| 933 | nmdc:mga08y16_224_c1 | 3300050511 | Bacteria | 50738 |
| 934 | nmdc:mga08y16_310337_c1 | 3300050511 | Bacteria | 1624 |
| 935 | nmdc:mga08y16_63609_c1 | 3300050511 | Bacteria | 3853 |
| 936 | nmdc:mga08y16_8480_c1 | 3300050511 | Bacteria | 10765 |
| 937 | nmdc:mga0n895_282058_c1 | 3300050512 | Bacteria | 1684 |
| 938 | nmdc:mga0n895_359974_c1 | 3300050512 | Bacteria | 1473 |
| 939 | nmdc:mga0n895_953_c1 | 3300050512 | Bacteria | 20945 |
| 940 | nmdc:mga0rr50_1829_c1 | 3300050513 | Bacteria | 11766 |
| 941 | nmdc:mga0rr50_242298_c1 | 3300050513 | Bacteria | 1495 |
| 942 | nmdc:mga08x19_1633_c1 | 3300050514 | Bacteria | 13880 |
| 943 | nmdc:mga08x19_19247_c1 | 3300050514 | Bacteria | 4187 |
| 944 | nmdc:mga08x19_5264_c1 | 3300050514 | Bacteria | 7656 |
| 945 | nmdc:mga0a205_119779_c1 | 3300050515 | Bacteria | 2531 |
| 946 | nmdc:mga0a205_2323_c1 | 3300050515 | Bacteria | 16775 |
| 947 | nmdc:mga0sz30_5227_c1 | 3300050516 | Bacteria | 4750 |
| 948 | Ga0495601_0004731 | 3300053077 | Bacteria | 7891 |
| 949 | Ga0495601_0026304 | 3300053077 | Bacteria | 3592 |
| 950 | Ga0495601_0129279 | 3300053077 | Bacteria | 1644 |
| 951 | Ga0500610_0105139 | 3300053079 | Bacteria | 1457 |
| 952 | Ga0495595_0012737 | 3300053084 | Bacteria | 3542 |
| 953 | Ga0495619_0011047 | 3300053085 | Bacteria | 5680 |
| 954 | Ga0495619_0039034 | 3300053085 | Bacteria | 3099 |
| 955 | Ga0495619_0059212 | 3300053085 | Bacteria | 2544 |
| 956 | Ga0500583_0035724 | 3300053092 | Bacteria | 2220 |
| 957 | Ga0500617_057641 | 3300053124 | Bacteria | 1724 |
| 958 | Ga0500568_0016243 | 3300053139 | Bacteria | 3315 |
| 959 | Ga0500622_0001264 | 3300053156 | Bacteria | 20628 |
| 960 | Ga0500622_0004749 | 3300053156 | Bacteria | 8372 |
| 961 | Ga0500637_0010271 | 3300053178 | Bacteria | 4796 |
| 962 | Ga0501084_0158522 | 3300054114 | Bacteria | 1909 |
| 963 | Ga0501082_0016725 | 3300060353 | Bacteria | 6317 |
| 964 | Ga0501082_0085013 | 3300060353 | Bacteria | 2728 |
| 965 | Ga0501082_0469107 | 3300060353 | Bacteria | 1100 |
| 966 | Ga0530510_0005818 | 3300061734 | Bacteria | 8542 |
| 967 | Ga0530510_0019992 | 3300061734 | Bacteria | 4759 |
| 968 | Ga0530510_0123926 | 3300061734 | Bacteria | 1899 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049580 | Ga0501046_0254064 | Ga0501046_0254064_372_1274 | 296 |
| 2 | 3300036647 | Ga0316582_0316630 | Ga0316582_0316630_14_991 | 306 |
| 3 | 3300049572 | Ga0501036_0424112 | Ga0501036_0424112_118_1089 | 306 |
| 4 | 3300049591 | Ga0501075_0038883 | Ga0501075_0038883_215_1186 | 306 |
| 5 | 3300036712 | Ga0316584_0174556 | Ga0316584_0174556_133_1086 | 309 |
| 6 | 3300028573 | Ga0265334_10002860 | Ga0265334_100028607 | 312 |
| 7 | 3300035724 | Ga0373933_0155183 | Ga0373933_0155183_436_1419 | 315 |
| 8 | 3300035119 | Ga0373956_0139692 | Ga0373956_0139692_26_1000 | 319 |
| 9 | 3300009093 | Ga0105240_10072097 | Ga0105240_100720972 | 320 |
| 10 | 3300009148 | Ga0105243_10049333 | Ga0105243_100493333 | 320 |
| 11 | 3300009553 | Ga0105249_10032592 | Ga0105249_100325924 | 320 |
| 12 | 3300014326 | Ga0157380_10036512 | Ga0157380_100365123 | 320 |
| 13 | 3300014968 | Ga0157379_10019806 | Ga0157379_100198064 | 320 |
| 14 | 3300049588 | Ga0501072_0015168 | Ga0501072_0015168_80_1093 | 320 |
| 15 | 3300050493 | nmdc:mga0k408_20984_c1 | nmdc:mga0k408_20984_c1_1977_2969 | 320 |
| 16 | 3300050496 | nmdc:mga07m45_8392_c1 | nmdc:mga07m45_8392_c1_2881_3873 | 320 |
| 17 | 3300009147 | Ga0114129_10689061 | Ga0114129_106890611 | 322 |
| 18 | 3300021361 | Ga0213872_10006459 | Ga0213872_100064595 | 324 |
| 19 | 3300039447 | Ga0436361_0408050 | Ga0436361_0408050_7294_8385 | 324 |
| 20 | 3300026118 | Ga0207675_100263509 | Ga0207675_1002635092 | 328 |
| 21 | 3300031727 | Ga0316576_10106068 | Ga0316576_101060681 | 328 |
| 22 | 3300031728 | Ga0316578_10015033 | Ga0316578_100150333 | 328 |
| 23 | 3300032137 | Ga0316585_10050710 | Ga0316585_100507101 | 328 |
| 24 | 3300035398 | Ga0316574_0096268 | Ga0316574_0096268_857_1843 | 328 |
| 25 | 3300048903 | Ga0496100_0248520 | Ga0496100_0248520_46_1032 | 328 |
| 26 | 3300049584 | Ga0501068_0001460 | Ga0501068_0001460_4084_5124 | 328 |
| 27 | 3300013308 | Ga0157375_10701421 | Ga0157375_107014211 | 329 |
| 28 | 3300031239 | Ga0265328_10003916 | Ga0265328_100039166 | 329 |
| 29 | 3300031242 | Ga0265329_10039753 | Ga0265329_100397532 | 329 |
| 30 | 3300031344 | Ga0265316_10004367 | Ga0265316_100043679 | 329 |
| 31 | 3300031727 | Ga0316576_10003197 | Ga0316576_100031974 | 329 |
| 32 | 3300031728 | Ga0316578_10001054 | Ga0316578_100010548 | 329 |
| 33 | 3300036647 | Ga0316582_0042542 | Ga0316582_0042542_808_1833 | 329 |
| 34 | 3300036712 | Ga0316584_0268650 | Ga0316584_0268650_28_1017 | 329 |
| 35 | 3300049587 | Ga0501071_0047415 | Ga0501071_0047415_1341_2372 | 329 |
| 36 | 3300050507 | nmdc:mga05p37_33910_c1 | nmdc:mga05p37_33910_c1_54_1067 | 329 |
| 37 | 3300050508 | nmdc:mga09592_12091_c1 | nmdc:mga09592_12091_c1_2799_3812 | 329 |
| 38 | 3300050508 | nmdc:mga09592_36377_c1 | nmdc:mga09592_36377_c1_74_1081 | 329 |
| 39 | 3300050509 | nmdc:mga0qj67_58216_c1 | nmdc:mga0qj67_58216_c1_1493_2506 | 329 |
| 40 | 3300050510 | nmdc:mga06r32_19661_c1 | nmdc:mga06r32_19661_c1_1444_2469 | 329 |
| 41 | 3300050510 | nmdc:mga06r32_35827_c1 | nmdc:mga06r32_35827_c1_1488_2501 | 329 |
| 42 | 3300053079 | Ga0500610_0105139 | Ga0500610_0105139_126_1133 | 329 |
| 43 | 3300053124 | Ga0500617_057641 | Ga0500617_057641_115_1122 | 329 |
| 44 | 3300053139 | Ga0500568_0016243 | Ga0500568_0016243_751_1749 | 329 |
| 45 | 3300053156 | Ga0500622_0001264 | Ga0500622_0001264_16720_17709 | 329 |
| 46 | 3300053156 | Ga0500622_0004749 | Ga0500622_0004749_5794_6792 | 329 |
| 47 | 3300053178 | Ga0500637_0010271 | Ga0500637_0010271_3740_4732 | 329 |
| 48 | 3300054114 | Ga0501084_0158522 | Ga0501084_0158522_835_1833 | 329 |
| 49 | 3300060353 | Ga0501082_0469107 | Ga0501082_0469107_17_1048 | 329 |
| 50 | 3300031240 | Ga0265320_10039726 | Ga0265320_100397262 | 330 |
| 51 | 3300039110 | Ga0400487_18541 | Ga0400487_18541_4934_5956 | 330 |
| 52 | 3300005327 | Ga0070658_10197034 | Ga0070658_101970341 | 332 |
| 53 | 3300025909 | Ga0207705_10168879 | Ga0207705_101688791 | 332 |
| 54 | 3300045051 | Ga0451576_0040519 | Ga0451576_0040519_3007_4095 | 332 |
| 55 | 3300049575 | Ga0501039_0263343 | Ga0501039_0263343_188_1285 | 332 |
| 56 | 3300049592 | Ga0501076_0128297 | Ga0501076_0128297_54_1151 | 332 |
| 57 | 3300006195 | Ga0075366_10084976 | Ga0075366_100849763 | 333 |
| 58 | 3300049571 | Ga0501034_0003674 | Ga0501034_0003674_843_1967 | 333 |
| 59 | 3300050491 | nmdc:mga00v17_24569_c1 | nmdc:mga00v17_24569_c1_777_1883 | 333 |
| 60 | 3300006846 | Ga0075430_100051641 | Ga0075430_1000516412 | 334 |
| 61 | 3300006880 | Ga0075429_100003183 | Ga0075429_1000031839 | 334 |
| 62 | 3300031733 | Ga0316577_10046875 | Ga0316577_100468752 | 334 |
| 63 | 3300036712 | Ga0316584_0013283 | Ga0316584_0013283_4305_5369 | 334 |
| 64 | 3300050508 | nmdc:mga09592_4372_c1 | nmdc:mga09592_4372_c1_4470_5567 | 334 |
| 65 | 3300005347 | Ga0070668_100102974 | Ga0070668_1001029742 | 335 |
| 66 | 3300005578 | Ga0068854_100000811 | Ga0068854_10000081112 | 335 |
| 67 | 3300031665 | Ga0316575_10035570 | Ga0316575_100355702 | 335 |
| 68 | 3300031727 | Ga0316576_10068814 | Ga0316576_100688141 | 335 |
| 69 | 3300031995 | Ga0307409_100004292 | Ga0307409_1000042924 | 335 |
| 70 | 3300032002 | Ga0307416_100001236 | Ga0307416_1000012366 | 335 |
| 71 | 3300032126 | Ga0307415_100003696 | Ga0307415_1000036968 | 335 |
| 72 | 3300038726 | Ga0400490_50633 | Ga0400490_50633_9368_10456 | 335 |
| 73 | 3300038727 | Ga0400491_16945 | Ga0400491_16945_1155_2243 | 335 |
| 74 | 3300025926 | Ga0207659_10068924 | Ga0207659_100689242 | 336 |
| 75 | 3300036401 | Ga0373937_0308532 | Ga0373937_0308532_421_1485 | 336 |
| 76 | 3300037471 | Ga0395905_0000090 | Ga0395905_0000090_123755_124831 | 336 |
| 77 | 3300049572 | Ga0501036_0247043 | Ga0501036_0247043_121_1137 | 336 |
| 78 | 3300049590 | Ga0501074_0063148 | Ga0501074_0063148_809_1861 | 336 |
| 79 | 3300049823 | Ga0501044_0411864 | Ga0501044_0411864_190_1242 | 336 |
| 80 | 3300050508 | nmdc:mga09592_92882_c1 | nmdc:mga09592_92882_c1_1538_2566 | 336 |
| 81 | 3300031250 | Ga0265331_10005379 | Ga0265331_100053795 | 337 |
| 82 | 3300031344 | Ga0265316_10012659 | Ga0265316_100126592 | 337 |
| 83 | 3300046542 | Ga0495597_0041970 | Ga0495597_0041970_798_1892 | 337 |
| 84 | 3300047443 | Ga0495687_000500 | Ga0495687_000500_22779_23873 | 337 |
| 85 | 3300049571 | Ga0501034_0429352 | Ga0501034_0429352_18_1094 | 337 |
| 86 | 3300009094 | Ga0111539_10004683 | Ga0111539_100046835 | 338 |
| 87 | 3300031251 | Ga0265327_10001881 | Ga0265327_1000188111 | 338 |
| 88 | 3300031251 | Ga0265327_10013236 | Ga0265327_100132364 | 338 |
| 89 | 3300039437 | Ga0436365_1362540 | Ga0436365_1362540_1284_2336 | 338 |
| 90 | 3300046539 | Ga0495621_0010777 | Ga0495621_0010777_504_1532 | 338 |
| 91 | 3300049590 | Ga0501074_0013206 | Ga0501074_0013206_2332_3426 | 338 |
| 92 | 3300049742 | Ga0501080_0000758 | Ga0501080_0000758_12476_13570 | 338 |
| 93 | 3300025939 | Ga0207665_10075120 | Ga0207665_100751202 | 339 |
| 94 | 3300031251 | Ga0265327_10028521 | Ga0265327_100285212 | 339 |
| 95 | 3300031691 | Ga0316579_10004781 | Ga0316579_100047815 | 339 |
| 96 | 3300031727 | Ga0316576_10040935 | Ga0316576_100409353 | 339 |
| 97 | 3300031727 | Ga0316576_10048043 | Ga0316576_100480433 | 339 |
| 98 | 3300031728 | Ga0316578_10014267 | Ga0316578_100142673 | 339 |
| 99 | 3300031728 | Ga0316578_10035608 | Ga0316578_100356081 | 339 |
