F487396

General Info

Members Datasets Scaffolds Average Seq Length
981 396 968 360

Family's Representative Sequence

Representative Sequence 3300036712|Ga0316584_0051912|Ga0316584_0051912_381_1607
Length 408
Sequence MSMPRTFTQDPPVASVAQSSTTPRPDARGAFRRTLDSISDAISLTDPYTVPTRHWHRLEDGRLQCDACPRACKLREGQRGVCFVRGRIDDQVVLTSYGRSSGYCIDPIEKKPLNHFLPGTSVLSFGTAGCNLACRFCQNWDISKSKEVDRLADAAPPDGIASAALELGCASVAFTYNDPVIFVEYAVDTALACRDVGVRTVAVSAGYATDATRRELYSAVDAANIDLKGFTEDFYRHVAMGQLEPVLDTLRYIRHETDTWLEITTLLIPGMNDGDEELHELATWIRTELGPDVPLHFSAFHPDYKMRDVPPTPPATLTRARRIALDEGLQHVYTGNVHDREGDTTTCTECGTAVIERDWYELKGWHLTGDGRCRSCGAPLSGVFDGPPGEWGAKRVPVELRTGKARRR

Samples

Sample ID Description Type Environment
1 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
2 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
3 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
4 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
5 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
6 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
7 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
8 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
9 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
10 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
124 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
125 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
183 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
184 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
185 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
192 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
193 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
194 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
195 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
196 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
197 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
198 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
199 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
200 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
201 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
202 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
203 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
204 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
205 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
206 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
207 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
208 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
209 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
210 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
211 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
212 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
213 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
214 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
215 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
216 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
217 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
218 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
219 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
220 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
221 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
222 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
223 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
224 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
228 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
229 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
230 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
231 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
233 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
239 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
240 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
241 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
242 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
243 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
244 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
245 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
246 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
247 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
248 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
249 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
250 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
251 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
252 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
253 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
254 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
255 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
256 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
257 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
258 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
259 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
260 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
261 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
262 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
263 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
264 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
265 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
266 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
267 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
268 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
269 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
270 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
271 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
272 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
273 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
274 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
275 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
276 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
277 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
278 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
279 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
280 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
281 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
282 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
283 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
284 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
285 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
286 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
287 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
288 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
289 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
290 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
291 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
292 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
293 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
294 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
295 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
296 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
297 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
298 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
299 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
300 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
301 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
302 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
303 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
304 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
305 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
306 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
307 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
308 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
309 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
310 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
311 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
312 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
313 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
314 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
315 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
316 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
317 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
318 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
319 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
320 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
321 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
322 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
323 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
324 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
325 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
326 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
327 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
328 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
329 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
330 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
331 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
332 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
348 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
349 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
350 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
351 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
352 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
353 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
354 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
355 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
356 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
357 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
358 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
359 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
360 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
361 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
362 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
363 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
366 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
367 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
368 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
369 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
370 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
371 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
372 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
373 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
374 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
375 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
376 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
377 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
378 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
379 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
380 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
381 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
382 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
383 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
384 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
385 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
386 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
387 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
388 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
389 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
390 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
391 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
392 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
393 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
394 639633007 Azoarcus olearius BH72 Isolate Unclassified
395 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
396 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.74
Metatranscriptomes 1.94
Isolates 1.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.98
Nodule 0.31
Rhizoplane 3.16
Rhizosphere 89.4
Stem 0
Stem Tuber 0
Unclassified 3.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10045099 3300001990 Bacteria 1347
2 Ga0065704_10023400 3300005289 Bacteria 1292
3 Ga0070658_10197034 3300005327 Bacteria 1698
4 Ga0070690_100003762 3300005330 Bacteria 8357
5 Ga0070690_100016631 3300005330 Bacteria 4410
6 Ga0070670_100000906 3300005331 Bacteria 23327
7 Ga0070670_100103701 3300005331 Bacteria 2450
8 Ga0068869_100019821 3300005334 Bacteria 4604
9 Ga0070666_10012915 3300005335 Bacteria 5283
10 Ga0070666_10015924 3300005335 Bacteria 4803
11 Ga0070666_10059296 3300005335 Bacteria 2589
12 Ga0070666_10167900 3300005335 Bacteria 1536
13 Ga0070680_100050702 3300005336 Bacteria 3386
14 Ga0070682_100208499 3300005337 Bacteria 1383
15 Ga0068868_100005274 3300005338 Bacteria 9076
16 Ga0068868_100008755 3300005338 Bacteria 7248
17 Ga0068868_100037456 3300005338 Bacteria 3760
18 Ga0068868_100259904 3300005338 Bacteria 1464
19 Ga0070689_100018529 3300005340 Bacteria 5131
20 Ga0070689_100035455 3300005340 Bacteria 3812
21 Ga0070689_100114910 3300005340 Bacteria 2145
22 Ga0070687_100059885 3300005343 Bacteria 2007
23 Ga0070661_100038443 3300005344 Bacteria 3484
24 Ga0070668_100026038 3300005347 Bacteria 4435
25 Ga0070668_100102974 3300005347 Bacteria 2264
26 Ga0070675_100022870 3300005354 Bacteria 4994
27 Ga0070675_100088001 3300005354 Bacteria 2598
28 Ga0070675_100116322 3300005354 Bacteria 2268
29 Ga0070671_100004118 3300005355 Bacteria 11479
30 Ga0070671_100051657 3300005355 Bacteria 3419
31 Ga0070674_100025779 3300005356 Bacteria 3831
32 Ga0070673_100001712 3300005364 Bacteria 13029
33 Ga0070673_100003842 3300005364 Bacteria 9429
34 Ga0070673_100009342 3300005364 Bacteria 6578
35 Ga0070673_100379440 3300005364 Bacteria 1260
36 Ga0070688_100077108 3300005365 Bacteria 2146
37 Ga0070688_100200257 3300005365 Bacteria 1397
38 Ga0070667_100006711 3300005367 Bacteria 9563
39 Ga0070667_100035568 3300005367 Bacteria 4173
40 Ga0070667_100058417 3300005367 Bacteria 3261
41 Ga0070667_100071936 3300005367 Bacteria 2946
42 Ga0070709_10008556 3300005434 Bacteria 5626
43 Ga0070714_100033710 3300005435 Bacteria 4283
44 Ga0070713_100072739 3300005436 Bacteria 2908
45 Ga0070713_100352038 3300005436 Bacteria 1367
46 Ga0070710_10010324 3300005437 Bacteria 4585
47 Ga0070701_10038979 3300005438 Bacteria 2408
48 Ga0070711_100030051 3300005439 Bacteria 3593
49 Ga0070711_100170391 3300005439 Bacteria 1659
50 Ga0070705_100042851 3300005440 Bacteria 2590
51 Ga0070705_100233589 3300005440 Bacteria 1281
52 Ga0070694_100069093 3300005444 Bacteria 2429
53 Ga0070708_100140108 3300005445 Bacteria 2242
54 Ga0070708_100236149 3300005445 Bacteria 1716
55 Ga0070678_100008843 3300005456 Bacteria 6059
56 Ga0070678_100124015 3300005456 Bacteria 2042
57 Ga0070678_100358334 3300005456 Bacteria 1256
58 Ga0070706_100001257 3300005467 Bacteria 27123
59 Ga0070706_100002535 3300005467 Bacteria 18359
60 Ga0070706_100081595 3300005467 Bacteria 2995
61 Ga0070706_100145555 3300005467 Bacteria 2213
62 Ga0070707_100000894 3300005468 Bacteria 29609