| 100 | 3300031728 | Ga0316578_10173251 | Ga0316578_101732511 | 339 |
| 101 | 3300031731 | Ga0307405_10082564 | Ga0307405_100825643 | 339 |
| 102 | 3300031733 | Ga0316577_10002145 | Ga0316577_100021454 | 339 |
| 103 | 3300031733 | Ga0316577_10083601 | Ga0316577_100836012 | 339 |
| 104 | 3300032002 | Ga0307416_100089060 | Ga0307416_1000890602 | 339 |
| 105 | 3300032133 | Ga0316583_10015714 | Ga0316583_100157143 | 339 |
| 106 | 3300032137 | Ga0316585_10033923 | Ga0316585_100339231 | 339 |
| 107 | 3300032139 | Ga0316580_10000523 | Ga0316580_100005234 | 339 |
| 108 | 3300032139 | Ga0316580_10020582 | Ga0316580_100205821 | 339 |
| 109 | 3300035398 | Ga0316574_0007850 | Ga0316574_0007850_3276_4364 | 339 |
| 110 | 3300036647 | Ga0316582_0051069 | Ga0316582_0051069_16_1104 | 339 |
| 111 | 3300036647 | Ga0316582_0055054 | Ga0316582_0055054_485_1573 | 339 |
| 112 | 3300036712 | Ga0316584_0001897 | Ga0316584_0001897_8560_9648 | 339 |
| 113 | 3300036712 | Ga0316584_0035379 | Ga0316584_0035379_857_1945 | 339 |
| 114 | 3300037588 | Ga0316581_0015139 | Ga0316581_0015139_1089_2177 | 339 |
| 115 | 3300049568 | Ga0501031_0200781 | Ga0501031_0200781_212_1288 | 339 |
| 116 | 3300005367 | Ga0070667_100035568 | Ga0070667_1000355683 | 340 |
| 117 | 3300005841 | Ga0068863_100017884 | Ga0068863_1000178847 | 340 |
| 118 | 3300005841 | Ga0068863_100058924 | Ga0068863_1000589242 | 340 |
| 119 | 3300009177 | Ga0105248_10057746 | Ga0105248_100577464 | 340 |
| 120 | 3300026088 | Ga0207641_10112973 | Ga0207641_101129732 | 340 |
| 121 | 3300032168 | Ga0316593_10021597 | Ga0316593_100215971 | 340 |
| 122 | 3300036647 | Ga0316582_0018517 | Ga0316582_0018517_2173_3285 | 340 |
| 123 | 3300038741 | Ga0400488_53777 | Ga0400488_53777_53_1135 | 340 |
| 124 | 3300039062 | Ga0400483_027323 | Ga0400483_027323_2629_3711 | 340 |
| 125 | 3300039062 | Ga0400483_166407 | Ga0400483_166407_148_1230 | 340 |
| 126 | 3300006353 | Ga0075370_10000095 | Ga0075370_100000954 | 341 |
| 127 | 3300025960 | Ga0207651_10245389 | Ga0207651_102453892 | 341 |
| 128 | 3300036401 | Ga0373937_0130992 | Ga0373937_0130992_529_1650 | 341 |
| 129 | 3300046663 | Ga0495635_0033171 | Ga0495635_0033171_1281_2402 | 341 |
| 130 | 3300046680 | Ga0495646_0095193 | Ga0495646_0095193_322_1443 | 341 |
| 131 | 3300046809 | Ga0495600_0133935 | Ga0495600_0133935_382_1503 | 341 |
| 132 | 3300047471 | Ga0495684_0049532 | Ga0495684_0049532_25_1146 | 341 |
| 133 | 3300048917 | Ga0496114_0037383 | Ga0496114_0037383_1514_2620 | 341 |
| 134 | 3300050496 | nmdc:mga07m45_750_c1 | nmdc:mga07m45_750_c1_11077_12180 | 341 |
| 135 | 3300053085 | Ga0495619_0011047 | Ga0495619_0011047_966_2087 | 341 |
| 136 | 3300009093 | Ga0105240_10005185 | Ga0105240_100051856 | 342 |
| 137 | 3300025913 | Ga0207695_10003421 | Ga0207695_1000342115 | 342 |
| 138 | 3300042876 | Ga0451577_0023295 | Ga0451577_0023295_3508_4587 | 342 |
| 139 | 3300044673 | Ga0453683_0001483 | Ga0453683_0001483_14355_15434 | 342 |
| 140 | 3300045051 | Ga0451576_0004755 | Ga0451576_0004755_1302_2381 | 342 |
| 141 | 3300049569 | Ga0501032_0115477 | Ga0501032_0115477_576_1727 | 342 |
| 142 | 3300049570 | Ga0501033_0005975 | Ga0501033_0005975_659_1810 | 342 |
| 143 | 3300049573 | Ga0501037_0004553 | Ga0501037_0004553_5922_7073 | 342 |
| 144 | 3300049574 | Ga0501038_0015594 | Ga0501038_0015594_4521_5672 | 342 |
| 145 | 3300049579 | Ga0501043_0012886 | Ga0501043_0012886_660_1811 | 342 |
| 146 | 3300049581 | Ga0501047_0074774 | Ga0501047_0074774_850_2001 | 342 |
| 147 | 3300049589 | Ga0501073_0010531 | Ga0501073_0010531_617_1768 | 342 |
| 148 | 3300049741 | Ga0501079_0020121 | Ga0501079_0020121_1406_2557 | 342 |
| 149 | 3300049742 | Ga0501080_0002718 | Ga0501080_0002718_11346_12497 | 342 |
| 150 | 3300049744 | Ga0501083_0063940 | Ga0501083_0063940_496_1623 | 342 |
| 151 | 3300049822 | Ga0501035_0017319 | Ga0501035_0017319_4860_6011 | 342 |
| 152 | 3300049823 | Ga0501044_0004147 | Ga0501044_0004147_829_1980 | 342 |
| 153 | 3300060353 | Ga0501082_0016725 | Ga0501082_0016725_3166_4317 | 342 |
| 154 | 3300005471 | Ga0070698_100000184 | Ga0070698_10000018433 | 343 |
| 155 | 3300005543 | Ga0070672_100266043 | Ga0070672_1002660431 | 343 |
| 156 | 3300014969 | Ga0157376_10008551 | Ga0157376_100085514 | 343 |
| 157 | 3300025972 | Ga0207668_10075469 | Ga0207668_100754692 | 343 |
| 158 | 3300031241 | Ga0265325_10010738 | Ga0265325_100107385 | 343 |
| 159 | 3300044673 | Ga0453683_0067817 | Ga0453683_0067817_68_1156 | 343 |
| 160 | 3300045051 | Ga0451576_0000029 | Ga0451576_0000029_32681_33769 | 343 |
| 161 | 3300049585 | Ga0501069_0039046 | Ga0501069_0039046_670_1752 | 343 |
| 162 | 3300049586 | Ga0501070_0046091 | Ga0501070_0046091_1418_2500 | 343 |
| 163 | 3300049590 | Ga0501074_0052250 | Ga0501074_0052250_211_1293 | 343 |
| 164 | 3300031251 | Ga0265327_10000988 | Ga0265327_100009883 | 344 |
| 165 | 3300031711 | Ga0265314_10001998 | Ga0265314_1000199812 | 344 |
| 166 | 3300036712 | Ga0316584_0048622 | Ga0316584_0048622_1623_2765 | 344 |
| 167 | 3300044712 | Ga0453684_0009614 | Ga0453684_0009614_42_1202 | 344 |
| 168 | 3300046472 | Ga0495580_0022054 | Ga0495580_0022054_354_1397 | 344 |
| 169 | 3300046642 | Ga0495634_0134521 | Ga0495634_0134521_308_1351 | 344 |
| 170 | 3300046675 | Ga0495657_0089781 | Ga0495657_0089781_247_1290 | 344 |
| 171 | 3300046681 | Ga0495647_0003619 | Ga0495647_0003619_3869_4912 | 344 |
| 172 | 3300046683 | Ga0495658_0048513 | Ga0495658_0048513_520_1563 | 344 |
| 173 | 3300047318 | Ga0495636_0089846 | Ga0495636_0089846_20_1063 | 344 |
| 174 | 3300053085 | Ga0495619_0059212 | Ga0495619_0059212_1092_2135 | 344 |
| 175 | 3300005438 | Ga0070701_10038979 | Ga0070701_100389793 | 345 |
| 176 | 3300005467 | Ga0070706_100001257 | Ga0070706_10000125719 | 345 |
| 177 | 3300005617 | Ga0068859_100009071 | Ga0068859_1000090719 | 345 |
| 178 | 3300006931 | Ga0097620_100009071 | Ga0097620_1000090719 | 345 |
| 179 | 3300009553 | Ga0105249_10318352 | Ga0105249_103183523 | 345 |
| 180 | 3300014325 | Ga0163163_10027044 | Ga0163163_100270445 | 345 |
| 181 | 3300025915 | Ga0207693_10102696 | Ga0207693_101026962 | 345 |
| 182 | 3300025928 | Ga0207700_10207154 | Ga0207700_102071542 | 345 |
| 183 | 3300027682 | Ga0209971_1014086 | Ga0209971_10140862 | 345 |
| 184 | 3300029957 | Ga0265324_10000439 | Ga0265324_1000043925 | 345 |
| 185 | 3300031250 | Ga0265331_10000093 | Ga0265331_10000093107 | 345 |
| 186 | 3300031727 | Ga0316576_10035928 | Ga0316576_100359283 | 345 |
| 187 | 3300035692 | Ga0373935_0153412 | Ga0373935_0153412_401_1444 | 345 |
| 188 | 3300036712 | Ga0316584_0014220 | Ga0316584_0014220_332_1444 | 345 |
| 189 | 3300036712 | Ga0316584_0060909 | Ga0316584_0060909_467_1531 | 345 |
| 190 | 3300046683 | Ga0495658_0193574 | Ga0495658_0193574_110_1231 | 345 |
| 191 | 3300006051 | Ga0075364_10019238 | Ga0075364_100192382 | 346 |
| 192 | 3300025961 | Ga0207712_10058347 | Ga0207712_100583472 | 346 |
| 193 | 3300026088 | Ga0207641_10418787 | Ga0207641_104187871 | 346 |
| 194 | 3300035398 | Ga0316574_0002122 | Ga0316574_0002122_2341_3387 | 346 |
| 195 | 3300044712 | Ga0453684_0082591 | Ga0453684_0082591_674_1765 | 346 |
| 196 | 3300045051 | Ga0451576_0139185 | Ga0451576_0139185_47_1108 | 346 |
| 197 | 3300050491 | nmdc:mga00v17_28697_c1 | nmdc:mga00v17_28697_c1_239_1360 | 346 |
| 198 | 3300053077 | Ga0495601_0026304 | Ga0495601_0026304_110_1162 | 346 |
| 199 | 3300014969 | Ga0157376_10086833 | Ga0157376_100868333 | 347 |
| 200 | 3300039062 | Ga0400483_063435 | Ga0400483_063435_7794_8876 | 347 |
| 201 | 3300005445 | Ga0070708_100140108 | Ga0070708_1001401081 | 348 |
| 202 | 3300009094 | Ga0111539_10189021 | Ga0111539_101890213 | 348 |
| 203 | 3300028380 | Ga0268265_10322968 | Ga0268265_103229682 | 348 |
| 204 | 3300028558 | Ga0265326_10001417 | Ga0265326_100014172 | 348 |
| 205 | 3300031247 | Ga0265340_10001827 | Ga0265340_100018275 | 348 |
| 206 | 3300037471 | Ga0395905_0195530 | Ga0395905_0195530_423_1496 | 348 |
| 207 | 3300046457 | Ga0495590_0001807 | Ga0495590_0001807_4509_5594 | 348 |
| 208 | 3300048907 | Ga0496104_0108391 | Ga0496104_0108391_1078_2136 | 348 |
| 209 | 3300050511 | nmdc:mga08y16_148070_c1 | nmdc:mga08y16_148070_c1_768_1832 | 348 |
| 210 | 3300005548 | Ga0070665_100018756 | Ga0070665_1000187565 | 349 |
| 211 | 3300026121 | Ga0207683_10008362 | Ga0207683_100083629 | 349 |
| 212 | 3300028379 | Ga0268266_10003141 | Ga0268266_1000314115 | 349 |
| 213 | 3300028653 | Ga0265323_10003438 | Ga0265323_100034386 | 349 |
| 214 | 3300028800 | Ga0265338_10000109 | Ga0265338_1000010986 | 349 |
| 215 | 3300031665 | Ga0316575_10004040 | Ga0316575_100040402 | 349 |
| 216 | 3300031727 | Ga0316576_10019045 | Ga0316576_100190452 | 349 |
| 217 | 3300048918 | Ga0496115_0055372 | Ga0496115_0055372_1019_2071 | 349 |
| 218 | iso_pu_bacteria | 2574179768 | 2574433167 | 349 |
| 219 | iso_pu_bacteria | 2891633521 | 2891634610 | 349 |
| 220 | iso_pu_bacteria | 639633007 | 639786823 | 349 |
| 221 | 3300005330 | Ga0070690_100016631 | Ga0070690_1000166313 | 350 |
| 222 | 3300005331 | Ga0070670_100103701 | Ga0070670_1001037012 | 350 |
| 223 | 3300005334 | Ga0068869_100019821 | Ga0068869_1000198212 | 350 |
| 224 | 3300005335 | Ga0070666_10012915 | Ga0070666_100129153 | 350 |
| 225 | 3300005335 | Ga0070666_10059296 | Ga0070666_100592962 | 350 |
| 226 | 3300005338 | Ga0068868_100037456 | Ga0068868_1000374563 | 350 |
| 227 | 3300005338 | Ga0068868_100259904 | Ga0068868_1002599041 | 350 |
| 228 | 3300005340 | Ga0070689_100035455 | Ga0070689_1000354554 | 350 |
| 229 | 3300005340 | Ga0070689_100114910 | Ga0070689_1001149102 | 350 |