63 Ga0070707_100085014 3300005468 Bacteria 3057
64 Ga0070698_100000184 3300005471 Bacteria 59150
65 Ga0070698_100004413 3300005471 Bacteria 15458
66 Ga0070698_100052734 3300005471 Bacteria 4136
67 Ga0070698_100082635 3300005471 Bacteria 3204
68 Ga0070698_100150048 3300005471 Bacteria 2279
69 Ga0070699_100003946 3300005518 Bacteria 13108
70 Ga0070699_100056021 3300005518 Bacteria 3413
71 Ga0070699_100064086 3300005518 Bacteria 3188
72 Ga0070679_100059313 3300005530 Bacteria 3814
73 Ga0070684_100001343 3300005535 Bacteria 17625
74 Ga0070684_100017800 3300005535 Bacteria 5839
75 Ga0070697_100005132 3300005536 Bacteria 10054
76 Ga0070697_100005266 3300005536 Bacteria 9930
77 Ga0068853_100040312 3300005539 Bacteria 3984
78 Ga0070672_100015346 3300005543 Bacteria 5453
79 Ga0070672_100037176 3300005543 Bacteria 3713
80 Ga0070672_100266043 3300005543 Bacteria 1447
81 Ga0070686_100044824 3300005544 Bacteria 2783
82 Ga0070696_100122438 3300005546 Bacteria 1884
83 Ga0070696_100127814 3300005546 Bacteria 1846
84 Ga0070693_100130154 3300005547 Bacteria 1572
85 Ga0070665_100018756 3300005548 Bacteria 6936
86 Ga0070665_100200703 3300005548 Bacteria 1995
87 Ga0070704_100041606 3300005549 Bacteria 3173
88 Ga0068855_100180773 3300005563 Bacteria 2384
89 Ga0068855_100341268 3300005563 Bacteria 1651
90 Ga0070664_100009003 3300005564 Bacteria 8098
91 Ga0070664_100071054 3300005564 Bacteria 2982
92 Ga0068857_100060931 3300005577 Bacteria 3352
93 Ga0068857_100182360 3300005577 Bacteria 1910
94 Ga0068854_100000811 3300005578 Bacteria 18633
95 Ga0068856_100002001 3300005614 Bacteria 21258
96 Ga0068852_100059006 3300005616 Bacteria 3326
97 Ga0068852_100169442 3300005616 Bacteria 2046
98 Ga0068852_100296397 3300005616 Bacteria 1564
99 Ga0068859_100009071 3300005617 Bacteria 10045
100 Ga0068859_100026232 3300005617 Bacteria 5843
101 Ga0068859_100031928 3300005617 Bacteria 5290
102 Ga0068859_100037140 3300005617 Bacteria 4889
103 Ga0068864_100000454 3300005618 Bacteria 35430
104 Ga0068864_100007705 3300005618 Bacteria 8868
105 Ga0068864_100027866 3300005618 Bacteria 4774
106 Ga0068864_100094021 3300005618 Bacteria 2649
107 Ga0068864_100097581 3300005618 Bacteria 2602
108 Ga0068864_100147429 3300005618 Bacteria 2129
109 Ga0068866_10005950 3300005718 Bacteria 5072
110 Ga0068861_100000999 3300005719 Bacteria 17236
111 Ga0068851_10097773 3300005834 Bacteria 1554
112 Ga0068863_100006585 3300005841 Bacteria 11398
113 Ga0068863_100015249 3300005841 Bacteria 7386
114 Ga0068863_100017884 3300005841 Bacteria 6783
115 Ga0068863_100022286 3300005841 Bacteria 6047
116 Ga0068863_100035396 3300005841 Bacteria 4756
117 Ga0068863_100058924 3300005841 Bacteria 3633
118 Ga0068863_100133724 3300005841 Bacteria 2369
119 Ga0068863_100195689 3300005841 Bacteria 1943
120 Ga0068858_100006836 3300005842 Bacteria 11094
121 Ga0068858_100016977 3300005842 Bacteria 6834
122 Ga0068858_100024873 3300005842 Bacteria 5575
123 Ga0068858_100069538 3300005842 Bacteria 3264
124 Ga0068858_100143421 3300005842 Bacteria 2243
125 Ga0068858_100201339 3300005842 Bacteria 1883
126 Ga0068860_100034823 3300005843 Bacteria 4831
127 Ga0068860_100043091 3300005843 Bacteria 4307
128 Ga0068860_100058487 3300005843 Bacteria 3664
129 Ga0068862_100005314 3300005844 Bacteria 10787
130 Ga0081455_10003202 3300005937 Bacteria 18959
131 Ga0081540_1048859 3300005983 Bacteria 2115
132 Ga0081539_10008545 3300005985 Bacteria 8867
133 Ga0075363_100121062 3300006048 Bacteria 1462
134 Ga0075364_10019238 3300006051 Bacteria 4284
135 Ga0075364_10070891 3300006051 Bacteria 2295
136 Ga0075364_10088545 3300006051 Bacteria 2053
137 Ga0070715_10009397 3300006163 Bacteria 3445
138 Ga0070716_100013161 3300006173 Bacteria 4212
139 Ga0070716_100038886 3300006173 Bacteria 2637
140 Ga0070716_100079043 3300006173 Bacteria 1958
141 Ga0070712_100012125 3300006175 Bacteria 5477
142 Ga0070712_100025793 3300006175 Bacteria 3910
143 Ga0070712_100048686 3300006175 Bacteria 2939
144 Ga0070712_100104622 3300006175 Bacteria 2101
145 Ga0075362_10007555 3300006177 Bacteria 4123
146 Ga0075362_10086060 3300006177 Bacteria 1454
147 Ga0075367_10003884 3300006178 Bacteria 7204
148 Ga0075367_10039449 3300006178 Bacteria 2753
149 Ga0075369_10004717 3300006186 Bacteria 5057
150 Ga0075369_10006202 3300006186 Bacteria 4515
151 Ga0075369_10006503 3300006186 Bacteria 4418
152 Ga0075366_10014391 3300006195 Bacteria 4517
153 Ga0075366_10084976 3300006195 Bacteria 1892
154 Ga0097621_100046220 3300006237 Bacteria 3521
155 Ga0097621_100068809 3300006237 Bacteria 2921
156 Ga0097621_100287769 3300006237 Bacteria 1448
157 Ga0075370_10000095 3300006353 Bacteria 27417
158 Ga0075370_10000217 3300006353 Bacteria 20447
159 Ga0075370_10059631 3300006353 Bacteria 2172
160 Ga0068871_100027149 3300006358 Bacteria 4474
161 Ga0068871_100070561 3300006358 Bacteria 2871
162 Ga0075428_100006684 3300006844 Bacteria 12828
163 Ga0075428_100006866 3300006844 Bacteria 12647
164 Ga0075430_100001621 3300006846 Bacteria 18391
165 Ga0075430_100034817 3300006846 Bacteria 4275
166 Ga0075430_100036653 3300006846 Bacteria 4158
167 Ga0075430_100051641 3300006846 Bacteria 3465
168 Ga0075430_100060607 3300006846 Bacteria 3180
169 Ga0075430_100124382 3300006846 Bacteria 2150
170 Ga0075431_100001412 3300006847 Bacteria 22043
171 Ga0075431_100004791 3300006847 Bacteria 13309
172 Ga0075431_100012454 3300006847 Bacteria 8585
173 Ga0075431_100022895 3300006847 Bacteria 6387
174 Ga0075431_100036103 3300006847 Bacteria 5091
175 Ga0075431_100044859 3300006847 Bacteria 4559
176 Ga0075433_10279863 3300006852 Bacteria 1478
177 Ga0075434_100000169 3300006871 Bacteria 41864
178 Ga0075434_100154873 3300006871 Bacteria 2311
179 Ga0075434_100292146 3300006871 Bacteria 1650
180 Ga0075429_100003183 3300006880 Bacteria 13955
181 Ga0075429_100011021 3300006880 Bacteria 7822
182 Ga0075429_100021021 3300006880 Bacteria 5662
183 Ga0075429_100021207 3300006880 Bacteria 5633
184 Ga0075429_100055692 3300006880 Bacteria 3441
185 Ga0075429_100262313 3300006880 Bacteria 1513
186 Ga0075436_100001151 3300006914 Bacteria 17888
187 Ga0075436_100005331 3300006914 Bacteria 8843
188 Ga0075436_100017896 3300006914 Bacteria 4852
189 Ga0075436_100128363 3300006914 Bacteria 1777
190 Ga0097620_100009071 3300006931 Bacteria 10045
191 Ga0097620_100026232 3300006931 Bacteria 5843
192 Ga0097620_100031930 3300006931 Bacteria 5290
193 Ga0097620_100037141 3300006931 Bacteria 4889
194 Ga0075435_100047868 3300007076 Bacteria 3433
195 Ga0075435_100084665 3300007076 Bacteria 2609
196 Ga0075435_100107345 3300007076 Bacteria 2319
197 Ga0075435_100123978 3300007076 Bacteria 2158
198 Ga0099794_10047087 3300007265 Bacteria 2067
199 Ga0105240_10005185 3300009093 Bacteria 19495
200 Ga0105240_10072097 3300009093 Bacteria 4270
201 Ga0111539_10004683 3300009094 Bacteria 17879
202 Ga0111539_10007501 3300009094 Bacteria 13961
203 Ga0111539_10026978 3300009094 Bacteria 7016
204 Ga0111539_10061639 3300009094 Bacteria 4443
205 Ga0111539_10189021 3300009094 Bacteria 2404
206 Ga0114129_10002520 3300009147 Bacteria 25430
207 Ga0114129_10011944 3300009147 Bacteria 12350
208 Ga0114129_10101509 3300009147 Bacteria 3980
209 Ga0114129_10218778 3300009147 Bacteria 2571
210 Ga0114129_10689061 3300009147 Bacteria 1314
211 Ga0105243_10049333 3300009148 Bacteria 3321
212 Ga0105243_10150858 3300009148 Bacteria 1994
213 Ga0105241_10030868 3300009174 Bacteria 4008
214 Ga0105241_10170098 3300009174 Bacteria 1799
215 Ga0105242_10000556 3300009176 Bacteria 29534
216 Ga0105242_10013676 3300009176 Bacteria 6277
217 Ga0105242_10032170 3300009176 Bacteria 4193
218 Ga0105242_10429715 3300009176 Bacteria 1240
219 Ga0105248_10004265 3300009177 Bacteria 15822
220 Ga0105248_10021930 3300009177 Bacteria 7078
221 Ga0105248_10057746 3300009177 Bacteria 4356
222 Ga0105237_10067738 3300009545 Bacteria 3564
223 Ga0105238_10109045 3300009551 Bacteria 2750
224 Ga0105238_10150330 3300009551 Bacteria 2304
225 Ga0105238_10323716 3300009551 Bacteria 1528
226 Ga0105249_10032592 3300009553 Bacteria 4715
227 Ga0105249_10268067 3300009553 Bacteria 1700
228 Ga0105249_10318352 3300009553 Bacteria 1566
229 Ga0099796_10004563 3300010159 Bacteria 3368
230 Ga0105239_10068834 3300010375 Bacteria 3890
231 Ga0105246_10031036 3300011119 Bacteria 3534
232 Ga0157371_10053128 3300013102 Bacteria 2877
233 Ga0157369_10004712 3300013105 Bacteria 16035
234 Ga0157369_10081506 3300013105 Bacteria 3463
235 Ga0157374_10080020 3300013296 Bacteria 3098
236 Ga0157374_10193419 3300013296 Bacteria 1990
237 Ga0157378_10045534 3300013297 Bacteria 3898
238 Ga0163162_10070559 3300013306 Bacteria 3545
239 Ga0163162_10070988 3300013306 Bacteria 3535
240 Ga0163162_10079555 3300013306 Bacteria 3344
241 Ga0157372_10078996 3300013307 Bacteria 3719
242 Ga0157375_10013194 3300013308 Bacteria 7346
243 Ga0157375_10059690 3300013308 Bacteria 3780
244 Ga0157375_10201206 3300013308 Bacteria 2148
245 Ga0157375_10701421 3300013308 Bacteria 1166
246 Ga0163163_10003827 3300014325 Bacteria 12814
247 Ga0163163_10005343 3300014325 Bacteria 11091
248 Ga0163163_10027044 3300014325 Bacteria 5490
249 Ga0163163_10053206 3300014325 Bacteria 3996
250 Ga0157380_10036512 3300014326 Bacteria 3802
251 Ga0182008_10124102 3300014497 Bacteria 1285
252 Ga0157379_10019806 3300014968 Bacteria 5947
253 Ga0157379_10050438 3300014968 Bacteria 3715
254 Ga0157376_10008551 3300014969 Bacteria 7394
255 Ga0157376_10086833 3300014969 Bacteria 2698
256 Ga0157376_10155165 3300014969 Bacteria 2069
257 Ga0163161_10012730 3300017792 Bacteria 5843
258 Ga0206356_10062693 3300020070 Bacteria 3078
259 Ga0206354_10232206 3300020081 Bacteria 1507
260 Ga0213872_10003092 3300021361 Bacteria 9370
261 Ga0213872_10006459 3300021361 Bacteria 5875
262 Ga0213872_10010099 3300021361 Bacteria 4502
263 Ga0213872_10031585 3300021361 Bacteria 2427
264 Ga0213875_10053763 3300021388 Bacteria 1886
265 Ga0224712_10034708 3300022467 Bacteria 1857
266 Ga0209051_1007653 3300025303 Bacteria 5872
267 Ga0207697_10093198 3300025315 Bacteria 1278
268 Ga0207656_10017568 3300025321 Bacteria 2804
269 Ga0207692_10000821 3300025898 Bacteria 11129
270 Ga0207642_10022428 3300025899 Bacteria 2504
271 Ga0207710_10067668 3300025900 Bacteria 1632
272 Ga0207680_10034895 3300025903 Bacteria 2882
273 Ga0207680_10061511 3300025903 Bacteria 2290
274 Ga0207647_10017480 3300025904 Bacteria 4875
275 Ga0207699_10000151 3300025906 Bacteria 44631
276 Ga0207699_10011935 3300025906 Bacteria 4404
277 Ga0207699_10131904 3300025906 Bacteria 1631
278 Ga0207645_10001558 3300025907 Bacteria 18754
279 Ga0207645_10083453 3300025907 Bacteria 2049
280 Ga0207643_10018803 3300025908 Bacteria 3784
281 Ga0207705_10030469 3300025909 Bacteria 3850
282 Ga0207705_10168879 3300025909 Bacteria 1646
283 Ga0207684_10000134 3300025910 Bacteria 133720
284 Ga0207684_10000153 3300025910 Bacteria 120731
285 Ga0207684_10005110 3300025910 Bacteria 12227
286 Ga0207684_10025168 3300025910 Bacteria 5073
287 Ga0207684_10060147 3300025910 Bacteria 3227
288 Ga0207684_10133160 3300025910 Bacteria 2134
289 Ga0207684_10163487 3300025910 Bacteria 1917
290 Ga0207695_10003421 3300025913 Bacteria 22392
291 Ga0207671_10087941 3300025914 Bacteria 2337
292 Ga0207693_10000339 3300025915 Bacteria 43073
293 Ga0207693_10005268 3300025915 Bacteria 10817
294 Ga0207693_10008424 3300025915 Bacteria 8435
295 Ga0207693_10077500 3300025915 Bacteria 2603
296 Ga0207693_10102696 3300025915 Bacteria 2242
297 Ga0207663_10008722 3300025916 Bacteria 5323
298 Ga0207649_10135705 3300025920 Bacteria 1677
299 Ga0207652_10037227 3300025921 Bacteria 4118
300 Ga0207652_10055534 3300025921 Bacteria 3407
301 Ga0207646_10031090 3300025922 Bacteria 4835
302 Ga0207646_10046974 3300025922 Bacteria 3873
303 Ga0207646_10210693 3300025922 Bacteria 1755
304 Ga0207646_10263531 3300025922 Bacteria 1557
305 Ga0207646_10274886 3300025922 Bacteria 1522
306 Ga0207681_10032686 3300025923 Bacteria 3407
307 Ga0207694_10084709 3300025924 Bacteria 2493
308 Ga0207650_10009835 3300025925 Bacteria 6543
309 Ga0207650_10164840 3300025925 Bacteria 1758
310 Ga0207659_10009066 3300025926 Bacteria 6207
311 Ga0207659_10033180 3300025926 Bacteria 3551
312 Ga0207659_10063037 3300025926 Bacteria 2678
313 Ga0207659_10068924 3300025926 Bacteria 2574
314 Ga0207659_10128564 3300025926 Bacteria 1952
315 Ga0207700_10036243 3300025928 Bacteria 3560
316 Ga0207700_10207154 3300025928 Bacteria 1656
317 Ga0207664_10030030 3300025929 Bacteria 4148
318 Ga0207644_10002988 3300025931 Bacteria 10877
319 Ga0207644_10118587 3300025931 Bacteria 2011
320 Ga0207644_10167608 3300025931 Bacteria 1712
321 Ga0207706_10059836 3300025933 Bacteria 3354
322 Ga0207686_10012098 3300025934 Bacteria 4741
323 Ga0207686_10070681 3300025934 Bacteria 2244
324 Ga0207709_10001097 3300025935 Bacteria 19856
325 Ga0207709_10082455 3300025935 Bacteria 2077
326 Ga0207670_10033137 3300025936 Bacteria 3327
327 Ga0207669_10022364 3300025937 Bacteria 3358
328 Ga0207669_10028685 3300025937 Bacteria 3065
329 Ga0207704_10017772 3300025938 Bacteria 3696
330 Ga0207704_10022467 3300025938 Bacteria 3380
331 Ga0207704_10248962 3300025938 Bacteria 1333
332 Ga0207665_10025087 3300025939 Bacteria 3932
333 Ga0207665_10039861 3300025939 Bacteria 3133
334 Ga0207665_10075120 3300025939 Bacteria 2314
335 Ga0207691_10003386 3300025940 Bacteria 15512
336 Ga0207691_10033473 3300025940 Bacteria 4784
337 Ga0207691_10050596 3300025940 Bacteria 3803
338 Ga0207691_10164614 3300025940 Bacteria 1944
339 Ga0207711_10022199 3300025941 Bacteria 5307
340 Ga0207711_10042672 3300025941 Bacteria 3865
341 Ga0207711_10046873 3300025941 Bacteria 3693
342 Ga0207689_10005582 3300025942 Bacteria 11215
343 Ga0207689_10108736 3300025942 Bacteria 2278
344 Ga0207661_10003175 3300025944 Bacteria 11398
345 Ga0207661_10022528 3300025944 Bacteria 4746
346 Ga0207667_10040008 3300025949 Bacteria 4992
347 Ga0207651_10245389 3300025960 Bacteria 1462
348 Ga0207712_10004066 3300025961 Bacteria 9233
349 Ga0207712_10058347 3300025961 Bacteria 2727
350 Ga0207712_10256241 3300025961 Bacteria 1417
351 Ga0207668_10038600 3300025972 Bacteria 3207
352 Ga0207668_10075469 3300025972 Bacteria 2424
353 Ga0207668_10196507 3300025972 Bacteria 1603
354 Ga0207640_10042307 3300025981 Bacteria 2904
355 Ga0207658_10016527 3300025986 Bacteria 5077
356 Ga0207658_10047951 3300025986 Bacteria 3129
357 Ga0207658_10069955 3300025986 Bacteria 2654
358 Ga0207677_10019840 3300026023 Bacteria 4069
359 Ga0207677_10114545 3300026023 Bacteria 2015
360 Ga0207703_10002940 3300026035 Bacteria 14483
361 Ga0207703_10007109 3300026035 Bacteria 8907
362 Ga0207703_10017641 3300026035 Bacteria 5572
363 Ga0207703_10031865 3300026035 Bacteria 4171
364 Ga0207703_10086518 3300026035 Bacteria 2626
365 Ga0207703_10210043 3300026035 Bacteria 1735
366 Ga0207639_10130399 3300026041 Bacteria 2080
367 Ga0207678_10145263 3300026067 Bacteria 2025
368 Ga0207708_10176533 3300026075 Bacteria 1694
369 Ga0207708_10182595 3300026075 Bacteria 1666
370 Ga0207702_10004539 3300026078 Bacteria 12304
371 Ga0207702_10006429 3300026078 Bacteria 10137
372 Ga0207702_10292486 3300026078 Bacteria 1544
373 Ga0207641_10009773 3300026088 Bacteria 7897
374 Ga0207641_10028713 3300026088 Bacteria 4598
375 Ga0207641_10112973 3300026088 Bacteria 2411
376 Ga0207641_10117525 3300026088 Bacteria 2368
377 Ga0207641_10168231 3300026088 Bacteria 1998
378 Ga0207641_10264418 3300026088 Bacteria 1612
379 Ga0207641_10279328 3300026088 Bacteria 1570
380 Ga0207641_10418787 3300026088 Bacteria 1289
381 Ga0207676_10002093 3300026095 Bacteria 14451
382 Ga0207676_10016118 3300026095 Bacteria 5406
383 Ga0207676_10252730 3300026095 Bacteria 1587
384 Ga0207676_10312085 3300026095 Bacteria 1440
385 Ga0207674_10081080 3300026116 Bacteria 3247
386 Ga0207674_10094112 3300026116 Bacteria 2983
387 Ga0207674_10299291 3300026116 Bacteria 1558
388 Ga0207674_10510885 3300026116 Bacteria 1161
389 Ga0207675_100120783 3300026118 Bacteria 2479
390 Ga0207675_100206696 3300026118 Bacteria 1887
391 Ga0207675_100263509 3300026118 Bacteria 1671
392 Ga0207683_10008362 3300026121 Bacteria 8848
393 Ga0207683_10077444 3300026121 Bacteria 2945
394 Ga0207683_10086582 3300026121 Bacteria 2785
395 Ga0207683_10140919 3300026121 Bacteria 2173
396 Ga0207683_10349453 3300026121 Bacteria 1357
397 Ga0207698_10050739 3300026142 Bacteria 3167
398 Ga0207698_10289916 3300026142 Bacteria 1518
399 Ga0207698_10330060 3300026142 Bacteria 1432
400 Ga0209389_1000009 3300027296 Bacteria 226873
401 Ga0209489_100050 3300027361 Bacteria 154669
402 Ga0209700_100016 3300027363 Bacteria 252567
403 Ga0209588_1017423 3300027671 Bacteria 2227
404 Ga0209971_1014086 3300027682 Bacteria 1895
405 Ga0207428_10003201 3300027907 Bacteria 16012
406 Ga0207428_10007187 3300027907 Bacteria 10183
407 Ga0268266_10003141 3300028379 Bacteria 16781
408 Ga0268266_10268139 3300028379 Bacteria 1584
409 Ga0268265_10322968 3300028380 Bacteria 1399
410 Ga0268264_10020456 3300028381 Bacteria 5407
411 Ga0268264_10049630 3300028381 Bacteria 3492
412 Ga0268264_10123801 3300028381 Bacteria 2282
413 Ga0268264_10133742 3300028381 Bacteria 2202
414 Ga0268264_10198865 3300028381 Bacteria 1832
415 Ga0265326_10001417 3300028558 Bacteria 8438
416 Ga0265319_1020910 3300028563 Bacteria 2413
417 Ga0265334_10002860 3300028573 Bacteria 7923
418 Ga0265318_10001480 3300028577 Bacteria 13734
419 Ga0265323_10001736 3300028653 Bacteria 10343
420 Ga0265323_10003438 3300028653 Bacteria 6992
421 Ga0265322_10004818 3300028654 Bacteria 3999
422 Ga0307515_10094760 3300028794 Bacteria 3683
423 Ga0265338_10000109 3300028800 Bacteria 152826
424 Ga0265338_10011920 3300028800 Bacteria 9977
425 Ga0265338_10038273 3300028800 Bacteria 4548
426 Ga0265324_10000433 3300029957 Bacteria 29760
427 Ga0265324_10000439 3300029957 Bacteria 29542
428 Ga0265330_10001505 3300031235 Bacteria 13469
429 Ga0265330_10002670 3300031235 Bacteria 9635
430 Ga0265330_10008907 3300031235 Bacteria 4794
431 Ga0265332_10000083 3300031238 Bacteria 83040
432 Ga0265332_10049485 3300031238 Bacteria 1807
433 Ga0265328_10000106 3300031239 Bacteria 39805
434 Ga0265328_10003916 3300031239 Bacteria 6549
435 Ga0265320_10009006 3300031240 Bacteria 6052
436 Ga0265320_10039726 3300031240 Bacteria 2350
437 Ga0265325_10008650 3300031241 Bacteria 5995
438 Ga0265325_10010738 3300031241 Bacteria 5285
439 Ga0265325_10015153 3300031241 Bacteria 4342
440 Ga0265325_10030002 3300031241 Bacteria 2919
441 Ga0265329_10003360 3300031242 Bacteria 6990
442 Ga0265329_10039753 3300031242 Bacteria 1511
443 Ga0265340_10001827 3300031247 Bacteria 12172
444 Ga0265331_10000093 3300031250 Bacteria 123060
445 Ga0265331_10000636 3300031250 Bacteria 30412
446 Ga0265331_10005379 3300031250 Bacteria 7741
447 Ga0265331_10010080 3300031250 Bacteria 5249
448 Ga0265331_10031913 3300031250 Bacteria 2615
449 Ga0265327_10000988 3300031251 Bacteria 40530
450 Ga0265327_10001720 3300031251 Bacteria 25945
451 Ga0265327_10001881 3300031251 Bacteria 24292
452 Ga0265327_10013236 3300031251 Bacteria 5493
453 Ga0265327_10028521 3300031251 Bacteria 3191
454 Ga0265327_10037426 3300031251 Bacteria 2656
455 Ga0265316_10000508 3300031344 Bacteria 43878
456 Ga0265316_10004367 3300031344 Bacteria 14099
457 Ga0265316_10012659 3300031344 Bacteria 7551
458 Ga0265316_10014135 3300031344 Bacteria 7043
459 Ga0265316_10031788 3300031344 Bacteria 4313
460 Ga0265316_10051541 3300031344 Bacteria 3232
461 Ga0265313_10000061 3300031595 Bacteria 107220
462 Ga0316575_10000910 3300031665 Bacteria 9077
463 Ga0316575_10004040 3300031665 Bacteria 5139
464 Ga0316575_10025877 3300031665 Bacteria 2278
465 Ga0316575_10035570 3300031665 Bacteria 1959
466 Ga0316575_10040223 3300031665 Bacteria 1847
467 Ga0316579_10004781 3300031691 Bacteria 5411
468 Ga0265314_10000136 3300031711 Bacteria 109906
469 Ga0265314_10000447 3300031711 Bacteria 55167
470 Ga0265314_10001998 3300031711 Bacteria 21636
471 Ga0265314_10002346 3300031711 Bacteria 19541
472 Ga0265314_10031660 3300031711 Bacteria 3901
473 Ga0265314_10071918 3300031711 Bacteria 2312
474 Ga0265342_10012919 3300031712 Bacteria 5629
475 Ga0316576_10000185 3300031727 Bacteria 26067
476 Ga0316576_10000775 3300031727 Bacteria 15974
477 Ga0316576_10003197 3300031727 Bacteria 9547
478 Ga0316576_10009926 3300031727 Bacteria 6163
479 Ga0316576_10019045 3300031727 Bacteria 4697
480 Ga0316576_10020319 3300031727 Bacteria 4568
481 Ga0316576_10022521 3300031727 Bacteria 4377
482 Ga0316576_10035413 3300031727 Bacteria 3562
483 Ga0316576_10035928 3300031727 Bacteria 3541
484 Ga0316576_10040935 3300031727 Bacteria 3332
485 Ga0316576_10048043 3300031727 Bacteria 3093
486 Ga0316576_10068814 3300031727 Bacteria 2609
487 Ga0316576_10070115 3300031727 Bacteria 2585
488 Ga0316576_10075746 3300031727 Bacteria 2489
489 Ga0316576_10077327 3300031727 Bacteria 2464
490 Ga0316576_10100367 3300031727 Bacteria 2163
491 Ga0316576_10104085 3300031727 Bacteria 2124
492 Ga0316576_10106068 3300031727 Bacteria 2103
493 Ga0316576_10167757 3300031727 Bacteria 1657
494 Ga0316578_10000009 3300031728 Bacteria 44952
495 Ga0316578_10001054 3300031728 Bacteria 10639
496 Ga0316578_10009518 3300031728 Bacteria 4999
497 Ga0316578_10010545 3300031728 Bacteria 4801
498 Ga0316578_10014151 3300031728 Bacteria 4253
499 Ga0316578_10014267 3300031728 Bacteria 4238
500 Ga0316578_10015033 3300031728 Bacteria 4152
501 Ga0316578_10015408 3300031728 Bacteria 4110
502 Ga0316578_10031100 3300031728 Bacteria 3039
503 Ga0316578_10035608 3300031728 Bacteria 2862
504 Ga0316578_10036047 3300031728 Bacteria 2846
505 Ga0316578_10038031 3300031728 Bacteria 2773
506 Ga0316578_10073172 3300031728 Bacteria 2031
507 Ga0316578_10173251 3300031728 Bacteria 1300
508 Ga0307516_10010810 3300031730 Bacteria 9987
509 Ga0307405_10082564 3300031731 Bacteria 2104
510 Ga0307405_10125312 3300031731 Bacteria 1765
511 Ga0316577_10002145 3300031733 Bacteria 9653
512 Ga0316577_10046875 3300031733 Bacteria 2413
513 Ga0316577_10072529 3300031733 Bacteria 1922
514 Ga0316577_10083601 3300031733 Bacteria 1785
515 Ga0316577_10129019 3300031733 Bacteria 1422
516 Ga0307413_10007356 3300031824 Bacteria 5108
517 Ga0307413_10098219 3300031824 Bacteria 1927
518 Ga0307413_10215345 3300031824 Bacteria 1398
519 Ga0307410_10073541 3300031852 Bacteria 2377
520 Ga0307406_10309963 3300031901 Bacteria 1216
521 Ga0307407_10036396 3300031903 Bacteria 2712
522 Ga0307407_10053359 3300031903 Bacteria 2326
523 Ga0307407_10091684 3300031903 Bacteria 1864
524 Ga0307407_10221988 3300031903 Bacteria 1278
525 Ga0307409_100004292 3300031995 Bacteria 7974
526 Ga0307409_100023190 3300031995 Bacteria 4294
527 Ga0307409_100124196 3300031995 Bacteria 2192
528 Ga0307409_100132326 3300031995 Bacteria 2134
529 Ga0307409_100134882 3300031995 Bacteria 2116
530 Ga0307409_100484803 3300031995 Bacteria 1200
531 Ga0307416_100001236 3300032002 Bacteria 13784
532 Ga0307416_100028930 3300032002 Bacteria 4130
533 Ga0307416_100048452 3300032002 Bacteria 3371
534 Ga0307416_100089060 3300032002 Bacteria 2641
535 Ga0307416_100165575 3300032002 Bacteria 2050
536 Ga0307416_100268724 3300032002 Bacteria 1672
537 Ga0307416_100497365 3300032002 Bacteria 1283
538 Ga0307411_10002945 3300032005 Bacteria 7728
539 Ga0307411_10081513 3300032005 Bacteria 2228
540 Ga0307411_10104615 3300032005 Bacteria 2011
541 Ga0307415_100003696 3300032126 Bacteria 7830
542 Ga0307415_100042383 3300032126 Bacteria 3029
543 Ga0307415_100258218 3300032126 Bacteria 1420
544 Ga0316583_10015714 3300032133 Bacteria 2725
545 Ga0316585_10008848 3300032137 Bacteria 2925
546 Ga0316585_10033923 3300032137 Bacteria 1611
547 Ga0316585_10050710 3300032137 Bacteria 1332
548 Ga0316580_10000523 3300032139 Bacteria 8884
549 Ga0316580_10006681 3300032139 Bacteria 3410
550 Ga0316580_10014380 3300032139 Bacteria 2417
551 Ga0316580_10020582 3300032139 Bacteria 2033
552 Ga0316593_10001400 3300032168 Bacteria 5297
553 Ga0316593_10005726 3300032168 Bacteria 3306
554 Ga0316593_10008151 3300032168 Bacteria 2909
555 Ga0316593_10021162 3300032168 Bacteria 2031
556 Ga0316593_10021597 3300032168 Bacteria 2014
557 Ga0307507_10022327 3300033179 Bacteria 6998
558 Ga0316592_1001415 3300033524 Bacteria 3847
559 Ga0316586_1004449 3300033527 Bacteria 1915
560 Ga0316588_1004450 3300033528 Bacteria 2655
561 Ga0316588_1005395 3300033528 Bacteria 2487
562 Ga0316588_1007960 3300033528 Bacteria 2168
563 Ga0316588_1017806 3300033528 Bacteria 1586
564 Ga0316587_1001928 3300033529 Bacteria 2680
565 Ga0316587_1014958 3300033529 Bacteria 1284
566 Ga0316587_1018704 3300033529 Bacteria 1168
567 Ga0316596_1013240 3300033541 Bacteria 2035
568 Ga0316596_1014493 3300033541 Bacteria 1955
569 Ga0373926_0005213 3300035083 Bacteria 4278
570 Ga0373934_0002111 3300035086 Bacteria 7290
571 Ga0373954_0000284 3300035118 Bacteria 18310
572 Ga0373956_0000996 3300035119 Bacteria 11720
573 Ga0373956_0139692 3300035119 Bacteria 1137
574 Ga0373955_0066479 3300035172 Bacteria 2004
575 Ga0316574_0001201 3300035398 Bacteria 12021
576 Ga0316574_0002122 3300035398 Bacteria 9833
577 Ga0316574_0003293 3300035398 Bacteria 8303
578 Ga0316574_0003902 3300035398 Bacteria 7750
579 Ga0316574_0003963 3300035398 Bacteria 7707
580 Ga0316574_0007850 3300035398 Bacteria 5882
581 Ga0316574_0012529 3300035398 Bacteria 4852
582 Ga0316574_0013379 3300035398 Bacteria 4715
583 Ga0316574_0017743 3300035398 Bacteria 4172
584 Ga0316574_0042760 3300035398 Bacteria 2797
585 Ga0316574_0055240 3300035398 Bacteria 2482
586 Ga0316574_0064009 3300035398 Bacteria 2313
587 Ga0316574_0064475 3300035398 Bacteria 2305
588 Ga0316574_0096268 3300035398 Bacteria 1891
589 Ga0316574_0111736 3300035398 Bacteria 1752
590 Ga0316574_0135563 3300035398 Bacteria 1585
591 Ga0316574_0154653 3300035398 Bacteria 1478
592 Ga0316574_0158357 3300035398 Bacteria 1459
593 Ga0316574_0161734 3300035398 Bacteria 1442
594 Ga0373924_0002671 3300035410 Bacteria 6013
595 Ga0373924_0038118 3300035410 Bacteria 1959
596 Ga0373931_0046143 3300035691 Bacteria 2303
597 Ga0373935_0003679 3300035692 Bacteria 8944
598 Ga0373935_0034934 3300035692 Bacteria 3135
599 Ga0373935_0153412 3300035692 Bacteria 1565
600 Ga0373927_0028535 3300035695 Bacteria 3641
601 Ga0373927_0040395 3300035695 Bacteria 3026
602 Ga0373933_0009642 3300035724 Bacteria 5276
603 Ga0373933_0155183 3300035724 Bacteria 1451
604 Ga0373947_0000740 3300035725 Bacteria 19574
605 Ga0373937_0079023 3300036401 Bacteria 3040
606 Ga0373937_0130992 3300036401 Bacteria 2342
607 Ga0373937_0147931 3300036401 Bacteria 2199
608 Ga0373937_0308532 3300036401 Bacteria 1496
609 Ga0316582_0018517 3300036647 Bacteria 4055
610 Ga0316582_0042542 3300036647 Unclassified 2846
611 Ga0316582_0044199 3300036647 Bacteria 2799
612 Ga0316582_0046563 3300036647 Bacteria 2735
613 Ga0316582_0051069 3300036647 Bacteria 2622
614 Ga0316582_0055054 3300036647 Bacteria 2534
615 Ga0316582_0055368 3300036647 Bacteria 2528
616 Ga0316582_0059869 3300036647 Bacteria 2440
617 Ga0316582_0101088 3300036647 Bacteria 1910
618 Ga0316582_0316630 3300036647 Bacteria 1072
619 Ga0316584_0001897 3300036712 Bacteria 13001
620 Ga0316584_0013099 3300036712 Bacteria 5862
621 Ga0316584_0013283 3300036712 Bacteria 5826
622 Ga0316584_0014220 3300036712 Bacteria 5660
623 Ga0316584_0016020 3300036712 Bacteria 5369
624 Ga0316584_0016776 3300036712 Bacteria 5254
625 Ga0316584_0029909 3300036712 Bacteria 4022
626 Ga0316584_0035379 3300036712 Bacteria 3705
627 Ga0316584_0048622 3300036712 Bacteria 3169
628 Ga0316584_0051912 3300036712 Bacteria 3067
629 Ga0316584_0060909 3300036712 Bacteria 2827
630 Ga0316584_0065573 3300036712 Bacteria 2720
631 Ga0316584_0087928 3300036712 Bacteria 2326
632 Ga0316584_0090466 3300036712 Bacteria 2291
633 Ga0316584_0100478 3300036712 Bacteria 2166
634 Ga0316584_0174556 3300036712 Bacteria 1592
635 Ga0316584_0198278 3300036712 Bacteria 1482
636 Ga0316584_0268650 3300036712 Bacteria 1242
637 Ga0373925_0013087 3300037068 Bacteria 6006
638 Ga0373925_0014962 3300037068 Bacteria 5609
639 Ga0373925_0025412 3300037068 Bacteria 4326
640 Ga0373925_0062685 3300037068 Bacteria 2796
641 Ga0395899_0117861 3300037312 Bacteria 1904
642 Ga0395900_0061724 3300037418 Bacteria 3853
643 Ga0395898_0121693 3300037466 Bacteria 2500
644 Ga0395898_0232976 3300037466 Bacteria 1756
645 Ga0395905_0000090 3300037471 Bacteria 152117
646 Ga0395905_0027816 3300037471 Bacteria 5331
647 Ga0395905_0042860 3300037471 Bacteria 4246
648 Ga0395905_0050933 3300037471 Bacteria 3878
649 Ga0395905_0133205 3300037471 Bacteria 2337
650 Ga0395905_0142817 3300037471 Bacteria 2252
651 Ga0395905_0195530 3300037471 Bacteria 1896
652 Ga0316581_0015139 3300037588 Bacteria 2200
653 Ga0436364_0410612 3300037853 Bacteria 5972
654 Ga0436364_1086943 3300037853 Bacteria 2961
655 Ga0395901_0001398 3300038443 Bacteria 25218
656 Ga0395901_0024823 3300038443 Bacteria 6152
657 Ga0400490_50633 3300038726 Bacteria 48494
658 Ga0400491_16945 3300038727 Bacteria 5211
659 Ga0400488_53777 3300038741 Bacteria 2885
660 Ga0400483_027323 3300039062 Bacteria 4433
661 Ga0400483_061984 3300039062 Bacteria 5747
662 Ga0400483_063435 3300039062 Bacteria 25413
663 Ga0400483_075120 3300039062 Bacteria 14732
664 Ga0400483_142661 3300039062 Bacteria 5275
665 Ga0400483_163069 3300039062 Bacteria 15145
666 Ga0400483_166407 3300039062 Bacteria 1694
667 Ga0400483_189406 3300039062 Bacteria 6677
668 Ga0400483_212256 3300039062 Bacteria 21400
669 Ga0400483_274218 3300039062 Bacteria 4101
670 Ga0400487_18541 3300039110 Bacteria 14059
671 Ga0400487_20179 3300039110 Bacteria 60838
672 Ga0436365_0391497 3300039437 Bacteria 3038
673 Ga0436365_1362540 3300039437 Bacteria 3066
674 Ga0436361_0162216 3300039447 Bacteria 10644
675 Ga0436361_0408050 3300039447 Bacteria 13949
676 Ga0436361_0687968 3300039447 Bacteria 7055
677 Ga0436361_0950210 3300039447 Bacteria 3736
678 Ga0436361_0976615 3300039447 Bacteria 1634
679 Ga0436361_0995760 3300039447 Bacteria 3068
680 Ga0436361_1012027 3300039447 Bacteria 2074
681 Ga0436361_1218959 3300039447 Bacteria 6548
682 Ga0436362_0536411 3300039453 Bacteria 2073
683 Ga0439439_0004069 3300041406 Bacteria 3268
684 Ga0439466_0035089 3300041411 Bacteria 1697
685 Ga0439431_0009831 3300041997 Bacteria 2163
686 Ga0439431_0014286 3300041997 Bacteria 1840
687 Ga0439441_007345 3300042001 Bacteria 1772
688 Ga0439445_0011025 3300042004 Bacteria 2148
689 Ga0439432_009430 3300042006 Bacteria 3404
690 Ga0439449_0002444 3300042007 Bacteria 7263