| 230 | 3300005347 | Ga0070668_100026038 | Ga0070668_1000260384 | 350 |
| 231 | 3300005354 | Ga0070675_100022870 | Ga0070675_1000228703 | 350 |
| 232 | 3300005355 | Ga0070671_100004118 | Ga0070671_1000041188 | 350 |
| 233 | 3300005355 | Ga0070671_100051657 | Ga0070671_1000516572 | 350 |
| 234 | 3300005356 | Ga0070674_100025779 | Ga0070674_1000257793 | 350 |
| 235 | 3300005364 | Ga0070673_100001712 | Ga0070673_1000017129 | 350 |
| 236 | 3300005364 | Ga0070673_100009342 | Ga0070673_1000093425 | 350 |
| 237 | 3300005367 | Ga0070667_100058417 | Ga0070667_1000584173 | 350 |
| 238 | 3300005436 | Ga0070713_100352038 | Ga0070713_1003520382 | 350 |
| 239 | 3300005444 | Ga0070694_100069093 | Ga0070694_1000690932 | 350 |
| 240 | 3300005445 | Ga0070708_100236149 | Ga0070708_1002361492 | 350 |
| 241 | 3300005456 | Ga0070678_100124015 | Ga0070678_1001240152 | 350 |
| 242 | 3300005468 | Ga0070707_100085014 | Ga0070707_1000850141 | 350 |
| 243 | 3300005471 | Ga0070698_100150048 | Ga0070698_1001500482 | 350 |
| 244 | 3300005518 | Ga0070699_100003946 | Ga0070699_1000039468 | 350 |
| 245 | 3300005518 | Ga0070699_100064086 | Ga0070699_1000640862 | 350 |
| 246 | 3300005543 | Ga0070672_100015346 | Ga0070672_1000153463 | 350 |
| 247 | 3300005544 | Ga0070686_100044824 | Ga0070686_1000448244 | 350 |
| 248 | 3300005548 | Ga0070665_100200703 | Ga0070665_1002007032 | 350 |
| 249 | 3300005563 | Ga0068855_100341268 | Ga0068855_1003412682 | 350 |
| 250 | 3300005577 | Ga0068857_100060931 | Ga0068857_1000609312 | 350 |
| 251 | 3300005616 | Ga0068852_100059006 | Ga0068852_1000590062 | 350 |
| 252 | 3300005617 | Ga0068859_100026232 | Ga0068859_1000262324 | 350 |
| 253 | 3300005617 | Ga0068859_100031928 | Ga0068859_1000319283 | 350 |
| 254 | 3300005617 | Ga0068859_100037140 | Ga0068859_1000371404 | 350 |
| 255 | 3300005618 | Ga0068864_100007705 | Ga0068864_1000077058 | 350 |
| 256 | 3300005618 | Ga0068864_100027866 | Ga0068864_1000278664 | 350 |
| 257 | 3300005618 | Ga0068864_100094021 | Ga0068864_1000940212 | 350 |
| 258 | 3300005618 | Ga0068864_100147429 | Ga0068864_1001474291 | 350 |
| 259 | 3300005718 | Ga0068866_10005950 | Ga0068866_100059503 | 350 |
| 260 | 3300005841 | Ga0068863_100006585 | Ga0068863_1000065858 | 350 |
| 261 | 3300005841 | Ga0068863_100015249 | Ga0068863_1000152496 | 350 |
| 262 | 3300005841 | Ga0068863_100022286 | Ga0068863_1000222865 | 350 |
| 263 | 3300005841 | Ga0068863_100035396 | Ga0068863_1000353963 | 350 |
| 264 | 3300005842 | Ga0068858_100024873 | Ga0068858_1000248733 | 350 |
| 265 | 3300005843 | Ga0068860_100034823 | Ga0068860_1000348232 | 350 |
| 266 | 3300005843 | Ga0068860_100043091 | Ga0068860_1000430913 | 350 |
| 267 | 3300005844 | Ga0068862_100005314 | Ga0068862_10000531412 | 350 |
| 268 | 3300006178 | Ga0075367_10003884 | Ga0075367_100038844 | 350 |
| 269 | 3300006178 | Ga0075367_10039449 | Ga0075367_100394493 | 350 |
| 270 | 3300006195 | Ga0075366_10014391 | Ga0075366_100143912 | 350 |
| 271 | 3300006237 | Ga0097621_100046220 | Ga0097621_1000462204 | 350 |
| 272 | 3300006237 | Ga0097621_100068809 | Ga0097621_1000688092 | 350 |
| 273 | 3300006353 | Ga0075370_10059631 | Ga0075370_100596312 | 350 |
| 274 | 3300006358 | Ga0068871_100027149 | Ga0068871_1000271493 | 350 |
| 275 | 3300006358 | Ga0068871_100070561 | Ga0068871_1000705612 | 350 |
| 276 | 3300006871 | Ga0075434_100000169 | Ga0075434_1000001694 | 350 |
| 277 | 3300006871 | Ga0075434_100154873 | Ga0075434_1001548732 | 350 |
| 278 | 3300006914 | Ga0075436_100001151 | Ga0075436_10000115118 | 350 |
| 279 | 3300006914 | Ga0075436_100005331 | Ga0075436_1000053311 | 350 |
| 280 | 3300006914 | Ga0075436_100128363 | Ga0075436_1001283632 | 350 |
| 281 | 3300006931 | Ga0097620_100026232 | Ga0097620_1000262324 | 350 |
| 282 | 3300006931 | Ga0097620_100031930 | Ga0097620_1000319303 | 350 |
| 283 | 3300006931 | Ga0097620_100037141 | Ga0097620_1000371414 | 350 |
| 284 | 3300007076 | Ga0075435_100084665 | Ga0075435_1000846652 | 350 |
| 285 | 3300007076 | Ga0075435_100107345 | Ga0075435_1001073452 | 350 |
| 286 | 3300007076 | Ga0075435_100123978 | Ga0075435_1001239782 | 350 |
| 287 | 3300009177 | Ga0105248_10004265 | Ga0105248_1000426510 | 350 |
| 288 | 3300013308 | Ga0157375_10013194 | Ga0157375_100131948 | 350 |
| 289 | 3300014325 | Ga0163163_10005343 | Ga0163163_100053433 | 350 |
| 290 | 3300014325 | Ga0163163_10053206 | Ga0163163_100532064 | 350 |
| 291 | 3300025315 | Ga0207697_10093198 | Ga0207697_100931982 | 350 |
| 292 | 3300025321 | Ga0207656_10017568 | Ga0207656_100175683 | 350 |
| 293 | 3300025899 | Ga0207642_10022428 | Ga0207642_100224283 | 350 |
| 294 | 3300025903 | Ga0207680_10034895 | Ga0207680_100348952 | 350 |
| 295 | 3300025906 | Ga0207699_10131904 | Ga0207699_101319041 | 350 |
| 296 | 3300025907 | Ga0207645_10001558 | Ga0207645_100015583 | 350 |
| 297 | 3300025908 | Ga0207643_10018803 | Ga0207643_100188033 | 350 |
| 298 | 3300025910 | Ga0207684_10005110 | Ga0207684_100051106 | 350 |
| 299 | 3300025910 | Ga0207684_10133160 | Ga0207684_101331602 | 350 |
| 300 | 3300025922 | Ga0207646_10263531 | Ga0207646_102635312 | 350 |
| 301 | 3300025923 | Ga0207681_10032686 | Ga0207681_100326863 | 350 |
| 302 | 3300025925 | Ga0207650_10164840 | Ga0207650_101648402 | 350 |
| 303 | 3300025926 | Ga0207659_10009066 | Ga0207659_100090666 | 350 |
| 304 | 3300025926 | Ga0207659_10063037 | Ga0207659_100630372 | 350 |
| 305 | 3300025931 | Ga0207644_10002988 | Ga0207644_100029887 | 350 |
| 306 | 3300025931 | Ga0207644_10167608 | Ga0207644_101676082 | 350 |
| 307 | 3300025933 | Ga0207706_10059836 | Ga0207706_100598363 | 350 |
| 308 | 3300025935 | Ga0207709_10082455 | Ga0207709_100824553 | 350 |
| 309 | 3300025936 | Ga0207670_10033137 | Ga0207670_100331373 | 350 |
| 310 | 3300025937 | Ga0207669_10022364 | Ga0207669_100223643 | 350 |
| 311 | 3300025937 | Ga0207669_10028685 | Ga0207669_100286852 | 350 |
| 312 | 3300025938 | Ga0207704_10022467 | Ga0207704_100224673 | 350 |
| 313 | 3300025938 | Ga0207704_10248962 | Ga0207704_102489621 | 350 |
| 314 | 3300025940 | Ga0207691_10033473 | Ga0207691_100334732 | 350 |
| 315 | 3300025940 | Ga0207691_10050596 | Ga0207691_100505964 | 350 |
| 316 | 3300025941 | Ga0207711_10042672 | Ga0207711_100426723 | 350 |
| 317 | 3300025941 | Ga0207711_10046873 | Ga0207711_100468733 | 350 |
| 318 | 3300025942 | Ga0207689_10005582 | Ga0207689_1000558212 | 350 |
| 319 | 3300025942 | Ga0207689_10108736 | Ga0207689_101087362 | 350 |
| 320 | 3300025961 | Ga0207712_10004066 | Ga0207712_100040668 | 350 |
| 321 | 3300025972 | Ga0207668_10038600 | Ga0207668_100386003 | 350 |
| 322 | 3300025986 | Ga0207658_10016527 | Ga0207658_100165274 | 350 |
| 323 | 3300025986 | Ga0207658_10047951 | Ga0207658_100479513 | 350 |
| 324 | 3300026023 | Ga0207677_10114545 | Ga0207677_101145452 | 350 |
| 325 | 3300026035 | Ga0207703_10002940 | Ga0207703_100029407 | 350 |
| 326 | 3300026035 | Ga0207703_10017641 | Ga0207703_100176415 | 350 |
| 327 | 3300026067 | Ga0207678_10145263 | Ga0207678_101452631 | 350 |
| 328 | 3300026075 | Ga0207708_10176533 | Ga0207708_101765332 | 350 |
| 329 | 3300026075 | Ga0207708_10182595 | Ga0207708_101825952 | 350 |
| 330 | 3300026088 | Ga0207641_10009773 | Ga0207641_100097735 | 350 |
| 331 | 3300026088 | Ga0207641_10028713 | Ga0207641_100287132 | 350 |
| 332 | 3300026088 | Ga0207641_10279328 | Ga0207641_102793282 | 350 |
| 333 | 3300026095 | Ga0207676_10016118 | Ga0207676_100161184 | 350 |
| 334 | 3300026095 | Ga0207676_10252730 | Ga0207676_102527302 | 350 |
| 335 | 3300026095 | Ga0207676_10312085 | Ga0207676_103120852 | 350 |
| 336 | 3300026116 | Ga0207674_10081080 | Ga0207674_100810802 | 350 |
| 337 | 3300026118 | Ga0207675_100206696 | Ga0207675_1002066962 | 350 |
| 338 | 3300026121 | Ga0207683_10077444 | Ga0207683_100774442 | 350 |
| 339 | 3300026121 | Ga0207683_10140919 | Ga0207683_101409193 | 350 |
| 340 | 3300026142 | Ga0207698_10289916 | Ga0207698_102899162 | 350 |
| 341 | 3300028381 | Ga0268264_10020456 | Ga0268264_100204565 | 350 |
| 342 | 3300028381 | Ga0268264_10049630 | Ga0268264_100496302 | 350 |
| 343 | 3300028381 | Ga0268264_10123801 | Ga0268264_101238012 | 350 |
| 344 | 3300028381 | Ga0268264_10133742 | Ga0268264_101337421 | 350 |
| 345 | 3300028800 | Ga0265338_10011920 | Ga0265338_100119208 | 350 |
| 346 | 3300031235 | Ga0265330_10001505 | Ga0265330_100015056 | 350 |
| 347 | 3300031238 | Ga0265332_10049485 | Ga0265332_100494852 | 350 |
| 348 | 3300031241 | Ga0265325_10015153 | Ga0265325_100151534 | 350 |
| 349 | 3300031242 | Ga0265329_10003360 | Ga0265329_100033605 | 350 |
| 350 | 3300031250 | Ga0265331_10000636 | Ga0265331_1000063628 | 350 |
| 351 | 3300031251 | Ga0265327_10001720 | Ga0265327_100017207 | 350 |
| 352 | 3300031344 | Ga0265316_10014135 | Ga0265316_100141355 | 350 |
| 353 | 3300031711 | Ga0265314_10002346 | Ga0265314_1000234615 | 350 |
| 354 | 3300031712 | Ga0265342_10012919 | Ga0265342_100129196 | 350 |
| 355 | 3300033179 | Ga0307507_10022327 | Ga0307507_100223273 | 350 |
| 356 | 3300037471 | Ga0395905_0042860 | Ga0395905_0042860_2827_3909 | 350 |
| 357 | 3300037853 | Ga0436364_1086943 | Ga0436364_1086943_397_1482 | 350 |
| 358 | 3300042876 | Ga0451577_0035928 | Ga0451577_0035928_3337_4428 | 350 |
| 359 | 3300044673 | Ga0453683_0002876 | Ga0453683_0002876_6876_7988 | 350 |
| 360 | 3300044712 | Ga0453684_0000006 | Ga0453684_0000006_1093014_1094093 | 350 |
| 361 | 3300044712 | Ga0453684_0000969 | Ga0453684_0000969_66335_67426 | 350 |
| 362 | 3300044712 | Ga0453684_0080090 | Ga0453684_0080090_1932_3044 | 350 |