691 Ga0439462_0015414 3300042015 Bacteria 1970
692 Ga0450906_004112 3300042145 Bacteria 3078
693 Ga0439446_0021158 3300042156 Bacteria 1837
694 Ga0439434_0006109 3300042435 Bacteria 3512
695 Ga0451577_0001417 3300042876 Bacteria 31981
696 Ga0451577_0003021 3300042876 Bacteria 19154
697 Ga0451577_0023295 3300042876 Bacteria 5647
698 Ga0451577_0035928 3300042876 Bacteria 4463
699 Ga0451577_0093041 3300042876 Bacteria 2692
700 Ga0451577_0188976 3300042876 Bacteria 1858
701 Ga0453683_0001483 3300044673 Bacteria 20077
702 Ga0453683_0002876 3300044673 Bacteria 13025
703 Ga0453683_0008630 3300044673 Bacteria 6834
704 Ga0453683_0067817 3300044673 Bacteria 2230
705 Ga0466965_0035114 3300044683 Bacteria 2455
706 Ga0466966_0149487 3300044684 Bacteria 1425
707 Ga0453684_0000006 3300044712 Bacteria 1364191
708 Ga0453684_0000027 3300044712 Bacteria 778857
709 Ga0453684_0000029 3300044712 Bacteria 757969
710 Ga0453684_0000847 3300044712 Bacteria 103142
711 Ga0453684_0000969 3300044712 Bacteria 94503
712 Ga0453684_0002999 3300044712 Bacteria 39284
713 Ga0453684_0009614 3300044712 Bacteria 16861
714 Ga0453684_0016369 3300044712 Bacteria 11604
715 Ga0453684_0020712 3300044712 Bacteria 9896
716 Ga0453684_0054458 3300044712 Bacteria 5210
717 Ga0453684_0080090 3300044712 Bacteria 4080
718 Ga0453684_0082591 3300044712 Bacteria 4002
719 Ga0453684_0085048 3300044712 Bacteria 3932
720 Ga0453684_0154167 3300044712 Bacteria 2726
721 Ga0453684_0273625 3300044712 Bacteria 1928
722 Ga0453684_0344330 3300044712 Bacteria 1682
723 Ga0466957_0045844 3300044842 Bacteria 2652
724 Ga0466960_0023445 3300044901 Bacteria 2771
725 Ga0466960_0049913 3300044901 Bacteria 2016
726 Ga0451576_0000029 3300045051 Bacteria 404449
727 Ga0451576_0000219 3300045051 Bacteria 141949
728 Ga0451576_0000483 3300045051 Bacteria 88050
729 Ga0451576_0002900 3300045051 Bacteria 24470
730 Ga0451576_0004162 3300045051 Bacteria 19049
731 Ga0451576_0004755 3300045051 Bacteria 17429
732 Ga0451576_0005937 3300045051 Bacteria 15127
733 Ga0451576_0021596 3300045051 Bacteria 6995
734 Ga0451576_0038947 3300045051 Bacteria 5031
735 Ga0451576_0040519 3300045051 Bacteria 4929
736 Ga0451576_0101011 3300045051 Bacteria 2999
737 Ga0451576_0139185 3300045051 Bacteria 2532
738 Ga0466967_0326688 3300045976 Bacteria 1480
739 Ga0495592_0082814 3300046454 Bacteria 2318
740 Ga0495590_0001807 3300046457 Bacteria 9062
741 Ga0495641_0016725 3300046461 Bacteria 3853
742 Ga0495651_0003692 3300046462 Bacteria 11727
743 Ga0495580_0000277 3300046472 Bacteria 41482
744 Ga0495580_0022054 3300046472 Bacteria 4692
745 Ga0495662_0005209 3300046476 Bacteria 6518
746 Ga0495608_0011389 3300046511 Bacteria 6189
747 Ga0495608_0021836 3300046511 Bacteria 4390
748 Ga0495608_0147857 3300046511 Bacteria 1498
749 Ga0495618_0048665 3300046514 Bacteria 2676
750 Ga0495628_0013619 3300046516 Bacteria 6837
751 Ga0495663_0029949 3300046525 Bacteria 1610
752 Ga0495666_0120431 3300046526 Bacteria 1229
753 Ga0495665_0014376 3300046531 Bacteria 4270
754 Ga0495586_0011145 3300046535 Bacteria 4777
755 Ga0495621_0010777 3300046539 Bacteria 2809
756 Ga0495597_0041970 3300046542 Bacteria 2041
757 Ga0495667_0002820 3300046559 Bacteria 11609
758 Ga0495656_0000108 3300046615 Bacteria 33050
759 Ga0495634_0134521 3300046642 Bacteria 1573
760 Ga0495635_0033171 3300046663 Bacteria 3581
761 Ga0495657_0002668 3300046675 Bacteria 14912
762 Ga0495657_0089781 3300046675 Bacteria 1973
763 Ga0495646_0095193 3300046680 Bacteria 1714
764 Ga0495647_0003619 3300046681 Bacteria 4958
765 Ga0495647_0010396 3300046681 Bacteria 3168
766 Ga0495647_0070205 3300046681 Bacteria 1401
767 Ga0495658_0048513 3300046683 Bacteria 2394
768 Ga0495658_0193574 3300046683 Bacteria 1265
769 Ga0495600_0133935 3300046809 Bacteria 1610
770 Ga0495604_0100946 3300047317 Bacteria 2120
771 Ga0495636_0089846 3300047318 Bacteria 1332
772 Ga0495687_000500 3300047443 Bacteria 47248
773 Ga0495675_0182716 3300047444 Bacteria 1283
774 Ga0495684_0036162 3300047471 Bacteria 3787
775 Ga0495684_0036614 3300047471 Bacteria 3761
776 Ga0495684_0049532 3300047471 Bacteria 3209
777 Ga0495684_0216699 3300047471 Bacteria 1405
778 Ga0496100_0119016 3300048903 Bacteria 1845
779 Ga0496100_0248520 3300048903 Bacteria 1315
780 Ga0496101_0002757 3300048904 Bacteria 10786
781 Ga0496101_0020182 3300048904 Bacteria 4557
782 Ga0496104_0069539 3300048907 Bacteria 3346
783 Ga0496104_0108391 3300048907 Bacteria 2662
784 Ga0496105_0003923 3300048908 Bacteria 11123
785 Ga0496105_0154328 3300048908 Bacteria 1886
786 Ga0496106_0013966 3300048909 Bacteria 5939
787 Ga0496108_0006306 3300048911 Bacteria 9613
788 Ga0496108_0027054 3300048911 Bacteria 4732
789 Ga0496108_0035004 3300048911 Bacteria 4173
790 Ga0496108_0094726 3300048911 Bacteria 2541
791 Ga0496108_0263247 3300048911 Bacteria 1501
792 Ga0496108_0411674 3300048911 Bacteria 1181
793 Ga0496109_0017015 3300048912 Bacteria 6363
794 Ga0496109_0038622 3300048912 Bacteria 4317
795 Ga0496109_0100982 3300048912 Bacteria 2677
796 Ga0496110_0020809 3300048913 Bacteria 5541
797 Ga0496110_0098626 3300048913 Bacteria 2619
798 Ga0496111_0064345 3300048914 Bacteria 2660
799 Ga0496112_0082650 3300048915 Bacteria 3176
800 Ga0496112_0128530 3300048915 Bacteria 2504
801 Ga0496112_0175868 3300048915 Bacteria 2105
802 Ga0496113_0020502 3300048916 Bacteria 4648
803 Ga0496113_0081507 3300048916 Bacteria 2480
804 Ga0496114_0000953 3300048917 Bacteria 21637
805 Ga0496114_0010629 3300048917 Bacteria 7323
806 Ga0496114_0037383 3300048917 Bacteria 4015
807 Ga0496115_0029355 3300048918 Bacteria 4319
808 Ga0496115_0055372 3300048918 Bacteria 3186
809 Ga0495682_0011325 3300049460 Bacteria 3434
810 Ga0501031_0000192 3300049568 Bacteria 34424
811 Ga0501031_0024609 3300049568 Bacteria 3924
812 Ga0501031_0058405 3300049568 Bacteria 2514
813 Ga0501031_0200781 3300049568 Bacteria 1301
814 Ga0501032_0009318 3300049569 Bacteria 7110
815 Ga0501032_0068724 3300049569 Bacteria 2364
816 Ga0501032_0115477 3300049569 Bacteria 1775
817 Ga0501033_0004357 3300049570 Bacteria 11345
818 Ga0501033_0005975 3300049570 Bacteria 9556
819 Ga0501034_0003674 3300049571 Bacteria 17345
820 Ga0501034_0003691 3300049571 Bacteria 17300
821 Ga0501034_0217159 3300049571 Bacteria 1866
822 Ga0501034_0396322 3300049571 Bacteria 1304
823 Ga0501034_0429352 3300049571 Bacteria 1241
824 Ga0501036_0037673 3300049572 Bacteria 4091
825 Ga0501036_0041567 3300049572 Bacteria 3889
826 Ga0501036_0247043 3300049572 Bacteria 1496
827 Ga0501036_0424112 3300049572 Bacteria 1109
828 Ga0501037_0004553 3300049573 Bacteria 10082
829 Ga0501037_0053143 3300049573 Bacteria 2963
830 Ga0501038_0015594 3300049574 Bacteria 6907
831 Ga0501039_0070352 3300049575 Bacteria 2718
832 Ga0501039_0131586 3300049575 Bacteria 1963
833 Ga0501039_0157073 3300049575 Bacteria 1787
834 Ga0501039_0263343 3300049575 Bacteria 1355
835 Ga0501040_0024604 3300049576 Bacteria 4042
836 Ga0501040_0067360 3300049576 Bacteria 2467
837 Ga0501041_0017992 3300049577 Bacteria 4206
838 Ga0501041_0111194 3300049577 Bacteria 1699
839 Ga0501042_0039246 3300049578 Bacteria 3364
840 Ga0501042_0061024 3300049578 Bacteria 2694
841 Ga0501043_0012886 3300049579 Bacteria 6536
842 Ga0501043_0076676 3300049579 Bacteria 2626
843 Ga0501046_0040269 3300049580 Bacteria 3735
844 Ga0501046_0048623 3300049580 Bacteria 3358
845 Ga0501046_0254064 3300049580 Bacteria 1293
846 Ga0501047_0018444 3300049581 Bacteria 6690
847 Ga0501047_0034783 3300049581 Bacteria 4865
848 Ga0501047_0074774 3300049581 Bacteria 3261
849 Ga0501048_0053638 3300049582 Bacteria 2866
850 Ga0501048_0149792 3300049582 Bacteria 1650
851 Ga0501048_0156413 3300049582 Bacteria 1612
852 Ga0501068_0001460 3300049584 Bacteria 12572
853 Ga0501068_0039776 3300049584 Bacteria 2820
854 Ga0501069_0014398 3300049585 Bacteria 4229
855 Ga0501069_0039046 3300049585 Bacteria 2622
856 Ga0501070_0003217 3300049586 Bacteria 14206
857 Ga0501070_0017006 3300049586 Bacteria 6102
858 Ga0501070_0046091 3300049586 Bacteria 3625
859 Ga0501071_0047415 3300049587 Bacteria 3087
860 Ga0501071_0098342 3300049587 Bacteria 2155
861 Ga0501072_0015168 3300049588 Bacteria 5908
862 Ga0501072_0188160 3300049588 Bacteria 1647
863 Ga0501073_0007822 3300049589 Bacteria 7937
864 Ga0501073_0010531 3300049589 Bacteria 6772
865 Ga0501073_0054843 3300049589 Bacteria 2790
866 Ga0501074_0013206 3300049590 Bacteria 6006
867 Ga0501074_0052250 3300049590 Bacteria 2950
868 Ga0501074_0063148 3300049590 Bacteria 2668
869 Ga0501074_0098935 3300049590 Bacteria 2088
870 Ga0501075_0038883 3300049591 Bacteria 3558
871 Ga0501076_0004696 3300049592 Bacteria 9744
872 Ga0501076_0011413 3300049592 Bacteria 6616
873 Ga0501076_0124670 3300049592 Bacteria 2087
874 Ga0501076_0128297 3300049592 Bacteria 2056
875 Ga0501077_0017709 3300049593 Bacteria 4500
876 Ga0501217_000641 3300049661 Bacteria 5900
877 Ga0501227_000165 3300049665 Bacteria 12660
878 Ga0501079_0020121 3300049741 Bacteria 5100
879 Ga0501079_0037957 3300049741 Bacteria 3715
880 Ga0501079_0040238 3300049741 Bacteria 3605
881 Ga0501079_0104952 3300049741 Bacteria 2192
882 Ga0501080_0000758 3300049742 Bacteria 26165
883 Ga0501080_0002718 3300049742 Bacteria 15506
884 Ga0501080_0011298 3300049742 Bacteria 8172
885 Ga0501080_0161903 3300049742 Bacteria 2066
886 Ga0501081_0034320 3300049743 Bacteria 3451
887 Ga0501083_0005573 3300049744 Bacteria 8919
888 Ga0501083_0063940 3300049744 Bacteria 2453
889 Ga0501035_0007596 3300049822 Bacteria 10128
890 Ga0501035_0017135 3300049822 Bacteria 6675
891 Ga0501035_0017319 3300049822 Bacteria 6645
892 Ga0501044_0000176 3300049823 Bacteria 79132
893 Ga0501044_0004147 3300049823 Bacteria 16277
894 Ga0501044_0411864 3300049823 Bacteria 1263
895 Ga0501045_0013593 3300049824 Bacteria 5752
896 nmdc:mga03683_65265_c1 3300050489 Bacteria 1546
897 nmdc:mga03683_8691_c1 3300050489 Bacteria 3580
898 nmdc:mga00v17_115499_c1 3300050491 Bacteria 1706
899 nmdc:mga00v17_24569_c1 3300050491 Bacteria 3496
900 nmdc:mga00v17_28697_c1 3300050491 Bacteria 3261
901 nmdc:mga00v17_35818_c1 3300050491 Bacteria 2956
902 nmdc:mga0yw44_26981_c1 3300050492 Bacteria 3285
903 nmdc:mga0k408_142757_c1 3300050493 Bacteria 1425
904 nmdc:mga0k408_20984_c1 3300050493 Bacteria 3666
905 nmdc:mga06z11_32407_c1 3300050494 Bacteria 2548
906 nmdc:mga07m45_13215_c1 3300050496 Bacteria 4376
907 nmdc:mga07m45_197_c1 3300050496 Bacteria 23906
908 nmdc:mga07m45_750_c1 3300050496 Bacteria 13883
909 nmdc:mga07m45_8392_c1 3300050496 Bacteria 5308
910 nmdc:mga05p37_22826_c1 3300050507 Bacteria 7588
911 nmdc:mga05p37_33910_c1 3300050507 Bacteria 3077
912 nmdc:mga05p37_43553_c1 3300050507 Bacteria 5522
913 nmdc:mga05p37_86_c1 3300050507 Bacteria 81974
914 nmdc:mga09592_12091_c1 3300050508 Bacteria 7025
915 nmdc:mga09592_160573_c1 3300050508 Bacteria 1941
916 nmdc:mga09592_25_c1 3300050508 Bacteria 44492
917 nmdc:mga09592_36377_c1 3300050508 Bacteria 4123
918 nmdc:mga09592_4214_c1 3300050508 Bacteria 11615
919 nmdc:mga09592_4372_c1 3300050508 Bacteria 11425
920 nmdc:mga09592_92882_c1 3300050508 Bacteria 2579
921 nmdc:mga0qj67_164_c1 3300050509 Bacteria 44665
922 nmdc:mga0qj67_33698_c1 3300050509 Bacteria 3997
923 nmdc:mga0qj67_46733_c1 3300050509 Bacteria 3418
924 nmdc:mga0qj67_58216_c1 3300050509 Bacteria 3064
925 nmdc:mga06r32_15043_c1 3300050510 Bacteria 7025
926 nmdc:mga06r32_19661_c1 3300050510 Bacteria 6203
927 nmdc:mga06r32_21156_c1 3300050510 Bacteria 6003
928 nmdc:mga06r32_281_c1 3300050510 Bacteria 42391
929 nmdc:mga06r32_35827_c1 3300050510 Bacteria 4683
930 nmdc:mga06r32_65612_c1 3300050510 Bacteria 3502
931 nmdc:mga08y16_148070_c1 3300050511 Bacteria 2440
932 nmdc:mga08y16_18553_c1 3300050511 Bacteria 7330
933 nmdc:mga08y16_224_c1 3300050511 Bacteria 50738
934 nmdc:mga08y16_310337_c1 3300050511 Bacteria 1624
935 nmdc:mga08y16_63609_c1 3300050511 Bacteria 3853
936 nmdc:mga08y16_8480_c1 3300050511 Bacteria 10765
937 nmdc:mga0n895_282058_c1 3300050512 Bacteria 1684
938 nmdc:mga0n895_359974_c1 3300050512 Bacteria 1473
939 nmdc:mga0n895_953_c1 3300050512 Bacteria 20945
940 nmdc:mga0rr50_1829_c1 3300050513 Bacteria 11766
941 nmdc:mga0rr50_242298_c1 3300050513 Bacteria 1495
942 nmdc:mga08x19_1633_c1 3300050514 Bacteria 13880
943 nmdc:mga08x19_19247_c1 3300050514 Bacteria 4187
944 nmdc:mga08x19_5264_c1 3300050514 Bacteria 7656
945 nmdc:mga0a205_119779_c1 3300050515 Bacteria 2531
946 nmdc:mga0a205_2323_c1 3300050515 Bacteria 16775
947 nmdc:mga0sz30_5227_c1 3300050516 Bacteria 4750
948 Ga0495601_0004731 3300053077 Bacteria 7891
949 Ga0495601_0026304 3300053077 Bacteria 3592
950 Ga0495601_0129279 3300053077 Bacteria 1644
951 Ga0500610_0105139 3300053079 Bacteria 1457
952 Ga0495595_0012737 3300053084 Bacteria 3542
953 Ga0495619_0011047 3300053085 Bacteria 5680
954 Ga0495619_0039034 3300053085 Bacteria 3099
955 Ga0495619_0059212 3300053085 Bacteria 2544
956 Ga0500583_0035724 3300053092 Bacteria 2220
957 Ga0500617_057641 3300053124 Bacteria 1724
958 Ga0500568_0016243 3300053139 Bacteria 3315
959 Ga0500622_0001264 3300053156 Bacteria 20628
960 Ga0500622_0004749 3300053156 Bacteria 8372
961 Ga0500637_0010271 3300053178 Bacteria 4796
962 Ga0501084_0158522 3300054114 Bacteria 1909
963 Ga0501082_0016725 3300060353 Bacteria 6317
964 Ga0501082_0085013 3300060353 Bacteria 2728
965 Ga0501082_0469107 3300060353 Bacteria 1100
966 Ga0530510_0005818 3300061734 Bacteria 8542
967 Ga0530510_0019992 3300061734 Bacteria 4759
968 Ga0530510_0123926 3300061734 Bacteria 1899

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049580 Ga0501046_0254064 Ga0501046_0254064_372_1274 296
2 3300036647 Ga0316582_0316630 Ga0316582_0316630_14_991 306
3 3300049572 Ga0501036_0424112 Ga0501036_0424112_118_1089 306
4 3300049591 Ga0501075_0038883 Ga0501075_0038883_215_1186 306
5 3300036712 Ga0316584_0174556 Ga0316584_0174556_133_1086 309
6 3300028573 Ga0265334_10002860 Ga0265334_100028607 312
7 3300035724 Ga0373933_0155183 Ga0373933_0155183_436_1419 315
8 3300035119 Ga0373956_0139692 Ga0373956_0139692_26_1000 319
9 3300009093 Ga0105240_10072097 Ga0105240_100720972 320
10 3300009148 Ga0105243_10049333 Ga0105243_100493333 320
11 3300009553 Ga0105249_10032592 Ga0105249_100325924 320
12 3300014326 Ga0157380_10036512 Ga0157380_100365123 320
13 3300014968 Ga0157379_10019806 Ga0157379_100198064 320
14 3300049588 Ga0501072_0015168 Ga0501072_0015168_80_1093 320
15 3300050493 nmdc:mga0k408_20984_c1 nmdc:mga0k408_20984_c1_1977_2969 320
16 3300050496 nmdc:mga07m45_8392_c1 nmdc:mga07m45_8392_c1_2881_3873 320
17 3300009147 Ga0114129_10689061 Ga0114129_106890611 322
18 3300021361 Ga0213872_10006459 Ga0213872_100064595 324
19 3300039447 Ga0436361_0408050 Ga0436361_0408050_7294_8385 324
20 3300026118 Ga0207675_100263509 Ga0207675_1002635092 328
21 3300031727 Ga0316576_10106068 Ga0316576_101060681 328
22 3300031728 Ga0316578_10015033 Ga0316578_100150333 328
23 3300032137 Ga0316585_10050710 Ga0316585_100507101 328
24 3300035398 Ga0316574_0096268 Ga0316574_0096268_857_1843 328
25 3300048903 Ga0496100_0248520 Ga0496100_0248520_46_1032 328
26 3300049584 Ga0501068_0001460 Ga0501068_0001460_4084_5124 328
27 3300013308 Ga0157375_10701421 Ga0157375_107014211 329
28 3300031239 Ga0265328_10003916 Ga0265328_100039166 329
29 3300031242 Ga0265329_10039753 Ga0265329_100397532 329
30 3300031344 Ga0265316_10004367 Ga0265316_100043679 329
31 3300031727 Ga0316576_10003197 Ga0316576_100031974 329
32 3300031728 Ga0316578_10001054 Ga0316578_100010548 329
33 3300036647 Ga0316582_0042542 Ga0316582_0042542_808_1833 329
34 3300036712 Ga0316584_0268650 Ga0316584_0268650_28_1017 329
35 3300049587 Ga0501071_0047415 Ga0501071_0047415_1341_2372 329
36 3300050507 nmdc:mga05p37_33910_c1 nmdc:mga05p37_33910_c1_54_1067 329
37 3300050508 nmdc:mga09592_12091_c1 nmdc:mga09592_12091_c1_2799_3812 329
38 3300050508 nmdc:mga09592_36377_c1 nmdc:mga09592_36377_c1_74_1081 329
39 3300050509 nmdc:mga0qj67_58216_c1 nmdc:mga0qj67_58216_c1_1493_2506 329
40 3300050510 nmdc:mga06r32_19661_c1 nmdc:mga06r32_19661_c1_1444_2469 329
41 3300050510 nmdc:mga06r32_35827_c1 nmdc:mga06r32_35827_c1_1488_2501 329
42 3300053079 Ga0500610_0105139 Ga0500610_0105139_126_1133 329
43 3300053124 Ga0500617_057641 Ga0500617_057641_115_1122 329
44 3300053139 Ga0500568_0016243 Ga0500568_0016243_751_1749 329
45 3300053156 Ga0500622_0001264 Ga0500622_0001264_16720_17709 329
46 3300053156 Ga0500622_0004749 Ga0500622_0004749_5794_6792 329
47 3300053178 Ga0500637_0010271 Ga0500637_0010271_3740_4732 329
48 3300054114 Ga0501084_0158522 Ga0501084_0158522_835_1833 329
49 3300060353 Ga0501082_0469107 Ga0501082_0469107_17_1048 329
50 3300031240 Ga0265320_10039726 Ga0265320_100397262 330
51 3300039110 Ga0400487_18541 Ga0400487_18541_4934_5956 330
52 3300005327 Ga0070658_10197034 Ga0070658_101970341 332
53 3300025909 Ga0207705_10168879 Ga0207705_101688791 332
54 3300045051 Ga0451576_0040519 Ga0451576_0040519_3007_4095 332
55 3300049575 Ga0501039_0263343 Ga0501039_0263343_188_1285 332
56 3300049592 Ga0501076_0128297 Ga0501076_0128297_54_1151 332
57 3300006195 Ga0075366_10084976 Ga0075366_100849763 333
58 3300049571 Ga0501034_0003674 Ga0501034_0003674_843_1967 333
59 3300050491 nmdc:mga00v17_24569_c1 nmdc:mga00v17_24569_c1_777_1883 333
60 3300006846 Ga0075430_100051641 Ga0075430_1000516412 334
61 3300006880 Ga0075429_100003183 Ga0075429_1000031839 334
62 3300031733 Ga0316577_10046875 Ga0316577_100468752 334
63 3300036712 Ga0316584_0013283 Ga0316584_0013283_4305_5369 334
64 3300050508 nmdc:mga09592_4372_c1 nmdc:mga09592_4372_c1_4470_5567 334
65 3300005347 Ga0070668_100102974 Ga0070668_1001029742 335
66 3300005578 Ga0068854_100000811 Ga0068854_10000081112 335
67 3300031665 Ga0316575_10035570 Ga0316575_100355702 335
68 3300031727 Ga0316576_10068814 Ga0316576_100688141 335
69 3300031995 Ga0307409_100004292 Ga0307409_1000042924 335
70 3300032002 Ga0307416_100001236 Ga0307416_1000012366 335
71 3300032126 Ga0307415_100003696 Ga0307415_1000036968 335
72 3300038726 Ga0400490_50633 Ga0400490_50633_9368_10456 335
73 3300038727 Ga0400491_16945 Ga0400491_16945_1155_2243 335
74 3300025926 Ga0207659_10068924 Ga0207659_100689242 336
75 3300036401 Ga0373937_0308532 Ga0373937_0308532_421_1485 336
76 3300037471 Ga0395905_0000090 Ga0395905_0000090_123755_124831 336
77 3300049572 Ga0501036_0247043 Ga0501036_0247043_121_1137 336
78 3300049590 Ga0501074_0063148 Ga0501074_0063148_809_1861 336
79 3300049823 Ga0501044_0411864 Ga0501044_0411864_190_1242 336
80 3300050508 nmdc:mga09592_92882_c1 nmdc:mga09592_92882_c1_1538_2566 336
81 3300031250 Ga0265331_10005379 Ga0265331_100053795 337
82 3300031344 Ga0265316_10012659 Ga0265316_100126592 337
83 3300046542 Ga0495597_0041970 Ga0495597_0041970_798_1892 337
84 3300047443 Ga0495687_000500 Ga0495687_000500_22779_23873 337
85 3300049571 Ga0501034_0429352 Ga0501034_0429352_18_1094 337
86 3300009094 Ga0111539_10004683 Ga0111539_100046835 338
87 3300031251 Ga0265327_10001881 Ga0265327_1000188111 338
88 3300031251 Ga0265327_10013236 Ga0265327_100132364 338
89 3300039437 Ga0436365_1362540 Ga0436365_1362540_1284_2336 338
90 3300046539 Ga0495621_0010777 Ga0495621_0010777_504_1532 338
91 3300049590 Ga0501074_0013206 Ga0501074_0013206_2332_3426 338
92 3300049742 Ga0501080_0000758 Ga0501080_0000758_12476_13570 338
93 3300025939 Ga0207665_10075120 Ga0207665_100751202 339
94 3300031251 Ga0265327_10028521 Ga0265327_100285212 339
95 3300031691 Ga0316579_10004781 Ga0316579_100047815 339
96 3300031727 Ga0316576_10040935 Ga0316576_100409353 339
97 3300031727 Ga0316576_10048043 Ga0316576_100480433 339
98 3300031728 Ga0316578_10014267 Ga0316578_100142673 339
99 3300031728 Ga0316578_10035608 Ga0316578_100356081 339
100 3300031728 Ga0316578_10173251 Ga0316578_101732511 339
101 3300031731 Ga0307405_10082564 Ga0307405_100825643 339
102 3300031733 Ga0316577_10002145 Ga0316577_100021454 339
103 3300031733 Ga0316577_10083601 Ga0316577_100836012 339
104 3300032002 Ga0307416_100089060 Ga0307416_1000890602 339
105 3300032133 Ga0316583_10015714 Ga0316583_100157143 339
106 3300032137 Ga0316585_10033923 Ga0316585_100339231 339
107 3300032139 Ga0316580_10000523 Ga0316580_100005234 339
108 3300032139 Ga0316580_10020582 Ga0316580_100205821 339
109 3300035398 Ga0316574_0007850 Ga0316574_0007850_3276_4364 339
110 3300036647 Ga0316582_0051069 Ga0316582_0051069_16_1104 339
111 3300036647 Ga0316582_0055054 Ga0316582_0055054_485_1573 339
112 3300036712 Ga0316584_0001897 Ga0316584_0001897_8560_9648 339
113 3300036712 Ga0316584_0035379 Ga0316584_0035379_857_1945 339
114 3300037588 Ga0316581_0015139 Ga0316581_0015139_1089_2177 339
115 3300049568 Ga0501031_0200781 Ga0501031_0200781_212_1288 339
116 3300005367 Ga0070667_100035568 Ga0070667_1000355683 340
117 3300005841 Ga0068863_100017884 Ga0068863_1000178847 340
118 3300005841 Ga0068863_100058924 Ga0068863_1000589242 340
119 3300009177 Ga0105248_10057746 Ga0105248_100577464 340
120 3300026088 Ga0207641_10112973 Ga0207641_101129732 340
121 3300032168 Ga0316593_10021597 Ga0316593_100215971 340
122 3300036647 Ga0316582_0018517 Ga0316582_0018517_2173_3285 340
123 3300038741 Ga0400488_53777 Ga0400488_53777_53_1135 340
124 3300039062 Ga0400483_027323 Ga0400483_027323_2629_3711 340
125 3300039062 Ga0400483_166407 Ga0400483_166407_148_1230 340
126 3300006353 Ga0075370_10000095 Ga0075370_100000954 341
127 3300025960 Ga0207651_10245389 Ga0207651_102453892 341
128 3300036401 Ga0373937_0130992 Ga0373937_0130992_529_1650 341
129 3300046663 Ga0495635_0033171 Ga0495635_0033171_1281_2402 341
130 3300046680 Ga0495646_0095193 Ga0495646_0095193_322_1443 341
131 3300046809 Ga0495600_0133935 Ga0495600_0133935_382_1503 341
132 3300047471 Ga0495684_0049532 Ga0495684_0049532_25_1146 341
133 3300048917 Ga0496114_0037383 Ga0496114_0037383_1514_2620 341
134 3300050496 nmdc:mga07m45_750_c1 nmdc:mga07m45_750_c1_11077_12180 341
135 3300053085 Ga0495619_0011047 Ga0495619_0011047_966_2087 341
136 3300009093 Ga0105240_10005185 Ga0105240_100051856 342
137 3300025913 Ga0207695_10003421 Ga0207695_1000342115 342
138 3300042876 Ga0451577_0023295 Ga0451577_0023295_3508_4587 342
139 3300044673 Ga0453683_0001483 Ga0453683_0001483_14355_15434 342
140 3300045051 Ga0451576_0004755 Ga0451576_0004755_1302_2381 342
141 3300049569 Ga0501032_0115477 Ga0501032_0115477_576_1727 342
142 3300049570 Ga0501033_0005975 Ga0501033_0005975_659_1810 342
143 3300049573 Ga0501037_0004553 Ga0501037_0004553_5922_7073 342
144 3300049574 Ga0501038_0015594 Ga0501038_0015594_4521_5672 342
145 3300049579 Ga0501043_0012886 Ga0501043_0012886_660_1811 342
146 3300049581 Ga0501047_0074774 Ga0501047_0074774_850_2001 342
147 3300049589 Ga0501073_0010531 Ga0501073_0010531_617_1768 342
148 3300049741 Ga0501079_0020121 Ga0501079_0020121_1406_2557 342
149 3300049742 Ga0501080_0002718 Ga0501080_0002718_11346_12497 342
150 3300049744 Ga0501083_0063940 Ga0501083_0063940_496_1623 342
151 3300049822 Ga0501035_0017319 Ga0501035_0017319_4860_6011 342
152 3300049823 Ga0501044_0004147 Ga0501044_0004147_829_1980 342
153 3300060353 Ga0501082_0016725 Ga0501082_0016725_3166_4317 342
154 3300005471 Ga0070698_100000184 Ga0070698_10000018433 343
155 3300005543 Ga0070672_100266043 Ga0070672_1002660431 343
156 3300014969 Ga0157376_10008551 Ga0157376_100085514 343
157 3300025972 Ga0207668_10075469 Ga0207668_100754692 343
158 3300031241 Ga0265325_10010738 Ga0265325_100107385 343
159 3300044673 Ga0453683_0067817 Ga0453683_0067817_68_1156 343
160 3300045051 Ga0451576_0000029 Ga0451576_0000029_32681_33769 343
161 3300049585 Ga0501069_0039046 Ga0501069_0039046_670_1752 343
162 3300049586 Ga0501070_0046091 Ga0501070_0046091_1418_2500 343
163 3300049590 Ga0501074_0052250 Ga0501074_0052250_211_1293 343
164 3300031251 Ga0265327_10000988 Ga0265327_100009883 344
165 3300031711 Ga0265314_10001998 Ga0265314_1000199812 344
166 3300036712 Ga0316584_0048622 Ga0316584_0048622_1623_2765 344
167 3300044712 Ga0453684_0009614 Ga0453684_0009614_42_1202 344
168 3300046472 Ga0495580_0022054 Ga0495580_0022054_354_1397 344
169 3300046642 Ga0495634_0134521 Ga0495634_0134521_308_1351 344
170 3300046675 Ga0495657_0089781 Ga0495657_0089781_247_1290 344
171 3300046681 Ga0495647_0003619 Ga0495647_0003619_3869_4912 344
172 3300046683 Ga0495658_0048513 Ga0495658_0048513_520_1563 344
173 3300047318 Ga0495636_0089846 Ga0495636_0089846_20_1063 344
174 3300053085 Ga0495619_0059212 Ga0495619_0059212_1092_2135 344
175 3300005438 Ga0070701_10038979 Ga0070701_100389793 345
176 3300005467 Ga0070706_100001257 Ga0070706_10000125719 345
177 3300005617 Ga0068859_100009071 Ga0068859_1000090719 345
178 3300006931 Ga0097620_100009071 Ga0097620_1000090719 345
179 3300009553 Ga0105249_10318352 Ga0105249_103183523 345
180 3300014325 Ga0163163_10027044 Ga0163163_100270445 345
181 3300025915 Ga0207693_10102696 Ga0207693_101026962 345
182 3300025928 Ga0207700_10207154 Ga0207700_102071542 345
183 3300027682 Ga0209971_1014086 Ga0209971_10140862 345
184 3300029957 Ga0265324_10000439 Ga0265324_1000043925 345
185 3300031250 Ga0265331_10000093 Ga0265331_10000093107 345
186 3300031727 Ga0316576_10035928 Ga0316576_100359283 345
187 3300035692 Ga0373935_0153412 Ga0373935_0153412_401_1444 345
188 3300036712 Ga0316584_0014220 Ga0316584_0014220_332_1444 345
189 3300036712 Ga0316584_0060909 Ga0316584_0060909_467_1531 345
190 3300046683 Ga0495658_0193574 Ga0495658_0193574_110_1231 345
191 3300006051 Ga0075364_10019238 Ga0075364_100192382 346
192 3300025961 Ga0207712_10058347 Ga0207712_100583472 346
193 3300026088 Ga0207641_10418787 Ga0207641_104187871 346
194 3300035398 Ga0316574_0002122 Ga0316574_0002122_2341_3387 346
195 3300044712 Ga0453684_0082591 Ga0453684_0082591_674_1765 346
196 3300045051 Ga0451576_0139185 Ga0451576_0139185_47_1108 346
197 3300050491 nmdc:mga00v17_28697_c1 nmdc:mga00v17_28697_c1_239_1360 346
198 3300053077 Ga0495601_0026304 Ga0495601_0026304_110_1162 346
199 3300014969 Ga0157376_10086833 Ga0157376_100868333 347
200 3300039062 Ga0400483_063435 Ga0400483_063435_7794_8876 347
201 3300005445 Ga0070708_100140108 Ga0070708_1001401081 348
202 3300009094 Ga0111539_10189021 Ga0111539_101890213 348
203 3300028380 Ga0268265_10322968 Ga0268265_103229682 348
204 3300028558 Ga0265326_10001417 Ga0265326_100014172 348
205 3300031247 Ga0265340_10001827 Ga0265340_100018275 348
206 3300037471 Ga0395905_0195530 Ga0395905_0195530_423_1496 348
207 3300046457 Ga0495590_0001807 Ga0495590_0001807_4509_5594 348
208 3300048907 Ga0496104_0108391 Ga0496104_0108391_1078_2136 348
209 3300050511 nmdc:mga08y16_148070_c1 nmdc:mga08y16_148070_c1_768_1832 348
210 3300005548 Ga0070665_100018756 Ga0070665_1000187565 349
211 3300026121 Ga0207683_10008362 Ga0207683_100083629 349
212 3300028379 Ga0268266_10003141 Ga0268266_1000314115 349
213 3300028653 Ga0265323_10003438 Ga0265323_100034386 349
214 3300028800 Ga0265338_10000109 Ga0265338_1000010986 349
215 3300031665 Ga0316575_10004040 Ga0316575_100040402 349
216 3300031727 Ga0316576_10019045 Ga0316576_100190452 349
217 3300048918 Ga0496115_0055372 Ga0496115_0055372_1019_2071 349
218 iso_pu_bacteria 2574179768 2574433167 349
219 iso_pu_bacteria 2891633521 2891634610 349
220 iso_pu_bacteria 639633007 639786823 349
221 3300005330 Ga0070690_100016631 Ga0070690_1000166313 350
222 3300005331 Ga0070670_100103701 Ga0070670_1001037012 350
223 3300005334 Ga0068869_100019821 Ga0068869_1000198212 350
224 3300005335 Ga0070666_10012915 Ga0070666_100129153 350
225 3300005335 Ga0070666_10059296 Ga0070666_100592962 350
226 3300005338 Ga0068868_100037456 Ga0068868_1000374563 350
227 3300005338 Ga0068868_100259904 Ga0068868_1002599041 350
228 3300005340 Ga0070689_100035455 Ga0070689_1000354554 350
229 3300005340 Ga0070689_100114910 Ga0070689_1001149102 350
230 3300005347 Ga0070668_100026038 Ga0070668_1000260384 350
231 3300005354 Ga0070675_100022870 Ga0070675_1000228703 350
232 3300005355 Ga0070671_100004118 Ga0070671_1000041188 350
233 3300005355 Ga0070671_100051657 Ga0070671_1000516572 350
234 3300005356 Ga0070674_100025779 Ga0070674_1000257793 350
235 3300005364 Ga0070673_100001712 Ga0070673_1000017129 350
236 3300005364 Ga0070673_100009342 Ga0070673_1000093425 350
237 3300005367 Ga0070667_100058417 Ga0070667_1000584173 350
238 3300005436 Ga0070713_100352038 Ga0070713_1003520382 350
239 3300005444 Ga0070694_100069093 Ga0070694_1000690932 350
240 3300005445 Ga0070708_100236149 Ga0070708_1002361492 350
241 3300005456 Ga0070678_100124015 Ga0070678_1001240152 350
242 3300005468 Ga0070707_100085014 Ga0070707_1000850141 350
243 3300005471 Ga0070698_100150048 Ga0070698_1001500482 350
244 3300005518 Ga0070699_100003946 Ga0070699_1000039468 350
245 3300005518 Ga0070699_100064086 Ga0070699_1000640862 350
246 3300005543 Ga0070672_100015346 Ga0070672_1000153463 350
247 3300005544 Ga0070686_100044824 Ga0070686_1000448244 350
248 3300005548 Ga0070665_100200703 Ga0070665_1002007032 350
249 3300005563 Ga0068855_100341268 Ga0068855_1003412682 350
250 3300005577 Ga0068857_100060931 Ga0068857_1000609312 350
251 3300005616 Ga0068852_100059006 Ga0068852_1000590062 350
252 3300005617 Ga0068859_100026232 Ga0068859_1000262324 350
253 3300005617 Ga0068859_100031928 Ga0068859_1000319283 350
254 3300005617 Ga0068859_100037140 Ga0068859_1000371404 350
255 3300005618 Ga0068864_100007705 Ga0068864_1000077058 350
256 3300005618 Ga0068864_100027866 Ga0068864_1000278664 350
257 3300005618 Ga0068864_100094021 Ga0068864_1000940212 350
258 3300005618 Ga0068864_100147429 Ga0068864_1001474291 350
259 3300005718 Ga0068866_10005950 Ga0068866_100059503 350
260 3300005841 Ga0068863_100006585 Ga0068863_1000065858 350
261 3300005841 Ga0068863_100015249 Ga0068863_1000152496 350
262 3300005841 Ga0068863_100022286 Ga0068863_1000222865 350
263 3300005841 Ga0068863_100035396 Ga0068863_1000353963 350
264 3300005842 Ga0068858_100024873 Ga0068858_1000248733 350
265 3300005843 Ga0068860_100034823 Ga0068860_1000348232 350
266 3300005843 Ga0068860_100043091 Ga0068860_1000430913 350
267 3300005844 Ga0068862_100005314 Ga0068862_10000531412 350
268 3300006178 Ga0075367_10003884 Ga0075367_100038844 350
269 3300006178 Ga0075367_10039449 Ga0075367_100394493 350
270 3300006195 Ga0075366_10014391 Ga0075366_100143912 350
271 3300006237 Ga0097621_100046220 Ga0097621_1000462204 350
272 3300006237 Ga0097621_100068809 Ga0097621_1000688092 350
273 3300006353 Ga0075370_10059631 Ga0075370_100596312 350
274 3300006358 Ga0068871_100027149 Ga0068871_1000271493 350
275 3300006358 Ga0068871_100070561 Ga0068871_1000705612 350