| 363 | 3300044712 | Ga0453684_0273625 | Ga0453684_0273625_297_1388 | 350 |
| 364 | 3300045051 | Ga0451576_0004162 | Ga0451576_0004162_1341_2432 | 350 |
| 365 | 3300045051 | Ga0451576_0005937 | Ga0451576_0005937_12759_13871 | 350 |
| 366 | 3300045051 | Ga0451576_0021596 | Ga0451576_0021596_2903_3994 | 350 |
| 367 | 3300046476 | Ga0495662_0005209 | Ga0495662_0005209_5398_6459 | 350 |
| 368 | 3300046525 | Ga0495663_0029949 | Ga0495663_0029949_421_1488 | 350 |
| 369 | 3300046535 | Ga0495586_0011145 | Ga0495586_0011145_2957_4018 | 350 |
| 370 | 3300046615 | Ga0495656_0000108 | Ga0495656_0000108_6472_7539 | 350 |
| 371 | 3300046681 | Ga0495647_0070205 | Ga0495647_0070205_80_1141 | 350 |
| 372 | 3300048916 | Ga0496113_0020502 | Ga0496113_0020502_2927_4006 | 350 |
| 373 | 3300049568 | Ga0501031_0000192 | Ga0501031_0000192_24961_26037 | 350 |
| 374 | 3300049569 | Ga0501032_0009318 | Ga0501032_0009318_1847_2923 | 350 |
| 375 | 3300049570 | Ga0501033_0004357 | Ga0501033_0004357_4121_5197 | 350 |
| 376 | 3300049571 | Ga0501034_0396322 | Ga0501034_0396322_98_1231 | 350 |
| 377 | 3300049573 | Ga0501037_0053143 | Ga0501037_0053143_509_1585 | 350 |
| 378 | 3300049822 | Ga0501035_0007596 | Ga0501035_0007596_2608_3684 | 350 |
| 379 | 3300049823 | Ga0501044_0000176 | Ga0501044_0000176_69907_70983 | 350 |
| 380 | 3300050493 | nmdc:mga0k408_142757_c1 | nmdc:mga0k408_142757_c1_31_1131 | 350 |
| 381 | 3300050494 | nmdc:mga06z11_32407_c1 | nmdc:mga06z11_32407_c1_987_2072 | 350 |
| 382 | 3300050496 | nmdc:mga07m45_13215_c1 | nmdc:mga07m45_13215_c1_2244_3329 | 350 |
| 383 | 3300050512 | nmdc:mga0n895_359974_c1 | nmdc:mga0n895_359974_c1_386_1456 | 350 |
| 384 | 3300050512 | nmdc:mga0n895_953_c1 | nmdc:mga0n895_953_c1_1463_2536 | 350 |
| 385 | 3300050513 | nmdc:mga0rr50_1829_c1 | nmdc:mga0rr50_1829_c1_1041_2114 | 350 |
| 386 | 3300050514 | nmdc:mga08x19_5264_c1 | nmdc:mga08x19_5264_c1_6439_7509 | 350 |
| 387 | 3300050515 | nmdc:mga0a205_2323_c1 | nmdc:mga0a205_2323_c1_11678_12781 | 350 |
| 388 | iso_pu_bacteria | 2885192300 | 2885195591 | 350 |
| 389 | 3300005335 | Ga0070666_10167900 | Ga0070666_101679002 | 351 |
| 390 | 3300005367 | Ga0070667_100071936 | Ga0070667_1000719363 | 351 |
| 391 | 3300005439 | Ga0070711_100030051 | Ga0070711_1000300512 | 351 |
| 392 | 3300005440 | Ga0070705_100042851 | Ga0070705_1000428512 | 351 |
| 393 | 3300005456 | Ga0070678_100008843 | Ga0070678_1000088433 | 351 |
| 394 | 3300005467 | Ga0070706_100081595 | Ga0070706_1000815952 | 351 |
| 395 | 3300005546 | Ga0070696_100122438 | Ga0070696_1001224382 | 351 |
| 396 | 3300005842 | Ga0068858_100069538 | Ga0068858_1000695383 | 351 |
| 397 | 3300006175 | Ga0070712_100025793 | Ga0070712_1000257933 | 351 |
| 398 | 3300006237 | Ga0097621_100287769 | Ga0097621_1002877691 | 351 |
| 399 | 3300009553 | Ga0105249_10268067 | Ga0105249_102680672 | 351 |
| 400 | 3300013102 | Ga0157371_10053128 | Ga0157371_100531283 | 351 |
| 401 | 3300013306 | Ga0163162_10070988 | Ga0163162_100709882 | 351 |
| 402 | 3300013307 | Ga0157372_10078996 | Ga0157372_100789963 | 351 |
| 403 | 3300014969 | Ga0157376_10155165 | Ga0157376_101551652 | 351 |
| 404 | 3300025922 | Ga0207646_10031090 | Ga0207646_100310904 | 351 |
| 405 | 3300025922 | Ga0207646_10210693 | Ga0207646_102106932 | 351 |
| 406 | 3300025922 | Ga0207646_10274886 | Ga0207646_102748862 | 351 |
| 407 | 3300025986 | Ga0207658_10069955 | Ga0207658_100699552 | 351 |
| 408 | 3300026121 | Ga0207683_10086582 | Ga0207683_100865823 | 351 |
| 409 | 3300028800 | Ga0265338_10038273 | Ga0265338_100382732 | 351 |
| 410 | 3300031239 | Ga0265328_10000106 | Ga0265328_1000010620 | 351 |
| 411 | 3300031241 | Ga0265325_10008650 | Ga0265325_100086502 | 351 |
| 412 | 3300031241 | Ga0265325_10030002 | Ga0265325_100300023 | 351 |
| 413 | 3300031250 | Ga0265331_10031913 | Ga0265331_100319131 | 351 |
| 414 | 3300031251 | Ga0265327_10037426 | Ga0265327_100374262 | 351 |
| 415 | 3300031344 | Ga0265316_10031788 | Ga0265316_100317884 | 351 |
| 416 | 3300031711 | Ga0265314_10031660 | Ga0265314_100316603 | 351 |
| 417 | 3300031711 | Ga0265314_10071918 | Ga0265314_100719182 | 351 |
| 418 | 3300035398 | Ga0316574_0154653 | Ga0316574_0154653_49_1137 | 351 |
| 419 | 3300041406 | Ga0439439_0004069 | Ga0439439_0004069_1649_2722 | 351 |
| 420 | 3300041997 | Ga0439431_0014286 | Ga0439431_0014286_387_1460 | 351 |
| 421 | 3300042006 | Ga0439432_009430 | Ga0439432_009430_220_1293 | 351 |
| 422 | 3300042007 | Ga0439449_0002444 | Ga0439449_0002444_2613_3686 | 351 |
| 423 | 3300042015 | Ga0439462_0015414 | Ga0439462_0015414_21_1094 | 351 |
| 424 | 3300042145 | Ga0450906_004112 | Ga0450906_004112_797_1870 | 351 |
| 425 | 3300042156 | Ga0439446_0021158 | Ga0439446_0021158_619_1692 | 351 |
| 426 | 3300042435 | Ga0439434_0006109 | Ga0439434_0006109_352_1425 | 351 |
| 427 | 3300044683 | Ga0466965_0035114 | Ga0466965_0035114_347_1429 | 351 |
| 428 | 3300044712 | Ga0453684_0000847 | Ga0453684_0000847_52724_53818 | 351 |
| 429 | 3300044901 | Ga0466960_0023445 | Ga0466960_0023445_1564_2646 | 351 |
| 430 | 3300045051 | Ga0451576_0038947 | Ga0451576_0038947_2769_3848 | 351 |
| 431 | 3300048911 | Ga0496108_0094726 | Ga0496108_0094726_797_1897 | 351 |
| 432 | 3300005549 | Ga0070704_100041606 | Ga0070704_1000416062 | 352 |
| 433 | 3300005614 | Ga0068856_100002001 | Ga0068856_1000020014 | 352 |
| 434 | 3300005843 | Ga0068860_100058487 | Ga0068860_1000584874 | 352 |
| 435 | 3300005983 | Ga0081540_1048859 | Ga0081540_10488592 | 352 |
| 436 | 3300006048 | Ga0075363_100121062 | Ga0075363_1001210621 | 352 |
| 437 | 3300006177 | Ga0075362_10007555 | Ga0075362_100075554 | 352 |
| 438 | 3300006186 | Ga0075369_10006503 | Ga0075369_100065034 | 352 |
| 439 | 3300006353 | Ga0075370_10000217 | Ga0075370_1000021718 | 352 |
| 440 | 3300009147 | Ga0114129_10218778 | Ga0114129_102187782 | 352 |
| 441 | 3300021361 | Ga0213872_10031585 | Ga0213872_100315851 | 352 |
| 442 | 3300025949 | Ga0207667_10040008 | Ga0207667_100400083 | 352 |
| 443 | 3300026078 | Ga0207702_10006429 | Ga0207702_100064296 | 352 |
| 444 | 3300028381 | Ga0268264_10198865 | Ga0268264_101988651 | 352 |
| 445 | 3300028563 | Ga0265319_1020910 | Ga0265319_10209102 | 352 |
| 446 | 3300028577 | Ga0265318_10001480 | Ga0265318_100014807 | 352 |
| 447 | 3300028653 | Ga0265323_10001736 | Ga0265323_100017367 | 352 |
| 448 | 3300028654 | Ga0265322_10004818 | Ga0265322_100048184 | 352 |
| 449 | 3300031240 | Ga0265320_10009006 | Ga0265320_100090066 | 352 |
| 450 | 3300031344 | Ga0265316_10051541 | Ga0265316_100515411 | 352 |
| 451 | 3300031731 | Ga0307405_10125312 | Ga0307405_101253121 | 352 |
| 452 | 3300031824 | Ga0307413_10215345 | Ga0307413_102153451 | 352 |
| 453 | 3300031901 | Ga0307406_10309963 | Ga0307406_103099631 | 352 |
| 454 | 3300031903 | Ga0307407_10221988 | Ga0307407_102219882 | 352 |
| 455 | 3300032002 | Ga0307416_100268724 | Ga0307416_1002687242 | 352 |
| 456 | 3300035410 | Ga0373924_0002671 | Ga0373924_0002671_115_1191 | 352 |
| 457 | 3300035410 | Ga0373924_0038118 | Ga0373924_0038118_371_1453 | 352 |
| 458 | 3300035692 | Ga0373935_0003679 | Ga0373935_0003679_3775_4857 | 352 |
| 459 | 3300036401 | Ga0373937_0147931 | Ga0373937_0147931_657_1751 | 352 |
| 460 | 3300039447 | Ga0436361_0995760 | Ga0436361_0995760_205_1296 | 352 |
| 461 | 3300042001 | Ga0439441_007345 | Ga0439441_007345_481_1560 | 352 |
| 462 | 3300042876 | Ga0451577_0003021 | Ga0451577_0003021_7377_8459 | 352 |
| 463 | 3300042876 | Ga0451577_0093041 | Ga0451577_0093041_1537_2637 | 352 |
| 464 | 3300044712 | Ga0453684_0002999 | Ga0453684_0002999_14831_15913 | 352 |
| 465 | 3300044712 | Ga0453684_0016369 | Ga0453684_0016369_7093_8193 | 352 |
| 466 | 3300046461 | Ga0495641_0016725 | Ga0495641_0016725_2453_3535 | 352 |
| 467 | 3300046511 | Ga0495608_0011389 | Ga0495608_0011389_560_1642 | 352 |
| 468 | 3300046514 | Ga0495618_0048665 | Ga0495618_0048665_684_1766 | 352 |
| 469 | 3300046516 | Ga0495628_0013619 | Ga0495628_0013619_1870_2991 | 352 |
| 470 | 3300046526 | Ga0495666_0120431 | Ga0495666_0120431_42_1124 | 352 |
| 471 | 3300046531 | Ga0495665_0014376 | Ga0495665_0014376_1340_2422 | 352 |
| 472 | 3300047317 | Ga0495604_0100946 | Ga0495604_0100946_684_1766 | 352 |
| 473 | 3300047471 | Ga0495684_0036614 | Ga0495684_0036614_2525_3607 | 352 |
| 474 | 3300047471 | Ga0495684_0216699 | Ga0495684_0216699_76_1209 | 352 |
| 475 | 3300049586 | Ga0501070_0017006 | Ga0501070_0017006_3661_4719 | 352 |
| 476 | 3300049588 | Ga0501072_0188160 | Ga0501072_0188160_493_1584 | 352 |
| 477 | 3300049589 | Ga0501073_0007822 | Ga0501073_0007822_854_1912 | 352 |
| 478 | 3300049592 | Ga0501076_0124670 | Ga0501076_0124670_808_1899 | 352 |
| 479 | 3300049742 | Ga0501080_0011298 | Ga0501080_0011298_138_1196 | 352 |
| 480 | 3300050489 | nmdc:mga03683_8691_c1 | nmdc:mga03683_8691_c1_741_1847 | 352 |
| 481 | 3300050496 | nmdc:mga07m45_197_c1 | nmdc:mga07m45_197_c1_10364_11470 | 352 |
| 482 | 3300050516 | nmdc:mga0sz30_5227_c1 | nmdc:mga0sz30_5227_c1_711_1817 | 352 |
| 483 | 3300053077 | Ga0495601_0004731 | Ga0495601_0004731_1887_3008 | 352 |
| 484 | 3300053077 | Ga0495601_0129279 | Ga0495601_0129279_249_1331 | 352 |
| 485 | 3300053084 | Ga0495595_0012737 | Ga0495595_0012737_126_1208 | 352 |
| 486 | 3300005289 | Ga0065704_10023400 | Ga0065704_100234001 | 353 |
| 487 | 3300005330 | Ga0070690_100003762 | Ga0070690_1000037623 | 353 |
| 488 | 3300005331 | Ga0070670_100000906 | Ga0070670_10000090611 | 353 |
| 489 | 3300005335 | Ga0070666_10015924 | Ga0070666_100159245 | 353 |
| 490 | 3300005338 | Ga0068868_100005274 | Ga0068868_1000052744 | 353 |
| 491 | 3300005340 | Ga0070689_100018529 | Ga0070689_1000185294 | 353 |
| 492 | 3300005365 | Ga0070688_100077108 | Ga0070688_1000771082 | 353 |
| 493 | 3300005365 | Ga0070688_100200257 | Ga0070688_1002002571 | 353 |
| 494 | 3300005618 | Ga0068864_100000454 | Ga0068864_1000004547 | 353 |
| 495 | 3300005841 | Ga0068863_100195689 | Ga0068863_1001956891 | 353 |
| 496 | 3300005937 | Ga0081455_10003202 | Ga0081455_1000320219 | 353 |
| 497 | 3300006173 | Ga0070716_100038886 | Ga0070716_1000388862 | 353 |
| 498 | 3300006846 | Ga0075430_100034817 | Ga0075430_1000348173 | 353 |
| 499 | 3300006846 | Ga0075430_100124382 | Ga0075430_1001243822 | 353 |
| 500 | 3300006847 | Ga0075431_100004791 | Ga0075431_10000479115 | 353 |
| 501 | 3300006871 | Ga0075434_100292146 | Ga0075434_1002921462 | 353 |
| 502 | 3300006880 | Ga0075429_100055692 | Ga0075429_1000556922 | 353 |
| 503 | 3300006914 | Ga0075436_100017896 | Ga0075436_1000178966 | 353 |
| 504 | 3300007265 | Ga0099794_10047087 | Ga0099794_100470872 | 353 |
| 505 | 3300010159 | Ga0099796_10004563 | Ga0099796_100045631 | 353 |
| 506 | 3300025303 | Ga0209051_1007653 | Ga0209051_10076533 | 353 |
| 507 | 3300025910 | Ga0207684_10000134 | Ga0207684_10000134118 | 353 |
| 508 | 3300025910 | Ga0207684_10060147 | Ga0207684_100601471 | 353 |
| 509 | 3300025910 | Ga0207684_10163487 | Ga0207684_101634872 | 353 |
| 510 | 3300025931 | Ga0207644_10118587 | Ga0207644_101185871 | 353 |
| 511 | 3300025939 | Ga0207665_10039861 | Ga0207665_100398613 | 353 |
| 512 | 3300025940 | Ga0207691_10003386 | Ga0207691_100033862 | 353 |
| 513 | 3300026035 | Ga0207703_10210043 | Ga0207703_102100432 | 353 |
| 514 | 3300026088 | Ga0207641_10264418 | Ga0207641_102644182 | 353 |
| 515 | 3300027671 | Ga0209588_1017423 | Ga0209588_10174232 | 353 |
| 516 | 3300028794 | Ga0307515_10094760 | Ga0307515_100947603 | 353 |
| 517 | 3300029957 | Ga0265324_10000433 | Ga0265324_1000043319 | 353 |
| 518 | 3300031711 | Ga0265314_10000136 | Ga0265314_1000013628 | 353 |
| 519 | 3300032002 | Ga0307416_100048452 | Ga0307416_1000484522 | 353 |
| 520 | 3300035086 | Ga0373934_0002111 | Ga0373934_0002111_5299_6387 | 353 |
| 521 | 3300035118 | Ga0373954_0000284 | Ga0373954_0000284_4431_5519 | 353 |
| 522 | 3300035119 | Ga0373956_0000996 | Ga0373956_0000996_8836_9924 | 353 |
| 523 | 3300035172 | Ga0373955_0066479 | Ga0373955_0066479_541_1629 | 353 |
| 524 | 3300035724 | Ga0373933_0009642 | Ga0373933_0009642_3274_4362 | 353 |
| 525 | 3300036401 | Ga0373937_0079023 | Ga0373937_0079023_1422_2510 | 353 |
| 526 | 3300037068 | Ga0373925_0013087 | Ga0373925_0013087_4232_5332 | 353 |
| 527 | 3300037471 | Ga0395905_0133205 | Ga0395905_0133205_672_1763 | 353 |
| 528 | 3300042876 | Ga0451577_0001417 | Ga0451577_0001417_27566_28660 | 353 |
| 529 | 3300044712 | Ga0453684_0000029 | Ga0453684_0000029_615072_616178 | 353 |
| 530 | 3300044712 | Ga0453684_0154167 | Ga0453684_0154167_329_1423 | 353 |
| 531 | 3300044712 | Ga0453684_0344330 | Ga0453684_0344330_237_1331 | 353 |
| 532 | 3300045051 | Ga0451576_0101011 | Ga0451576_0101011_716_1813 | 353 |
| 533 | 3300046454 | Ga0495592_0082814 | Ga0495592_0082814_790_1878 | 353 |
| 534 | 3300046462 | Ga0495651_0003692 | Ga0495651_0003692_2116_3204 | 353 |
| 535 | 3300046472 | Ga0495580_0000277 | Ga0495580_0000277_4105_5178 | 353 |
| 536 | 3300046511 | Ga0495608_0021836 | Ga0495608_0021836_301_1368 | 353 |
| 537 | 3300046511 | Ga0495608_0147857 | Ga0495608_0147857_32_1120 | 353 |
| 538 | 3300046559 | Ga0495667_0002820 | Ga0495667_0002820_5418_6485 | 353 |
| 539 | 3300046675 | Ga0495657_0002668 | Ga0495657_0002668_8292_9359 | 353 |
| 540 | 3300047444 | Ga0495675_0182716 | Ga0495675_0182716_25_1092 | 353 |
| 541 | 3300047471 | Ga0495684_0036162 | Ga0495684_0036162_2409_3476 | 353 |
| 542 | 3300049572 | Ga0501036_0041567 | Ga0501036_0041567_2010_3086 | 353 |
| 543 | 3300049582 | Ga0501048_0053638 | Ga0501048_0053638_663_1739 | 353 |
| 544 | 3300049593 | Ga0501077_0017709 | Ga0501077_0017709_909_1970 | 353 |
| 545 | 3300049661 | Ga0501217_000641 | Ga0501217_000641_3646_4713 | 353 |
| 546 | 3300049665 | Ga0501227_000165 | Ga0501227_000165_2684_3751 | 353 |
| 547 | 3300050508 | nmdc:mga09592_160573_c1 | nmdc:mga09592_160573_c1_399_1484 | 353 |
| 548 | 3300050509 | nmdc:mga0qj67_33698_c1 | nmdc:mga0qj67_33698_c1_867_1949 | 353 |
| 549 | 3300050510 | nmdc:mga06r32_15043_c1 | nmdc:mga06r32_15043_c1_2555_3637 | 353 |
| 550 | 3300050512 | nmdc:mga0n895_282058_c1 | nmdc:mga0n895_282058_c1_330_1430 | 353 |
| 551 | 3300050514 | nmdc:mga08x19_19247_c1 | nmdc:mga08x19_19247_c1_2378_3466 | 353 |
| 552 | 3300050515 | nmdc:mga0a205_119779_c1 | nmdc:mga0a205_119779_c1_479_1579 | 353 |
| 553 | 3300053085 | Ga0495619_0039034 | Ga0495619_0039034_1475_2542 | 353 |
| 554 | 3300061734 | Ga0530510_0123926 | Ga0530510_0123926_199_1293 | 353 |
| 555 | iso_pu_bacteria | 2901300506 | 2901312026 | 353 |
| 556 | 3300005467 | Ga0070706_100002535 | Ga0070706_10000253514 | 354 |
| 557 | 3300005468 | Ga0070707_100000894 | Ga0070707_10000089414 | 354 |
| 558 | 3300005530 | Ga0070679_100059313 | Ga0070679_1000593134 | 354 |
| 559 | 3300005536 | Ga0070697_100005266 | Ga0070697_1000052666 | 354 |
| 560 | 3300005616 | Ga0068852_100296397 | Ga0068852_1002963972 | 354 |
| 561 | 3300006844 | Ga0075428_100006866 | Ga0075428_1000068663 | 354 |
| 562 | 3300009094 | Ga0111539_10007501 | Ga0111539_100075015 | 354 |
| 563 | 3300009094 | Ga0111539_10026978 | Ga0111539_100269784 | 354 |
| 564 | 3300025910 | Ga0207684_10000153 | Ga0207684_1000015384 | 354 |
| 565 | 3300025914 | Ga0207671_10087941 | Ga0207671_100879413 | 354 |
| 566 | 3300025921 | Ga0207652_10037227 | Ga0207652_100372274 | 354 |
| 567 | 3300025922 | Ga0207646_10046974 | Ga0207646_100469743 | 354 |
| 568 | 3300026116 | Ga0207674_10299291 | Ga0207674_102992911 | 354 |
| 569 | 3300026142 | Ga0207698_10050739 | Ga0207698_100507392 | 354 |
| 570 | 3300027907 | Ga0207428_10003201 | Ga0207428_1000320114 | 354 |
| 571 | 3300028379 | Ga0268266_10268139 | Ga0268266_102681392 | 354 |
| 572 | 3300031235 | Ga0265330_10008907 | Ga0265330_100089075 | 354 |
| 573 | 3300031238 | Ga0265332_10000083 | Ga0265332_1000008398 | 354 |
| 574 | 3300031250 | Ga0265331_10010080 | Ga0265331_100100804 | 354 |
| 575 | 3300031665 | Ga0316575_10000910 | Ga0316575_1000091012 | 354 |
| 576 | 3300031665 | Ga0316575_10025877 | Ga0316575_100258773 | 354 |
| 577 | 3300031730 | Ga0307516_10010810 | Ga0307516_100108102 | 354 |
| 578 | 3300035695 | Ga0373927_0040395 | Ga0373927_0040395_1115_2194 | 354 |
| 579 | 3300037068 | Ga0373925_0062685 | Ga0373925_0062685_54_1133 | 354 |
| 580 | 3300039447 | Ga0436361_1012027 | Ga0436361_1012027_596_1675 | 354 |
| 581 | 3300042876 | Ga0451577_0188976 | Ga0451577_0188976_205_1314 | 354 |
| 582 | 3300044712 | Ga0453684_0000027 | Ga0453684_0000027_693953_695044 | 354 |
| 583 | 3300044712 | Ga0453684_0020712 | Ga0453684_0020712_7912_9018 | 354 |
| 584 | 3300044712 | Ga0453684_0054458 | Ga0453684_0054458_3112_4209 | 354 |
| 585 | 3300044842 | Ga0466957_0045844 | Ga0466957_0045844_923_1987 | 354 |
| 586 | 3300045051 | Ga0451576_0000483 | Ga0451576_0000483_59394_60497 | 354 |
| 587 | 3300045051 | Ga0451576_0002900 | Ga0451576_0002900_7724_8827 | 354 |
| 588 | 3300048903 | Ga0496100_0119016 | Ga0496100_0119016_444_1538 | 354 |
| 589 | 3300048904 | Ga0496101_0020182 | Ga0496101_0020182_1711_2805 | 354 |
| 590 | 3300048907 | Ga0496104_0069539 | Ga0496104_0069539_591_1685 | 354 |
| 591 | 3300048908 | Ga0496105_0003923 | Ga0496105_0003923_1604_2698 | 354 |
| 592 | 3300048911 | Ga0496108_0035004 | Ga0496108_0035004_2166_3260 | 354 |
| 593 | 3300048911 | Ga0496108_0411674 | Ga0496108_0411674_53_1162 | 354 |
| 594 | 3300048912 | Ga0496109_0100982 | Ga0496109_0100982_1455_2549 | 354 |
| 595 | 3300048913 | Ga0496110_0020809 | Ga0496110_0020809_150_1244 | 354 |
| 596 | 3300048917 | Ga0496114_0010629 | Ga0496114_0010629_1542_2636 | 354 |
| 597 | 3300049569 | Ga0501032_0068724 | Ga0501032_0068724_200_1297 | 354 |
| 598 | 3300049575 | Ga0501039_0131586 | Ga0501039_0131586_364_1461 | 354 |
| 599 | 3300050511 | nmdc:mga08y16_18553_c1 | nmdc:mga08y16_18553_c1_876_1943 | 354 |
| 600 | 3300050511 | nmdc:mga08y16_224_c1 | nmdc:mga08y16_224_c1_34030_35133 | 354 |
| 601 | 3300005354 | Ga0070675_100088001 | Ga0070675_1000880012 | 355 |
| 602 | 3300005439 | Ga0070711_100170391 | Ga0070711_1001703912 | 355 |
| 603 | 3300005440 | Ga0070705_100233589 | Ga0070705_1002335891 | 355 |
| 604 | 3300005456 | Ga0070678_100358334 | Ga0070678_1003583341 | 355 |
| 605 | 3300005543 | Ga0070672_100037176 | Ga0070672_1000371762 | 355 |
| 606 | 3300005842 | Ga0068858_100006836 | Ga0068858_1000068367 | 355 |
| 607 | 3300007076 | Ga0075435_100047868 | Ga0075435_1000478684 | 355 |
| 608 | 3300009094 | Ga0111539_10061639 | Ga0111539_100616394 | 355 |
| 609 | 3300009147 | Ga0114129_10002520 | Ga0114129_100025205 | 355 |
| 610 | 3300009176 | Ga0105242_10000556 | Ga0105242_1000055624 | 355 |
| 611 | 3300009176 | Ga0105242_10429715 | Ga0105242_104297151 | 355 |
| 612 | 3300009551 | Ga0105238_10109045 | Ga0105238_101090453 | 355 |
| 613 | 3300025924 | Ga0207694_10084709 | Ga0207694_100847092 | 355 |
| 614 | 3300025926 | Ga0207659_10128564 | Ga0207659_101285642 | 355 |
| 615 | 3300025934 | Ga0207686_10012098 | Ga0207686_100120983 | 355 |
| 616 | 3300025940 | Ga0207691_10164614 | Ga0207691_101646142 | 355 |
| 617 | 3300026035 | Ga0207703_10007109 | Ga0207703_100071097 | 355 |
| 618 | 3300026035 | Ga0207703_10086518 | Ga0207703_100865182 | 355 |
| 619 | 3300026121 | Ga0207683_10349453 | Ga0207683_103494531 | 355 |