276 3300006871 Ga0075434_100000169 Ga0075434_1000001694 350
277 3300006871 Ga0075434_100154873 Ga0075434_1001548732 350
278 3300006914 Ga0075436_100001151 Ga0075436_10000115118 350
279 3300006914 Ga0075436_100005331 Ga0075436_1000053311 350
280 3300006914 Ga0075436_100128363 Ga0075436_1001283632 350
281 3300006931 Ga0097620_100026232 Ga0097620_1000262324 350
282 3300006931 Ga0097620_100031930 Ga0097620_1000319303 350
283 3300006931 Ga0097620_100037141 Ga0097620_1000371414 350
284 3300007076 Ga0075435_100084665 Ga0075435_1000846652 350
285 3300007076 Ga0075435_100107345 Ga0075435_1001073452 350
286 3300007076 Ga0075435_100123978 Ga0075435_1001239782 350
287 3300009177 Ga0105248_10004265 Ga0105248_1000426510 350
288 3300013308 Ga0157375_10013194 Ga0157375_100131948 350
289 3300014325 Ga0163163_10005343 Ga0163163_100053433 350
290 3300014325 Ga0163163_10053206 Ga0163163_100532064 350
291 3300025315 Ga0207697_10093198 Ga0207697_100931982 350
292 3300025321 Ga0207656_10017568 Ga0207656_100175683 350
293 3300025899 Ga0207642_10022428 Ga0207642_100224283 350
294 3300025903 Ga0207680_10034895 Ga0207680_100348952 350
295 3300025906 Ga0207699_10131904 Ga0207699_101319041 350
296 3300025907 Ga0207645_10001558 Ga0207645_100015583 350
297 3300025908 Ga0207643_10018803 Ga0207643_100188033 350
298 3300025910 Ga0207684_10005110 Ga0207684_100051106 350
299 3300025910 Ga0207684_10133160 Ga0207684_101331602 350
300 3300025922 Ga0207646_10263531 Ga0207646_102635312 350
301 3300025923 Ga0207681_10032686 Ga0207681_100326863 350
302 3300025925 Ga0207650_10164840 Ga0207650_101648402 350
303 3300025926 Ga0207659_10009066 Ga0207659_100090666 350
304 3300025926 Ga0207659_10063037 Ga0207659_100630372 350
305 3300025931 Ga0207644_10002988 Ga0207644_100029887 350
306 3300025931 Ga0207644_10167608 Ga0207644_101676082 350
307 3300025933 Ga0207706_10059836 Ga0207706_100598363 350
308 3300025935 Ga0207709_10082455 Ga0207709_100824553 350
309 3300025936 Ga0207670_10033137 Ga0207670_100331373 350
310 3300025937 Ga0207669_10022364 Ga0207669_100223643 350
311 3300025937 Ga0207669_10028685 Ga0207669_100286852 350
312 3300025938 Ga0207704_10022467 Ga0207704_100224673 350
313 3300025938 Ga0207704_10248962 Ga0207704_102489621 350
314 3300025940 Ga0207691_10033473 Ga0207691_100334732 350
315 3300025940 Ga0207691_10050596 Ga0207691_100505964 350
316 3300025941 Ga0207711_10042672 Ga0207711_100426723 350
317 3300025941 Ga0207711_10046873 Ga0207711_100468733 350
318 3300025942 Ga0207689_10005582 Ga0207689_1000558212 350
319 3300025942 Ga0207689_10108736 Ga0207689_101087362 350
320 3300025961 Ga0207712_10004066 Ga0207712_100040668 350
321 3300025972 Ga0207668_10038600 Ga0207668_100386003 350
322 3300025986 Ga0207658_10016527 Ga0207658_100165274 350
323 3300025986 Ga0207658_10047951 Ga0207658_100479513 350
324 3300026023 Ga0207677_10114545 Ga0207677_101145452 350
325 3300026035 Ga0207703_10002940 Ga0207703_100029407 350
326 3300026035 Ga0207703_10017641 Ga0207703_100176415 350
327 3300026067 Ga0207678_10145263 Ga0207678_101452631 350
328 3300026075 Ga0207708_10176533 Ga0207708_101765332 350
329 3300026075 Ga0207708_10182595 Ga0207708_101825952 350
330 3300026088 Ga0207641_10009773 Ga0207641_100097735 350
331 3300026088 Ga0207641_10028713 Ga0207641_100287132 350
332 3300026088 Ga0207641_10279328 Ga0207641_102793282 350
333 3300026095 Ga0207676_10016118 Ga0207676_100161184 350
334 3300026095 Ga0207676_10252730 Ga0207676_102527302 350
335 3300026095 Ga0207676_10312085 Ga0207676_103120852 350
336 3300026116 Ga0207674_10081080 Ga0207674_100810802 350
337 3300026118 Ga0207675_100206696 Ga0207675_1002066962 350
338 3300026121 Ga0207683_10077444 Ga0207683_100774442 350
339 3300026121 Ga0207683_10140919 Ga0207683_101409193 350
340 3300026142 Ga0207698_10289916 Ga0207698_102899162 350
341 3300028381 Ga0268264_10020456 Ga0268264_100204565 350
342 3300028381 Ga0268264_10049630 Ga0268264_100496302 350
343 3300028381 Ga0268264_10123801 Ga0268264_101238012 350
344 3300028381 Ga0268264_10133742 Ga0268264_101337421 350
345 3300028800 Ga0265338_10011920 Ga0265338_100119208 350
346 3300031235 Ga0265330_10001505 Ga0265330_100015056 350
347 3300031238 Ga0265332_10049485 Ga0265332_100494852 350
348 3300031241 Ga0265325_10015153 Ga0265325_100151534 350
349 3300031242 Ga0265329_10003360 Ga0265329_100033605 350
350 3300031250 Ga0265331_10000636 Ga0265331_1000063628 350
351 3300031251 Ga0265327_10001720 Ga0265327_100017207 350
352 3300031344 Ga0265316_10014135 Ga0265316_100141355 350
353 3300031711 Ga0265314_10002346 Ga0265314_1000234615 350
354 3300031712 Ga0265342_10012919 Ga0265342_100129196 350
355 3300033179 Ga0307507_10022327 Ga0307507_100223273 350
356 3300037471 Ga0395905_0042860 Ga0395905_0042860_2827_3909 350
357 3300037853 Ga0436364_1086943 Ga0436364_1086943_397_1482 350
358 3300042876 Ga0451577_0035928 Ga0451577_0035928_3337_4428 350
359 3300044673 Ga0453683_0002876 Ga0453683_0002876_6876_7988 350
360 3300044712 Ga0453684_0000006 Ga0453684_0000006_1093014_1094093 350
361 3300044712 Ga0453684_0000969 Ga0453684_0000969_66335_67426 350
362 3300044712 Ga0453684_0080090 Ga0453684_0080090_1932_3044 350
363 3300044712 Ga0453684_0273625 Ga0453684_0273625_297_1388 350
364 3300045051 Ga0451576_0004162 Ga0451576_0004162_1341_2432 350
365 3300045051 Ga0451576_0005937 Ga0451576_0005937_12759_13871 350
366 3300045051 Ga0451576_0021596 Ga0451576_0021596_2903_3994 350
367 3300046476 Ga0495662_0005209 Ga0495662_0005209_5398_6459 350
368 3300046525 Ga0495663_0029949 Ga0495663_0029949_421_1488 350
369 3300046535 Ga0495586_0011145 Ga0495586_0011145_2957_4018 350
370 3300046615 Ga0495656_0000108 Ga0495656_0000108_6472_7539 350
371 3300046681 Ga0495647_0070205 Ga0495647_0070205_80_1141 350
372 3300048916 Ga0496113_0020502 Ga0496113_0020502_2927_4006 350
373 3300049568 Ga0501031_0000192 Ga0501031_0000192_24961_26037 350
374 3300049569 Ga0501032_0009318 Ga0501032_0009318_1847_2923 350
375 3300049570 Ga0501033_0004357 Ga0501033_0004357_4121_5197 350
376 3300049571 Ga0501034_0396322 Ga0501034_0396322_98_1231 350
377 3300049573 Ga0501037_0053143 Ga0501037_0053143_509_1585 350
378 3300049822 Ga0501035_0007596 Ga0501035_0007596_2608_3684 350
379 3300049823 Ga0501044_0000176 Ga0501044_0000176_69907_70983 350
380 3300050493 nmdc:mga0k408_142757_c1 nmdc:mga0k408_142757_c1_31_1131 350
381 3300050494 nmdc:mga06z11_32407_c1 nmdc:mga06z11_32407_c1_987_2072 350
382 3300050496 nmdc:mga07m45_13215_c1 nmdc:mga07m45_13215_c1_2244_3329 350
383 3300050512 nmdc:mga0n895_359974_c1 nmdc:mga0n895_359974_c1_386_1456 350
384 3300050512 nmdc:mga0n895_953_c1 nmdc:mga0n895_953_c1_1463_2536 350
385 3300050513 nmdc:mga0rr50_1829_c1 nmdc:mga0rr50_1829_c1_1041_2114 350
386 3300050514 nmdc:mga08x19_5264_c1 nmdc:mga08x19_5264_c1_6439_7509 350
387 3300050515 nmdc:mga0a205_2323_c1 nmdc:mga0a205_2323_c1_11678_12781 350
388 iso_pu_bacteria 2885192300 2885195591 350
389 3300005335 Ga0070666_10167900 Ga0070666_101679002 351
390 3300005367 Ga0070667_100071936 Ga0070667_1000719363 351
391 3300005439 Ga0070711_100030051 Ga0070711_1000300512 351
392 3300005440 Ga0070705_100042851 Ga0070705_1000428512 351
393 3300005456 Ga0070678_100008843 Ga0070678_1000088433 351
394 3300005467 Ga0070706_100081595 Ga0070706_1000815952 351
395 3300005546 Ga0070696_100122438 Ga0070696_1001224382 351
396 3300005842 Ga0068858_100069538 Ga0068858_1000695383 351
397 3300006175 Ga0070712_100025793 Ga0070712_1000257933 351
398 3300006237 Ga0097621_100287769 Ga0097621_1002877691 351
399 3300009553 Ga0105249_10268067 Ga0105249_102680672 351
400 3300013102 Ga0157371_10053128 Ga0157371_100531283 351
401 3300013306 Ga0163162_10070988 Ga0163162_100709882 351
402 3300013307 Ga0157372_10078996 Ga0157372_100789963 351
403 3300014969 Ga0157376_10155165 Ga0157376_101551652 351
404 3300025922 Ga0207646_10031090 Ga0207646_100310904 351
405 3300025922 Ga0207646_10210693 Ga0207646_102106932 351
406 3300025922 Ga0207646_10274886 Ga0207646_102748862 351
407 3300025986 Ga0207658_10069955 Ga0207658_100699552 351
408 3300026121 Ga0207683_10086582 Ga0207683_100865823 351
409 3300028800 Ga0265338_10038273 Ga0265338_100382732 351
410 3300031239 Ga0265328_10000106 Ga0265328_1000010620 351
411 3300031241 Ga0265325_10008650 Ga0265325_100086502 351
412 3300031241 Ga0265325_10030002 Ga0265325_100300023 351
413 3300031250 Ga0265331_10031913 Ga0265331_100319131 351
414 3300031251 Ga0265327_10037426 Ga0265327_100374262 351
415 3300031344 Ga0265316_10031788 Ga0265316_100317884 351
416 3300031711 Ga0265314_10031660 Ga0265314_100316603 351
417 3300031711 Ga0265314_10071918 Ga0265314_100719182 351
418 3300035398 Ga0316574_0154653 Ga0316574_0154653_49_1137 351
419 3300041406 Ga0439439_0004069 Ga0439439_0004069_1649_2722 351
420 3300041997 Ga0439431_0014286 Ga0439431_0014286_387_1460 351
421 3300042006 Ga0439432_009430 Ga0439432_009430_220_1293 351
422 3300042007 Ga0439449_0002444 Ga0439449_0002444_2613_3686 351
423 3300042015 Ga0439462_0015414 Ga0439462_0015414_21_1094 351
424 3300042145 Ga0450906_004112 Ga0450906_004112_797_1870 351
425 3300042156 Ga0439446_0021158 Ga0439446_0021158_619_1692 351
426 3300042435 Ga0439434_0006109 Ga0439434_0006109_352_1425 351
427 3300044683 Ga0466965_0035114 Ga0466965_0035114_347_1429 351
428 3300044712 Ga0453684_0000847 Ga0453684_0000847_52724_53818 351
429 3300044901 Ga0466960_0023445 Ga0466960_0023445_1564_2646 351
430 3300045051 Ga0451576_0038947 Ga0451576_0038947_2769_3848 351
431 3300048911 Ga0496108_0094726 Ga0496108_0094726_797_1897 351
432 3300005549 Ga0070704_100041606 Ga0070704_1000416062 352
433 3300005614 Ga0068856_100002001 Ga0068856_1000020014 352
434 3300005843 Ga0068860_100058487 Ga0068860_1000584874 352
435 3300005983 Ga0081540_1048859 Ga0081540_10488592 352
436 3300006048 Ga0075363_100121062 Ga0075363_1001210621 352
437 3300006177 Ga0075362_10007555 Ga0075362_100075554 352
438 3300006186 Ga0075369_10006503 Ga0075369_100065034 352
439 3300006353 Ga0075370_10000217 Ga0075370_1000021718 352
440 3300009147 Ga0114129_10218778 Ga0114129_102187782 352
441 3300021361 Ga0213872_10031585 Ga0213872_100315851 352
442 3300025949 Ga0207667_10040008 Ga0207667_100400083 352
443 3300026078 Ga0207702_10006429 Ga0207702_100064296 352
444 3300028381 Ga0268264_10198865 Ga0268264_101988651 352
445 3300028563 Ga0265319_1020910 Ga0265319_10209102 352
446 3300028577 Ga0265318_10001480 Ga0265318_100014807 352
447 3300028653 Ga0265323_10001736 Ga0265323_100017367 352
448 3300028654 Ga0265322_10004818 Ga0265322_100048184 352
449 3300031240 Ga0265320_10009006 Ga0265320_100090066 352
450 3300031344 Ga0265316_10051541 Ga0265316_100515411 352
451 3300031731 Ga0307405_10125312 Ga0307405_101253121 352
452 3300031824 Ga0307413_10215345 Ga0307413_102153451 352
453 3300031901 Ga0307406_10309963 Ga0307406_103099631 352
454 3300031903 Ga0307407_10221988 Ga0307407_102219882 352
455 3300032002 Ga0307416_100268724 Ga0307416_1002687242 352
456 3300035410 Ga0373924_0002671 Ga0373924_0002671_115_1191 352
457 3300035410 Ga0373924_0038118 Ga0373924_0038118_371_1453 352
458 3300035692 Ga0373935_0003679 Ga0373935_0003679_3775_4857 352
459 3300036401 Ga0373937_0147931 Ga0373937_0147931_657_1751 352
460 3300039447 Ga0436361_0995760 Ga0436361_0995760_205_1296 352
461 3300042001 Ga0439441_007345 Ga0439441_007345_481_1560 352
462 3300042876 Ga0451577_0003021 Ga0451577_0003021_7377_8459 352
463 3300042876 Ga0451577_0093041 Ga0451577_0093041_1537_2637 352
464 3300044712 Ga0453684_0002999 Ga0453684_0002999_14831_15913 352
465 3300044712 Ga0453684_0016369 Ga0453684_0016369_7093_8193 352
466 3300046461 Ga0495641_0016725 Ga0495641_0016725_2453_3535 352
467 3300046511 Ga0495608_0011389 Ga0495608_0011389_560_1642 352
468 3300046514 Ga0495618_0048665 Ga0495618_0048665_684_1766 352
469 3300046516 Ga0495628_0013619 Ga0495628_0013619_1870_2991 352
470 3300046526 Ga0495666_0120431 Ga0495666_0120431_42_1124 352
471 3300046531 Ga0495665_0014376 Ga0495665_0014376_1340_2422 352
472 3300047317 Ga0495604_0100946 Ga0495604_0100946_684_1766 352
473 3300047471 Ga0495684_0036614 Ga0495684_0036614_2525_3607 352
474 3300047471 Ga0495684_0216699 Ga0495684_0216699_76_1209 352
475 3300049586 Ga0501070_0017006 Ga0501070_0017006_3661_4719 352
476 3300049588 Ga0501072_0188160 Ga0501072_0188160_493_1584 352
477 3300049589 Ga0501073_0007822 Ga0501073_0007822_854_1912 352
478 3300049592 Ga0501076_0124670 Ga0501076_0124670_808_1899 352
479 3300049742 Ga0501080_0011298 Ga0501080_0011298_138_1196 352
480 3300050489 nmdc:mga03683_8691_c1 nmdc:mga03683_8691_c1_741_1847 352
481 3300050496 nmdc:mga07m45_197_c1 nmdc:mga07m45_197_c1_10364_11470 352
482 3300050516 nmdc:mga0sz30_5227_c1 nmdc:mga0sz30_5227_c1_711_1817 352
483 3300053077 Ga0495601_0004731 Ga0495601_0004731_1887_3008 352
484 3300053077 Ga0495601_0129279 Ga0495601_0129279_249_1331 352
485 3300053084 Ga0495595_0012737 Ga0495595_0012737_126_1208 352
486 3300005289 Ga0065704_10023400 Ga0065704_100234001 353
487 3300005330 Ga0070690_100003762 Ga0070690_1000037623 353
488 3300005331 Ga0070670_100000906 Ga0070670_10000090611 353
489 3300005335 Ga0070666_10015924 Ga0070666_100159245 353
490 3300005338 Ga0068868_100005274 Ga0068868_1000052744 353
491 3300005340 Ga0070689_100018529 Ga0070689_1000185294 353
492 3300005365 Ga0070688_100077108 Ga0070688_1000771082 353
493 3300005365 Ga0070688_100200257 Ga0070688_1002002571 353
494 3300005618 Ga0068864_100000454 Ga0068864_1000004547 353
495 3300005841 Ga0068863_100195689 Ga0068863_1001956891 353
496 3300005937 Ga0081455_10003202 Ga0081455_1000320219 353
497 3300006173 Ga0070716_100038886 Ga0070716_1000388862 353
498 3300006846 Ga0075430_100034817 Ga0075430_1000348173 353
499 3300006846 Ga0075430_100124382 Ga0075430_1001243822 353
500 3300006847 Ga0075431_100004791 Ga0075431_10000479115 353
501 3300006871 Ga0075434_100292146 Ga0075434_1002921462 353
502 3300006880 Ga0075429_100055692 Ga0075429_1000556922 353
503 3300006914 Ga0075436_100017896 Ga0075436_1000178966 353
504 3300007265 Ga0099794_10047087 Ga0099794_100470872 353
505 3300010159 Ga0099796_10004563 Ga0099796_100045631 353
506 3300025303 Ga0209051_1007653 Ga0209051_10076533 353
507 3300025910 Ga0207684_10000134 Ga0207684_10000134118 353
508 3300025910 Ga0207684_10060147 Ga0207684_100601471 353
509 3300025910 Ga0207684_10163487 Ga0207684_101634872 353
510 3300025931 Ga0207644_10118587 Ga0207644_101185871 353
511 3300025939 Ga0207665_10039861 Ga0207665_100398613 353
512 3300025940 Ga0207691_10003386 Ga0207691_100033862 353
513 3300026035 Ga0207703_10210043 Ga0207703_102100432 353
514 3300026088 Ga0207641_10264418 Ga0207641_102644182 353
515 3300027671 Ga0209588_1017423 Ga0209588_10174232 353
516 3300028794 Ga0307515_10094760 Ga0307515_100947603 353
517 3300029957 Ga0265324_10000433 Ga0265324_1000043319 353
518 3300031711 Ga0265314_10000136 Ga0265314_1000013628 353
519 3300032002 Ga0307416_100048452 Ga0307416_1000484522 353
520 3300035086 Ga0373934_0002111 Ga0373934_0002111_5299_6387 353
521 3300035118 Ga0373954_0000284 Ga0373954_0000284_4431_5519 353
522 3300035119 Ga0373956_0000996 Ga0373956_0000996_8836_9924 353
523 3300035172 Ga0373955_0066479 Ga0373955_0066479_541_1629 353