| 620 | 3300031235 | Ga0265330_10002670 | Ga0265330_100026704 | 355 |
| 621 | 3300031344 | Ga0265316_10000508 | Ga0265316_1000050822 | 355 |
| 622 | 3300031665 | Ga0316575_10040223 | Ga0316575_100402232 | 355 |
| 623 | 3300031727 | Ga0316576_10000185 | Ga0316576_1000018522 | 355 |
| 624 | 3300031727 | Ga0316576_10022521 | Ga0316576_100225213 | 355 |
| 625 | 3300031728 | Ga0316578_10000009 | Ga0316578_1000000910 | 355 |
| 626 | 3300031728 | Ga0316578_10015408 | Ga0316578_100154085 | 355 |
| 627 | 3300031733 | Ga0316577_10129019 | Ga0316577_101290192 | 355 |
| 628 | 3300032168 | Ga0316593_10001400 | Ga0316593_100014005 | 355 |
| 629 | 3300032168 | Ga0316593_10005726 | Ga0316593_100057264 | 355 |
| 630 | 3300032168 | Ga0316593_10008151 | Ga0316593_100081512 | 355 |
| 631 | 3300032168 | Ga0316593_10021162 | Ga0316593_100211622 | 355 |
| 632 | 3300033528 | Ga0316588_1004450 | Ga0316588_10044502 | 355 |
| 633 | 3300033529 | Ga0316587_1014958 | Ga0316587_10149581 | 355 |
| 634 | 3300033529 | Ga0316587_1018704 | Ga0316587_10187041 | 355 |
| 635 | 3300033541 | Ga0316596_1013240 | Ga0316596_10132402 | 355 |
| 636 | 3300035398 | Ga0316574_0042760 | Ga0316574_0042760_1652_2746 | 355 |
| 637 | 3300036647 | Ga0316582_0044199 | Ga0316582_0044199_160_1254 | 355 |
| 638 | 3300036712 | Ga0316584_0065573 | Ga0316584_0065573_1331_2425 | 355 |
| 639 | 3300049460 | Ga0495682_0011325 | Ga0495682_0011325_771_1886 | 355 |
| 640 | 3300049575 | Ga0501039_0157073 | Ga0501039_0157073_39_1136 | 355 |
| 641 | 3300049592 | Ga0501076_0004696 | Ga0501076_0004696_1119_2216 | 355 |
| 642 | 3300050507 | nmdc:mga05p37_43553_c1 | nmdc:mga05p37_43553_c1_3371_4438 | 355 |
| 643 | 3300050511 | nmdc:mga08y16_63609_c1 | nmdc:mga08y16_63609_c1_1563_2657 | 355 |
| 644 | 3300050513 | nmdc:mga0rr50_242298_c1 | nmdc:mga0rr50_242298_c1_340_1446 | 355 |
| 645 | 3300050514 | nmdc:mga08x19_1633_c1 | nmdc:mga08x19_1633_c1_1801_2907 | 355 |
| 646 | iso_pu_bacteria | 2847930680 | 2847938030 | 355 |
| 647 | iso_pu_bacteria | 2879083081 | 2879084423 | 355 |
| 648 | iso_pu_bacteria | 8001522603 | 8001524625 | 355 |
| 649 | 3300005364 | Ga0070673_100003842 | Ga0070673_1000038423 | 356 |
| 650 | 3300005367 | Ga0070667_100006711 | Ga0070667_1000067116 | 356 |
| 651 | 3300005467 | Ga0070706_100145555 | Ga0070706_1001455552 | 356 |
| 652 | 3300005471 | Ga0070698_100004413 | Ga0070698_10000441311 | 356 |
| 653 | 3300005471 | Ga0070698_100052734 | Ga0070698_1000527344 | 356 |
| 654 | 3300005518 | Ga0070699_100056021 | Ga0070699_1000560212 | 356 |
| 655 | 3300005536 | Ga0070697_100005132 | Ga0070697_10000513212 | 356 |
| 656 | 3300005546 | Ga0070696_100127814 | Ga0070696_1001278141 | 356 |
| 657 | 3300005564 | Ga0070664_100009003 | Ga0070664_1000090034 | 356 |
| 658 | 3300005834 | Ga0068851_10097773 | Ga0068851_100977731 | 356 |
| 659 | 3300005842 | Ga0068858_100201339 | Ga0068858_1002013393 | 356 |
| 660 | 3300006846 | Ga0075430_100060607 | Ga0075430_1000606072 | 356 |
| 661 | 3300006847 | Ga0075431_100036103 | Ga0075431_1000361033 | 356 |
| 662 | 3300021361 | Ga0213872_10003092 | Ga0213872_100030922 | 356 |
| 663 | 3300021361 | Ga0213872_10010099 | Ga0213872_100100994 | 356 |
| 664 | 3300021388 | Ga0213875_10053763 | Ga0213875_100537631 | 356 |
| 665 | 3300025903 | Ga0207680_10061511 | Ga0207680_100615113 | 356 |
| 666 | 3300025910 | Ga0207684_10025168 | Ga0207684_100251683 | 356 |
| 667 | 3300025925 | Ga0207650_10009835 | Ga0207650_100098354 | 356 |
| 668 | 3300025941 | Ga0207711_10022199 | Ga0207711_100221994 | 356 |
| 669 | 3300026023 | Ga0207677_10019840 | Ga0207677_100198405 | 356 |
| 670 | 3300026035 | Ga0207703_10031865 | Ga0207703_100318651 | 356 |
| 671 | 3300026088 | Ga0207641_10168231 | Ga0207641_101682312 | 356 |
| 672 | 3300026095 | Ga0207676_10002093 | Ga0207676_1000209313 | 356 |
| 673 | 3300031727 | Ga0316576_10100367 | Ga0316576_101003672 | 356 |
| 674 | 3300031728 | Ga0316578_10014151 | Ga0316578_100141511 | 356 |
| 675 | 3300031728 | Ga0316578_10031100 | Ga0316578_100311002 | 356 |
| 676 | 3300031728 | Ga0316578_10036047 | Ga0316578_100360473 | 356 |
| 677 | 3300031824 | Ga0307413_10098219 | Ga0307413_100982192 | 356 |
| 678 | 3300031903 | Ga0307407_10036396 | Ga0307407_100363962 | 356 |
| 679 | 3300031995 | Ga0307409_100023190 | Ga0307409_1000231902 | 356 |
| 680 | 3300032002 | Ga0307416_100028930 | Ga0307416_1000289302 | 356 |
| 681 | 3300032139 | Ga0316580_10014380 | Ga0316580_100143803 | 356 |
| 682 | 3300033524 | Ga0316592_1001415 | Ga0316592_10014154 | 356 |
| 683 | 3300033528 | Ga0316588_1007960 | Ga0316588_10079602 | 356 |
| 684 | 3300033528 | Ga0316588_1017806 | Ga0316588_10178063 | 356 |
| 685 | 3300033541 | Ga0316596_1014493 | Ga0316596_10144932 | 356 |
| 686 | 3300035083 | Ga0373926_0005213 | Ga0373926_0005213_807_1910 | 356 |
| 687 | 3300035398 | Ga0316574_0017743 | Ga0316574_0017743_2267_3364 | 356 |
| 688 | 3300035398 | Ga0316574_0064475 | Ga0316574_0064475_339_1436 | 356 |
| 689 | 3300035398 | Ga0316574_0111736 | Ga0316574_0111736_537_1631 | 356 |
| 690 | 3300035692 | Ga0373935_0034934 | Ga0373935_0034934_512_1615 | 356 |
| 691 | 3300035695 | Ga0373927_0028535 | Ga0373927_0028535_1277_2383 | 356 |
| 692 | 3300035725 | Ga0373947_0000740 | Ga0373947_0000740_5688_6791 | 356 |
| 693 | 3300036647 | Ga0316582_0059869 | Ga0316582_0059869_302_1399 | 356 |
| 694 | 3300036712 | Ga0316584_0029909 | Ga0316584_0029909_230_1336 | 356 |
| 695 | 3300037068 | Ga0373925_0014962 | Ga0373925_0014962_1026_2129 | 356 |
| 696 | 3300037068 | Ga0373925_0025412 | Ga0373925_0025412_1920_3026 | 356 |
| 697 | 3300037312 | Ga0395899_0117861 | Ga0395899_0117861_468_1541 | 356 |
| 698 | 3300037418 | Ga0395900_0061724 | Ga0395900_0061724_470_1543 | 356 |
| 699 | 3300037471 | Ga0395905_0027816 | Ga0395905_0027816_1322_2395 | 356 |
| 700 | 3300037853 | Ga0436364_0410612 | Ga0436364_0410612_4003_5100 | 356 |
| 701 | 3300038443 | Ga0395901_0024823 | Ga0395901_0024823_678_1751 | 356 |
| 702 | 3300039062 | Ga0400483_061984 | Ga0400483_061984_1899_2984 | 356 |
| 703 | 3300039062 | Ga0400483_075120 | Ga0400483_075120_11576_12649 | 356 |
| 704 | 3300039062 | Ga0400483_163069 | Ga0400483_163069_12143_13228 | 356 |
| 705 | 3300039062 | Ga0400483_212256 | Ga0400483_212256_12724_13797 | 356 |
| 706 | 3300039110 | Ga0400487_20179 | Ga0400487_20179_30392_31465 | 356 |
| 707 | 3300039437 | Ga0436365_0391497 | Ga0436365_0391497_130_1209 | 356 |
| 708 | 3300039447 | Ga0436361_0162216 | Ga0436361_0162216_9455_10546 | 356 |
| 709 | 3300039447 | Ga0436361_0687968 | Ga0436361_0687968_1982_3073 | 356 |
| 710 | 3300039447 | Ga0436361_0950210 | Ga0436361_0950210_396_1484 | 356 |
| 711 | 3300039447 | Ga0436361_0976615 | Ga0436361_0976615_158_1246 | 356 |
| 712 | 3300039447 | Ga0436361_1218959 | Ga0436361_1218959_99_1187 | 356 |
| 713 | 3300039453 | Ga0436362_0536411 | Ga0436362_0536411_53_1138 | 356 |
| 714 | 3300044673 | Ga0453683_0008630 | Ga0453683_0008630_151_1230 | 356 |
| 715 | 3300045976 | Ga0466967_0326688 | Ga0466967_0326688_267_1364 | 356 |
| 716 | 3300046681 | Ga0495647_0010396 | Ga0495647_0010396_1867_2973 | 356 |
| 717 | 3300049568 | Ga0501031_0024609 | Ga0501031_0024609_375_1457 | 356 |
| 718 | 3300049568 | Ga0501031_0058405 | Ga0501031_0058405_1409_2497 | 356 |
| 719 | 3300049571 | Ga0501034_0003691 | Ga0501034_0003691_6864_7979 | 356 |
| 720 | 3300049571 | Ga0501034_0217159 | Ga0501034_0217159_378_1460 | 356 |
| 721 | 3300049572 | Ga0501036_0037673 | Ga0501036_0037673_1720_2808 | 356 |
| 722 | 3300049576 | Ga0501040_0024604 | Ga0501040_0024604_685_1773 | 356 |
| 723 | 3300049577 | Ga0501041_0111194 | Ga0501041_0111194_220_1308 | 356 |
| 724 | 3300049578 | Ga0501042_0039246 | Ga0501042_0039246_1815_2903 | 356 |
| 725 | 3300049579 | Ga0501043_0076676 | Ga0501043_0076676_1151_2233 | 356 |
| 726 | 3300049580 | Ga0501046_0048623 | Ga0501046_0048623_547_1635 | 356 |
| 727 | 3300049582 | Ga0501048_0149792 | Ga0501048_0149792_136_1224 | 356 |
| 728 | 3300049582 | Ga0501048_0156413 | Ga0501048_0156413_94_1176 | 356 |
| 729 | 3300049584 | Ga0501068_0039776 | Ga0501068_0039776_1284_2366 | 356 |
| 730 | 3300049585 | Ga0501069_0014398 | Ga0501069_0014398_2770_3852 | 356 |
| 731 | 3300049586 | Ga0501070_0003217 | Ga0501070_0003217_356_1438 | 356 |
| 732 | 3300049587 | Ga0501071_0098342 | Ga0501071_0098342_909_1991 | 356 |
| 733 | 3300049589 | Ga0501073_0054843 | Ga0501073_0054843_524_1606 | 356 |
| 734 | 3300049592 | Ga0501076_0011413 | Ga0501076_0011413_3049_4137 | 356 |
| 735 | 3300049741 | Ga0501079_0037957 | Ga0501079_0037957_295_1383 | 356 |
| 736 | 3300049741 | Ga0501079_0104952 | Ga0501079_0104952_229_1311 | 356 |
| 737 | 3300049742 | Ga0501080_0161903 | Ga0501080_0161903_145_1227 | 356 |
| 738 | 3300049743 | Ga0501081_0034320 | Ga0501081_0034320_1587_2675 | 356 |
| 739 | 3300049744 | Ga0501083_0005573 | Ga0501083_0005573_709_1791 | 356 |
| 740 | 3300049822 | Ga0501035_0017135 | Ga0501035_0017135_415_1497 | 356 |
| 741 | 3300050509 | nmdc:mga0qj67_46733_c1 | nmdc:mga0qj67_46733_c1_1718_2803 | 356 |
| 742 | 3300050510 | nmdc:mga06r32_65612_c1 | nmdc:mga06r32_65612_c1_473_1582 | 356 |
| 743 | 3300060353 | Ga0501082_0085013 | Ga0501082_0085013_1485_2567 | 356 |
| 744 | 3300061734 | Ga0530510_0019992 | Ga0530510_0019992_783_1871 | 356 |
| 745 | 3300005336 | Ga0070680_100050702 | Ga0070680_1000507023 | 357 |
| 746 | 3300005337 | Ga0070682_100208499 | Ga0070682_1002084991 | 357 |
| 747 | 3300005344 | Ga0070661_100038443 | Ga0070661_1000384433 | 357 |
| 748 | 3300005434 | Ga0070709_10008556 | Ga0070709_100085563 | 357 |