524 3300035724 Ga0373933_0009642 Ga0373933_0009642_3274_4362 353
525 3300036401 Ga0373937_0079023 Ga0373937_0079023_1422_2510 353
526 3300037068 Ga0373925_0013087 Ga0373925_0013087_4232_5332 353
527 3300037471 Ga0395905_0133205 Ga0395905_0133205_672_1763 353
528 3300042876 Ga0451577_0001417 Ga0451577_0001417_27566_28660 353
529 3300044712 Ga0453684_0000029 Ga0453684_0000029_615072_616178 353
530 3300044712 Ga0453684_0154167 Ga0453684_0154167_329_1423 353
531 3300044712 Ga0453684_0344330 Ga0453684_0344330_237_1331 353
532 3300045051 Ga0451576_0101011 Ga0451576_0101011_716_1813 353
533 3300046454 Ga0495592_0082814 Ga0495592_0082814_790_1878 353
534 3300046462 Ga0495651_0003692 Ga0495651_0003692_2116_3204 353
535 3300046472 Ga0495580_0000277 Ga0495580_0000277_4105_5178 353
536 3300046511 Ga0495608_0021836 Ga0495608_0021836_301_1368 353
537 3300046511 Ga0495608_0147857 Ga0495608_0147857_32_1120 353
538 3300046559 Ga0495667_0002820 Ga0495667_0002820_5418_6485 353
539 3300046675 Ga0495657_0002668 Ga0495657_0002668_8292_9359 353
540 3300047444 Ga0495675_0182716 Ga0495675_0182716_25_1092 353
541 3300047471 Ga0495684_0036162 Ga0495684_0036162_2409_3476 353
542 3300049572 Ga0501036_0041567 Ga0501036_0041567_2010_3086 353
543 3300049582 Ga0501048_0053638 Ga0501048_0053638_663_1739 353
544 3300049593 Ga0501077_0017709 Ga0501077_0017709_909_1970 353
545 3300049661 Ga0501217_000641 Ga0501217_000641_3646_4713 353
546 3300049665 Ga0501227_000165 Ga0501227_000165_2684_3751 353
547 3300050508 nmdc:mga09592_160573_c1 nmdc:mga09592_160573_c1_399_1484 353
548 3300050509 nmdc:mga0qj67_33698_c1 nmdc:mga0qj67_33698_c1_867_1949 353
549 3300050510 nmdc:mga06r32_15043_c1 nmdc:mga06r32_15043_c1_2555_3637 353
550 3300050512 nmdc:mga0n895_282058_c1 nmdc:mga0n895_282058_c1_330_1430 353
551 3300050514 nmdc:mga08x19_19247_c1 nmdc:mga08x19_19247_c1_2378_3466 353
552 3300050515 nmdc:mga0a205_119779_c1 nmdc:mga0a205_119779_c1_479_1579 353
553 3300053085 Ga0495619_0039034 Ga0495619_0039034_1475_2542 353
554 3300061734 Ga0530510_0123926 Ga0530510_0123926_199_1293 353
555 iso_pu_bacteria 2901300506 2901312026 353
556 3300005467 Ga0070706_100002535 Ga0070706_10000253514 354
557 3300005468 Ga0070707_100000894 Ga0070707_10000089414 354
558 3300005530 Ga0070679_100059313 Ga0070679_1000593134 354
559 3300005536 Ga0070697_100005266 Ga0070697_1000052666 354
560 3300005616 Ga0068852_100296397 Ga0068852_1002963972 354
561 3300006844 Ga0075428_100006866 Ga0075428_1000068663 354
562 3300009094 Ga0111539_10007501 Ga0111539_100075015 354
563 3300009094 Ga0111539_10026978 Ga0111539_100269784 354
564 3300025910 Ga0207684_10000153 Ga0207684_1000015384 354
565 3300025914 Ga0207671_10087941 Ga0207671_100879413 354
566 3300025921 Ga0207652_10037227 Ga0207652_100372274 354
567 3300025922 Ga0207646_10046974 Ga0207646_100469743 354
568 3300026116 Ga0207674_10299291 Ga0207674_102992911 354
569 3300026142 Ga0207698_10050739 Ga0207698_100507392 354
570 3300027907 Ga0207428_10003201 Ga0207428_1000320114 354
571 3300028379 Ga0268266_10268139 Ga0268266_102681392 354
572 3300031235 Ga0265330_10008907 Ga0265330_100089075 354
573 3300031238 Ga0265332_10000083 Ga0265332_1000008398 354
574 3300031250 Ga0265331_10010080 Ga0265331_100100804 354
575 3300031665 Ga0316575_10000910 Ga0316575_1000091012 354
576 3300031665 Ga0316575_10025877 Ga0316575_100258773 354
577 3300031730 Ga0307516_10010810 Ga0307516_100108102 354
578 3300035695 Ga0373927_0040395 Ga0373927_0040395_1115_2194 354
579 3300037068 Ga0373925_0062685 Ga0373925_0062685_54_1133 354
580 3300039447 Ga0436361_1012027 Ga0436361_1012027_596_1675 354
581 3300042876 Ga0451577_0188976 Ga0451577_0188976_205_1314 354
582 3300044712 Ga0453684_0000027 Ga0453684_0000027_693953_695044 354
583 3300044712 Ga0453684_0020712 Ga0453684_0020712_7912_9018 354
584 3300044712 Ga0453684_0054458 Ga0453684_0054458_3112_4209 354
585 3300044842 Ga0466957_0045844 Ga0466957_0045844_923_1987 354
586 3300045051 Ga0451576_0000483 Ga0451576_0000483_59394_60497 354
587 3300045051 Ga0451576_0002900 Ga0451576_0002900_7724_8827 354
588 3300048903 Ga0496100_0119016 Ga0496100_0119016_444_1538 354
589 3300048904 Ga0496101_0020182 Ga0496101_0020182_1711_2805 354
590 3300048907 Ga0496104_0069539 Ga0496104_0069539_591_1685 354
591 3300048908 Ga0496105_0003923 Ga0496105_0003923_1604_2698 354
592 3300048911 Ga0496108_0035004 Ga0496108_0035004_2166_3260 354
593 3300048911 Ga0496108_0411674 Ga0496108_0411674_53_1162 354
594 3300048912 Ga0496109_0100982 Ga0496109_0100982_1455_2549 354
595 3300048913 Ga0496110_0020809 Ga0496110_0020809_150_1244 354
596 3300048917 Ga0496114_0010629 Ga0496114_0010629_1542_2636 354
597 3300049569 Ga0501032_0068724 Ga0501032_0068724_200_1297 354
598 3300049575 Ga0501039_0131586 Ga0501039_0131586_364_1461 354
599 3300050511 nmdc:mga08y16_18553_c1 nmdc:mga08y16_18553_c1_876_1943 354
600 3300050511 nmdc:mga08y16_224_c1 nmdc:mga08y16_224_c1_34030_35133 354
601 3300005354 Ga0070675_100088001 Ga0070675_1000880012 355
602 3300005439 Ga0070711_100170391 Ga0070711_1001703912 355
603 3300005440 Ga0070705_100233589 Ga0070705_1002335891 355
604 3300005456 Ga0070678_100358334 Ga0070678_1003583341 355
605 3300005543 Ga0070672_100037176 Ga0070672_1000371762 355
606 3300005842 Ga0068858_100006836 Ga0068858_1000068367 355
607 3300007076 Ga0075435_100047868 Ga0075435_1000478684 355
608 3300009094 Ga0111539_10061639 Ga0111539_100616394 355
609 3300009147 Ga0114129_10002520 Ga0114129_100025205 355
610 3300009176 Ga0105242_10000556 Ga0105242_1000055624 355
611 3300009176 Ga0105242_10429715 Ga0105242_104297151 355
612 3300009551 Ga0105238_10109045 Ga0105238_101090453 355
613 3300025924 Ga0207694_10084709 Ga0207694_100847092 355
614 3300025926 Ga0207659_10128564 Ga0207659_101285642 355
615 3300025934 Ga0207686_10012098 Ga0207686_100120983 355
616 3300025940 Ga0207691_10164614 Ga0207691_101646142 355
617 3300026035 Ga0207703_10007109 Ga0207703_100071097 355
618 3300026035 Ga0207703_10086518 Ga0207703_100865182 355
619 3300026121 Ga0207683_10349453 Ga0207683_103494531 355
620 3300031235 Ga0265330_10002670 Ga0265330_100026704 355
621 3300031344 Ga0265316_10000508 Ga0265316_1000050822 355
622 3300031665 Ga0316575_10040223 Ga0316575_100402232 355
623 3300031727 Ga0316576_10000185 Ga0316576_1000018522 355
624 3300031727 Ga0316576_10022521 Ga0316576_100225213 355
625 3300031728 Ga0316578_10000009 Ga0316578_1000000910 355
626 3300031728 Ga0316578_10015408 Ga0316578_100154085 355
627 3300031733 Ga0316577_10129019 Ga0316577_101290192 355
628 3300032168 Ga0316593_10001400 Ga0316593_100014005 355
629 3300032168 Ga0316593_10005726 Ga0316593_100057264 355
630 3300032168 Ga0316593_10008151 Ga0316593_100081512 355
631 3300032168 Ga0316593_10021162 Ga0316593_100211622 355
632 3300033528 Ga0316588_1004450 Ga0316588_10044502 355
633 3300033529 Ga0316587_1014958 Ga0316587_10149581 355
634 3300033529 Ga0316587_1018704 Ga0316587_10187041 355
635 3300033541 Ga0316596_1013240 Ga0316596_10132402 355
636 3300035398 Ga0316574_0042760 Ga0316574_0042760_1652_2746 355
637 3300036647 Ga0316582_0044199 Ga0316582_0044199_160_1254 355
638 3300036712 Ga0316584_0065573 Ga0316584_0065573_1331_2425 355
639 3300049460 Ga0495682_0011325 Ga0495682_0011325_771_1886 355
640 3300049575 Ga0501039_0157073 Ga0501039_0157073_39_1136 355
641 3300049592 Ga0501076_0004696 Ga0501076_0004696_1119_2216 355
642 3300050507 nmdc:mga05p37_43553_c1 nmdc:mga05p37_43553_c1_3371_4438 355
643 3300050511 nmdc:mga08y16_63609_c1 nmdc:mga08y16_63609_c1_1563_2657 355
644 3300050513 nmdc:mga0rr50_242298_c1 nmdc:mga0rr50_242298_c1_340_1446 355
645 3300050514 nmdc:mga08x19_1633_c1 nmdc:mga08x19_1633_c1_1801_2907 355
646 iso_pu_bacteria 2847930680 2847938030 355
647 iso_pu_bacteria 2879083081 2879084423 355
648 iso_pu_bacteria 8001522603 8001524625 355
649 3300005364 Ga0070673_100003842 Ga0070673_1000038423 356
650 3300005367 Ga0070667_100006711 Ga0070667_1000067116 356
651 3300005467 Ga0070706_100145555 Ga0070706_1001455552 356
652 3300005471 Ga0070698_100004413 Ga0070698_10000441311 356
653 3300005471 Ga0070698_100052734 Ga0070698_1000527344 356
654 3300005518 Ga0070699_100056021 Ga0070699_1000560212 356
655 3300005536 Ga0070697_100005132 Ga0070697_10000513212 356
656 3300005546 Ga0070696_100127814 Ga0070696_1001278141 356
657 3300005564 Ga0070664_100009003 Ga0070664_1000090034 356
658 3300005834 Ga0068851_10097773 Ga0068851_100977731 356
659 3300005842 Ga0068858_100201339 Ga0068858_1002013393 356
660 3300006846 Ga0075430_100060607 Ga0075430_1000606072 356
661 3300006847 Ga0075431_100036103 Ga0075431_1000361033 356
662 3300021361 Ga0213872_10003092 Ga0213872_100030922 356
663 3300021361 Ga0213872_10010099 Ga0213872_100100994 356
664 3300021388 Ga0213875_10053763 Ga0213875_100537631 356
665 3300025903 Ga0207680_10061511 Ga0207680_100615113 356
666 3300025910 Ga0207684_10025168 Ga0207684_100251683 356
667 3300025925 Ga0207650_10009835 Ga0207650_100098354 356
668 3300025941 Ga0207711_10022199 Ga0207711_100221994 356
669 3300026023 Ga0207677_10019840 Ga0207677_100198405 356
670 3300026035 Ga0207703_10031865 Ga0207703_100318651 356
671 3300026088 Ga0207641_10168231 Ga0207641_101682312 356
672 3300026095 Ga0207676_10002093 Ga0207676_1000209313 356
673 3300031727 Ga0316576_10100367 Ga0316576_101003672 356
674 3300031728 Ga0316578_10014151 Ga0316578_100141511 356
675 3300031728 Ga0316578_10031100 Ga0316578_100311002 356
676 3300031728 Ga0316578_10036047 Ga0316578_100360473 356
677 3300031824 Ga0307413_10098219 Ga0307413_100982192 356
678 3300031903 Ga0307407_10036396 Ga0307407_100363962 356
679 3300031995 Ga0307409_100023190 Ga0307409_1000231902 356
680 3300032002 Ga0307416_100028930 Ga0307416_1000289302 356
681 3300032139 Ga0316580_10014380 Ga0316580_100143803 356
682 3300033524 Ga0316592_1001415 Ga0316592_10014154 356
683 3300033528 Ga0316588_1007960 Ga0316588_10079602 356
684 3300033528 Ga0316588_1017806 Ga0316588_10178063 356
685 3300033541 Ga0316596_1014493 Ga0316596_10144932 356
686 3300035083 Ga0373926_0005213 Ga0373926_0005213_807_1910 356
687 3300035398 Ga0316574_0017743 Ga0316574_0017743_2267_3364 356
688 3300035398 Ga0316574_0064475 Ga0316574_0064475_339_1436 356
689 3300035398 Ga0316574_0111736 Ga0316574_0111736_537_1631 356
690 3300035692 Ga0373935_0034934 Ga0373935_0034934_512_1615 356
691 3300035695 Ga0373927_0028535 Ga0373927_0028535_1277_2383 356
692 3300035725 Ga0373947_0000740 Ga0373947_0000740_5688_6791 356
693 3300036647 Ga0316582_0059869 Ga0316582_0059869_302_1399 356
694 3300036712 Ga0316584_0029909 Ga0316584_0029909_230_1336 356
695 3300037068 Ga0373925_0014962 Ga0373925_0014962_1026_2129 356
696 3300037068 Ga0373925_0025412 Ga0373925_0025412_1920_3026 356
697 3300037312 Ga0395899_0117861 Ga0395899_0117861_468_1541 356
698 3300037418 Ga0395900_0061724 Ga0395900_0061724_470_1543 356
699 3300037471 Ga0395905_0027816 Ga0395905_0027816_1322_2395 356
700 3300037853 Ga0436364_0410612 Ga0436364_0410612_4003_5100 356
701 3300038443 Ga0395901_0024823 Ga0395901_0024823_678_1751 356
702 3300039062 Ga0400483_061984 Ga0400483_061984_1899_2984 356
703 3300039062 Ga0400483_075120 Ga0400483_075120_11576_12649 356
704 3300039062 Ga0400483_163069 Ga0400483_163069_12143_13228 356
705 3300039062 Ga0400483_212256 Ga0400483_212256_12724_13797 356
706 3300039110 Ga0400487_20179 Ga0400487_20179_30392_31465 356
707 3300039437 Ga0436365_0391497 Ga0436365_0391497_130_1209 356
708 3300039447 Ga0436361_0162216 Ga0436361_0162216_9455_10546 356
709 3300039447 Ga0436361_0687968 Ga0436361_0687968_1982_3073 356
710 3300039447 Ga0436361_0950210 Ga0436361_0950210_396_1484 356
711 3300039447 Ga0436361_0976615 Ga0436361_0976615_158_1246 356
712 3300039447 Ga0436361_1218959 Ga0436361_1218959_99_1187 356
713 3300039453 Ga0436362_0536411 Ga0436362_0536411_53_1138 356
714 3300044673 Ga0453683_0008630 Ga0453683_0008630_151_1230 356
715 3300045976 Ga0466967_0326688 Ga0466967_0326688_267_1364 356
716 3300046681 Ga0495647_0010396 Ga0495647_0010396_1867_2973 356
717 3300049568 Ga0501031_0024609 Ga0501031_0024609_375_1457 356
718 3300049568 Ga0501031_0058405 Ga0501031_0058405_1409_2497 356
719 3300049571 Ga0501034_0003691 Ga0501034_0003691_6864_7979 356
720 3300049571 Ga0501034_0217159 Ga0501034_0217159_378_1460 356
721 3300049572 Ga0501036_0037673 Ga0501036_0037673_1720_2808 356
722 3300049576 Ga0501040_0024604 Ga0501040_0024604_685_1773 356
723 3300049577 Ga0501041_0111194 Ga0501041_0111194_220_1308 356
724 3300049578 Ga0501042_0039246 Ga0501042_0039246_1815_2903 356
725 3300049579 Ga0501043_0076676 Ga0501043_0076676_1151_2233 356
726 3300049580 Ga0501046_0048623 Ga0501046_0048623_547_1635 356
727 3300049582 Ga0501048_0149792 Ga0501048_0149792_136_1224 356
728 3300049582 Ga0501048_0156413 Ga0501048_0156413_94_1176 356
729 3300049584 Ga0501068_0039776 Ga0501068_0039776_1284_2366 356
730 3300049585 Ga0501069_0014398 Ga0501069_0014398_2770_3852 356
731 3300049586 Ga0501070_0003217 Ga0501070_0003217_356_1438 356
732 3300049587 Ga0501071_0098342 Ga0501071_0098342_909_1991 356
733 3300049589 Ga0501073_0054843 Ga0501073_0054843_524_1606 356
734 3300049592 Ga0501076_0011413 Ga0501076_0011413_3049_4137 356
735 3300049741 Ga0501079_0037957 Ga0501079_0037957_295_1383 356
736 3300049741 Ga0501079_0104952 Ga0501079_0104952_229_1311 356
737 3300049742 Ga0501080_0161903 Ga0501080_0161903_145_1227 356
738 3300049743 Ga0501081_0034320 Ga0501081_0034320_1587_2675 356
739 3300049744 Ga0501083_0005573 Ga0501083_0005573_709_1791 356
740 3300049822 Ga0501035_0017135 Ga0501035_0017135_415_1497 356
741 3300050509 nmdc:mga0qj67_46733_c1 nmdc:mga0qj67_46733_c1_1718_2803 356
742 3300050510 nmdc:mga06r32_65612_c1 nmdc:mga06r32_65612_c1_473_1582 356
743 3300060353 Ga0501082_0085013 Ga0501082_0085013_1485_2567 356
744 3300061734 Ga0530510_0019992 Ga0530510_0019992_783_1871 356
745 3300005336 Ga0070680_100050702 Ga0070680_1000507023 357
746 3300005337 Ga0070682_100208499 Ga0070682_1002084991 357
747 3300005344 Ga0070661_100038443 Ga0070661_1000384433 357
748 3300005434 Ga0070709_10008556 Ga0070709_100085563 357
749 3300005435 Ga0070714_100033710 Ga0070714_1000337102 357
750 3300005436 Ga0070713_100072739 Ga0070713_1000727393 357
751 3300005437 Ga0070710_10010324 Ga0070710_100103245 357
752 3300005535 Ga0070684_100001343 Ga0070684_1000013438 357
753 3300005535 Ga0070684_100017800 Ga0070684_1000178005 357
754 3300005564 Ga0070664_100071054 Ga0070664_1000710542 357
755 3300005577 Ga0068857_100182360 Ga0068857_1001823602 357
756 3300005842 Ga0068858_100143421 Ga0068858_1001434212 357
757 3300006163 Ga0070715_10009397 Ga0070715_100093972 357
758 3300006173 Ga0070716_100013161 Ga0070716_1000131614 357
759 3300006175 Ga0070712_100012125 Ga0070712_1000121255 357
760 3300006175 Ga0070712_100048686 Ga0070712_1000486863 357
761 3300006175 Ga0070712_100104622 Ga0070712_1001046222 357
762 3300013105 Ga0157369_10004712 Ga0157369_1000471214 357
763 3300020070 Ga0206356_10062693 Ga0206356_100626933 357
764 3300020081 Ga0206354_10232206 Ga0206354_102322062 357
765 3300022467 Ga0224712_10034708 Ga0224712_100347081 357
766 3300025898 Ga0207692_10000821 Ga0207692_1000082111 357
767 3300025906 Ga0207699_10011935 Ga0207699_100119355 357
768 3300025909 Ga0207705_10030469 Ga0207705_100304694 357
769 3300025915 Ga0207693_10008424 Ga0207693_1000842410 357
770 3300025915 Ga0207693_10077500 Ga0207693_100775003 357
771 3300025916 Ga0207663_10008722 Ga0207663_100087224 357
772 3300025920 Ga0207649_10135705 Ga0207649_101357052 357
773 3300025921 Ga0207652_10055534 Ga0207652_100555342 357
774 3300025928 Ga0207700_10036243 Ga0207700_100362433 357
775 3300025929 Ga0207664_10030030 Ga0207664_100300303 357
776 3300025939 Ga0207665_10025087 Ga0207665_100250874 357
777 3300025944 Ga0207661_10003175 Ga0207661_1000317510 357
778 3300025944 Ga0207661_10022528 Ga0207661_100225283 357
779 3300026078 Ga0207702_10292486 Ga0207702_102924862 357
780 3300026116 Ga0207674_10094112 Ga0207674_100941123 357
781 3300027296 Ga0209389_1000009 Ga0209389_100000939 357
782 3300027361 Ga0209489_100050 Ga0209489_10005087 357
783 3300027363 Ga0209700_100016 Ga0209700_100016195 357
784 3300027907 Ga0207428_10007187 Ga0207428_100071873 357
785 3300031727 Ga0316576_10009926 Ga0316576_100099263 357
786 3300031727 Ga0316576_10020319 Ga0316576_100203193 357
787 3300031727 Ga0316576_10077327 Ga0316576_100773272 357
788 3300031727 Ga0316576_10104085 Ga0316576_101040852 357
789 3300031727 Ga0316576_10167757 Ga0316576_101677571 357
790 3300031728 Ga0316578_10038031 Ga0316578_100380312 357
791 3300031728 Ga0316578_10073172 Ga0316578_100731722 357
792 3300031733 Ga0316577_10072529 Ga0316577_100725292 357
793 3300035398 Ga0316574_0001201 Ga0316574_0001201_4364_5440 357
794 3300035398 Ga0316574_0003293 Ga0316574_0003293_2411_3523 357
795 3300035398 Ga0316574_0012529 Ga0316574_0012529_1175_2278 357
796 3300035398 Ga0316574_0055240 Ga0316574_0055240_761_1861 357
797 3300035398 Ga0316574_0135563 Ga0316574_0135563_451_1569 357
798 3300035398 Ga0316574_0158357 Ga0316574_0158357_230_1345 357
799 3300035398 Ga0316574_0161734 Ga0316574_0161734_299_1381 357
800 3300036647 Ga0316582_0055368 Ga0316582_0055368_557_1669 357
801 3300036712 Ga0316584_0090466 Ga0316584_0090466_917_1999 357
802 3300036712 Ga0316584_0100478 Ga0316584_0100478_739_1851 357
803 3300036712 Ga0316584_0198278 Ga0316584_0198278_71_1186 357
804 3300039062 Ga0400483_142661 Ga0400483_142661_2302_3390 357
805 3300039062 Ga0400483_189406 Ga0400483_189406_188_1276 357
806 3300039062 Ga0400483_274218 Ga0400483_274218_2251_3372 357
807 3300048915 Ga0496112_0082650 Ga0496112_0082650_283_1368 357
808 3300048915 Ga0496112_0175868 Ga0496112_0175868_765_1853 357
809 3300050511 nmdc:mga08y16_8480_c1 nmdc:mga08y16_8480_c1_2460_3560 357
810 iso_pu_bacteria 2523231044 2523384828 357
811 iso_pu_bacteria 8056054917 8056056662 357
812 3300014497 Ga0182008_10124102 Ga0182008_101241021 358
813 3300025906 Ga0207699_10000151 Ga0207699_1000015129 358
814 3300031595 Ga0265313_10000061 Ga0265313_1000006163 358
815 3300031727 Ga0316576_10000775 Ga0316576_100007759 358
816 3300031903 Ga0307407_10053359 Ga0307407_100533592 358
817 3300031995 Ga0307409_100132326 Ga0307409_1001323261 358
818 3300032005 Ga0307411_10002945 Ga0307411_100029455 358
819 3300036712 Ga0316584_0013099 Ga0316584_0013099_2410_3531 358
820 3300044712 Ga0453684_0085048 Ga0453684_0085048_2334_3461 358
821 3300045051 Ga0451576_0000219 Ga0451576_0000219_109032_110123 358
822 3300048911 Ga0496108_0263247 Ga0496108_0263247_392_1480 358
823 3300005471 Ga0070698_100082635 Ga0070698_1000826352 359
824 3300005539 Ga0068853_100040312 Ga0068853_1000403122 359
825 3300005547 Ga0070693_100130154 Ga0070693_1001301541 359
826 3300005719 Ga0068861_100000999 Ga0068861_1000009994 359
827 3300005842 Ga0068858_100016977 Ga0068858_1000169774 359
828 3300005985 Ga0081539_10008545 Ga0081539_100085453 359
829 3300006051 Ga0075364_10070891 Ga0075364_100708911 359
830 3300006051 Ga0075364_10088545 Ga0075364_100885452 359
831 3300006177 Ga0075362_10086060 Ga0075362_100860601 359
832 3300006186 Ga0075369_10004717 Ga0075369_100047172 359
833 3300006186 Ga0075369_10006202 Ga0075369_100062023 359
834 3300006880 Ga0075429_100021207 Ga0075429_1000212074 359
835 3300006880 Ga0075429_100262313 Ga0075429_1002623132 359
836 3300009147 Ga0114129_10011944 Ga0114129_100119449 359
837 3300009174 Ga0105241_10030868 Ga0105241_100308684 359
838 3300009176 Ga0105242_10032170 Ga0105242_100321704 359
839 3300009177 Ga0105248_10021930 Ga0105248_100219304 359
840 3300009545 Ga0105237_10067738 Ga0105237_100677383 359
841 3300010375 Ga0105239_10068834 Ga0105239_100688342 359
842 3300013296 Ga0157374_10080020 Ga0157374_100800203 359
843 3300013297 Ga0157378_10045534 Ga0157378_100455343 359
844 3300013306 Ga0163162_10070559 Ga0163162_100705592 359
845 3300014325 Ga0163163_10003827 Ga0163163_100038278 359
846 3300014968 Ga0157379_10050438 Ga0157379_100504385 359
847 3300017792 Ga0163161_10012730 Ga0163161_100127304 359
848 3300025915 Ga0207693_10000339 Ga0207693_100003394 359
849 3300025935 Ga0207709_10001097 Ga0207709_1000109718 359
850 3300025981 Ga0207640_10042307 Ga0207640_100423072 359
851 3300031727 Ga0316576_10070115 Ga0316576_100701152 359
852 3300031824 Ga0307413_10007356 Ga0307413_100073565 359
853 3300031852 Ga0307410_10073541 Ga0307410_100735412 359
854 3300031903 Ga0307407_10091684 Ga0307407_100916842 359
855 3300031995 Ga0307409_100124196 Ga0307409_1001241962 359
856 3300031995 Ga0307409_100484803 Ga0307409_1004848031 359
857 3300032002 Ga0307416_100165575 Ga0307416_1001655752 359
858 3300032005 Ga0307411_10081513 Ga0307411_100815132 359
859 3300032005 Ga0307411_10104615 Ga0307411_101046152 359
860 3300032126 Ga0307415_100258218 Ga0307415_1002582181 359
861 3300032137 Ga0316585_10008848 Ga0316585_100088483 359
862 3300033529 Ga0316587_1001928 Ga0316587_10019281 359
863 3300035398 Ga0316574_0003963 Ga0316574_0003963_2640_3749 359
864 3300035691 Ga0373931_0046143 Ga0373931_0046143_504_1679 359
865 3300036712 Ga0316584_0087928 Ga0316584_0087928_164_1285 359
866 3300037466 Ga0395898_0232976 Ga0395898_0232976_587_1714 359
867 3300037471 Ga0395905_0142817 Ga0395905_0142817_107_1234 359
868 3300041411 Ga0439466_0035089 Ga0439466_0035089_388_1467 359
869 3300041997 Ga0439431_0009831 Ga0439431_0009831_990_2069 359
870 3300042004 Ga0439445_0011025 Ga0439445_0011025_919_1998 359
871 3300044901 Ga0466960_0049913 Ga0466960_0049913_847_1926 359
872 3300048904 Ga0496101_0002757 Ga0496101_0002757_6718_7797 359
873 3300048908 Ga0496105_0154328 Ga0496105_0154328_11_1129 359
874 3300048909 Ga0496106_0013966 Ga0496106_0013966_20_1195 359
875 3300048912 Ga0496109_0038622 Ga0496109_0038622_1188_2363 359
876 3300048915 Ga0496112_0128530 Ga0496112_0128530_390_1565 359
877 3300048916 Ga0496113_0081507 Ga0496113_0081507_369_1544 359
878 3300048917 Ga0496114_0000953 Ga0496114_0000953_8874_9953 359
879 3300048918 Ga0496115_0029355 Ga0496115_0029355_106_1281 359
880 3300049581 Ga0501047_0018444 Ga0501047_0018444_2358_3464 359
881 3300050489 nmdc:mga03683_65265_c1 nmdc:mga03683_65265_c1_237_1316 359
882 3300050491 nmdc:mga00v17_115499_c1 nmdc:mga00v17_115499_c1_350_1429 359
883 3300050491 nmdc:mga00v17_35818_c1 nmdc:mga00v17_35818_c1_1304_2383 359
884 3300050492 nmdc:mga0yw44_26981_c1 nmdc:mga0yw44_26981_c1_497_1576 359
885 3300050507 nmdc:mga05p37_22826_c1 nmdc:mga05p37_22826_c1_5253_6389 359
886 iso_pu_bacteria 2885409591 2885410015 359
887 3300001990 JGI24737J22298_10045099 JGI24737J22298_100450991 360
888 3300005338 Ga0068868_100008755 Ga0068868_1000087552 360
889 3300005343 Ga0070687_100059885 Ga0070687_1000598852 360
890 3300005354 Ga0070675_100116322 Ga0070675_1001163221 360
891 3300005364 Ga0070673_100379440 Ga0070673_1003794401 360
892 3300005563 Ga0068855_100180773 Ga0068855_1001807732 360
893 3300005616 Ga0068852_100169442 Ga0068852_1001694422 360
894 3300005618 Ga0068864_100097581 Ga0068864_1000975813 360
895 3300005841 Ga0068863_100133724 Ga0068863_1001337242 360
896 3300006173 Ga0070716_100079043 Ga0070716_1000790432 360
897 3300006844 Ga0075428_100006684 Ga0075428_1000066845 360
898 3300006846 Ga0075430_100001621 Ga0075430_10000162118 360
899 3300006846 Ga0075430_100036653 Ga0075430_1000366534 360
900 3300006847 Ga0075431_100001412 Ga0075431_1000014128 360
901 3300006847 Ga0075431_100012454 Ga0075431_1000124542 360
902 3300006847 Ga0075431_100022895 Ga0075431_1000228952 360
903 3300006847 Ga0075431_100044859 Ga0075431_1000448595 360
904 3300006852 Ga0075433_10279863 Ga0075433_102798632 360
905 3300006880 Ga0075429_100011021 Ga0075429_1000110218 360
906 3300006880 Ga0075429_100021021 Ga0075429_1000210214 360
907 3300009147 Ga0114129_10101509 Ga0114129_101015095 360
908 3300009148 Ga0105243_10150858 Ga0105243_101508582 360
909 3300009174 Ga0105241_10170098 Ga0105241_101700981 360
910 3300009176 Ga0105242_10013676 Ga0105242_100136761 360
911 3300009551 Ga0105238_10150330 Ga0105238_101503301 360
912 3300009551 Ga0105238_10323716 Ga0105238_103237161 360
913 3300011119 Ga0105246_10031036 Ga0105246_100310363 360
914 3300013105 Ga0157369_10081506 Ga0157369_100815063 360
915 3300013296 Ga0157374_10193419 Ga0157374_101934191 360
916 3300013306 Ga0163162_10079555 Ga0163162_100795553 360
917 3300013308 Ga0157375_10059690 Ga0157375_100596904 360
918 3300013308 Ga0157375_10201206 Ga0157375_102012061 360
919 3300025900 Ga0207710_10067668 Ga0207710_100676681 360
920 3300025904 Ga0207647_10017480 Ga0207647_100174801 360
921 3300025907 Ga0207645_10083453 Ga0207645_100834531 360
922 3300025915 Ga0207693_10005268 Ga0207693_100052683 360
923 3300025926 Ga0207659_10033180 Ga0207659_100331802 360
924 3300025934 Ga0207686_10070681 Ga0207686_100706811 360
925 3300025938 Ga0207704_10017772 Ga0207704_100177723 360
926 3300025961 Ga0207712_10256241 Ga0207712_102562412 360
927 3300025972 Ga0207668_10196507 Ga0207668_101965071 360
928 3300026041 Ga0207639_10130399 Ga0207639_101303992 360
929 3300026078 Ga0207702_10004539 Ga0207702_1000453913 360
930 3300026088 Ga0207641_10117525 Ga0207641_101175252 360
931 3300026116 Ga0207674_10510885 Ga0207674_105108851 360
932 3300026118 Ga0207675_100120783 Ga0207675_1001207831 360
933 3300026142 Ga0207698_10330060 Ga0207698_103300601 360
934 3300031711 Ga0265314_10000447 Ga0265314_1000044738 360
935 3300031727 Ga0316576_10035413 Ga0316576_100354134 360
936 3300031727 Ga0316576_10075746 Ga0316576_100757462 360
937 3300031728 Ga0316578_10009518 Ga0316578_100095184 360
938 3300031728 Ga0316578_10010545 Ga0316578_100105452 360
939 3300031995 Ga0307409_100134882 Ga0307409_1001348822 360
940 3300032002 Ga0307416_100497365 Ga0307416_1004973651 360
941 3300032126 Ga0307415_100042383 Ga0307415_1000423831 360
942 3300032139 Ga0316580_10006681 Ga0316580_100066812 360
943 3300033527 Ga0316586_1004449 Ga0316586_10044492 360
944 3300033528 Ga0316588_1005395 Ga0316588_10053953 360
945 3300035398 Ga0316574_0003902 Ga0316574_0003902_5855_7009 360
946 3300035398 Ga0316574_0013379 Ga0316574_0013379_1341_2453 360
947 3300035398 Ga0316574_0064009 Ga0316574_0064009_432_1655 360
948 3300036647 Ga0316582_0046563 Ga0316582_0046563_1153_2265 360
949 3300036647 Ga0316582_0101088 Ga0316582_0101088_171_1280 360
950 3300036712 Ga0316584_0016020 Ga0316584_0016020_1983_3095 360
951 3300036712 Ga0316584_0016776 Ga0316584_0016776_3084_4238 360
952 3300036712 Ga0316584_0051912 Ga0316584_0051912_381_1607 360
953 3300037466 Ga0395898_0121693 Ga0395898_0121693_1320_2486 360
954 3300037471 Ga0395905_0050933 Ga0395905_0050933_1861_3027 360
955 3300038443 Ga0395901_0001398 Ga0395901_0001398_22112_23278 360
956 3300044684 Ga0466966_0149487 Ga0466966_0149487_214_1305 360
957 3300048911 Ga0496108_0006306 Ga0496108_0006306_2370_3452 360
958 3300048911 Ga0496108_0027054 Ga0496108_0027054_579_1724 360
959 3300048912 Ga0496109_0017015 Ga0496109_0017015_601_1746 360
960 3300048913 Ga0496110_0098626 Ga0496110_0098626_1142_2257 360
961 3300048914 Ga0496111_0064345 Ga0496111_0064345_495_1640 360
962 3300049575 Ga0501039_0070352 Ga0501039_0070352_1251_2363 360
963 3300049576 Ga0501040_0067360 Ga0501040_0067360_112_1224 360
964 3300049577 Ga0501041_0017992 Ga0501041_0017992_1382_2494 360
965 3300049578 Ga0501042_0061024 Ga0501042_0061024_13_1125 360
966 3300049580 Ga0501046_0040269 Ga0501046_0040269_1572_2684 360
967 3300049581 Ga0501047_0034783 Ga0501047_0034783_2107_3222 360
968 3300049590 Ga0501074_0098935 Ga0501074_0098935_116_1228 360
969 3300049741 Ga0501079_0040238 Ga0501079_0040238_1033_2145 360
970 3300049824 Ga0501045_0013593 Ga0501045_0013593_2612_3736 360
971 3300050507 nmdc:mga05p37_86_c1 nmdc:mga05p37_86_c1_417_1559 360
972 3300050508 nmdc:mga09592_25_c1 nmdc:mga09592_25_c1_26523_27665 360
973 3300050508 nmdc:mga09592_4214_c1 nmdc:mga09592_4214_c1_9892_10986 360
974 3300050509 nmdc:mga0qj67_164_c1 nmdc:mga0qj67_164_c1_16802_17944 360
975 3300050510 nmdc:mga06r32_21156_c1 nmdc:mga06r32_21156_c1_3912_5006 360
976 3300050510 nmdc:mga06r32_281_c1 nmdc:mga06r32_281_c1_25357_26499 360
977 3300050511 nmdc:mga08y16_310337_c1 nmdc:mga08y16_310337_c1_92_1189 360
978 3300053092 Ga0500583_0035724 Ga0500583_0035724_950_2065 360
979 3300061734 Ga0530510_0005818 Ga0530510_0005818_2222_3346 360
980 iso_pu_bacteria 2622736605 2623501357 360
981 iso_pu_bacteria 2861520306 2861527149 360

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

125

282

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3can-assembly1.cif.gz_A-2 crystal structure of a domain of pyruvate-formate lyase-activating enzyme from bacteroides vulgatus atcc 8482 0.8849 130 294
8fsi-assembly1.cif.gz_A the structure of a crystallizable variant of e. coli pyruvate formate-lyase activating enzyme bound to sam 0.8676 77 291
3can-assembly1.cif.gz_A-2 crystal structure of a domain of pyruvate-formate lyase-activating enzyme from bacteroides vulgatus atcc 8482 0.8646 130 294
3cb8-assembly1.cif.gz_A 4fe-4s-pyruvate formate-lyase activating enzyme in complex with adomet and a peptide substrate 0.8103 56 291
2yx6-assembly3.cif.gz_D-3 crystal structure of ph0822 0.7989 115 158
ID Description Score Start End Superfamily
af_P95188_67_289_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 1.001 69 290 3.20.20.70
af_P95188_67_289_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9918 69 290 3.20.20.70
af_Q58218_60_281_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9666 67 291 3.20.20.70
af_Q58218_60_281_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9581 67 291 3.20.20.70
3canA00 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;pyruvate-formate lyase- activating enzyme 0.8832 130 294 3.80.30.10
ID Description Score Start End GO Terms
AF-A0A1G9MQY4-F1-model_v4 Pyruvate formate lyase activating enzyme 0.9986 1 359 GO:0016829
GO:0046872
GO:0051539
AF-A0A2V6ZC46-F1-model_v4 AmmeMemoRadiSam system radical SAM enzyme 0.9971 7 311 GO:0003824
GO:0046872
GO:0051539
AF-A0A4U0GWB2-F1-model_v4 AmmeMemoRadiSam system radical SAM enzyme 0.9965 3 359 GO:0003824
GO:0046872
GO:0051539
AF-A0A3D3JJK7-F1-model_v4 AmmeMemoRadiSam system radical SAM enzyme 0.9954 7 275 GO:0003824
GO:0046872
GO:0051539
AF-A0A2D6TX55-F1-model_v4 MEMO1 family protein CL561_13240 0.9945 2 359 GO:0003824
GO:0046872
GO:0051539

Feature Viewer

pLDDT pTM Quality
95.15 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map