| 749 | 3300005435 | Ga0070714_100033710 | Ga0070714_1000337102 | 357 |
| 750 | 3300005436 | Ga0070713_100072739 | Ga0070713_1000727393 | 357 |
| 751 | 3300005437 | Ga0070710_10010324 | Ga0070710_100103245 | 357 |
| 752 | 3300005535 | Ga0070684_100001343 | Ga0070684_1000013438 | 357 |
| 753 | 3300005535 | Ga0070684_100017800 | Ga0070684_1000178005 | 357 |
| 754 | 3300005564 | Ga0070664_100071054 | Ga0070664_1000710542 | 357 |
| 755 | 3300005577 | Ga0068857_100182360 | Ga0068857_1001823602 | 357 |
| 756 | 3300005842 | Ga0068858_100143421 | Ga0068858_1001434212 | 357 |
| 757 | 3300006163 | Ga0070715_10009397 | Ga0070715_100093972 | 357 |
| 758 | 3300006173 | Ga0070716_100013161 | Ga0070716_1000131614 | 357 |
| 759 | 3300006175 | Ga0070712_100012125 | Ga0070712_1000121255 | 357 |
| 760 | 3300006175 | Ga0070712_100048686 | Ga0070712_1000486863 | 357 |
| 761 | 3300006175 | Ga0070712_100104622 | Ga0070712_1001046222 | 357 |
| 762 | 3300013105 | Ga0157369_10004712 | Ga0157369_1000471214 | 357 |
| 763 | 3300020070 | Ga0206356_10062693 | Ga0206356_100626933 | 357 |
| 764 | 3300020081 | Ga0206354_10232206 | Ga0206354_102322062 | 357 |
| 765 | 3300022467 | Ga0224712_10034708 | Ga0224712_100347081 | 357 |
| 766 | 3300025898 | Ga0207692_10000821 | Ga0207692_1000082111 | 357 |
| 767 | 3300025906 | Ga0207699_10011935 | Ga0207699_100119355 | 357 |
| 768 | 3300025909 | Ga0207705_10030469 | Ga0207705_100304694 | 357 |
| 769 | 3300025915 | Ga0207693_10008424 | Ga0207693_1000842410 | 357 |
| 770 | 3300025915 | Ga0207693_10077500 | Ga0207693_100775003 | 357 |
| 771 | 3300025916 | Ga0207663_10008722 | Ga0207663_100087224 | 357 |
| 772 | 3300025920 | Ga0207649_10135705 | Ga0207649_101357052 | 357 |
| 773 | 3300025921 | Ga0207652_10055534 | Ga0207652_100555342 | 357 |
| 774 | 3300025928 | Ga0207700_10036243 | Ga0207700_100362433 | 357 |
| 775 | 3300025929 | Ga0207664_10030030 | Ga0207664_100300303 | 357 |
| 776 | 3300025939 | Ga0207665_10025087 | Ga0207665_100250874 | 357 |
| 777 | 3300025944 | Ga0207661_10003175 | Ga0207661_1000317510 | 357 |
| 778 | 3300025944 | Ga0207661_10022528 | Ga0207661_100225283 | 357 |
| 779 | 3300026078 | Ga0207702_10292486 | Ga0207702_102924862 | 357 |
| 780 | 3300026116 | Ga0207674_10094112 | Ga0207674_100941123 | 357 |
| 781 | 3300027296 | Ga0209389_1000009 | Ga0209389_100000939 | 357 |
| 782 | 3300027361 | Ga0209489_100050 | Ga0209489_10005087 | 357 |
| 783 | 3300027363 | Ga0209700_100016 | Ga0209700_100016195 | 357 |
| 784 | 3300027907 | Ga0207428_10007187 | Ga0207428_100071873 | 357 |
| 785 | 3300031727 | Ga0316576_10009926 | Ga0316576_100099263 | 357 |
| 786 | 3300031727 | Ga0316576_10020319 | Ga0316576_100203193 | 357 |
| 787 | 3300031727 | Ga0316576_10077327 | Ga0316576_100773272 | 357 |
| 788 | 3300031727 | Ga0316576_10104085 | Ga0316576_101040852 | 357 |
| 789 | 3300031727 | Ga0316576_10167757 | Ga0316576_101677571 | 357 |
| 790 | 3300031728 | Ga0316578_10038031 | Ga0316578_100380312 | 357 |
| 791 | 3300031728 | Ga0316578_10073172 | Ga0316578_100731722 | 357 |
| 792 | 3300031733 | Ga0316577_10072529 | Ga0316577_100725292 | 357 |
| 793 | 3300035398 | Ga0316574_0001201 | Ga0316574_0001201_4364_5440 | 357 |
| 794 | 3300035398 | Ga0316574_0003293 | Ga0316574_0003293_2411_3523 | 357 |
| 795 | 3300035398 | Ga0316574_0012529 | Ga0316574_0012529_1175_2278 | 357 |
| 796 | 3300035398 | Ga0316574_0055240 | Ga0316574_0055240_761_1861 | 357 |
| 797 | 3300035398 | Ga0316574_0135563 | Ga0316574_0135563_451_1569 | 357 |
| 798 | 3300035398 | Ga0316574_0158357 | Ga0316574_0158357_230_1345 | 357 |
| 799 | 3300035398 | Ga0316574_0161734 | Ga0316574_0161734_299_1381 | 357 |
| 800 | 3300036647 | Ga0316582_0055368 | Ga0316582_0055368_557_1669 | 357 |
| 801 | 3300036712 | Ga0316584_0090466 | Ga0316584_0090466_917_1999 | 357 |
| 802 | 3300036712 | Ga0316584_0100478 | Ga0316584_0100478_739_1851 | 357 |
| 803 | 3300036712 | Ga0316584_0198278 | Ga0316584_0198278_71_1186 | 357 |
| 804 | 3300039062 | Ga0400483_142661 | Ga0400483_142661_2302_3390 | 357 |
| 805 | 3300039062 | Ga0400483_189406 | Ga0400483_189406_188_1276 | 357 |
| 806 | 3300039062 | Ga0400483_274218 | Ga0400483_274218_2251_3372 | 357 |
| 807 | 3300048915 | Ga0496112_0082650 | Ga0496112_0082650_283_1368 | 357 |
| 808 | 3300048915 | Ga0496112_0175868 | Ga0496112_0175868_765_1853 | 357 |
| 809 | 3300050511 | nmdc:mga08y16_8480_c1 | nmdc:mga08y16_8480_c1_2460_3560 | 357 |
| 810 | iso_pu_bacteria | 2523231044 | 2523384828 | 357 |
| 811 | iso_pu_bacteria | 8056054917 | 8056056662 | 357 |
| 812 | 3300014497 | Ga0182008_10124102 | Ga0182008_101241021 | 358 |
| 813 | 3300025906 | Ga0207699_10000151 | Ga0207699_1000015129 | 358 |
| 814 | 3300031595 | Ga0265313_10000061 | Ga0265313_1000006163 | 358 |
| 815 | 3300031727 | Ga0316576_10000775 | Ga0316576_100007759 | 358 |
| 816 | 3300031903 | Ga0307407_10053359 | Ga0307407_100533592 | 358 |
| 817 | 3300031995 | Ga0307409_100132326 | Ga0307409_1001323261 | 358 |
| 818 | 3300032005 | Ga0307411_10002945 | Ga0307411_100029455 | 358 |
| 819 | 3300036712 | Ga0316584_0013099 | Ga0316584_0013099_2410_3531 | 358 |
| 820 | 3300044712 | Ga0453684_0085048 | Ga0453684_0085048_2334_3461 | 358 |
| 821 | 3300045051 | Ga0451576_0000219 | Ga0451576_0000219_109032_110123 | 358 |
| 822 | 3300048911 | Ga0496108_0263247 | Ga0496108_0263247_392_1480 | 358 |
| 823 | 3300005471 | Ga0070698_100082635 | Ga0070698_1000826352 | 359 |
| 824 | 3300005539 | Ga0068853_100040312 | Ga0068853_1000403122 | 359 |
| 825 | 3300005547 | Ga0070693_100130154 | Ga0070693_1001301541 | 359 |
| 826 | 3300005719 | Ga0068861_100000999 | Ga0068861_1000009994 | 359 |
| 827 | 3300005842 | Ga0068858_100016977 | Ga0068858_1000169774 | 359 |
| 828 | 3300005985 | Ga0081539_10008545 | Ga0081539_100085453 | 359 |
| 829 | 3300006051 | Ga0075364_10070891 | Ga0075364_100708911 | 359 |
| 830 | 3300006051 | Ga0075364_10088545 | Ga0075364_100885452 | 359 |
| 831 | 3300006177 | Ga0075362_10086060 | Ga0075362_100860601 | 359 |
| 832 | 3300006186 | Ga0075369_10004717 | Ga0075369_100047172 | 359 |
| 833 | 3300006186 | Ga0075369_10006202 | Ga0075369_100062023 | 359 |
| 834 | 3300006880 | Ga0075429_100021207 | Ga0075429_1000212074 | 359 |
| 835 | 3300006880 | Ga0075429_100262313 | Ga0075429_1002623132 | 359 |
| 836 | 3300009147 | Ga0114129_10011944 | Ga0114129_100119449 | 359 |
| 837 | 3300009174 | Ga0105241_10030868 | Ga0105241_100308684 | 359 |
| 838 | 3300009176 | Ga0105242_10032170 | Ga0105242_100321704 | 359 |
| 839 | 3300009177 | Ga0105248_10021930 | Ga0105248_100219304 | 359 |
| 840 | 3300009545 | Ga0105237_10067738 | Ga0105237_100677383 | 359 |
| 841 | 3300010375 | Ga0105239_10068834 | Ga0105239_100688342 | 359 |
| 842 | 3300013296 | Ga0157374_10080020 | Ga0157374_100800203 | 359 |
| 843 | 3300013297 | Ga0157378_10045534 | Ga0157378_100455343 | 359 |
| 844 | 3300013306 | Ga0163162_10070559 | Ga0163162_100705592 | 359 |
| 845 | 3300014325 | Ga0163163_10003827 | Ga0163163_100038278 | 359 |
| 846 | 3300014968 | Ga0157379_10050438 | Ga0157379_100504385 | 359 |
| 847 | 3300017792 | Ga0163161_10012730 | Ga0163161_100127304 | 359 |
| 848 | 3300025915 | Ga0207693_10000339 | Ga0207693_100003394 | 359 |
| 849 | 3300025935 | Ga0207709_10001097 | Ga0207709_1000109718 | 359 |
| 850 | 3300025981 | Ga0207640_10042307 | Ga0207640_100423072 | 359 |
| 851 | 3300031727 | Ga0316576_10070115 | Ga0316576_100701152 | 359 |
| 852 | 3300031824 | Ga0307413_10007356 | Ga0307413_100073565 | 359 |
| 853 | 3300031852 | Ga0307410_10073541 | Ga0307410_100735412 | 359 |
| 854 | 3300031903 | Ga0307407_10091684 | Ga0307407_100916842 | 359 |
| 855 | 3300031995 | Ga0307409_100124196 | Ga0307409_1001241962 | 359 |
| 856 | 3300031995 | Ga0307409_100484803 | Ga0307409_1004848031 | 359 |
| 857 | 3300032002 | Ga0307416_100165575 | Ga0307416_1001655752 | 359 |
| 858 | 3300032005 | Ga0307411_10081513 | Ga0307411_100815132 | 359 |
| 859 | 3300032005 | Ga0307411_10104615 | Ga0307411_101046152 | 359 |
| 860 | 3300032126 | Ga0307415_100258218 | Ga0307415_1002582181 | 359 |
| 861 | 3300032137 | Ga0316585_10008848 | Ga0316585_100088483 | 359 |
| 862 | 3300033529 | Ga0316587_1001928 | Ga0316587_10019281 | 359 |
| 863 | 3300035398 | Ga0316574_0003963 | Ga0316574_0003963_2640_3749 | 359 |
| 864 | 3300035691 | Ga0373931_0046143 | Ga0373931_0046143_504_1679 | 359 |
| 865 | 3300036712 | Ga0316584_0087928 | Ga0316584_0087928_164_1285 | 359 |
| 866 | 3300037466 | Ga0395898_0232976 | Ga0395898_0232976_587_1714 | 359 |
| 867 | 3300037471 | Ga0395905_0142817 | Ga0395905_0142817_107_1234 | 359 |
| 868 | 3300041411 | Ga0439466_0035089 | Ga0439466_0035089_388_1467 | 359 |
| 869 | 3300041997 | Ga0439431_0009831 | Ga0439431_0009831_990_2069 | 359 |
| 870 | 3300042004 | Ga0439445_0011025 | Ga0439445_0011025_919_1998 | 359 |
| 871 | 3300044901 | Ga0466960_0049913 | Ga0466960_0049913_847_1926 | 359 |
| 872 | 3300048904 | Ga0496101_0002757 | Ga0496101_0002757_6718_7797 | 359 |
| 873 | 3300048908 | Ga0496105_0154328 | Ga0496105_0154328_11_1129 | 359 |
| 874 | 3300048909 | Ga0496106_0013966 | Ga0496106_0013966_20_1195 | 359 |
| 875 | 3300048912 | Ga0496109_0038622 | Ga0496109_0038622_1188_2363 | 359 |
| 876 | 3300048915 | Ga0496112_0128530 | Ga0496112_0128530_390_1565 | 359 |
| 877 | 3300048916 | Ga0496113_0081507 | Ga0496113_0081507_369_1544 | 359 |
| 878 | 3300048917 | Ga0496114_0000953 | Ga0496114_0000953_8874_9953 | 359 |
| 879 | 3300048918 | Ga0496115_0029355 | Ga0496115_0029355_106_1281 | 359 |
| 880 | 3300049581 | Ga0501047_0018444 | Ga0501047_0018444_2358_3464 | 359 |
| 881 | 3300050489 | nmdc:mga03683_65265_c1 | nmdc:mga03683_65265_c1_237_1316 | 359 |
| 882 | 3300050491 | nmdc:mga00v17_115499_c1 | nmdc:mga00v17_115499_c1_350_1429 | 359 |
| 883 | 3300050491 | nmdc:mga00v17_35818_c1 | nmdc:mga00v17_35818_c1_1304_2383 | 359 |
| 884 | 3300050492 | nmdc:mga0yw44_26981_c1 | nmdc:mga0yw44_26981_c1_497_1576 | 359 |
| 885 | 3300050507 | nmdc:mga05p37_22826_c1 | nmdc:mga05p37_22826_c1_5253_6389 | 359 |
| 886 | iso_pu_bacteria | 2885409591 | 2885410015 | 359 |
| 887 | 3300001990 | JGI24737J22298_10045099 | JGI24737J22298_100450991 | 360 |
| 888 | 3300005338 | Ga0068868_100008755 | Ga0068868_1000087552 | 360 |
| 889 | 3300005343 | Ga0070687_100059885 | Ga0070687_1000598852 | 360 |
| 890 | 3300005354 | Ga0070675_100116322 | Ga0070675_1001163221 | 360 |
| 891 | 3300005364 | Ga0070673_100379440 | Ga0070673_1003794401 | 360 |
| 892 | 3300005563 | Ga0068855_100180773 | Ga0068855_1001807732 | 360 |
| 893 | 3300005616 | Ga0068852_100169442 | Ga0068852_1001694422 | 360 |
| 894 | 3300005618 | Ga0068864_100097581 | Ga0068864_1000975813 | 360 |
| 895 | 3300005841 | Ga0068863_100133724 | Ga0068863_1001337242 | 360 |
| 896 | 3300006173 | Ga0070716_100079043 | Ga0070716_1000790432 | 360 |
| 897 | 3300006844 | Ga0075428_100006684 | Ga0075428_1000066845 | 360 |
| 898 | 3300006846 | Ga0075430_100001621 | Ga0075430_10000162118 | 360 |
| 899 | 3300006846 | Ga0075430_100036653 | Ga0075430_1000366534 | 360 |
| 900 | 3300006847 | Ga0075431_100001412 | Ga0075431_1000014128 | 360 |
| 901 | 3300006847 | Ga0075431_100012454 | Ga0075431_1000124542 | 360 |
| 902 | 3300006847 | Ga0075431_100022895 | Ga0075431_1000228952 | 360 |
| 903 | 3300006847 | Ga0075431_100044859 | Ga0075431_1000448595 | 360 |
| 904 | 3300006852 | Ga0075433_10279863 | Ga0075433_102798632 | 360 |
| 905 | 3300006880 | Ga0075429_100011021 | Ga0075429_1000110218 | 360 |
| 906 | 3300006880 | Ga0075429_100021021 | Ga0075429_1000210214 | 360 |
| 907 | 3300009147 | Ga0114129_10101509 | Ga0114129_101015095 | 360 |
| 908 | 3300009148 | Ga0105243_10150858 | Ga0105243_101508582 | 360 |
| 909 | 3300009174 | Ga0105241_10170098 | Ga0105241_101700981 | 360 |
| 910 | 3300009176 | Ga0105242_10013676 | Ga0105242_100136761 | 360 |
| 911 | 3300009551 | Ga0105238_10150330 | Ga0105238_101503301 | 360 |
| 912 | 3300009551 | Ga0105238_10323716 | Ga0105238_103237161 | 360 |
| 913 | 3300011119 | Ga0105246_10031036 | Ga0105246_100310363 | 360 |
| 914 | 3300013105 | Ga0157369_10081506 | Ga0157369_100815063 | 360 |
| 915 | 3300013296 | Ga0157374_10193419 | Ga0157374_101934191 | 360 |
| 916 | 3300013306 | Ga0163162_10079555 | Ga0163162_100795553 | 360 |
| 917 | 3300013308 | Ga0157375_10059690 | Ga0157375_100596904 | 360 |
| 918 | 3300013308 | Ga0157375_10201206 | Ga0157375_102012061 | 360 |
| 919 | 3300025900 | Ga0207710_10067668 | Ga0207710_100676681 | 360 |
| 920 | 3300025904 | Ga0207647_10017480 | Ga0207647_100174801 | 360 |
| 921 | 3300025907 | Ga0207645_10083453 | Ga0207645_100834531 | 360 |
| 922 | 3300025915 | Ga0207693_10005268 | Ga0207693_100052683 | 360 |
| 923 | 3300025926 | Ga0207659_10033180 | Ga0207659_100331802 | 360 |
| 924 | 3300025934 | Ga0207686_10070681 | Ga0207686_100706811 | 360 |
| 925 | 3300025938 | Ga0207704_10017772 | Ga0207704_100177723 | 360 |
| 926 | 3300025961 | Ga0207712_10256241 | Ga0207712_102562412 | 360 |
| 927 | 3300025972 | Ga0207668_10196507 | Ga0207668_101965071 | 360 |
| 928 | 3300026041 | Ga0207639_10130399 | Ga0207639_101303992 | 360 |
| 929 | 3300026078 | Ga0207702_10004539 | Ga0207702_1000453913 | 360 |
| 930 | 3300026088 | Ga0207641_10117525 | Ga0207641_101175252 | 360 |
| 931 | 3300026116 | Ga0207674_10510885 | Ga0207674_105108851 | 360 |
| 932 | 3300026118 | Ga0207675_100120783 | Ga0207675_1001207831 | 360 |
| 933 | 3300026142 | Ga0207698_10330060 | Ga0207698_103300601 | 360 |
| 934 | 3300031711 | Ga0265314_10000447 | Ga0265314_1000044738 | 360 |
| 935 | 3300031727 | Ga0316576_10035413 | Ga0316576_100354134 | 360 |
| 936 | 3300031727 | Ga0316576_10075746 | Ga0316576_100757462 | 360 |
| 937 | 3300031728 | Ga0316578_10009518 | Ga0316578_100095184 | 360 |
| 938 | 3300031728 | Ga0316578_10010545 | Ga0316578_100105452 | 360 |
| 939 | 3300031995 | Ga0307409_100134882 | Ga0307409_1001348822 | 360 |
| 940 | 3300032002 | Ga0307416_100497365 | Ga0307416_1004973651 | 360 |
| 941 | 3300032126 | Ga0307415_100042383 | Ga0307415_1000423831 | 360 |
| 942 | 3300032139 | Ga0316580_10006681 | Ga0316580_100066812 | 360 |
| 943 | 3300033527 | Ga0316586_1004449 | Ga0316586_10044492 | 360 |
| 944 | 3300033528 | Ga0316588_1005395 | Ga0316588_10053953 | 360 |
| 945 | 3300035398 | Ga0316574_0003902 | Ga0316574_0003902_5855_7009 | 360 |
| 946 | 3300035398 | Ga0316574_0013379 | Ga0316574_0013379_1341_2453 | 360 |
| 947 | 3300035398 | Ga0316574_0064009 | Ga0316574_0064009_432_1655 | 360 |
| 948 | 3300036647 | Ga0316582_0046563 | Ga0316582_0046563_1153_2265 | 360 |
| 949 | 3300036647 | Ga0316582_0101088 | Ga0316582_0101088_171_1280 | 360 |
| 950 | 3300036712 | Ga0316584_0016020 | Ga0316584_0016020_1983_3095 | 360 |
| 951 | 3300036712 | Ga0316584_0016776 | Ga0316584_0016776_3084_4238 | 360 |
| 952 | 3300036712 | Ga0316584_0051912 | Ga0316584_0051912_381_1607 | 360 |
| 953 | 3300037466 | Ga0395898_0121693 | Ga0395898_0121693_1320_2486 | 360 |
| 954 | 3300037471 | Ga0395905_0050933 | Ga0395905_0050933_1861_3027 | 360 |
| 955 | 3300038443 | Ga0395901_0001398 | Ga0395901_0001398_22112_23278 | 360 |
| 956 | 3300044684 | Ga0466966_0149487 | Ga0466966_0149487_214_1305 | 360 |
| 957 | 3300048911 | Ga0496108_0006306 | Ga0496108_0006306_2370_3452 | 360 |
| 958 | 3300048911 | Ga0496108_0027054 | Ga0496108_0027054_579_1724 | 360 |
| 959 | 3300048912 | Ga0496109_0017015 | Ga0496109_0017015_601_1746 | 360 |
| 960 | 3300048913 | Ga0496110_0098626 | Ga0496110_0098626_1142_2257 | 360 |
| 961 | 3300048914 | Ga0496111_0064345 | Ga0496111_0064345_495_1640 | 360 |
| 962 | 3300049575 | Ga0501039_0070352 | Ga0501039_0070352_1251_2363 | 360 |
| 963 | 3300049576 | Ga0501040_0067360 | Ga0501040_0067360_112_1224 | 360 |
| 964 | 3300049577 | Ga0501041_0017992 | Ga0501041_0017992_1382_2494 | 360 |
| 965 | 3300049578 | Ga0501042_0061024 | Ga0501042_0061024_13_1125 | 360 |
| 966 | 3300049580 | Ga0501046_0040269 | Ga0501046_0040269_1572_2684 | 360 |
| 967 | 3300049581 | Ga0501047_0034783 | Ga0501047_0034783_2107_3222 | 360 |
| 968 | 3300049590 | Ga0501074_0098935 | Ga0501074_0098935_116_1228 | 360 |
| 969 | 3300049741 | Ga0501079_0040238 | Ga0501079_0040238_1033_2145 | 360 |
| 970 | 3300049824 | Ga0501045_0013593 | Ga0501045_0013593_2612_3736 | 360 |
| 971 | 3300050507 | nmdc:mga05p37_86_c1 | nmdc:mga05p37_86_c1_417_1559 | 360 |
| 972 | 3300050508 | nmdc:mga09592_25_c1 | nmdc:mga09592_25_c1_26523_27665 | 360 |
| 973 | 3300050508 | nmdc:mga09592_4214_c1 | nmdc:mga09592_4214_c1_9892_10986 | 360 |
| 974 | 3300050509 | nmdc:mga0qj67_164_c1 | nmdc:mga0qj67_164_c1_16802_17944 | 360 |
| 975 | 3300050510 | nmdc:mga06r32_21156_c1 | nmdc:mga06r32_21156_c1_3912_5006 | 360 |
| 976 | 3300050510 | nmdc:mga06r32_281_c1 | nmdc:mga06r32_281_c1_25357_26499 | 360 |
| 977 | 3300050511 | nmdc:mga08y16_310337_c1 | nmdc:mga08y16_310337_c1_92_1189 | 360 |
| 978 | 3300053092 | Ga0500583_0035724 | Ga0500583_0035724_950_2065 | 360 |
| 979 | 3300061734 | Ga0530510_0005818 | Ga0530510_0005818_2222_3346 | 360 |
| 980 | iso_pu_bacteria | 2622736605 | 2623501357 | 360 |
| 981 | iso_pu_bacteria | 2861520306 | 2861527149 | 360 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3can-assembly1.cif.gz_A-2 | crystal structure of a domain of pyruvate-formate lyase-activating enzyme from bacteroides vulgatus atcc 8482 | 0.8849 | 130 | 294 |
| 8fsi-assembly1.cif.gz_A | the structure of a crystallizable variant of e. coli pyruvate formate-lyase activating enzyme bound to sam | 0.8676 | 77 | 291 |
| 3can-assembly1.cif.gz_A-2 | crystal structure of a domain of pyruvate-formate lyase-activating enzyme from bacteroides vulgatus atcc 8482 | 0.8646 | 130 | 294 |
| 3cb8-assembly1.cif.gz_A | 4fe-4s-pyruvate formate-lyase activating enzyme in complex with adomet and a peptide substrate | 0.8103 | 56 | 291 |
| 2yx6-assembly3.cif.gz_D-3 | crystal structure of ph0822 | 0.7989 | 115 | 158 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P95188_67_289_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 1.001 | 69 | 290 | 3.20.20.70 |
| af_P95188_67_289_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9918 | 69 | 290 | 3.20.20.70 |
| af_Q58218_60_281_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9666 | 67 | 291 | 3.20.20.70 |
| af_Q58218_60_281_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9581 | 67 | 291 | 3.20.20.70 |
| 3canA00 | Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;pyruvate-formate lyase- activating enzyme | 0.8832 | 130 | 294 | 3.80.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G9MQY4-F1-model_v4 | Pyruvate formate lyase activating enzyme | 0.9986 | 1 | 359 |
GO:0016829
GO:0046872 GO:0051539 |
| AF-A0A2V6ZC46-F1-model_v4 | AmmeMemoRadiSam system radical SAM enzyme | 0.9971 | 7 | 311 |
GO:0003824
GO:0046872 GO:0051539 |
| AF-A0A4U0GWB2-F1-model_v4 | AmmeMemoRadiSam system radical SAM enzyme | 0.9965 | 3 | 359 |
GO:0003824
GO:0046872 GO:0051539 |
| AF-A0A3D3JJK7-F1-model_v4 | AmmeMemoRadiSam system radical SAM enzyme | 0.9954 | 7 | 275 |
GO:0003824
GO:0046872 GO:0051539 |
| AF-A0A2D6TX55-F1-model_v4 | MEMO1 family protein CL561_13240 | 0.9945 | 2 | 359 |
GO:0003824
GO:0046872 GO:0051539 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar