F487335
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 979 | 408 | 979 | 387 |
Family's Representative Sequence
| Representative Sequence | 3300031090|Ga0265760_10006486|Ga0265760_100064862 |
| Length | 392 |
| Sequence | MKRSTDRILTTHVGSLIRPQALQEFLRAKQAGKPYDMAAYDKCLTASVADVVHKQAEVGIDVISDGEFGKSISWSQYVLERLSGFERRPINPGNKNPFTRGVDREQFAEFYAELDAREGVATTVEAVCVGPIAYTGQAELQRDIDNFKAALKGVNVVEAFLPVAAPASVIPDRKNEYYKTEEELIRAIGAAMRTEYRMIIDAGFVLQLDDARAAVTYDRMVPPGSFEDYRKWLRLQVEVLNEAIAGLPPDRIRYHVCWGSWPGPHTTDVALKDIVDLILGMNVGAFVIEGANPRHEHEWRVWENAKLPKDKVLIPGVISHATNVVEHPELVAERIVRLAKLVGRENVLAGTDCGFAQGPFHRRVHPSIMWAKLGALVEGAGIASAELWRKAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 4 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 6 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 7 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 11 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 14 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 15 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 16 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 17 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 18 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 19 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 20 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 21 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 95 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 96 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 98 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 99 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 101 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 102 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 104 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 105 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 106 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 109 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 112 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 113 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 114 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 145 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 216 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 217 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 221 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 223 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 224 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 226 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 227 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 228 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 229 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 230 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 231 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 232 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 233 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 234 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 235 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 236 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 240 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 242 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 244 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 245 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 247 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 248 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 249 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 251 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 252 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 253 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 255 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 257 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 258 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 259 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 260 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 261 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 262 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 263 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 264 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 266 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 268 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 269 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 270 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 271 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 272 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 273 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 274 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 275 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 276 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 277 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 278 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 279 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 280 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 281 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 282 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 283 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 284 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 285 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 286 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 337 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 338 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 339 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 340 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 341 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 342 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 345 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 346 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 347 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 348 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 349 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 350 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 383 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 384 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 385 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 386 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 395 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 400 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 401 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 402 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 403 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 404 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 405 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 406 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.9 |
| Metatranscriptomes | 0.1 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.76 |
| Nodule | 0 |
| Rhizoplane | 8.17 |
| Rhizosphere | 88.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214911850 | 2209111006 | Bacteria | 7117 |
| 2 | ARcpr5yngRDRAFT_c000600 | 3300000043 | Bacteria | 4526 |
| 3 | ARSoilOldRDRAFT_c000023 | 3300000044 | Bacteria | 34965 |
| 4 | ARCol0oldRDRAFT_c00462 | 3300000045 | Bacteria | 3835 |
| 5 | ARCol0yngRDRAFT_1000216 | 3300000652 | Bacteria | 9710 |
| 6 | JGI24032J14994_100292 | 3300001430 | Bacteria | 2646 |
| 7 | JGI24746J21847_1000047 | 3300001977 | Bacteria | 11979 |
| 8 | JGI24739J22299_10000148 | 3300001989 | Bacteria | 22525 |
| 9 | JGI24737J22298_10000458 | 3300001990 | Bacteria | 14018 |
| 10 | JGI24737J22298_10003428 | 3300001990 | Bacteria | 5606 |
| 11 | JGI24743J22301_10001360 | 3300001991 | Bacteria | 3359 |
| 12 | JGI24750J21931_1000011 | 3300002070 | Bacteria | 22441 |
| 13 | JGI24738J21930_10000236 | 3300002075 | Bacteria | 15024 |
| 14 | JGI24749J21850_1000378 | 3300002076 | Bacteria | 6650 |
| 15 | JGI24744J21845_10008543 | 3300002077 | Bacteria | 2105 |
| 16 | JGI24744J21845_10010109 | 3300002077 | Bacteria | 1935 |
| 17 | JGI24035J26624_1001314 | 3300002126 | Bacteria | 2353 |
| 18 | JGI24033J26618_1001259 | 3300002155 | Bacteria | 2487 |
| 19 | JGI24034J26672_10000483 | 3300002239 | Bacteria | 5147 |
| 20 | JGI24742J22300_10000248 | 3300002244 | Bacteria | 8017 |
| 21 | JGI24751J29686_10007458 | 3300002459 | Bacteria | 2233 |
| 22 | JGI25404J52841_10000611 | 3300003659 | Bacteria | 5354 |
| 23 | Ga0065716_1002142 | 3300005277 | Bacteria | 2189 |
| 24 | Ga0065712_10072517 | 3300005290 | Bacteria | 4722 |
| 25 | Ga0065712_10077915 | 3300005290 | Bacteria | 3425 |
| 26 | Ga0065715_10001564 | 3300005293 | Bacteria | 10196 |
| 27 | Ga0065715_10088960 | 3300005293 | Bacteria | 20217 |
| 28 | Ga0065715_10146095 | 3300005293 | Bacteria | 1787 |
| 29 | Ga0070658_10206441 | 3300005327 | Bacteria | 1659 |
| 30 | Ga0070658_10287789 | 3300005327 | Bacteria | 1400 |
| 31 | Ga0070676_10000536 | 3300005328 | Bacteria | 18324 |
| 32 | Ga0070683_100000144 | 3300005329 | Bacteria | 45900 |
| 33 | Ga0070683_100103835 | 3300005329 | Bacteria | 2679 |
| 34 | Ga0070690_100001428 | 3300005330 | Bacteria | 12481 |
| 35 | Ga0070690_100028441 | 3300005330 | Bacteria | 3463 |
| 36 | Ga0070690_100044603 | 3300005330 | Bacteria | 2815 |
| 37 | Ga0070670_100000437 | 3300005331 | Bacteria | 34047 |
| 38 | Ga0070670_100011345 | 3300005331 | Bacteria | 7616 |
| 39 | Ga0070677_10008501 | 3300005333 | Bacteria | 3457 |
| 40 | Ga0068869_100000035 | 3300005334 | Bacteria | 55467 |
| 41 | Ga0070666_10006881 | 3300005335 | Bacteria | 7005 |
| 42 | Ga0070666_10033534 | 3300005335 | Bacteria | 3398 |
| 43 | Ga0070666_10033695 | 3300005335 | Bacteria | 3391 |
| 44 | Ga0070680_100001482 | 3300005336 | Bacteria | 17052 |
| 45 | Ga0070680_100010932 | 3300005336 | Bacteria | 7015 |
| 46 | Ga0070680_100015993 | 3300005336 | Bacteria | 5895 |
| 47 | Ga0070680_100023460 | 3300005336 | Bacteria | 4920 |
| 48 | Ga0070682_100002219 | 3300005337 | Bacteria | 10771 |
| 49 | Ga0070682_100013572 | 3300005337 | Bacteria | 4690 |
| 50 | Ga0068868_100001888 | 3300005338 | Bacteria | 14384 |
| 51 | Ga0068868_100119761 | 3300005338 | Bacteria | 2146 |
| 52 | Ga0070660_100001344 | 3300005339 | Bacteria | 16702 |
| 53 | Ga0070660_100008614 | 3300005339 | Bacteria | 7139 |
| 54 | Ga0070689_100000207 | 3300005340 | Bacteria | 35559 |
| 55 | Ga0070689_100043423 | 3300005340 | Bacteria | 3455 |
| 56 | Ga0070689_100068592 | 3300005340 | Bacteria | 2766 |
| 57 | Ga0070691_10001234 | 3300005341 | Bacteria | 10769 |
| 58 | Ga0070687_100000261 | 3300005343 | Bacteria | 17944 |
| 59 | Ga0070661_100000017 | 3300005344 | Bacteria | 153232 |
| 60 | Ga0070692_10000008 | 3300005345 | Bacteria | 47438 |
| 61 | Ga0070668_100000699 | 3300005347 | Bacteria | 22898 |
| 62 | Ga0070668_100062678 | 3300005347 | Bacteria | 2881 |
| 63 | Ga0070669_100000250 | 3300005353 | Bacteria | 44115 |
| 64 | Ga0070669_100078587 | 3300005353 | Bacteria | 2453 |
| 65 | Ga0070675_100000246 | 3300005354 | Bacteria | 35225 |
| 66 | Ga0070675_100152209 | 3300005354 | Unclassified | 1984 |
| 67 | Ga0070671_100003025 | 3300005355 | Bacteria | 13092 |
| 68 | Ga0070674_100000355 | 3300005356 | Bacteria | 22844 |
| 69 | Ga0070673_100000032 | 3300005364 | Bacteria | 61665 |
| 70 | Ga0070673_100037972 | 3300005364 | Bacteria | 3674 |
| 71 | Ga0070688_100000669 | 3300005365 | Bacteria | 17042 |
| 72 | Ga0070659_100000214 | 3300005366 | Bacteria | 44422 |
| 73 | Ga0070659_100009561 | 3300005366 | Bacteria | 7124 |
| 74 | Ga0070667_100000816 | 3300005367 | Bacteria | 29087 |
| 75 | Ga0070667_100067811 | 3300005367 | Bacteria | 3035 |
| 76 | Ga0070667_100135426 | 3300005367 | Bacteria | 2153 |
| 77 | Ga0070703_10003001 | 3300005406 | Bacteria | 4821 |
| 78 | Ga0070709_10008980 | 3300005434 | Bacteria | 5505 |
| 79 | Ga0070714_100057751 | 3300005435 | Bacteria | 3322 |
| 80 | Ga0070714_100359436 | 3300005435 | Bacteria | 1369 |
| 81 | Ga0070713_100020676 | 3300005436 | Bacteria | 5050 |
| 82 | Ga0070710_10033187 | 3300005437 | Bacteria | 2801 |
| 83 | Ga0070701_10000099 | 3300005438 | Bacteria | 24473 |
| 84 | Ga0070701_10036265 | 3300005438 | Bacteria | 2484 |
| 85 | Ga0070701_10056293 | 3300005438 | Bacteria | 2057 |
| 86 | Ga0070711_100147157 | 3300005439 | Bacteria | 1773 |
| 87 | Ga0070705_100002586 | 3300005440 | Bacteria | 9071 |
| 88 | Ga0070705_100028007 | 3300005440 | Bacteria | 3082 |
| 89 | Ga0070705_100052781 | 3300005440 | Bacteria | 2376 |
| 90 | Ga0070700_100000234 | 3300005441 | Bacteria | 30487 |
| 91 | Ga0070700_100005017 | 3300005441 | Bacteria | 6979 |
| 92 | Ga0070694_100000247 | 3300005444 | Bacteria | 28607 |
| 93 | Ga0070663_100000201 | 3300005455 | Bacteria | 29751 |
| 94 | Ga0070678_100003298 | 3300005456 | Bacteria | 8975 |
| 95 | Ga0070678_100015873 | 3300005456 | Bacteria | 4799 |
| 96 | Ga0070662_100009709 | 3300005457 | Bacteria | 6298 |
| 97 | Ga0070662_100010369 | 3300005457 | Bacteria | 6110 |
| 98 | Ga0070662_100042269 | 3300005457 | Bacteria | 3255 |
| 99 | Ga0070681_10000401 | 3300005458 | Bacteria | 35170 |
| 100 | Ga0070681_10001364 | 3300005458 | Bacteria | 21350 |
| 101 | Ga0070681_10332233 | 3300005458 | Bacteria | 1429 |
| 102 | Ga0068867_100000190 | 3300005459 | Bacteria | 40626 |
| 103 | Ga0068867_100123667 | 3300005459 | Bacteria | 2002 |
| 104 | Ga0070685_10009054 | 3300005466 | Bacteria | 5136 |
| 105 | Ga0070707_100187753 | 3300005468 | Bacteria | 2015 |
| 106 | Ga0070679_100000512 | 3300005530 | Bacteria | 32969 |
| 107 | Ga0070679_100000847 | 3300005530 | Bacteria | 26675 |
| 108 | Ga0070679_100025113 | 3300005530 | Bacteria | 5844 |
| 109 | Ga0070679_100057996 | 3300005530 | Unclassified | 3859 |
| 110 | Ga0070679_100177188 | 3300005530 | Bacteria | 2104 |
| 111 | Ga0070684_100000904 | 3300005535 | Bacteria | 21016 |
| 112 | Ga0070684_100061415 | 3300005535 | Bacteria | 3289 |
| 113 | Ga0068853_100003019 | 3300005539 | Bacteria | 12851 |
| 114 | Ga0068853_100023115 | 3300005539 | Bacteria | 5203 |
| 115 | Ga0070672_100000807 | 3300005543 | Bacteria | 18712 |
| 116 | Ga0070672_100142029 | 3300005543 | Bacteria | 1981 |
| 117 | Ga0070686_100010404 | 3300005544 | Bacteria | 5243 |
| 118 | Ga0070686_100033721 | 3300005544 | Bacteria | 3148 |
| 119 | Ga0070695_100000406 | 3300005545 | Bacteria | 22313 |
| 120 | Ga0070695_100011865 | 3300005545 | Bacteria | 5215 |
| 121 | Ga0070695_100014581 | 3300005545 | Bacteria | 4738 |
| 122 | Ga0070696_100000304 | 3300005546 | Bacteria | 29759 |
| 123 | Ga0070696_100064387 | 3300005546 | Bacteria | 2569 |
| 124 | Ga0070693_100000546 | 3300005547 | Bacteria | 16772 |
| 125 | Ga0070693_100010607 | 3300005547 | Bacteria | 4619 |
| 126 | Ga0070693_100062362 | 3300005547 | Bacteria | 2169 |
| 127 | Ga0070704_100000385 | 3300005549 | Bacteria | 20151 |
| 128 | Ga0070704_100003857 | 3300005549 | Bacteria | 8632 |
| 129 | Ga0068855_100019930 | 3300005563 | Bacteria | 8055 |
| 130 | Ga0068855_100222335 | 3300005563 | Bacteria | 2117 |
| 131 | Ga0070664_100000912 | 3300005564 | Bacteria | 23051 |
| 132 | Ga0068857_100000494 | 3300005577 | Bacteria | 28282 |
| 133 | Ga0068857_100124549 | 3300005577 | Bacteria | 2322 |
| 134 | Ga0068857_100209625 | 3300005577 | Bacteria | 1778 |
| 135 | Ga0068854_100000139 | 3300005578 | Bacteria | 50270 |
| 136 | Ga0068856_100005193 | 3300005614 | Bacteria | 12858 |
| 137 | Ga0068856_100359006 | 3300005614 | Bacteria | 1476 |
| 138 | Ga0070702_100000177 | 3300005615 | Bacteria | 20344 |
| 139 | Ga0070702_100011837 | 3300005615 | Bacteria | 4351 |
| 140 | Ga0068852_100000193 | 3300005616 | Bacteria | 41505 |
| 141 | Ga0068852_100042613 | 3300005616 | Bacteria | 3843 |
| 142 | Ga0068852_100087017 | 3300005616 | Bacteria | 2787 |
| 143 | Ga0068859_100002972 | 3300005617 | Bacteria | 17185 |
| 144 | Ga0068864_100000226 | 3300005618 | Bacteria | 50929 |
| 145 | Ga0068864_100012607 | 3300005618 | Bacteria | 6989 |
| 146 | Ga0068864_100080542 | 3300005618 | Bacteria | 2853 |
| 147 | Ga0068866_10000199 | 3300005718 | Bacteria | 28222 |
| 148 | Ga0068861_100000328 | 3300005719 | Bacteria | 26783 |
| 149 | Ga0068851_10084106 | 3300005834 | Bacteria | 1666 |
| 150 | Ga0068851_10161546 | 3300005834 | Bacteria | 1231 |
| 151 | Ga0068870_10000388 | 3300005840 | Bacteria | 16520 |
| 152 | Ga0068863_100001877 | 3300005841 | Bacteria | 20878 |
| 153 | Ga0068863_100144226 | 3300005841 | Bacteria | 2277 |
| 154 | Ga0068858_100000512 | 3300005842 | Bacteria | 40596 |
| 155 | Ga0068858_100096035 | 3300005842 | Bacteria | 2762 |
| 156 | Ga0068860_100001525 | 3300005843 | Bacteria | 24947 |
| 157 | Ga0068860_100154993 | 3300005843 | Bacteria | 2207 |
| 158 | Ga0068862_100000557 | 3300005844 | Bacteria | 38898 |
| 159 | Ga0081455_10000035 | 3300005937 | Bacteria | 136366 |
| 160 | Ga0081455_10002005 | 3300005937 | Bacteria | 24324 |
| 161 | Ga0081540_1000001 | 3300005983 | Bacteria | 293507 |
| 162 | Ga0081540_1014473 | 3300005983 | Bacteria | 5051 |
| 163 | Ga0081540_1054104 | 3300005983 | Bacteria | 1963 |
| 164 | Ga0081539_10010875 | 3300005985 | Bacteria | 7308 |
| 165 | Ga0081539_10074748 | 3300005985 | Bacteria | 1803 |
| 166 | Ga0070717_10003781 | 3300006028 | Bacteria | 10877 |
| 167 | Ga0075365_10007896 | 3300006038 | Bacteria | 5995 |
| 168 | Ga0075365_10051815 | 3300006038 | Bacteria | 2712 |
| 169 | Ga0075365_10151866 | 3300006038 | Bacteria | 1611 |
| 170 | Ga0075363_100089185 | 3300006048 | Bacteria | 1696 |
| 171 | Ga0070712_100037167 | 3300006175 | Bacteria | 3317 |
| 172 | Ga0070712_100065830 | 3300006175 | Bacteria | 2573 |
| 173 | Ga0070712_100077344 | 3300006175 | Bacteria | 2398 |
| 174 | Ga0075367_10053116 | 3300006178 | Bacteria | 2400 |
| 175 | Ga0075367_10083357 | 3300006178 | Bacteria | 1937 |
| 176 | Ga0075369_10022612 | 3300006186 | Bacteria | 2594 |
| 177 | Ga0097621_100000049 | 3300006237 | Bacteria | 61062 |
| 178 | Ga0097621_100037890 | 3300006237 | Bacteria | 3867 |
| 179 | Ga0068871_100000097 | 3300006358 | Bacteria | 52015 |
| 180 | Ga0068871_100005912 | 3300006358 | Bacteria | 8608 |
| 181 | Ga0068871_100045059 | 3300006358 | Bacteria | 3549 |
| 182 | Ga0075428_100184226 | 3300006844 | Bacteria | 2259 |
| 183 | Ga0075428_100195351 | 3300006844 | Bacteria | 2188 |
| 184 | Ga0075430_100000476 | 3300006846 | Bacteria | 30038 |
| 185 | Ga0075431_100186739 | 3300006847 | Bacteria | 2125 |
| 186 | Ga0075431_100306184 | 3300006847 | Unclassified | 1604 |
| 187 | Ga0075434_100000383 | 3300006871 | Bacteria | 32396 |
| 188 | Ga0075434_100068480 | 3300006871 | Bacteria | 3536 |
| 189 | Ga0075434_100078639 | 3300006871 | Unclassified | 3294 |
| 190 | Ga0075434_100127207 | 3300006871 | Bacteria | 2565 |
| 191 | Ga0075434_100339957 | 3300006871 | Bacteria | 1522 |
| 192 | Ga0075429_100038157 | 3300006880 | Bacteria | 4182 |
| 193 | Ga0075429_100101556 | 3300006880 | Bacteria | 2511 |
| 194 | Ga0068865_100000119 | 3300006881 | Bacteria | 39895 |
| 195 | Ga0097620_100002972 | 3300006931 | Bacteria | 17185 |
| 196 | Ga0075435_100003932 | 3300007076 | Bacteria | 10158 |
| 197 | Ga0075435_100034684 | 3300007076 | Bacteria | 4000 |
| 198 | Ga0075435_100045146 | 3300007076 | Bacteria | 3531 |
| 199 | Ga0099794_10014583 | 3300007265 | Bacteria | 3447 |
| 200 | Ga0099795_10000065 | 3300007788 | Bacteria | 18517 |
| 201 | Ga0105251_10024945 | 3300009011 | Bacteria | 3064 |
| 202 | Ga0105240_10134204 | 3300009093 | Bacteria | 2965 |
| 203 | Ga0105240_10200443 | 3300009093 | Bacteria | 2339 |
| 204 | Ga0111539_10000237 | 3300009094 | Bacteria | 65638 |
| 205 | Ga0111539_10001512 | 3300009094 | Bacteria | 31036 |
| 206 | Ga0111539_10268889 | 3300009094 | Bacteria | 1984 |
| 207 | Ga0111539_10295857 | 3300009094 | Bacteria | 1884 |
| 208 | Ga0105245_10000202 | 3300009098 | Bacteria | 57012 |
| 209 | Ga0105245_10003663 | 3300009098 | Bacteria | 13721 |
| 210 | Ga0105245_10037311 | 3300009098 | Bacteria | 4320 |
| 211 | Ga0105247_10003839 | 3300009101 | Bacteria | 9725 |
| 212 | Ga0105247_10010332 | 3300009101 | Bacteria | 5646 |
| 213 | Ga0105247_10211918 | 3300009101 | Bacteria | 1307 |
| 214 | Ga0114129_10207613 | 3300009147 | Bacteria | 2650 |
| 215 | Ga0105243_10001790 | 3300009148 | Bacteria | 18452 |
| 216 | Ga0105243_10026091 | 3300009148 | Bacteria | 4471 |
| 217 | Ga0105241_10000430 | 3300009174 | Bacteria | 31789 |
| 218 | Ga0105242_10002429 | 3300009176 | Bacteria | 14632 |
| 219 | Ga0105242_10132857 | 3300009176 | Bacteria | 2151 |
| 220 | Ga0105242_10158731 | 3300009176 | Bacteria | 1978 |
| 221 | Ga0105248_10001335 | 3300009177 | Bacteria | 27466 |
| 222 | Ga0105248_10098539 | 3300009177 | Bacteria | 3293 |
| 223 | Ga0105237_10011108 | 3300009545 | Bacteria | 9545 |
| 224 | Ga0105237_10232742 | 3300009545 | Bacteria | 1843 |
| 225 | Ga0105237_10511193 | 3300009545 | Bacteria | 1208 |
| 226 | Ga0105238_10013781 | 3300009551 | Bacteria | 8171 |
| 227 | Ga0105238_10054694 | 3300009551 | Bacteria | 4007 |
| 228 | Ga0105238_10215181 | 3300009551 | Bacteria | 1898 |
| 229 | Ga0105249_10000215 | 3300009553 | Bacteria | 66439 |
| 230 | Ga0105249_10039083 | 3300009553 | Bacteria | 4307 |
| 231 | Ga0105239_10028262 | 3300010375 | Bacteria | 6169 |
| 232 | Ga0105239_10048716 | 3300010375 | Bacteria | 4646 |
| 233 | Ga0105239_10369213 | 3300010375 | Bacteria | 1621 |
| 234 | Ga0105246_10000019 | 3300011119 | Bacteria | 62666 |
| 235 | Ga0105246_10176718 | 3300011119 | Bacteria | 1640 |
| 236 | Ga0105246_10189296 | 3300011119 | Bacteria | 1591 |
| 237 | Ga0157373_10039499 | 3300013100 | Bacteria | 3379 |
| 238 | Ga0157373_10106324 | 3300013100 | Bacteria | 1973 |
| 239 | Ga0157371_10018650 | 3300013102 | Bacteria | 5126 |
| 240 | Ga0157371_10140280 | 3300013102 | Bacteria | 1722 |
| 241 | Ga0157370_10004500 | 3300013104 | Bacteria | 15977 |
| 242 | Ga0157370_10051700 | 3300013104 | Bacteria | 3924 |
| 243 | Ga0157369_10005666 | 3300013105 | Bacteria | 14509 |
| 244 | Ga0157374_10001742 | 3300013296 | Bacteria | 18255 |
| 245 | Ga0157374_10065644 | 3300013296 | Bacteria | 3409 |
| 246 | Ga0157374_10163948 | 3300013296 | Bacteria | 2166 |
| 247 | Ga0157378_10002701 | 3300013297 | Bacteria | 15807 |
| 248 | Ga0157378_10054488 | 3300013297 | Bacteria | 3560 |
| 249 | Ga0157378_10119950 | 3300013297 | Bacteria | 2423 |
| 250 | Ga0163162_10001187 | 3300013306 | Bacteria | 24299 |
| 251 | Ga0163162_10192309 | 3300013306 | Bacteria | 2168 |
| 252 | Ga0163162_10461116 | 3300013306 | Unclassified | 1402 |
| 253 | Ga0157372_10123858 | 3300013307 | Bacteria | 2971 |
| 254 | Ga0157375_10000135 | 3300013308 | Bacteria | 73281 |
| 255 | Ga0157375_10010957 | 3300013308 | Bacteria | 7996 |
| 256 | Ga0157375_10121543 | 3300013308 | Bacteria | 2721 |
| 257 | Ga0163163_10011189 | 3300014325 | Bacteria | 8127 |
| 258 | Ga0163163_10019264 | 3300014325 | Bacteria | 6406 |
| 259 | Ga0163163_10259652 | 3300014325 | Bacteria | 1788 |
| 260 | Ga0163163_10268805 | 3300014325 | Bacteria | 1756 |
| 261 | Ga0157380_10000284 | 3300014326 | Bacteria | 30507 |
| 262 | Ga0157380_10119042 | 3300014326 | Bacteria | 2233 |
| 263 | Ga0157380_10308622 | 3300014326 | Bacteria | 1461 |
| 264 | Ga0182008_10005672 | 3300014497 | Bacteria | 7070 |
| 265 | Ga0157379_10000065 | 3300014968 | Bacteria | 67475 |
| 266 | Ga0157379_10075984 | 3300014968 | Bacteria | 3008 |
| 267 | Ga0157379_10210808 | 3300014968 | Bacteria | 1759 |
| 268 | Ga0157379_10269787 | 3300014968 | Bacteria | 1547 |
| 269 | Ga0157376_10000180 | 3300014969 | Bacteria | 43524 |
| 270 | Ga0157376_10163553 | 3300014969 | Bacteria | 2020 |
| 271 | Ga0157376_10194758 | 3300014969 | Bacteria | 1861 |
| 272 | Ga0163161_10001579 | 3300017792 | Bacteria | 16787 |
| 273 | Ga0213876_10050387 | 3300021384 | Bacteria | 2200 |
| 274 | Ga0207666_1000078 | 3300025271 | Bacteria | 16262 |
| 275 | Ga0207666_1000744 | 3300025271 | Bacteria | 3908 |
| 276 | Ga0207673_1000034 | 3300025290 | Bacteria | 10698 |
| 277 | Ga0207697_10000370 | 3300025315 | Bacteria | 25198 |
| 278 | Ga0207697_10003696 | 3300025315 | Bacteria | 7483 |
| 279 | Ga0207656_10068370 | 3300025321 | Bacteria | 1574 |
| 280 | Ga0207653_10001699 | 3300025885 | Bacteria | 7037 |
| 281 | Ga0207682_10000304 | 3300025893 | Bacteria | 22182 |
| 282 | Ga0207642_10000268 | 3300025899 | Bacteria | 15628 |
| 283 | Ga0207642_10070941 | 3300025899 | Bacteria | 1657 |
| 284 | Ga0207642_10082622 | 3300025899 | Bacteria | 1564 |
| 285 | Ga0207710_10055539 | 3300025900 | Bacteria | 1785 |
| 286 | Ga0207688_10000014 | 3300025901 | Bacteria | 59269 |
| 287 | Ga0207688_10004456 | 3300025901 | Bacteria | 7625 |
| 288 | Ga0207688_10044106 | 3300025901 | Bacteria | 2485 |
| 289 | Ga0207680_10006371 | 3300025903 | Bacteria | 5702 |
| 290 | Ga0207680_10019425 | 3300025903 | Bacteria | 3634 |
| 291 | Ga0207647_10004406 | 3300025904 | Bacteria | 10441 |
| 292 | Ga0207647_10014236 | 3300025904 | Bacteria | 5488 |
| 293 | Ga0207647_10043164 | 3300025904 | Bacteria | 2823 |
| 294 | Ga0207699_10141012 | 3300025906 | Bacteria | 1584 |
| 295 | Ga0207699_10162760 | 3300025906 | Bacteria | 1487 |
| 296 | Ga0207645_10000160 | 3300025907 | Bacteria | 53155 |
| 297 | Ga0207645_10111993 | 3300025907 | Bacteria | 1767 |
| 298 | Ga0207645_10145884 | 3300025907 | Bacteria | 1543 |
| 299 | Ga0207643_10000009 | 3300025908 | Bacteria | 160496 |
| 300 | Ga0207643_10001904 | 3300025908 | Bacteria | 11507 |
| 301 | Ga0207654_10000441 | 3300025911 | Bacteria | 23641 |
| 302 | Ga0207654_10036529 | 3300025911 | Bacteria | 2745 |
| 303 | Ga0207707_10000554 | 3300025912 | Bacteria | 37851 |
| 304 | Ga0207707_10009645 | 3300025912 | Bacteria | 8375 |
| 305 | Ga0207707_10061954 | 3300025912 | Bacteria | 3255 |
| 306 | Ga0207707_10148250 | 3300025912 | Bacteria | 2051 |
| 307 | Ga0207671_10011327 | 3300025914 | Bacteria | 7265 |
| 308 | Ga0207671_10260066 | 3300025914 | Bacteria | 1366 |
| 309 | Ga0207693_10015698 | 3300025915 | Bacteria | 6069 |
| 310 | Ga0207693_10017770 | 3300025915 | Bacteria | 5671 |
| 311 | Ga0207693_10018018 | 3300025915 | Bacteria | 5628 |
| 312 | Ga0207693_10020784 | 3300025915 | Bacteria | 5220 |
| 313 | Ga0207660_10000161 | 3300025917 | Bacteria | 41972 |
| 314 | Ga0207660_10041014 | 3300025917 | Bacteria | 3242 |
| 315 | Ga0207662_10004160 | 3300025918 | Bacteria | 7573 |
| 316 | Ga0207662_10037644 | 3300025918 | Bacteria | 2832 |
| 317 | Ga0207657_10000980 | 3300025919 | Bacteria | 30300 |
| 318 | Ga0207657_10010318 | 3300025919 | Bacteria | 9328 |
| 319 | Ga0207649_10000429 | 3300025920 | Bacteria | 30596 |
| 320 | Ga0207652_10000364 | 3300025921 | Bacteria | 47007 |
| 321 | Ga0207652_10026006 | 3300025921 | Bacteria | 4871 |
| 322 | Ga0207652_10032435 | 3300025921 | Bacteria | 4391 |
| 323 | Ga0207652_10045443 | 3300025921 | Unclassified | 3745 |
| 324 | Ga0207652_10192469 | 3300025921 | Bacteria | 1835 |
| 325 | Ga0207681_10000035 | 3300025923 | Bacteria | 161792 |
| 326 | Ga0207694_10145574 | 3300025924 | Bacteria | 1907 |
| 327 | Ga0207650_10002514 | 3300025925 | Bacteria | 12729 |
| 328 | Ga0207650_10112041 | 3300025925 | Bacteria | 2113 |
| 329 | Ga0207659_10000027 | 3300025926 | Bacteria | 135454 |
| 330 | Ga0207659_10028682 | 3300025926 | Bacteria | 3784 |
| 331 | Ga0207659_10066360 | 3300025926 | Bacteria | 2619 |
| 332 | Ga0207687_10000551 | 3300025927 | Bacteria | 25176 |
| 333 | Ga0207700_10004694 | 3300025928 | Bacteria | 8096 |
| 334 | Ga0207700_10077925 | 3300025928 | Bacteria | 2576 |
| 335 | Ga0207664_10154154 | 3300025929 | Bacteria | 1954 |
| 336 | Ga0207664_10184443 | 3300025929 | Bacteria | 1793 |
| 337 | Ga0207644_10014608 | 3300025931 | Bacteria | 5257 |
| 338 | Ga0207644_10190907 | 3300025931 | Bacteria | 1610 |
| 339 | Ga0207690_10000056 | 3300025932 | Bacteria | 101387 |
| 340 | Ga0207690_10025916 | 3300025932 | Bacteria | 3688 |
| 341 | Ga0207690_10044581 | 3300025932 | Bacteria | 2925 |
| 342 | Ga0207706_10000307 | 3300025933 | Bacteria | 52944 |
| 343 | Ga0207706_10013650 | 3300025933 | Bacteria | 7377 |
| 344 | Ga0207706_10035216 | 3300025933 | Bacteria | 4452 |
| 345 | Ga0207686_10001402 | 3300025934 | Bacteria | 13707 |
| 346 | Ga0207686_10027578 | 3300025934 | Bacteria | 3327 |
| 347 | Ga0207686_10066389 | 3300025934 | Bacteria | 2304 |
| 348 | Ga0207686_10076969 | 3300025934 | Bacteria | 2165 |
| 349 | Ga0207709_10000087 | 3300025935 | Bacteria | 155019 |
| 350 | Ga0207670_10000263 | 3300025936 | Bacteria | 32926 |
| 351 | Ga0207670_10049725 | 3300025936 | Bacteria | 2806 |
| 352 | Ga0207670_10277822 | 3300025936 | Bacteria | 1304 |
| 353 | Ga0207669_10000052 | 3300025937 | Bacteria | 58284 |
| 354 | Ga0207669_10026216 | 3300025937 | Bacteria | 3166 |
| 355 | Ga0207704_10000063 | 3300025938 | Bacteria | 74699 |
| 356 | Ga0207665_10000631 | 3300025939 | Bacteria | 23652 |
| 357 | Ga0207691_10000167 | 3300025940 | Bacteria | 60999 |
| 358 | Ga0207691_10021468 | 3300025940 | Bacteria | 6096 |
| 359 | Ga0207691_10055482 | 3300025940 | Bacteria | 3611 |
| 360 | Ga0207691_10172496 | 3300025940 | Bacteria | 1893 |
| 361 | Ga0207711_10006590 | 3300025941 | Bacteria | 9775 |
| 362 | Ga0207711_10016598 | 3300025941 | Bacteria | 6115 |
| 363 | Ga0207689_10000155 | 3300025942 | Bacteria | 59178 |
| 364 | Ga0207689_10036982 | 3300025942 | Bacteria | 4052 |
| 365 | Ga0207689_10039328 | 3300025942 | Bacteria | 3916 |
| 366 | Ga0207661_10000072 | 3300025944 | Bacteria | 69126 |
| 367 | Ga0207661_10015191 | 3300025944 | Bacteria | 5662 |
| 368 | Ga0207679_10000057 | 3300025945 | Bacteria | 104912 |
| 369 | Ga0207679_10003395 | 3300025945 | Bacteria | 9824 |
| 370 | Ga0207679_10326299 | 3300025945 | Bacteria | 1331 |
| 371 | Ga0207679_10353677 | 3300025945 | Bacteria | 1281 |
| 372 | Ga0207667_10113025 | 3300025949 | Bacteria | 2800 |
| 373 | Ga0207667_10256828 | 3300025949 | Bacteria | 1787 |
| 374 | Ga0207651_10000087 | 3300025960 | Bacteria | 41160 |
| 375 | Ga0207651_10037972 | 3300025960 | Bacteria | 3160 |
| 376 | Ga0207712_10000122 | 3300025961 | Bacteria | 83730 |
| 377 | Ga0207712_10019090 | 3300025961 | Bacteria | 4473 |
| 378 | Ga0207668_10000084 | 3300025972 | Bacteria | 70850 |
| 379 | Ga0207640_10000878 | 3300025981 | Bacteria | 17041 |
| 380 | Ga0207658_10004557 | 3300025986 | Bacteria | 9613 |
| 381 | Ga0207658_10015437 | 3300025986 | Bacteria | 5240 |
| 382 | Ga0207658_10031452 | 3300025986 | Bacteria | 3769 |
| 383 | Ga0207677_10000549 | 3300026023 | Bacteria | 23737 |
| 384 | Ga0207703_10005829 | 3300026035 | Bacteria | 9867 |
| 385 | Ga0207703_10081284 | 3300026035 | Bacteria | 2701 |
| 386 | Ga0207639_10001925 | 3300026041 | Bacteria | 13946 |
| 387 | Ga0207639_10047666 | 3300026041 | Bacteria | 3240 |
| 388 | Ga0207678_10000187 | 3300026067 | Bacteria | 53154 |
| 389 | Ga0207678_10027526 | 3300026067 | Bacteria | 4961 |
| 390 | Ga0207678_10036968 | 3300026067 | Bacteria | 4250 |
| 391 | Ga0207708_10000158 | 3300026075 | Bacteria | 53154 |
| 392 | Ga0207708_10002015 | 3300026075 | Bacteria | 14967 |
| 393 | Ga0207708_10002641 | 3300026075 | Bacteria | 13186 |
| 394 | Ga0207702_10001960 | 3300026078 | Bacteria | 20035 |
| 395 | Ga0207702_10073421 | 3300026078 | Bacteria | 2949 |
| 396 | Ga0207641_10000896 | 3300026088 | Bacteria | 31014 |
| 397 | Ga0207641_10012014 | 3300026088 | Bacteria | 7105 |
| 398 | Ga0207648_10001167 | 3300026089 | Bacteria | 29390 |
| 399 | Ga0207648_10003124 | 3300026089 | Bacteria | 17485 |
| 400 | Ga0207648_10038868 | 3300026089 | Bacteria | 4187 |
| 401 | Ga0207676_10000089 | 3300026095 | Bacteria | 82462 |
| 402 | Ga0207676_10009698 | 3300026095 | Bacteria | 6845 |
| 403 | Ga0207676_10074074 | 3300026095 | Bacteria | 2742 |
| 404 | Ga0207676_10349171 | 3300026095 | Bacteria | 1367 |
| 405 | Ga0207674_10001478 | 3300026116 | Bacteria | 30348 |
| 406 | Ga0207675_100000229 | 3300026118 | Bacteria | 52966 |
| 407 | Ga0207675_100014980 | 3300026118 | Bacteria | 7237 |
| 408 | Ga0207675_100028481 | 3300026118 | Bacteria | 5201 |
| 409 | Ga0207683_10000525 | 3300026121 | Bacteria | 35508 |
| 410 | Ga0207683_10045639 | 3300026121 | Bacteria | 3832 |
| 411 | Ga0209983_1004225 | 3300027665 | Bacteria | 3027 |
| 412 | Ga0209971_1009585 | 3300027682 | Bacteria | 2294 |
| 413 | Ga0209998_10000949 | 3300027717 | Bacteria | 7357 |
| 414 | Ga0209974_10003008 | 3300027876 | Bacteria | 6101 |
| 415 | Ga0207428_10000037 | 3300027907 | Bacteria | 218857 |
| 416 | Ga0207428_10000308 | 3300027907 | Bacteria | 64810 |
| 417 | Ga0207428_10122931 | 3300027907 | Bacteria | 1989 |
| 418 | Ga0207428_10166664 | 3300027907 | Bacteria | 1670 |
| 419 | Ga0268266_10140836 | 3300028379 | Bacteria | 2164 |
| 420 | Ga0268265_10000195 | 3300028380 | Bacteria | 70871 |
| 421 | Ga0268264_10000526 | 3300028381 | Bacteria | 48503 |
| 422 | Ga0268264_10045619 | 3300028381 | Bacteria | 3639 |
| 423 | Ga0268264_10316118 | 3300028381 | Unclassified | 1475 |
| 424 | Ga0265337_1000963 | 3300028556 | Bacteria | 15083 |
| 425 | Ga0265337_1002095 | 3300028556 | Bacteria | 9423 |
| 426 | Ga0265334_10002101 | 3300028573 | Bacteria | 9409 |
| 427 | Ga0265338_10016636 | 3300028800 | Bacteria | 7979 |
| 428 | Ga0265338_10043272 | 3300028800 | Bacteria | 4179 |
| 429 | Ga0265760_10006486 | 3300031090 | Bacteria | 3344 |
| 430 | Ga0265330_10003043 | 3300031235 | Bacteria | 8895 |
| 431 | Ga0265325_10000352 | 3300031241 | Bacteria | 32405 |
| 432 | Ga0265325_10000736 | 3300031241 | Bacteria | 23678 |
| 433 | Ga0265325_10010060 | 3300031241 | Bacteria | 5494 |
| 434 | Ga0265339_10005391 | 3300031249 | Bacteria | 8520 |
| 435 | Ga0265339_10042125 | 3300031249 | Bacteria | 2529 |
| 436 | Ga0265313_10000106 | 3300031595 | Bacteria | 83923 |
| 437 | Ga0265313_10000686 | 3300031595 | Bacteria | 34918 |
| 438 | Ga0265313_10045737 | 3300031595 | Bacteria | 2129 |
| 439 | Ga0316575_10045914 | 3300031665 | Bacteria | 1735 |
| 440 | Ga0265314_10003780 | 3300031711 | Bacteria | 14466 |
| 441 | Ga0265342_10000882 | 3300031712 | Bacteria | 29894 |
| 442 | Ga0265342_10004819 | 3300031712 | Bacteria | 10468 |
| 443 | Ga0307416_100339168 | 3300032002 | Bacteria | 1515 |
| 444 | Ga0316583_10000161 | 3300032133 | Bacteria | 16491 |
| 445 | Ga0373930_0000020 | 3300034816 | Bacteria | 15356 |
| 446 | Ga0373948_0000371 | 3300034817 | Bacteria | 5533 |
| 447 | Ga0373948_0008576 | 3300034817 | Bacteria | 1743 |
| 448 | Ga0373958_0000533 | 3300034819 | Bacteria | 4759 |
| 449 | Ga0373958_0000699 | 3300034819 | Bacteria | 4250 |
| 450 | Ga0373959_0000539 | 3300034820 | Bacteria | 6764 |
| 451 | Ga0373938_0000748 | 3300034957 | Bacteria | 5254 |
| 452 | Ga0373926_0022850 | 3300035083 | Bacteria | 2170 |
| 453 | Ga0373926_0026611 | 3300035083 | Bacteria | 2024 |
| 454 | Ga0373928_0001398 | 3300035084 | Bacteria | 4709 |
| 455 | Ga0373929_0001728 | 3300035085 | Bacteria | 4107 |
| 456 | Ga0373934_0018802 | 3300035086 | Bacteria | 2647 |
| 457 | Ga0373934_0020424 | 3300035086 | Bacteria | 2545 |
| 458 | Ga0373940_0000325 | 3300035088 | Bacteria | 7005 |
| 459 | Ga0373944_0006563 | 3300035089 | Bacteria | 3091 |
| 460 | Ga0373944_0010969 | 3300035089 | Bacteria | 2478 |
| 461 | Ga0373949_0001003 | 3300035090 | Bacteria | 8717 |
| 462 | Ga0373949_0001117 | 3300035090 | Bacteria | 8122 |
| 463 | Ga0373949_0006408 | 3300035090 | Bacteria | 2588 |
| 464 | Ga0373951_0000547 | 3300035091 | Bacteria | 10574 |
| 465 | Ga0373952_0000114 | 3300035092 | Bacteria | 10971 |
| 466 | Ga0373952_0000713 | 3300035092 | Bacteria | 5943 |
| 467 | Ga0373932_0001186 | 3300035112 | Bacteria | 7459 |
| 468 | Ga0373932_0002300 | 3300035112 | Bacteria | 4857 |
| 469 | Ga0373932_0009525 | 3300035112 | Bacteria | 2336 |
| 470 | Ga0373936_0004882 | 3300035113 | Bacteria | 5055 |
| 471 | Ga0373939_0000261 | 3300035114 | Bacteria | 14162 |
| 472 | Ga0373939_0000360 | 3300035114 | Bacteria | 11493 |
| 473 | Ga0373939_0042053 | 3300035114 | Bacteria | 1380 |
| 474 | Ga0373941_0001573 | 3300035115 | Bacteria | 4850 |
| 475 | Ga0373941_0001805 | 3300035115 | Bacteria | 4608 |
| 476 | Ga0373945_0008327 | 3300035116 | Bacteria | 3373 |
| 477 | Ga0373945_0008419 | 3300035116 | Bacteria | 3361 |
| 478 | Ga0373945_0020000 | 3300035116 | Bacteria | 2289 |
| 479 | Ga0373953_0000785 | 3300035117 | Bacteria | 8844 |
| 480 | Ga0373953_0001943 | 3300035117 | Bacteria | 6145 |
| 481 | Ga0373953_0032058 | 3300035117 | Bacteria | 2047 |
| 482 | Ga0373954_0000969 | 3300035118 | Bacteria | 11258 |
| 483 | Ga0373954_0009797 | 3300035118 | Bacteria | 4217 |
| 484 | Ga0373956_0011124 | 3300035119 | Bacteria | 3705 |
| 485 | Ga0373956_0054836 | 3300035119 | Bacteria | 1797 |
| 486 | Ga0373957_0005912 | 3300035120 | Bacteria | 3826 |
| 487 | Ga0373960_0003891 | 3300035121 | Bacteria | 3403 |
| 488 | Ga0373960_0008095 | 3300035121 | Bacteria | 2510 |
| 489 | Ga0373960_0017544 | 3300035121 | Bacteria | 1856 |
| 490 | Ga0373943_0000306 | 3300035170 | Bacteria | 20449 |
| 491 | Ga0373943_0001944 | 3300035170 | Bacteria | 9358 |
| 492 | Ga0373943_0020329 | 3300035170 | Bacteria | 3059 |
| 493 | Ga0373946_0001059 | 3300035171 | Bacteria | 9481 |
| 494 | Ga0373946_0022197 | 3300035171 | Bacteria | 2468 |
| 495 | Ga0373946_0026560 | 3300035171 | Bacteria | 2285 |
| 496 | Ga0373946_0084295 | 3300035171 | Bacteria | 1397 |
| 497 | Ga0373955_0000039 | 3300035172 | Bacteria | 51994 |
| 498 | Ga0373955_0010587 | 3300035172 | Bacteria | 4361 |
| 499 | Ga0373955_0114296 | 3300035172 | Bacteria | 1563 |
| 500 | Ga0373942_0001477 | 3300035207 | Bacteria | 6050 |
| 501 | Ga0373942_0003320 | 3300035207 | Bacteria | 3782 |
| 502 | Ga0373961_0001845 | 3300035241 | Bacteria | 5795 |
| 503 | Ga0373962_0000273 | 3300035242 | Bacteria | 11116 |
| 504 | Ga0373962_0000354 | 3300035242 | Bacteria | 10085 |
| 505 | Ga0373962_0006957 | 3300035242 | Bacteria | 2757 |
| 506 | Ga0373962_0037273 | 3300035242 | Unclassified | 1357 |
| 507 | Ga0373924_0045126 | 3300035410 | Bacteria | 1812 |
| 508 | Ga0373924_0047222 | 3300035410 | Bacteria | 1776 |
| 509 | Ga0373931_0000082 | 3300035691 | Bacteria | 44600 |
| 510 | Ga0373931_0007665 | 3300035691 | Bacteria | 5092 |
| 511 | Ga0373931_0010622 | 3300035691 | Bacteria | 4427 |
| 512 | Ga0373931_0151827 | 3300035691 | Bacteria | 1351 |
| 513 | Ga0373935_0000079 | 3300035692 | Bacteria | 41989 |
| 514 | Ga0373935_0003255 | 3300035692 | Bacteria | 9390 |
| 515 | Ga0373935_0010573 | 3300035692 | Bacteria | 5538 |
| 516 | Ga0373935_0116947 | 3300035692 | Unclassified | 1776 |
| 517 | Ga0373927_0013767 | 3300035695 | Bacteria | 5368 |
| 518 | Ga0373927_0023394 | 3300035695 | Bacteria | 4046 |
| 519 | Ga0373927_0027655 | 3300035695 | Bacteria | 3702 |
| 520 | Ga0373927_0029598 | 3300035695 | Bacteria | 3570 |
| 521 | Ga0373927_0033383 | 3300035695 | Bacteria | 3351 |
| 522 | Ga0373927_0052750 | 3300035695 | Unclassified | 2629 |
| 523 | Ga0373933_0004704 | 3300035724 | Bacteria | 7475 |
| 524 | Ga0373933_0022723 | 3300035724 | Bacteria | 3575 |
| 525 | Ga0373933_0031487 | 3300035724 | Bacteria | 3077 |
| 526 | Ga0373933_0101185 | 3300035724 | Bacteria | 1788 |
| 527 | Ga0373947_0001044 | 3300035725 | Bacteria | 16908 |
| 528 | Ga0373947_0013808 | 3300035725 | Bacteria | 4629 |
| 529 | Ga0373937_0000223 | 3300036401 | Bacteria | 54957 |
| 530 | Ga0373937_0003786 | 3300036401 | Bacteria | 12792 |
| 531 | Ga0373937_0005292 | 3300036401 | Bacteria | 11025 |
| 532 | Ga0373937_0011036 | 3300036401 | Bacteria | 7921 |
| 533 | Ga0373937_0029554 | 3300036401 | Bacteria | 4964 |
| 534 | Ga0373937_0112702 | 3300036401 | Bacteria | 2530 |
| 535 | Ga0373937_0112952 | 3300036401 | Bacteria | 2527 |
| 536 | Ga0373937_0307400 | 3300036401 | Bacteria | 1499 |
| 537 | Ga0316582_0129027 | 3300036647 | Bacteria | 1697 |
| 538 | Ga0373925_0000002 | 3300037068 | Bacteria | 368879 |
| 539 | Ga0373925_0005123 | 3300037068 | Bacteria | 9818 |
| 540 | Ga0373925_0008940 | 3300037068 | Bacteria | 7298 |
| 541 | Ga0373925_0036705 | 3300037068 | Bacteria | 3616 |
| 542 | Ga0395899_0036755 | 3300037312 | Bacteria | 3672 |
| 543 | Ga0395899_0210759 | 3300037312 | Bacteria | 1350 |
| 544 | Ga0395900_0008255 | 3300037418 | Bacteria | 10721 |
| 545 | Ga0395900_0238696 | 3300037418 | Bacteria | 1824 |
| 546 | Ga0395898_0011916 | 3300037466 | Bacteria | 9006 |
| 547 | Ga0436364_0562385 | 3300037853 | Bacteria | 3895 |
| 548 | Ga0436364_0575338 | 3300037853 | Bacteria | 1455 |
| 549 | Ga0395901_0009281 | 3300038443 | Bacteria | 9972 |
| 550 | Ga0395901_0014372 | 3300038443 | Bacteria | 8058 |
| 551 | Ga0242420_008230 | 3300038996 | Bacteria | 1687 |
| 552 | Ga0436365_0855986 | 3300039437 | Bacteria | 7757 |
| 553 | Ga0436365_1407541 | 3300039437 | Bacteria | 11292 |
| 554 | Ga0436360_0966528 | 3300039438 | Bacteria | 2511 |
| 555 | Ga0436363_0889203 | 3300039450 | Bacteria | 4880 |
| 556 | Ga0439443_000439 | 3300042003 | Bacteria | 3624 |
| 557 | Ga0439444_0000655 | 3300042437 | Bacteria | 4021 |
| 558 | Ga0439464_0007110 | 3300042439 | Bacteria | 2925 |
| 559 | Ga0439460_0005185 | 3300042461 | Bacteria | 3191 |
| 560 | Ga0439460_0027028 | 3300042461 | Bacteria | 1609 |
| 561 | Ga0466965_0136901 | 3300044683 | Bacteria | 1273 |
| 562 | Ga0466963_0055121 | 3300044694 | Bacteria | 2643 |
| 563 | Ga0466971_0091002 | 3300044719 | Bacteria | 1397 |
| 564 | Ga0466959_0027730 | 3300045049 | Bacteria | 4200 |
| 565 | Ga0466959_0184081 | 3300045049 | Bacteria | 1460 |
| 566 | Ga0466958_0036333 | 3300045836 | Bacteria | 2948 |
| 567 | Ga0466967_0075883 | 3300045976 | Bacteria | 3022 |
| 568 | Ga0466967_0102678 | 3300045976 | Bacteria | 2616 |
| 569 | Ga0495592_0000475 | 3300046454 | Bacteria | 29441 |
| 570 | Ga0495592_0070656 | 3300046454 | Bacteria | 2542 |
| 571 | Ga0495603_0033346 | 3300046455 | Bacteria | 3098 |
| 572 | Ga0495603_0109535 | 3300046455 | Bacteria | 1611 |
| 573 | Ga0495629_0000222 | 3300046459 | Bacteria | 50600 |
| 574 | Ga0495629_0025089 | 3300046459 | Bacteria | 4240 |
| 575 | Ga0495629_0114884 | 3300046459 | Unclassified | 1876 |
| 576 | Ga0495641_0038095 | 3300046461 | Bacteria | 2248 |
| 577 | Ga0495641_0052254 | 3300046461 | Bacteria | 1863 |
| 578 | Ga0495651_0005638 | 3300046462 | Bacteria | 9539 |
| 579 | Ga0495651_0014733 | 3300046462 | Bacteria | 6046 |
| 580 | Ga0495651_0094361 | 3300046462 | Bacteria | 2239 |
| 581 | Ga0495653_0000006 | 3300046463 | Bacteria | 363285 |
| 582 | Ga0495580_0023974 | 3300046472 | Bacteria | 4473 |
| 583 | Ga0495580_0034407 | 3300046472 | Bacteria | 3648 |
| 584 | Ga0495580_0047493 | 3300046472 | Bacteria | 3043 |
| 585 | Ga0495582_0008516 | 3300046473 | Bacteria | 5657 |
| 586 | Ga0495582_0028249 | 3300046473 | Bacteria | 3078 |
| 587 | Ga0495582_0196782 | 3300046473 | Unclassified | 1150 |
| 588 | Ga0495662_0001482 | 3300046476 | Bacteria | 11622 |
| 589 | Ga0495662_0008512 | 3300046476 | Bacteria | 5042 |
| 590 | Ga0495662_0009876 | 3300046476 | Bacteria | 4688 |
| 591 | Ga0495664_0000002 | 3300046477 | Bacteria | 625183 |
| 592 | Ga0495664_0000553 | 3300046477 | Bacteria | 18839 |
| 593 | Ga0495664_0003233 | 3300046477 | Bacteria | 8850 |
| 594 | Ga0495584_0011722 | 3300046491 | Bacteria | 4483 |
| 595 | Ga0495594_0017544 | 3300046499 | Bacteria | 3783 |
| 596 | Ga0495594_0059828 | 3300046499 | Bacteria | 2107 |
| 597 | Ga0495594_0136075 | 3300046499 | Bacteria | 1392 |
| 598 | Ga0495608_0000009 | 3300046511 | Bacteria | 266614 |
| 599 | Ga0495608_0002323 | 3300046511 | Bacteria | 13726 |
| 600 | Ga0495608_0068939 | 3300046511 | Bacteria | 2312 |
| 601 | Ga0495618_0000005 | 3300046514 | Bacteria | 230421 |
| 602 | Ga0495618_0002320 | 3300046514 | Bacteria | 12323 |
| 603 | Ga0495618_0006486 | 3300046514 | Bacteria | 7103 |
| 604 | Ga0495618_0087504 | 3300046514 | Bacteria | 1992 |
| 605 | Ga0495628_0000002 | 3300046516 | Bacteria | 589399 |
| 606 | Ga0495628_0011343 | 3300046516 | Bacteria | 7543 |
| 607 | Ga0495630_0000240 | 3300046517 | Bacteria | 43911 |
| 608 | Ga0495630_0055666 | 3300046517 | Bacteria | 2964 |
| 609 | Ga0495630_0192869 | 3300046517 | Bacteria | 1554 |
| 610 | Ga0495630_0270771 | 3300046517 | Unclassified | 1297 |
| 611 | Ga0495652_0000004 | 3300046529 | Bacteria | 588877 |
| 612 | Ga0495652_0015928 | 3300046529 | Bacteria | 6728 |
| 613 | Ga0495652_0034412 | 3300046529 | Bacteria | 4415 |
| 614 | Ga0495652_0039358 | 3300046529 | Bacteria | 4088 |
| 615 | Ga0495652_0095921 | 3300046529 | Bacteria | 2416 |
| 616 | Ga0495665_0003071 | 3300046531 | Bacteria | 9032 |
| 617 | Ga0495665_0004921 | 3300046531 | Bacteria | 7200 |
| 618 | Ga0495665_0012467 | 3300046531 | Bacteria | 4600 |
| 619 | Ga0495640_0000005 | 3300046533 | Bacteria | 318271 |
| 620 | Ga0495640_0008496 | 3300046533 | Bacteria | 8049 |
| 621 | Ga0495640_0014607 | 3300046533 | Bacteria | 5934 |
| 622 | Ga0495640_0019242 | 3300046533 | Bacteria | 5043 |
| 623 | Ga0495640_0052361 | 3300046533 | Bacteria | 2803 |
| 624 | Ga0495586_0006088 | 3300046535 | Bacteria | 6450 |
| 625 | Ga0495586_0016023 | 3300046535 | Bacteria | 3988 |
| 626 | Ga0495586_0058039 | 3300046535 | Unclassified | 2101 |
| 627 | Ga0495586_0058565 | 3300046535 | Bacteria | 2092 |
| 628 | Ga0495587_0000007 | 3300046536 | Bacteria | 290788 |
| 629 | Ga0495587_0006576 | 3300046536 | Bacteria | 7568 |
| 630 | Ga0495587_0024692 | 3300046536 | Bacteria | 3681 |
| 631 | Ga0495645_0000003 | 3300046543 | Bacteria | 570133 |
| 632 | Ga0495645_0020641 | 3300046543 | Bacteria | 4756 |
| 633 | Ga0495645_0025774 | 3300046543 | Bacteria | 4268 |
| 634 | Ga0495622_0060647 | 3300046557 | Unclassified | 1752 |
| 635 | Ga0495667_0000002 | 3300046559 | Bacteria | 437535 |
| 636 | Ga0495667_0002675 | 3300046559 | Bacteria | 11909 |
| 637 | Ga0495667_0019291 | 3300046559 | Bacteria | 4601 |
| 638 | Ga0495667_0045829 | 3300046559 | Bacteria | 2893 |
| 639 | Ga0495656_0060932 | 3300046615 | Bacteria | 1646 |
| 640 | Ga0495656_0091601 | 3300046615 | Bacteria | 1391 |
| 641 | Ga0495634_0000129 | 3300046642 | Bacteria | 65082 |
| 642 | Ga0495634_0008810 | 3300046642 | Bacteria | 7481 |
| 643 | Ga0495634_0035176 | 3300046642 | Bacteria | 3433 |
| 644 | Ga0495634_0118185 | 3300046642 | Unclassified | 1699 |
| 645 | Ga0495634_0141283 | 3300046642 | Bacteria | 1528 |
| 646 | Ga0495635_0000020 | 3300046663 | Bacteria | 189698 |
| 647 | Ga0495635_0002537 | 3300046663 | Bacteria | 12495 |
| 648 | Ga0495635_0002623 | 3300046663 | Bacteria | 12304 |
| 649 | Ga0495635_0081225 | 3300046663 | Bacteria | 2218 |
| 650 | Ga0495657_0004771 | 3300046675 | Bacteria | 10810 |
| 651 | Ga0495657_0045424 | 3300046675 | Bacteria | 2981 |
| 652 | Ga0495657_0099372 | 3300046675 | Bacteria | 1856 |
| 653 | Ga0495599_0000001 | 3300046678 | Bacteria | 537563 |
| 654 | Ga0495599_0041642 | 3300046678 | Bacteria | 2883 |
| 655 | Ga0495623_0000001 | 3300046679 | Bacteria | 313861 |
| 656 | Ga0495623_0001394 | 3300046679 | Bacteria | 16421 |
| 657 | Ga0495646_0000013 | 3300046680 | Bacteria | 159700 |
| 658 | Ga0495646_0001135 | 3300046680 | Bacteria | 15537 |
| 659 | Ga0495647_0003047 | 3300046681 | Bacteria | 5340 |
| 660 | Ga0495647_0003641 | 3300046681 | Bacteria | 4947 |
| 661 | Ga0495647_0006607 | 3300046681 | Bacteria | 3849 |
| 662 | Ga0495647_0025809 | 3300046681 | Bacteria | 2149 |
| 663 | Ga0495658_0000656 | 3300046683 | Bacteria | 18755 |
| 664 | Ga0495658_0010561 | 3300046683 | Bacteria | 4621 |
| 665 | Ga0495658_0031947 | 3300046683 | Bacteria | 2871 |
| 666 | Ga0495613_0004890 | 3300046689 | Bacteria | 10065 |
| 667 | Ga0495613_0017049 | 3300046689 | Bacteria | 5407 |
| 668 | Ga0495613_0028418 | 3300046689 | Bacteria | 4159 |
| 669 | Ga0495613_0134125 | 3300046689 | Bacteria | 1772 |
| 670 | Ga0495613_0155919 | 3300046689 | Bacteria | 1627 |
| 671 | Ga0495624_0004432 | 3300046690 | Bacteria | 10272 |
| 672 | Ga0495624_0005773 | 3300046690 | Bacteria | 8865 |
| 673 | Ga0495671_0124558 | 3300046692 | Bacteria | 1257 |
| 674 | Ga0495600_0000041 | 3300046809 | Bacteria | 75747 |
| 675 | Ga0495600_0000708 | 3300046809 | Bacteria | 17501 |
| 676 | Ga0495600_0038262 | 3300046809 | Bacteria | 3121 |
| 677 | Ga0495581_0003767 | 3300047315 | Bacteria | 8729 |
| 678 | Ga0495581_0011746 | 3300047315 | Bacteria | 5071 |
| 679 | Ga0495581_0046261 | 3300047315 | Bacteria | 2514 |
| 680 | Ga0495604_0000005 | 3300047317 | Bacteria | 424516 |
| 681 | Ga0495604_0007332 | 3300047317 | Bacteria | 8734 |
| 682 | Ga0495604_0031950 | 3300047317 | Bacteria | 4174 |
| 683 | Ga0495604_0127480 | 3300047317 | Bacteria | 1833 |
| 684 | Ga0495674_0000003 | 3300047319 | Bacteria | 562126 |
| 685 | Ga0495674_0002023 | 3300047319 | Bacteria | 19947 |
| 686 | Ga0495674_0003325 | 3300047319 | Bacteria | 15611 |
| 687 | Ga0495676_0036509 | 3300047321 | Bacteria | 4102 |
| 688 | Ga0495676_0042309 | 3300047321 | Bacteria | 3741 |
| 689 | Ga0495680_0000002 | 3300047322 | Bacteria | 197533 |
| 690 | Ga0495680_0005048 | 3300047322 | Bacteria | 12467 |
| 691 | Ga0495680_0009889 | 3300047322 | Bacteria | 8550 |
| 692 | Ga0495680_0070207 | 3300047322 | Bacteria | 2671 |
| 693 | Ga0495675_0000383 | 3300047444 | Bacteria | 30552 |
| 694 | Ga0495675_0003495 | 3300047444 | Bacteria | 9466 |
| 695 | Ga0495679_025931 | 3300047446 | Bacteria | 1953 |
| 696 | Ga0495684_0000020 | 3300047471 | Bacteria | 148507 |
| 697 | Ga0495684_0001619 | 3300047471 | Bacteria | 18049 |
| 698 | Ga0495684_0008545 | 3300047471 | Bacteria | 7929 |
| 699 | Ga0495684_0096579 | 3300047471 | Bacteria | 2236 |
| 700 | Ga0495684_0175691 | 3300047471 | Bacteria | 1590 |
| 701 | Ga0495593_0001985 | 3300047673 | Bacteria | 12195 |
| 702 | Ga0495593_0097929 | 3300047673 | Bacteria | 1506 |
| 703 | Ga0495602_0000027 | 3300048088 | Bacteria | 145010 |
| 704 | Ga0495602_0036787 | 3300048088 | Bacteria | 4551 |
| 705 | Ga0495602_0113829 | 3300048088 | Bacteria | 2192 |
| 706 | Ga0495614_0005475 | 3300048089 | Bacteria | 5723 |
| 707 | Ga0496100_0000189 | 3300048903 | Bacteria | 34151 |
| 708 | Ga0496100_0001161 | 3300048903 | Bacteria | 12807 |
| 709 | Ga0496100_0037778 | 3300048903 | Bacteria | 3055 |
| 710 | Ga0496100_0056282 | 3300048903 | Bacteria | 2572 |
| 711 | Ga0496100_0143964 | 3300048903 | Bacteria | 1693 |
| 712 | Ga0496101_0000367 | 3300048904 | Bacteria | 29989 |
| 713 | Ga0496101_0014471 | 3300048904 | Bacteria | 5303 |
| 714 | Ga0496101_0025023 | 3300048904 | Bacteria | 4138 |
| 715 | Ga0496102_0002863 | 3300048905 | Bacteria | 14654 |
| 716 | Ga0496102_0005220 | 3300048905 | Bacteria | 11029 |
| 717 | Ga0496102_0009146 | 3300048905 | Bacteria | 8498 |
| 718 | Ga0496102_0033628 | 3300048905 | Bacteria | 4608 |
| 719 | Ga0496102_0198971 | 3300048905 | Bacteria | 1888 |
| 720 | Ga0496103_0001608 | 3300048906 | Bacteria | 14839 |
| 721 | Ga0496103_0099495 | 3300048906 | Bacteria | 1839 |
| 722 | Ga0496103_0116901 | 3300048906 | Bacteria | 1697 |
| 723 | Ga0496104_0000116 | 3300048907 | Bacteria | 74423 |
| 724 | Ga0496104_0001130 | 3300048907 | Bacteria | 22846 |
| 725 | Ga0496104_0015135 | 3300048907 | Bacteria | 6981 |
| 726 | Ga0496104_0021724 | 3300048907 | Bacteria | 5895 |
| 727 | Ga0496104_0040929 | 3300048907 | Bacteria | 4344 |
| 728 | Ga0496104_0104391 | 3300048907 | Bacteria | 2715 |
| 729 | Ga0496104_0179542 | 3300048907 | Bacteria | 2027 |
| 730 | Ga0496104_0224927 | 3300048907 | Bacteria | 1788 |
| 731 | Ga0496105_0000550 | 3300048908 | Bacteria | 24744 |
| 732 | Ga0496105_0002424 | 3300048908 | Bacteria | 13516 |
| 733 | Ga0496105_0003830 | 3300048908 | Bacteria | 11224 |
| 734 | Ga0496105_0006935 | 3300048908 | Bacteria | 8725 |
| 735 | Ga0496105_0007809 | 3300048908 | Bacteria | 8303 |
| 736 | Ga0496105_0172991 | 3300048908 | Bacteria | 1770 |
| 737 | Ga0496105_0181825 | 3300048908 | Bacteria | 1721 |
| 738 | Ga0496105_0248499 | 3300048908 | Bacteria | 1441 |
| 739 | Ga0496105_0302820 | 3300048908 | Unclassified | 1285 |
| 740 | Ga0496106_0000736 | 3300048909 | Bacteria | 23593 |
| 741 | Ga0496106_0004342 | 3300048909 | Bacteria | 10529 |
| 742 | Ga0496106_0006742 | 3300048909 | Bacteria | 8505 |
| 743 | Ga0496106_0019354 | 3300048909 | Bacteria | 5048 |
| 744 | Ga0496106_0022228 | 3300048909 | Bacteria | 4711 |
| 745 | Ga0496106_0049486 | 3300048909 | Bacteria | 3166 |
| 746 | Ga0496106_0076675 | 3300048909 | Bacteria | 2563 |
| 747 | Ga0496107_0000080 | 3300048910 | Bacteria | 46272 |
| 748 | Ga0496107_0000646 | 3300048910 | Bacteria | 19609 |
| 749 | Ga0496107_0020206 | 3300048910 | Bacteria | 4702 |
| 750 | Ga0496107_0048652 | 3300048910 | Bacteria | 3055 |
| 751 | Ga0496107_0063030 | 3300048910 | Bacteria | 2686 |
| 752 | Ga0496107_0257166 | 3300048910 | Unclassified | 1299 |
| 753 | Ga0496108_0004997 | 3300048911 | Bacteria | 10716 |
| 754 | Ga0496108_0006587 | 3300048911 | Bacteria | 9421 |
| 755 | Ga0496108_0031303 | 3300048911 | Bacteria | 4413 |
| 756 | Ga0496108_0172168 | 3300048911 | Bacteria | 1873 |
| 757 | Ga0496109_0000737 | 3300048912 | Bacteria | 27192 |
| 758 | Ga0496109_0005620 | 3300048912 | Bacteria | 10492 |
| 759 | Ga0496109_0010007 | 3300048912 | Bacteria | 8096 |
| 760 | Ga0496109_0014904 | 3300048912 | Bacteria | 6765 |
| 761 | Ga0496109_0125953 | 3300048912 | Bacteria | 2388 |
| 762 | Ga0496109_0252596 | 3300048912 | Unclassified | 1660 |
| 763 | Ga0496110_0028924 | 3300048913 | Bacteria | 4763 |
| 764 | Ga0496110_0060408 | 3300048913 | Bacteria | 3343 |
| 765 | Ga0496110_0062381 | 3300048913 | Bacteria | 3292 |
| 766 | Ga0496110_0284624 | 3300048913 | Bacteria | 1505 |
| 767 | Ga0496111_0004597 | 3300048914 | Bacteria | 8737 |
| 768 | Ga0496111_0050125 | 3300048914 | Bacteria | 3010 |
| 769 | Ga0496111_0153359 | 3300048914 | Bacteria | 1709 |
| 770 | Ga0496112_0006007 | 3300048915 | Bacteria | 10597 |
| 771 | Ga0496112_0011362 | 3300048915 | Bacteria | 8127 |
| 772 | Ga0496112_0353962 | 3300048915 | Unclassified | 1410 |
| 773 | Ga0496113_0000682 | 3300048916 | Bacteria | 17292 |
| 774 | Ga0496113_0000721 | 3300048916 | Bacteria | 16927 |
| 775 | Ga0496113_0005126 | 3300048916 | Bacteria | 8141 |
| 776 | Ga0496114_0005823 | 3300048917 | Bacteria | 9677 |
| 777 | Ga0496114_0007885 | 3300048917 | Bacteria | 8425 |
| 778 | Ga0496114_0027379 | 3300048917 | Bacteria | 4668 |
| 779 | Ga0496114_0031377 | 3300048917 | Bacteria | 4373 |
| 780 | Ga0496114_0173948 | 3300048917 | Bacteria | 1878 |
| 781 | Ga0496115_0001413 | 3300048918 | Bacteria | 17185 |
| 782 | Ga0496115_0009214 | 3300048918 | Bacteria | 7328 |
| 783 | Ga0496115_0022768 | 3300048918 | Bacteria | 4857 |
| 784 | Ga0496115_0024635 | 3300048918 | Bacteria | 4680 |
| 785 | Ga0496115_0054167 | 3300048918 | Bacteria | 3220 |
| 786 | Ga0496115_0212539 | 3300048918 | Bacteria | 1597 |
| 787 | Ga0501031_0097875 | 3300049568 | Bacteria | 1915 |
| 788 | Ga0501032_0022662 | 3300049569 | Bacteria | 4351 |
| 789 | Ga0501032_0037377 | 3300049569 | Bacteria | 3311 |
| 790 | Ga0501033_0005800 | 3300049570 | Bacteria | 9718 |
| 791 | Ga0501033_0020328 | 3300049570 | Bacteria | 5016 |
| 792 | Ga0501034_0000247 | 3300049571 | Bacteria | 99828 |
| 793 | Ga0501034_0001519 | 3300049571 | Bacteria | 30483 |
| 794 | Ga0501034_0027708 | 3300049571 | Bacteria | 5761 |
| 795 | Ga0501034_0060022 | 3300049571 | Bacteria | 3820 |
| 796 | Ga0501034_0093689 | 3300049571 | Bacteria | 3000 |
| 797 | Ga0501036_0000124 | 3300049572 | Bacteria | 48755 |
| 798 | Ga0501036_0001768 | 3300049572 | Bacteria | 16772 |
| 799 | Ga0501036_0028767 | 3300049572 | Bacteria | 4696 |
| 800 | Ga0501036_0146536 | 3300049572 | Bacteria | 1991 |
| 801 | Ga0501037_0005176 | 3300049573 | Bacteria | 9490 |
| 802 | Ga0501037_0023211 | 3300049573 | Bacteria | 4587 |
| 803 | Ga0501037_0039212 | 3300049573 | Bacteria | 3488 |
| 804 | Ga0501037_0128912 | 3300049573 | Bacteria | 1815 |
| 805 | Ga0501038_0006330 | 3300049574 | Bacteria | 10953 |
| 806 | Ga0501038_0018465 | 3300049574 | Bacteria | 6296 |
| 807 | Ga0501038_0040136 | 3300049574 | Bacteria | 4090 |
| 808 | Ga0501038_0041971 | 3300049574 | Bacteria | 3986 |
| 809 | Ga0501038_0056279 | 3300049574 | Bacteria | 3377 |
| 810 | Ga0501038_0069953 | 3300049574 | Bacteria | 2980 |
| 811 | Ga0501038_0104008 | 3300049574 | Bacteria | 2360 |
| 812 | Ga0501039_0012756 | 3300049575 | Bacteria | 6423 |
| 813 | Ga0501039_0019747 | 3300049575 | Bacteria | 5167 |
| 814 | Ga0501039_0030461 | 3300049575 | Bacteria | 4161 |
| 815 | Ga0501039_0040389 | 3300049575 | Bacteria | 3601 |
| 816 | Ga0501039_0076368 | 3300049575 | Bacteria | 2604 |
| 817 | Ga0501040_0000194 | 3300049576 | Bacteria | 35298 |
| 818 | Ga0501040_0019715 | 3300049576 | Bacteria | 4488 |
| 819 | Ga0501040_0109933 | 3300049576 | Bacteria | 1927 |
| 820 | Ga0501041_0001330 | 3300049577 | Bacteria | 13598 |
| 821 | Ga0501041_0016275 | 3300049577 | Bacteria | 4421 |
| 822 | Ga0501042_0042626 | 3300049578 | Bacteria | 3231 |
| 823 | Ga0501042_0058670 | 3300049578 | Bacteria | 2747 |
| 824 | Ga0501042_0102899 | 3300049578 | Bacteria | 2054 |
| 825 | Ga0501043_0001829 | 3300049579 | Bacteria | 18264 |
| 826 | Ga0501043_0046400 | 3300049579 | Bacteria | 3416 |
| 827 | Ga0501043_0061543 | 3300049579 | Bacteria | 2948 |
| 828 | Ga0501043_0074181 | 3300049579 | Bacteria | 2672 |
| 829 | Ga0501046_0000501 | 3300049580 | Bacteria | 39127 |
| 830 | Ga0501046_0016004 | 3300049580 | Bacteria | 6292 |
| 831 | Ga0501046_0041776 | 3300049580 | Bacteria | 3658 |
| 832 | Ga0501046_0058359 | 3300049580 | Bacteria | 3026 |
| 833 | Ga0501046_0091010 | 3300049580 | Bacteria | 2346 |
| 834 | Ga0501047_0000010 | 3300049581 | Bacteria | 429357 |
| 835 | Ga0501047_0011285 | 3300049581 | Bacteria | 8457 |
| 836 | Ga0501047_0012811 | 3300049581 | Bacteria | 7945 |
| 837 | Ga0501047_0047155 | 3300049581 | Bacteria | 4163 |
| 838 | Ga0501047_0057389 | 3300049581 | Bacteria | 3765 |
| 839 | Ga0501048_0000554 | 3300049582 | Bacteria | 26430 |
| 840 | Ga0501048_0207393 | 3300049582 | Bacteria | 1390 |
| 841 | Ga0501068_0009707 | 3300049584 | Bacteria | 5388 |
| 842 | Ga0501068_0062183 | 3300049584 | Bacteria | 2269 |
| 843 | Ga0501069_0111223 | 3300049585 | Bacteria | 1560 |
| 844 | Ga0501070_0008050 | 3300049586 | Bacteria | 8921 |
| 845 | Ga0501070_0029949 | 3300049586 | Bacteria | 4560 |
| 846 | Ga0501070_0036241 | 3300049586 | Bacteria | 4119 |
| 847 | Ga0501070_0050777 | 3300049586 | Bacteria | 3442 |
| 848 | Ga0501070_0076061 | 3300049586 | Bacteria | 2779 |
| 849 | Ga0501070_0084146 | 3300049586 | Bacteria | 2634 |
| 850 | Ga0501071_0004671 | 3300049587 | Bacteria | 8701 |
| 851 | Ga0501071_0011158 | 3300049587 | Bacteria | 6042 |
| 852 | Ga0501072_0000412 | 3300049588 | Bacteria | 30560 |
| 853 | Ga0501072_0003559 | 3300049588 | Bacteria | 11726 |
| 854 | Ga0501072_0053922 | 3300049588 | Bacteria | 3167 |
| 855 | Ga0501072_0083789 | 3300049588 | Bacteria | 2528 |
| 856 | Ga0501073_0027991 | 3300049589 | Bacteria | 4026 |
| 857 | Ga0501073_0058146 | 3300049589 | Bacteria | 2703 |
| 858 | Ga0501074_0018217 | 3300049590 | Bacteria | 5101 |
| 859 | Ga0501074_0029915 | 3300049590 | Bacteria | 3947 |
| 860 | Ga0501074_0106604 | 3300049590 | Bacteria | 2006 |
| 861 | Ga0501074_0247900 | 3300049590 | Bacteria | 1266 |
| 862 | Ga0501075_0000046 | 3300049591 | Bacteria | 50813 |
| 863 | Ga0501075_0006556 | 3300049591 | Bacteria | 8017 |
| 864 | Ga0501075_0066325 | 3300049591 | Bacteria | 2724 |
| 865 | Ga0501076_0000768 | 3300049592 | Bacteria | 20719 |
| 866 | Ga0501076_0168865 | 3300049592 | Bacteria | 1783 |
| 867 | Ga0501076_0266446 | 3300049592 | Bacteria | 1403 |
| 868 | Ga0501077_0002139 | 3300049593 | Bacteria | 11923 |
| 869 | Ga0501077_0037790 | 3300049593 | Bacteria | 3074 |
| 870 | Ga0501077_0061505 | 3300049593 | Bacteria | 2383 |
| 871 | Ga0501079_0007157 | 3300049741 | Bacteria | 8422 |
| 872 | Ga0501079_0011365 | 3300049741 | Bacteria | 6794 |
| 873 | Ga0501079_0020439 | 3300049741 | Bacteria | 5061 |
| 874 | Ga0501079_0125432 | 3300049741 | Bacteria | 1997 |
| 875 | Ga0501079_0179289 | 3300049741 | Bacteria | 1653 |
| 876 | Ga0501080_0000100 | 3300049742 | Bacteria | 58925 |
| 877 | Ga0501080_0018292 | 3300049742 | Bacteria | 6486 |
| 878 | Ga0501080_0058906 | 3300049742 | Bacteria | 3574 |
| 879 | Ga0501080_0151023 | 3300049742 | Bacteria | 2147 |
| 880 | Ga0501081_0000517 | 3300049743 | Bacteria | 21705 |
| 881 | Ga0501081_0005416 | 3300049743 | Bacteria | 8237 |
| 882 | Ga0501083_0003213 | 3300049744 | Bacteria | 11384 |
| 883 | Ga0501083_0006706 | 3300049744 | Bacteria | 8171 |
| 884 | Ga0501035_0002939 | 3300049822 | Bacteria | 16395 |
| 885 | Ga0501035_0056982 | 3300049822 | Bacteria | 3485 |
| 886 | Ga0501035_0061789 | 3300049822 | Bacteria | 3333 |
| 887 | Ga0501035_0255409 | 3300049822 | Bacteria | 1487 |
| 888 | Ga0501035_0258253 | 3300049822 | Bacteria | 1478 |
| 889 | Ga0501044_0022356 | 3300049823 | Bacteria | 6740 |
| 890 | Ga0501044_0022773 | 3300049823 | Bacteria | 6671 |
| 891 | Ga0501044_0046008 | 3300049823 | Bacteria | 4519 |
| 892 | Ga0501044_0047839 | 3300049823 | Bacteria | 4422 |
| 893 | Ga0501044_0066871 | 3300049823 | Bacteria | 3663 |
| 894 | Ga0501044_0144331 | 3300049823 | Bacteria | 2367 |
| 895 | Ga0501044_0170875 | 3300049823 | Bacteria | 2145 |
| 896 | Ga0501044_0288425 | 3300049823 | Bacteria | 1573 |
| 897 | Ga0501045_0001084 | 3300049824 | Bacteria | 17987 |
| 898 | Ga0501045_0001975 | 3300049824 | Bacteria | 13865 |
| 899 | nmdc:mga03n38_8389_c1 | 3300050490 | Bacteria | 3707 |
| 900 | nmdc:mga00v17_59794_c1 | 3300050491 | Bacteria | 2339 |
| 901 | nmdc:mga0yw44_28208_c1 | 3300050492 | Bacteria | 3227 |
| 902 | nmdc:mga0yw44_28951_c1 | 3300050492 | Bacteria | 3192 |
| 903 | nmdc:mga0yw44_31737_c1 | 3300050492 | Bacteria | 3074 |
| 904 | nmdc:mga0yw44_34879_c1 | 3300050492 | Bacteria | 2952 |
| 905 | nmdc:mga0yw44_79114_c1 | 3300050492 | Bacteria | 2057 |
| 906 | nmdc:mga0yw44_87700_c1 | 3300050492 | Bacteria | 1962 |
| 907 | nmdc:mga06z11_100582_c1 | 3300050494 | Bacteria | 1585 |
| 908 | nmdc:mga05p37_203690_c1 | 3300050507 | Bacteria | 2395 |
| 909 | nmdc:mga05p37_20453_c1 | 3300050507 | Bacteria | 8005 |
| 910 | nmdc:mga09592_192647_c1 | 3300050508 | Bacteria | 1765 |
| 911 | nmdc:mga0qj67_10975_c1 | 3300050509 | Bacteria | 6780 |
| 912 | nmdc:mga0qj67_60210_c1 | 3300050509 | Bacteria | 3012 |
| 913 | nmdc:mga0qj67_82695_c1 | 3300050509 | Bacteria | 2575 |
| 914 | nmdc:mga0qj67_930_c1 | 3300050509 | Bacteria | 20158 |
| 915 | nmdc:mga06r32_158351_c1 | 3300050510 | Bacteria | 2246 |
| 916 | nmdc:mga06r32_34777_c1 | 3300050510 | Bacteria | 4753 |
| 917 | nmdc:mga06r32_38341_c1 | 3300050510 | Bacteria | 4540 |
| 918 | nmdc:mga08y16_215960_c1 | 3300050511 | Bacteria | 1986 |
| 919 | nmdc:mga08y16_4316_c1 | 3300050511 | Bacteria | 14850 |
| 920 | nmdc:mga08y16_55553_c1 | 3300050511 | Bacteria | 4137 |
| 921 | nmdc:mga08y16_60333_c1 | 3300050511 | Unclassified | 3962 |
| 922 | nmdc:mga08y16_738_c1 | 3300050511 | Bacteria | 31085 |
| 923 | nmdc:mga0n895_121065_c1 | 3300050512 | Bacteria | 2638 |
| 924 | nmdc:mga0n895_167961_c1 | 3300050512 | Bacteria | 2226 |
| 925 | nmdc:mga0n895_178316_c1 | 3300050512 | Unclassified | 2156 |
| 926 | nmdc:mga0n895_313274_c1 | 3300050512 | Bacteria | 1590 |
| 927 | nmdc:mga0n895_48732_c1 | 3300050512 | Bacteria | 4148 |
| 928 | nmdc:mga0n895_65635_c1 | 3300050512 | Bacteria | 3593 |
| 929 | nmdc:mga0n895_76804_c1 | 3300050512 | Unclassified | 3321 |
| 930 | nmdc:mga0n895_842_c1 | 3300050512 | Bacteria | 22003 |
| 931 | nmdc:mga0rr50_214062_c1 | 3300050513 | Unclassified | 1589 |
| 932 | nmdc:mga0rr50_2286_c1 | 3300050513 | Bacteria | 10743 |
| 933 | nmdc:mga0rr50_27222_c1 | 3300050513 | Bacteria | 3999 |
| 934 | nmdc:mga0rr50_28329_c1 | 3300050513 | Bacteria | 3936 |
| 935 | nmdc:mga0rr50_67088_c1 | 3300050513 | Bacteria | 2724 |
| 936 | nmdc:mga0a205_32568_c1 | 3300050515 | Bacteria | 4997 |
| 937 | nmdc:mga0sz30_25919_c1 | 3300050516 | Bacteria | 2400 |
| 938 | Ga0495601_0000010 | 3300053077 | Bacteria | 266222 |
| 939 | Ga0495601_0003343 | 3300053077 | Bacteria | 9183 |
| 940 | Ga0495601_0012889 | 3300053077 | Bacteria | 5018 |
| 941 | Ga0495601_0013244 | 3300053077 | Bacteria | 4958 |
| 942 | Ga0495601_0024831 | 3300053077 | Bacteria | 3691 |
| 943 | Ga0495601_0060814 | 3300053077 | Bacteria | 2397 |
| 944 | Ga0495601_0061768 | 3300053077 | Bacteria | 2378 |
| 945 | Ga0495601_0130310 | 3300053077 | Bacteria | 1638 |
| 946 | Ga0495612_0000002 | 3300053078 | Bacteria | 310466 |
| 947 | Ga0495612_0001058 | 3300053078 | Bacteria | 11257 |
| 948 | Ga0495612_0001550 | 3300053078 | Bacteria | 9471 |
| 949 | Ga0495612_0052073 | 3300053078 | Bacteria | 1683 |
| 950 | Ga0495595_0000110 | 3300053084 | Bacteria | 37533 |
| 951 | Ga0495595_0000762 | 3300053084 | Bacteria | 12239 |
| 952 | Ga0495595_0018683 | 3300053084 | Bacteria | 2998 |
| 953 | Ga0495595_0032506 | 3300053084 | Bacteria | 2350 |
| 954 | Ga0495595_0035761 | 3300053084 | Bacteria | 2251 |
| 955 | Ga0495619_0000002 | 3300053085 | Bacteria | 530226 |
| 956 | Ga0495619_0000271 | 3300053085 | Bacteria | 37662 |
| 957 | Ga0495619_0001919 | 3300053085 | Bacteria | 13857 |
| 958 | Ga0495619_0002564 | 3300053085 | Bacteria | 11890 |
| 959 | Ga0495619_0007587 | 3300053085 | Bacteria | 6868 |
| 960 | Ga0495619_0017692 | 3300053085 | Bacteria | 4515 |
| 961 | Ga0495619_0022184 | 3300053085 | Bacteria | 4060 |
| 962 | Ga0495619_0033071 | 3300053085 | Unclassified | 3357 |
| 963 | Ga0495619_0062525 | 3300053085 | Bacteria | 2478 |
| 964 | Ga0500651_0001961 | 3300053093 | Bacteria | 10665 |
| 965 | Ga0500641_0034247 | 3300053096 | Bacteria | 2020 |
| 966 | Ga0500593_052637 | 3300053117 | Bacteria | 1803 |
| 967 | Ga0500595_000062 | 3300053119 | Bacteria | 77506 |
| 968 | Ga0500595_019155 | 3300053119 | Bacteria | 2488 |
| 969 | Ga0500652_000016 | 3300053131 | Bacteria | 126768 |
| 970 | Ga0500652_005922 | 3300053131 | Bacteria | 3892 |
| 971 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 972 | Ga0500616_0043385 | 3300053153 | Bacteria | 2403 |
| 973 | Ga0500645_000282 | 3300053730 | Bacteria | 36379 |
| 974 | Ga0501084_0001795 | 3300054114 | Bacteria | 17098 |
| 975 | Ga0501084_0072537 | 3300054114 | Bacteria | 2883 |
| 976 | Ga0501082_0002559 | 3300060353 | Bacteria | 15919 |
| 977 | Ga0530510_0000097 | 3300061734 | Bacteria | 47406 |
| 978 | Ga0530510_0001449 | 3300061734 | Bacteria | 15902 |
| 979 | Ga0530510_0083164 | 3300061734 | Bacteria | 2331 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046473 | Ga0495582_0196782 | Ga0495582_0196782_23_1096 | 357 |
| 2 | 3300006048 | Ga0075363_100089185 | Ga0075363_1000891852 | 360 |
| 3 | 3300050492 | nmdc:mga0yw44_87700_c1 | nmdc:mga0yw44_87700_c1_397_1620 | 360 |
| 4 | 3300001991 | JGI24743J22301_10001360 | JGI24743J22301_100013602 | 361 |
| 5 | 3300002077 | JGI24744J21845_10008543 | JGI24744J21845_100085432 | 361 |
| 6 | 3300005329 | Ga0070683_100103835 | Ga0070683_1001038352 | 361 |
| 7 | 3300005330 | Ga0070690_100044603 | Ga0070690_1000446032 | 361 |
| 8 | 3300005335 | Ga0070666_10033534 | Ga0070666_100335343 | 361 |
| 9 | 3300005338 | Ga0068868_100119761 | Ga0068868_1001197612 | 361 |
| 10 | 3300005439 | Ga0070711_100147157 | Ga0070711_1001471572 | 361 |
| 11 | 3300005440 | Ga0070705_100028007 | Ga0070705_1000280073 | 361 |
| 12 | 3300005459 | Ga0068867_100123667 | Ga0068867_1001236672 | 361 |
| 13 | 3300005543 | Ga0070672_100142029 | Ga0070672_1001420292 | 361 |
| 14 | 3300005547 | Ga0070693_100010607 | Ga0070693_1000106072 | 361 |
| 15 | 3300005614 | Ga0068856_100359006 | Ga0068856_1003590062 | 361 |
| 16 | 3300005618 | Ga0068864_100012607 | Ga0068864_1000126076 | 361 |
| 17 | 3300005834 | Ga0068851_10161546 | Ga0068851_101615461 | 361 |
| 18 | 3300006038 | Ga0075365_10051815 | Ga0075365_100518152 | 361 |
| 19 | 3300006237 | Ga0097621_100037890 | Ga0097621_1000378903 | 361 |
| 20 | 3300009101 | Ga0105247_10003839 | Ga0105247_100038399 | 361 |
| 21 | 3300014968 | Ga0157379_10269787 | Ga0157379_102697872 | 361 |
| 22 | 3300014969 | Ga0157376_10163553 | Ga0157376_101635532 | 361 |
| 23 | 3300025900 | Ga0207710_10055539 | Ga0207710_100555392 | 361 |
| 24 | 3300025901 | Ga0207688_10004456 | Ga0207688_100044562 | 361 |
| 25 | 3300025904 | Ga0207647_10014236 | Ga0207647_100142364 | 361 |
| 26 | 3300025908 | Ga0207643_10001904 | Ga0207643_100019048 | 361 |
| 27 | 3300025918 | Ga0207662_10004160 | Ga0207662_100041606 | 361 |
| 28 | 3300025926 | Ga0207659_10066360 | Ga0207659_100663602 | 361 |
| 29 | 3300025931 | Ga0207644_10014608 | Ga0207644_100146082 | 361 |
| 30 | 3300025932 | Ga0207690_10044581 | Ga0207690_100445812 | 361 |
| 31 | 3300025933 | Ga0207706_10013650 | Ga0207706_100136505 | 361 |
| 32 | 3300025934 | Ga0207686_10027578 | Ga0207686_100275784 | 361 |
| 33 | 3300025937 | Ga0207669_10026216 | Ga0207669_100262163 | 361 |
| 34 | 3300025940 | Ga0207691_10021468 | Ga0207691_100214682 | 361 |
| 35 | 3300025942 | Ga0207689_10039328 | Ga0207689_100393283 | 361 |
| 36 | 3300025944 | Ga0207661_10015191 | Ga0207661_100151913 | 361 |
| 37 | 3300025945 | Ga0207679_10003395 | Ga0207679_100033957 | 361 |
| 38 | 3300025961 | Ga0207712_10019090 | Ga0207712_100190904 | 361 |
| 39 | 3300025986 | Ga0207658_10031452 | Ga0207658_100314522 | 361 |
| 40 | 3300026075 | Ga0207708_10002015 | Ga0207708_1000201514 | 361 |
| 41 | 3300026088 | Ga0207641_10012014 | Ga0207641_100120145 | 361 |
| 42 | 3300026089 | Ga0207648_10003124 | Ga0207648_1000312414 | 361 |
| 43 | 3300026095 | Ga0207676_10009698 | Ga0207676_100096985 | 361 |
| 44 | 3300026118 | Ga0207675_100014980 | Ga0207675_1000149805 | 361 |
| 45 | 3300027907 | Ga0207428_10122931 | Ga0207428_101229312 | 361 |
| 46 | 3300028381 | Ga0268264_10045619 | Ga0268264_100456193 | 361 |
| 47 | 3300035116 | Ga0373945_0008327 | Ga0373945_0008327_1628_2794 | 361 |
| 48 | 3300035170 | Ga0373943_0020329 | Ga0373943_0020329_1419_2585 | 361 |
| 49 | 3300035171 | Ga0373946_0084295 | Ga0373946_0084295_135_1301 | 361 |
| 50 | 3300046461 | Ga0495641_0038095 | Ga0495641_0038095_319_1485 | 361 |
| 51 | 3300046472 | Ga0495580_0023974 | Ga0495580_0023974_1740_2906 | 361 |
| 52 | 3300046473 | Ga0495582_0028249 | Ga0495582_0028249_525_1691 | 361 |
| 53 | 3300046557 | Ga0495622_0060647 | Ga0495622_0060647_423_1589 | 361 |
| 54 | 3300046615 | Ga0495656_0060932 | Ga0495656_0060932_70_1236 | 361 |
| 55 | 3300046681 | Ga0495647_0006607 | Ga0495647_0006607_623_1789 | 361 |
| 56 | 3300046689 | Ga0495613_0155919 | Ga0495613_0155919_238_1404 | 361 |
| 57 | 3300047315 | Ga0495581_0011746 | Ga0495581_0011746_3028_4194 | 361 |
| 58 | 3300047446 | Ga0495679_025931 | Ga0495679_025931_336_1502 | 361 |
| 59 | 3300048903 | Ga0496100_0001161 | Ga0496100_0001161_1981_3147 | 361 |
| 60 | 3300048904 | Ga0496101_0014471 | Ga0496101_0014471_3035_4201 | 361 |
| 61 | 3300048906 | Ga0496103_0001608 | Ga0496103_0001608_12457_13623 | 361 |
| 62 | 3300048907 | Ga0496104_0040929 | Ga0496104_0040929_747_1913 | 361 |
| 63 | 3300048908 | Ga0496105_0007809 | Ga0496105_0007809_1958_3124 | 361 |
| 64 | 3300048909 | Ga0496106_0004342 | Ga0496106_0004342_225_1391 | 361 |
| 65 | 3300048910 | Ga0496107_0000646 | Ga0496107_0000646_12980_14146 | 361 |
| 66 | 3300048911 | Ga0496108_0031303 | Ga0496108_0031303_3070_4236 | 361 |
| 67 | 3300048912 | Ga0496109_0005620 | Ga0496109_0005620_6093_7259 | 361 |
| 68 | 3300048913 | Ga0496110_0028924 | Ga0496110_0028924_1919_3085 | 361 |
| 69 | 3300048914 | Ga0496111_0153359 | Ga0496111_0153359_179_1345 | 361 |
| 70 | 3300048916 | Ga0496113_0000682 | Ga0496113_0000682_3561_4727 | 361 |
| 71 | 3300048917 | Ga0496114_0027379 | Ga0496114_0027379_3478_4644 | 361 |
| 72 | 3300048918 | Ga0496115_0001413 | Ga0496115_0001413_13026_14192 | 361 |
| 73 | 3300050492 | nmdc:mga0yw44_31737_c1 | nmdc:mga0yw44_31737_c1_1044_2258 | 361 |
| 74 | 3300050511 | nmdc:mga08y16_55553_c1 | nmdc:mga08y16_55553_c1_2730_3896 | 361 |
| 75 | 3300053077 | Ga0495601_0060814 | Ga0495601_0060814_606_1772 | 361 |
| 76 | 3300049568 | Ga0501031_0097875 | Ga0501031_0097875_211_1371 | 362 |
| 77 | 3300049588 | Ga0501072_0083789 | Ga0501072_0083789_1235_2395 | 362 |
| 78 | 3300049741 | Ga0501079_0179289 | Ga0501079_0179289_78_1238 | 362 |
| 79 | 3300009176 | Ga0105242_10132857 | Ga0105242_101328572 | 366 |
| 80 | 3300005985 | Ga0081539_10074748 | Ga0081539_100747482 | 367 |
| 81 | 3300035691 | Ga0373931_0151827 | Ga0373931_0151827_204_1307 | 367 |
| 82 | 3300049590 | Ga0501074_0247900 | Ga0501074_0247900_125_1240 | 367 |
| 83 | 3300046454 | Ga0495592_0070656 | Ga0495592_0070656_43_1149 | 368 |
| 84 | 3300046499 | Ga0495594_0059828 | Ga0495594_0059828_983_2089 | 368 |
| 85 | 3300046533 | Ga0495640_0014607 | Ga0495640_0014607_4686_5792 | 368 |
| 86 | 3300048917 | Ga0496114_0173948 | Ga0496114_0173948_576_1742 | 368 |
| 87 | 3300048918 | Ga0496115_0212539 | Ga0496115_0212539_250_1416 | 368 |
| 88 | 3300053077 | Ga0495601_0012889 | Ga0495601_0012889_55_1161 | 368 |
| 89 | 3300053085 | Ga0495619_0022184 | Ga0495619_0022184_55_1161 | 368 |
| 90 | 3300053153 | Ga0500616_0043385 | Ga0500616_0043385_15_1121 | 368 |
| 91 | 3300046455 | Ga0495603_0109535 | Ga0495603_0109535_199_1317 | 372 |
| 92 | 3300049584 | Ga0501068_0009707 | Ga0501068_0009707_4238_5371 | 373 |
| 93 | 3300009545 | Ga0105237_10511193 | Ga0105237_105111931 | 378 |
| 94 | 3300009093 | Ga0105240_10200443 | Ga0105240_102004432 | 380 |
| 95 | 3300025912 | Ga0207707_10061954 | Ga0207707_100619543 | 382 |
| 96 | 3300049570 | Ga0501033_0020328 | Ga0501033_0020328_1341_2516 | 386 |
| 97 | 3300049572 | Ga0501036_0000124 | Ga0501036_0000124_22689_23864 | 386 |
| 98 | 3300049573 | Ga0501037_0023211 | Ga0501037_0023211_2390_3565 | 386 |
| 99 | 3300049574 | Ga0501038_0006330 | Ga0501038_0006330_3876_5051 | 386 |
| 100 | 3300049575 | Ga0501039_0040389 | Ga0501039_0040389_1010_2185 | 386 |
| 101 | 3300049576 | Ga0501040_0000194 | Ga0501040_0000194_16917_18092 | 386 |
| 102 | 3300049577 | Ga0501041_0001330 | Ga0501041_0001330_316_1491 | 386 |
| 103 | 3300049578 | Ga0501042_0058670 | Ga0501042_0058670_22_1197 | 386 |
| 104 | 3300049579 | Ga0501043_0061543 | Ga0501043_0061543_1377_2552 | 386 |
| 105 | 3300049580 | Ga0501046_0000501 | Ga0501046_0000501_12852_14027 | 386 |
| 106 | 3300049580 | Ga0501046_0058359 | Ga0501046_0058359_517_1683 | 386 |
| 107 | 3300049581 | Ga0501047_0012811 | Ga0501047_0012811_5470_6636 | 386 |
| 108 | 3300049587 | Ga0501071_0004671 | Ga0501071_0004671_752_1927 | 386 |
| 109 | 3300049588 | Ga0501072_0000412 | Ga0501072_0000412_16511_17686 | 386 |
| 110 | 3300049589 | Ga0501073_0058146 | Ga0501073_0058146_493_1668 | 386 |
| 111 | 3300049590 | Ga0501074_0029915 | Ga0501074_0029915_1354_2529 | 386 |
| 112 | 3300049591 | Ga0501075_0000046 | Ga0501075_0000046_48094_49269 | 386 |
| 113 | 3300049593 | Ga0501077_0002139 | Ga0501077_0002139_9754_10929 | 386 |
| 114 | 3300049741 | Ga0501079_0011365 | Ga0501079_0011365_4902_6077 | 386 |
| 115 | 3300049742 | Ga0501080_0018292 | Ga0501080_0018292_2997_4163 | 386 |
| 116 | 3300049742 | Ga0501080_0058906 | Ga0501080_0058906_1632_2807 | 386 |
| 117 | 3300049743 | Ga0501081_0000517 | Ga0501081_0000517_4370_5545 | 386 |
| 118 | 3300049823 | Ga0501044_0066871 | Ga0501044_0066871_1904_3070 | 386 |
| 119 | 3300049823 | Ga0501044_0288425 | Ga0501044_0288425_286_1461 | 386 |
| 120 | 3300049824 | Ga0501045_0001084 | Ga0501045_0001084_4426_5601 | 386 |
| 121 | 3300054114 | Ga0501084_0072537 | Ga0501084_0072537_1308_2483 | 386 |
| 122 | 3300061734 | Ga0530510_0001449 | Ga0530510_0001449_1024_2199 | 386 |
| 123 | 3300005530 | Ga0070679_100057996 | Ga0070679_1000579964 | 387 |
| 124 | 3300006847 | Ga0075431_100186739 | Ga0075431_1001867393 | 387 |
| 125 | 3300006880 | Ga0075429_100038157 | Ga0075429_1000381573 | 387 |
| 126 | 3300007788 | Ga0099795_10000065 | Ga0099795_100000659 | 387 |
| 127 | 3300025906 | Ga0207699_10162760 | Ga0207699_101627602 | 387 |
| 128 | 3300025921 | Ga0207652_10045443 | Ga0207652_100454432 | 387 |
| 129 | 3300027665 | Ga0209983_1004225 | Ga0209983_10042253 | 387 |
| 130 | 3300027682 | Ga0209971_1009585 | Ga0209971_10095852 | 387 |
| 131 | 3300028556 | Ga0265337_1002095 | Ga0265337_10020957 | 387 |
| 132 | 3300028573 | Ga0265334_10002101 | Ga0265334_100021019 | 387 |
| 133 | 3300028800 | Ga0265338_10016636 | Ga0265338_100166364 | 387 |
| 134 | 3300042003 | Ga0439443_000439 | Ga0439443_000439_16_1224 | 387 |
| 135 | 3300042437 | Ga0439444_0000655 | Ga0439444_0000655_2015_3223 | 387 |
| 136 | 3300042461 | Ga0439460_0005185 | Ga0439460_0005185_1183_2391 | 387 |
| 137 | 3300042461 | Ga0439460_0027028 | Ga0439460_0027028_51_1229 | 387 |
| 138 | 3300046459 | Ga0495629_0114884 | Ga0495629_0114884_306_1469 | 387 |
| 139 | 3300046472 | Ga0495580_0047493 | Ga0495580_0047493_1820_2983 | 387 |
| 140 | 3300046531 | Ga0495665_0012467 | Ga0495665_0012467_3115_4278 | 387 |
| 141 | 3300046535 | Ga0495586_0058039 | Ga0495586_0058039_285_1448 | 387 |
| 142 | 3300046642 | Ga0495634_0035176 | Ga0495634_0035176_370_1533 | 387 |
| 143 | 3300049574 | Ga0501038_0056279 | Ga0501038_0056279_178_1356 | 387 |
| 144 | 3300049575 | Ga0501039_0019747 | Ga0501039_0019747_1034_2212 | 387 |
| 145 | 3300049576 | Ga0501040_0109933 | Ga0501040_0109933_590_1768 | 387 |
| 146 | 3300049577 | Ga0501041_0016275 | Ga0501041_0016275_1236_2414 | 387 |
| 147 | 3300049578 | Ga0501042_0042626 | Ga0501042_0042626_1977_3155 | 387 |
| 148 | 3300049578 | Ga0501042_0102899 | Ga0501042_0102899_447_1625 | 387 |
| 149 | 3300049580 | Ga0501046_0016004 | Ga0501046_0016004_2970_4148 | 387 |
| 150 | 3300049587 | Ga0501071_0011158 | Ga0501071_0011158_2201_3379 | 387 |
| 151 | 3300049588 | Ga0501072_0003559 | Ga0501072_0003559_4659_5837 | 387 |
| 152 | 3300049590 | Ga0501074_0106604 | Ga0501074_0106604_787_1965 | 387 |
| 153 | 3300049591 | Ga0501075_0006556 | Ga0501075_0006556_2593_3771 | 387 |
| 154 | 3300049592 | Ga0501076_0000768 | Ga0501076_0000768_13616_14794 | 387 |
| 155 | 3300049593 | Ga0501077_0037790 | Ga0501077_0037790_1300_2478 | 387 |
| 156 | 3300049741 | Ga0501079_0007157 | Ga0501079_0007157_3084_4262 | 387 |
| 157 | 3300049743 | Ga0501081_0005416 | Ga0501081_0005416_2964_4142 | 387 |
| 158 | 3300049822 | Ga0501035_0255409 | Ga0501035_0255409_196_1374 | 387 |
| 159 | 3300049824 | Ga0501045_0001975 | Ga0501045_0001975_10419_11597 | 387 |
| 160 | 3300050508 | nmdc:mga09592_192647_c1 | nmdc:mga09592_192647_c1_76_1254 | 387 |
| 161 | 3300050509 | nmdc:mga0qj67_82695_c1 | nmdc:mga0qj67_82695_c1_896_2074 | 387 |
| 162 | 3300054114 | Ga0501084_0001795 | Ga0501084_0001795_3369_4547 | 387 |
| 163 | 3300060353 | Ga0501082_0002559 | Ga0501082_0002559_12114_13292 | 387 |
| 164 | 3300061734 | Ga0530510_0000097 | Ga0530510_0000097_20609_21787 | 387 |
| 165 | 3300003659 | JGI25404J52841_10000611 | JGI25404J52841_100006111 | 388 |
| 166 | 3300005327 | Ga0070658_10206441 | Ga0070658_102064411 | 388 |
| 167 | 3300005331 | Ga0070670_100011345 | Ga0070670_1000113452 | 388 |
| 168 | 3300005336 | Ga0070680_100015993 | Ga0070680_1000159931 | 388 |
| 169 | 3300005340 | Ga0070689_100043423 | Ga0070689_1000434233 | 388 |
| 170 | 3300005354 | Ga0070675_100152209 | Ga0070675_1001522091 | 388 |
| 171 | 3300005435 | Ga0070714_100359436 | Ga0070714_1003594361 | 388 |
| 172 | 3300005438 | Ga0070701_10036265 | Ga0070701_100362653 | 388 |
| 173 | 3300005458 | Ga0070681_10001364 | Ga0070681_1000136415 | 388 |
| 174 | 3300005530 | Ga0070679_100000512 | Ga0070679_1000005124 | 388 |
| 175 | 3300005577 | Ga0068857_100124549 | Ga0068857_1001245493 | 388 |
| 176 | 3300005841 | Ga0068863_100144226 | Ga0068863_1001442262 | 388 |
| 177 | 3300005937 | Ga0081455_10002005 | Ga0081455_100020053 | 388 |
| 178 | 3300005983 | Ga0081540_1000001 | Ga0081540_1000001178 | 388 |
| 179 | 3300005983 | Ga0081540_1014473 | Ga0081540_10144733 | 388 |
| 180 | 3300005983 | Ga0081540_1054104 | Ga0081540_10541042 | 388 |
| 181 | 3300005985 | Ga0081539_10010875 | Ga0081539_100108752 | 388 |
| 182 | 3300006038 | Ga0075365_10007896 | Ga0075365_100078966 | 388 |
| 183 | 3300006038 | Ga0075365_10151866 | Ga0075365_101518662 | 388 |
| 184 | 3300006186 | Ga0075369_10022612 | Ga0075369_100226122 | 388 |
| 185 | 3300006844 | Ga0075428_100184226 | Ga0075428_1001842261 | 388 |
| 186 | 3300006844 | Ga0075428_100195351 | Ga0075428_1001953512 | 388 |
| 187 | 3300006846 | Ga0075430_100000476 | Ga0075430_10000047612 | 388 |
| 188 | 3300006847 | Ga0075431_100306184 | Ga0075431_1003061841 | 388 |
| 189 | 3300006871 | Ga0075434_100068480 | Ga0075434_1000684803 | 388 |
| 190 | 3300006871 | Ga0075434_100078639 | Ga0075434_1000786393 | 388 |
| 191 | 3300006880 | Ga0075429_100101556 | Ga0075429_1001015561 | 388 |
| 192 | 3300007076 | Ga0075435_100003932 | Ga0075435_1000039323 | 388 |
| 193 | 3300007265 | Ga0099794_10014583 | Ga0099794_100145833 | 388 |
| 194 | 3300009093 | Ga0105240_10134204 | Ga0105240_101342043 | 388 |
| 195 | 3300009094 | Ga0111539_10268889 | Ga0111539_102688892 | 388 |
| 196 | 3300009147 | Ga0114129_10207613 | Ga0114129_102076131 | 388 |
| 197 | 3300010375 | Ga0105239_10369213 | Ga0105239_103692132 | 388 |
| 198 | 3300011119 | Ga0105246_10189296 | Ga0105246_101892961 | 388 |
| 199 | 3300013104 | Ga0157370_10004500 | Ga0157370_1000450011 | 388 |
| 200 | 3300013105 | Ga0157369_10005666 | Ga0157369_1000566611 | 388 |
| 201 | 3300014325 | Ga0163163_10011189 | Ga0163163_100111896 | 388 |
| 202 | 3300014326 | Ga0157380_10119042 | Ga0157380_101190421 | 388 |
| 203 | 3300014497 | Ga0182008_10005672 | Ga0182008_100056724 | 388 |
| 204 | 3300021384 | Ga0213876_10050387 | Ga0213876_100503872 | 388 |
| 205 | 3300025903 | Ga0207680_10006371 | Ga0207680_100063713 | 388 |
| 206 | 3300025907 | Ga0207645_10145884 | Ga0207645_101458841 | 388 |
| 207 | 3300025915 | Ga0207693_10018018 | Ga0207693_100180181 | 388 |
| 208 | 3300025915 | Ga0207693_10020784 | Ga0207693_100207843 | 388 |
| 209 | 3300025917 | Ga0207660_10041014 | Ga0207660_100410143 | 388 |
| 210 | 3300025921 | Ga0207652_10032435 | Ga0207652_100324354 | 388 |
| 211 | 3300025925 | Ga0207650_10112041 | Ga0207650_101120412 | 388 |
| 212 | 3300025928 | Ga0207700_10077925 | Ga0207700_100779252 | 388 |
| 213 | 3300025932 | Ga0207690_10025916 | Ga0207690_100259162 | 388 |
| 214 | 3300025945 | Ga0207679_10326299 | Ga0207679_103262992 | 388 |
| 215 | 3300027907 | Ga0207428_10166664 | Ga0207428_101666642 | 388 |
| 216 | 3300031241 | Ga0265325_10010060 | Ga0265325_100100605 | 388 |
| 217 | 3300031595 | Ga0265313_10000106 | Ga0265313_100001065 | 388 |
| 218 | 3300032002 | Ga0307416_100339168 | Ga0307416_1003391682 | 388 |
| 219 | 3300035083 | Ga0373926_0022850 | Ga0373926_0022850_432_1598 | 388 |
| 220 | 3300035083 | Ga0373926_0026611 | Ga0373926_0026611_483_1649 | 388 |
| 221 | 3300035086 | Ga0373934_0018802 | Ga0373934_0018802_163_1329 | 388 |
| 222 | 3300035089 | Ga0373944_0006563 | Ga0373944_0006563_1801_2967 | 388 |
| 223 | 3300035113 | Ga0373936_0004882 | Ga0373936_0004882_420_1586 | 388 |
| 224 | 3300035114 | Ga0373939_0042053 | Ga0373939_0042053_97_1263 | 388 |
| 225 | 3300035116 | Ga0373945_0008419 | Ga0373945_0008419_1135_2301 | 388 |
| 226 | 3300035116 | Ga0373945_0020000 | Ga0373945_0020000_348_1514 | 388 |
| 227 | 3300035117 | Ga0373953_0000785 | Ga0373953_0000785_6252_7418 | 388 |
| 228 | 3300035118 | Ga0373954_0000969 | Ga0373954_0000969_1451_2617 | 388 |
| 229 | 3300035119 | Ga0373956_0054836 | Ga0373956_0054836_499_1665 | 388 |
| 230 | 3300035170 | Ga0373943_0000306 | Ga0373943_0000306_17458_18624 | 388 |
| 231 | 3300035170 | Ga0373943_0001944 | Ga0373943_0001944_2729_3895 | 388 |
| 232 | 3300035171 | Ga0373946_0022197 | Ga0373946_0022197_971_2137 | 388 |
| 233 | 3300035171 | Ga0373946_0026560 | Ga0373946_0026560_887_2053 | 388 |
| 234 | 3300035172 | Ga0373955_0000039 | Ga0373955_0000039_20521_21687 | 388 |
| 235 | 3300035242 | Ga0373962_0006957 | Ga0373962_0006957_808_1974 | 388 |
| 236 | 3300035692 | Ga0373935_0000079 | Ga0373935_0000079_29244_30410 | 388 |
| 237 | 3300035692 | Ga0373935_0010573 | Ga0373935_0010573_4294_5460 | 388 |
| 238 | 3300035695 | Ga0373927_0013767 | Ga0373927_0013767_3680_4846 | 388 |
| 239 | 3300035695 | Ga0373927_0023394 | Ga0373927_0023394_523_1689 | 388 |
| 240 | 3300035695 | Ga0373927_0029598 | Ga0373927_0029598_2011_3177 | 388 |
| 241 | 3300035724 | Ga0373933_0004704 | Ga0373933_0004704_5569_6735 | 388 |
| 242 | 3300035724 | Ga0373933_0101185 | Ga0373933_0101185_37_1221 | 388 |
| 243 | 3300035725 | Ga0373947_0001044 | Ga0373947_0001044_2737_3903 | 388 |
| 244 | 3300035725 | Ga0373947_0013808 | Ga0373947_0013808_2862_4028 | 388 |
| 245 | 3300036401 | Ga0373937_0000223 | Ga0373937_0000223_14051_15217 | 388 |
| 246 | 3300036401 | Ga0373937_0003786 | Ga0373937_0003786_6337_7503 | 388 |
| 247 | 3300036401 | Ga0373937_0029554 | Ga0373937_0029554_1869_3182 | 388 |
| 248 | 3300036401 | Ga0373937_0112702 | Ga0373937_0112702_911_2077 | 388 |
| 249 | 3300036401 | Ga0373937_0307400 | Ga0373937_0307400_260_1426 | 388 |
| 250 | 3300037068 | Ga0373925_0000002 | Ga0373925_0000002_344462_345628 | 388 |
| 251 | 3300037068 | Ga0373925_0005123 | Ga0373925_0005123_5416_6582 | 388 |
| 252 | 3300037068 | Ga0373925_0036705 | Ga0373925_0036705_54_1220 | 388 |
| 253 | 3300037853 | Ga0436364_0562385 | Ga0436364_0562385_2215_3435 | 388 |
| 254 | 3300039437 | Ga0436365_1407541 | Ga0436365_1407541_7935_9101 | 388 |
| 255 | 3300039450 | Ga0436363_0889203 | Ga0436363_0889203_138_1304 | 388 |
| 256 | 3300044694 | Ga0466963_0055121 | Ga0466963_0055121_1246_2412 | 388 |
| 257 | 3300045049 | Ga0466959_0027730 | Ga0466959_0027730_643_1809 | 388 |
| 258 | 3300045836 | Ga0466958_0036333 | Ga0466958_0036333_726_1892 | 388 |
| 259 | 3300045976 | Ga0466967_0075883 | Ga0466967_0075883_1237_2415 | 388 |
| 260 | 3300045976 | Ga0466967_0102678 | Ga0466967_0102678_891_2234 | 388 |
| 261 | 3300046454 | Ga0495592_0000475 | Ga0495592_0000475_17322_18488 | 388 |
| 262 | 3300046459 | Ga0495629_0025089 | Ga0495629_0025089_1744_2910 | 388 |
| 263 | 3300046462 | Ga0495651_0005638 | Ga0495651_0005638_2295_3461 | 388 |
| 264 | 3300046463 | Ga0495653_0000006 | Ga0495653_0000006_344610_345776 | 388 |
| 265 | 3300046472 | Ga0495580_0034407 | Ga0495580_0034407_374_1540 | 388 |
| 266 | 3300046476 | Ga0495662_0001482 | Ga0495662_0001482_9702_10868 | 388 |
| 267 | 3300046476 | Ga0495662_0008512 | Ga0495662_0008512_3425_4591 | 388 |
| 268 | 3300046477 | Ga0495664_0000002 | Ga0495664_0000002_380244_381410 | 388 |
| 269 | 3300046477 | Ga0495664_0000553 | Ga0495664_0000553_9499_10665 | 388 |
| 270 | 3300046491 | Ga0495584_0011722 | Ga0495584_0011722_276_1442 | 388 |
| 271 | 3300046511 | Ga0495608_0000009 | Ga0495608_0000009_99025_100191 | 388 |
| 272 | 3300046514 | Ga0495618_0000005 | Ga0495618_0000005_157603_158769 | 388 |
| 273 | 3300046514 | Ga0495618_0002320 | Ga0495618_0002320_7380_8546 | 388 |
| 274 | 3300046514 | Ga0495618_0087504 | Ga0495618_0087504_319_1485 | 388 |
| 275 | 3300046516 | Ga0495628_0000002 | Ga0495628_0000002_344629_345795 | 388 |
| 276 | 3300046517 | Ga0495630_0000240 | Ga0495630_0000240_36247_37413 | 388 |
| 277 | 3300046517 | Ga0495630_0055666 | Ga0495630_0055666_1262_2428 | 388 |
| 278 | 3300046517 | Ga0495630_0270771 | Ga0495630_0270771_113_1279 | 388 |
| 279 | 3300046529 | Ga0495652_0000004 | Ga0495652_0000004_243088_244254 | 388 |
| 280 | 3300046529 | Ga0495652_0015928 | Ga0495652_0015928_2625_3791 | 388 |
| 281 | 3300046531 | Ga0495665_0004921 | Ga0495665_0004921_599_1765 | 388 |
| 282 | 3300046533 | Ga0495640_0000005 | Ga0495640_0000005_99040_100206 | 388 |
| 283 | 3300046533 | Ga0495640_0008496 | Ga0495640_0008496_3100_4266 | 388 |
| 284 | 3300046535 | Ga0495586_0058565 | Ga0495586_0058565_606_1772 | 388 |
| 285 | 3300046536 | Ga0495587_0000007 | Ga0495587_0000007_218036_219202 | 388 |
| 286 | 3300046543 | Ga0495645_0000003 | Ga0495645_0000003_325880_327046 | 388 |
| 287 | 3300046543 | Ga0495645_0025774 | Ga0495645_0025774_363_1529 | 388 |
| 288 | 3300046559 | Ga0495667_0000002 | Ga0495667_0000002_91928_93094 | 388 |
| 289 | 3300046615 | Ga0495656_0091601 | Ga0495656_0091601_96_1262 | 388 |
| 290 | 3300046642 | Ga0495634_0000129 | Ga0495634_0000129_10896_12062 | 388 |
| 291 | 3300046642 | Ga0495634_0008810 | Ga0495634_0008810_3533_4699 | 388 |
| 292 | 3300046642 | Ga0495634_0141283 | Ga0495634_0141283_269_1435 | 388 |
| 293 | 3300046663 | Ga0495635_0000020 | Ga0495635_0000020_154002_155168 | 388 |
| 294 | 3300046663 | Ga0495635_0002623 | Ga0495635_0002623_3881_5047 | 388 |
| 295 | 3300046678 | Ga0495599_0000001 | Ga0495599_0000001_483307_484473 | 388 |
| 296 | 3300046679 | Ga0495623_0000001 | Ga0495623_0000001_252252_253418 | 388 |
| 297 | 3300046680 | Ga0495646_0000013 | Ga0495646_0000013_102885_104051 | 388 |
| 298 | 3300046681 | Ga0495647_0025809 | Ga0495647_0025809_531_1697 | 388 |
| 299 | 3300046683 | Ga0495658_0010561 | Ga0495658_0010561_541_1707 | 388 |
| 300 | 3300046689 | Ga0495613_0017049 | Ga0495613_0017049_2696_3862 | 388 |
| 301 | 3300046689 | Ga0495613_0028418 | Ga0495613_0028418_1155_2321 | 388 |
| 302 | 3300046689 | Ga0495613_0134125 | Ga0495613_0134125_362_1528 | 388 |
| 303 | 3300046690 | Ga0495624_0004432 | Ga0495624_0004432_5040_6206 | 388 |
| 304 | 3300046690 | Ga0495624_0005773 | Ga0495624_0005773_4265_5431 | 388 |
| 305 | 3300046692 | Ga0495671_0124558 | Ga0495671_0124558_73_1239 | 388 |
| 306 | 3300046809 | Ga0495600_0000041 | Ga0495600_0000041_61874_63040 | 388 |
| 307 | 3300047315 | Ga0495581_0003767 | Ga0495581_0003767_6400_7566 | 388 |
| 308 | 3300047315 | Ga0495581_0046261 | Ga0495581_0046261_291_1457 | 388 |
| 309 | 3300047317 | Ga0495604_0000005 | Ga0495604_0000005_370273_371439 | 388 |
| 310 | 3300047317 | Ga0495604_0127480 | Ga0495604_0127480_175_1341 | 388 |
| 311 | 3300047319 | Ga0495674_0000003 | Ga0495674_0000003_216331_217497 | 388 |
| 312 | 3300047319 | Ga0495674_0003325 | Ga0495674_0003325_6096_7262 | 388 |
| 313 | 3300047321 | Ga0495676_0036509 | Ga0495676_0036509_1083_2249 | 388 |
| 314 | 3300047322 | Ga0495680_0000002 | Ga0495680_0000002_147696_148862 | 388 |
| 315 | 3300047444 | Ga0495675_0000383 | Ga0495675_0000383_22356_23522 | 388 |
| 316 | 3300047471 | Ga0495684_0000020 | Ga0495684_0000020_94289_95455 | 388 |
| 317 | 3300047471 | Ga0495684_0001619 | Ga0495684_0001619_7314_8480 | 388 |
| 318 | 3300047471 | Ga0495684_0008545 | Ga0495684_0008545_3225_4391 | 388 |
| 319 | 3300047471 | Ga0495684_0096579 | Ga0495684_0096579_1017_2183 | 388 |
| 320 | 3300047673 | Ga0495593_0001985 | Ga0495593_0001985_8534_9700 | 388 |
| 321 | 3300047673 | Ga0495593_0097929 | Ga0495593_0097929_104_1270 | 388 |
| 322 | 3300048088 | Ga0495602_0000027 | Ga0495602_0000027_72189_73355 | 388 |
| 323 | 3300048903 | Ga0496100_0143964 | Ga0496100_0143964_467_1633 | 388 |
| 324 | 3300048905 | Ga0496102_0002863 | Ga0496102_0002863_12698_13864 | 388 |
| 325 | 3300048907 | Ga0496104_0001130 | Ga0496104_0001130_10229_11395 | 388 |
| 326 | 3300048907 | Ga0496104_0015135 | Ga0496104_0015135_4833_5999 | 388 |
| 327 | 3300048907 | Ga0496104_0021724 | Ga0496104_0021724_1981_3147 | 388 |
| 328 | 3300048907 | Ga0496104_0179542 | Ga0496104_0179542_788_1987 | 388 |
| 329 | 3300048908 | Ga0496105_0002424 | Ga0496105_0002424_8105_9271 | 388 |
| 330 | 3300048908 | Ga0496105_0003830 | Ga0496105_0003830_5323_6489 | 388 |
| 331 | 3300048908 | Ga0496105_0172991 | Ga0496105_0172991_183_1352 | 388 |
| 332 | 3300048909 | Ga0496106_0019354 | Ga0496106_0019354_835_2001 | 388 |
| 333 | 3300048911 | Ga0496108_0006587 | Ga0496108_0006587_3402_4568 | 388 |
| 334 | 3300048912 | Ga0496109_0010007 | Ga0496109_0010007_2107_3273 | 388 |
| 335 | 3300048914 | Ga0496111_0004597 | Ga0496111_0004597_3855_5021 | 388 |
| 336 | 3300048915 | Ga0496112_0011362 | Ga0496112_0011362_4855_6021 | 388 |
| 337 | 3300048916 | Ga0496113_0005126 | Ga0496113_0005126_2107_3273 | 388 |
| 338 | 3300048917 | Ga0496114_0005823 | Ga0496114_0005823_3412_4611 | 388 |
| 339 | 3300048917 | Ga0496114_0031377 | Ga0496114_0031377_1624_2790 | 388 |
| 340 | 3300049569 | Ga0501032_0022662 | Ga0501032_0022662_1920_3098 | 388 |
| 341 | 3300049569 | Ga0501032_0037377 | Ga0501032_0037377_1570_2748 | 388 |
| 342 | 3300049570 | Ga0501033_0005800 | Ga0501033_0005800_1695_2861 | 388 |
| 343 | 3300049571 | Ga0501034_0000247 | Ga0501034_0000247_48178_49356 | 388 |
| 344 | 3300049571 | Ga0501034_0001519 | Ga0501034_0001519_23300_24478 | 388 |
| 345 | 3300049571 | Ga0501034_0027708 | Ga0501034_0027708_4201_5367 | 388 |
| 346 | 3300049571 | Ga0501034_0060022 | Ga0501034_0060022_100_1266 | 388 |
| 347 | 3300049571 | Ga0501034_0093689 | Ga0501034_0093689_1088_2266 | 388 |
| 348 | 3300049572 | Ga0501036_0001768 | Ga0501036_0001768_8973_10151 | 388 |
| 349 | 3300049572 | Ga0501036_0028767 | Ga0501036_0028767_1447_2625 | 388 |
| 350 | 3300049572 | Ga0501036_0146536 | Ga0501036_0146536_547_1725 | 388 |
| 351 | 3300049573 | Ga0501037_0005176 | Ga0501037_0005176_4569_5747 | 388 |
| 352 | 3300049573 | Ga0501037_0039212 | Ga0501037_0039212_1237_2403 | 388 |
| 353 | 3300049574 | Ga0501038_0018465 | Ga0501038_0018465_1409_2587 | 388 |
| 354 | 3300049574 | Ga0501038_0040136 | Ga0501038_0040136_1768_2946 | 388 |
| 355 | 3300049574 | Ga0501038_0041971 | Ga0501038_0041971_2321_3499 | 388 |
| 356 | 3300049574 | Ga0501038_0069953 | Ga0501038_0069953_280_1458 | 388 |
| 357 | 3300049574 | Ga0501038_0104008 | Ga0501038_0104008_123_1289 | 388 |
| 358 | 3300049575 | Ga0501039_0012756 | Ga0501039_0012756_726_1904 | 388 |
| 359 | 3300049575 | Ga0501039_0030461 | Ga0501039_0030461_2853_4019 | 388 |
| 360 | 3300049575 | Ga0501039_0076368 | Ga0501039_0076368_863_2041 | 388 |
| 361 | 3300049576 | Ga0501040_0019715 | Ga0501040_0019715_2964_4142 | 388 |
| 362 | 3300049579 | Ga0501043_0001829 | Ga0501043_0001829_5100_6278 | 388 |
| 363 | 3300049579 | Ga0501043_0046400 | Ga0501043_0046400_1678_2856 | 388 |
| 364 | 3300049579 | Ga0501043_0074181 | Ga0501043_0074181_949_2127 | 388 |
| 365 | 3300049580 | Ga0501046_0041776 | Ga0501046_0041776_614_1792 | 388 |
| 366 | 3300049580 | Ga0501046_0091010 | Ga0501046_0091010_529_1707 | 388 |
| 367 | 3300049581 | Ga0501047_0000010 | Ga0501047_0000010_174882_176060 | 388 |
| 368 | 3300049581 | Ga0501047_0011285 | Ga0501047_0011285_6338_7504 | 388 |
| 369 | 3300049581 | Ga0501047_0047155 | Ga0501047_0047155_1333_2511 | 388 |
| 370 | 3300049582 | Ga0501048_0000554 | Ga0501048_0000554_16403_17581 | 388 |
| 371 | 3300049584 | Ga0501068_0062183 | Ga0501068_0062183_529_1707 | 388 |
| 372 | 3300049586 | Ga0501070_0029949 | Ga0501070_0029949_206_1372 | 388 |
| 373 | 3300049586 | Ga0501070_0036241 | Ga0501070_0036241_2652_3830 | 388 |
| 374 | 3300049586 | Ga0501070_0050777 | Ga0501070_0050777_2056_3234 | 388 |
| 375 | 3300049586 | Ga0501070_0084146 | Ga0501070_0084146_12_1190 | 388 |
| 376 | 3300049588 | Ga0501072_0053922 | Ga0501072_0053922_774_1952 | 388 |
| 377 | 3300049589 | Ga0501073_0027991 | Ga0501073_0027991_2106_3284 | 388 |
| 378 | 3300049590 | Ga0501074_0018217 | Ga0501074_0018217_1831_3009 | 388 |
| 379 | 3300049591 | Ga0501075_0066325 | Ga0501075_0066325_521_1687 | 388 |
| 380 | 3300049592 | Ga0501076_0266446 | Ga0501076_0266446_84_1250 | 388 |
| 381 | 3300049593 | Ga0501077_0061505 | Ga0501077_0061505_989_2155 | 388 |
| 382 | 3300049741 | Ga0501079_0020439 | Ga0501079_0020439_2329_3507 | 388 |
| 383 | 3300049741 | Ga0501079_0125432 | Ga0501079_0125432_564_1742 | 388 |
| 384 | 3300049742 | Ga0501080_0000100 | Ga0501080_0000100_10005_11183 | 388 |
| 385 | 3300049744 | Ga0501083_0003213 | Ga0501083_0003213_6509_7687 | 388 |
| 386 | 3300049822 | Ga0501035_0056982 | Ga0501035_0056982_1435_2613 | 388 |
| 387 | 3300049822 | Ga0501035_0061789 | Ga0501035_0061789_436_1602 | 388 |
| 388 | 3300049822 | Ga0501035_0258253 | Ga0501035_0258253_108_1286 | 388 |
| 389 | 3300049823 | Ga0501044_0022356 | Ga0501044_0022356_1298_2464 | 388 |
| 390 | 3300049823 | Ga0501044_0022773 | Ga0501044_0022773_4072_5250 | 388 |
| 391 | 3300049823 | Ga0501044_0046008 | Ga0501044_0046008_2412_3590 | 388 |
| 392 | 3300049823 | Ga0501044_0047839 | Ga0501044_0047839_2859_4037 | 388 |
| 393 | 3300049823 | Ga0501044_0144331 | Ga0501044_0144331_334_1512 | 388 |
| 394 | 3300049823 | Ga0501044_0170875 | Ga0501044_0170875_930_2108 | 388 |
| 395 | 3300050491 | nmdc:mga00v17_59794_c1 | nmdc:mga00v17_59794_c1_1137_2303 | 388 |
| 396 | 3300050492 | nmdc:mga0yw44_28208_c1 | nmdc:mga0yw44_28208_c1_524_1690 | 388 |
| 397 | 3300050492 | nmdc:mga0yw44_28951_c1 | nmdc:mga0yw44_28951_c1_406_1572 | 388 |
| 398 | 3300050492 | nmdc:mga0yw44_34879_c1 | nmdc:mga0yw44_34879_c1_643_1809 | 388 |
| 399 | 3300050492 | nmdc:mga0yw44_79114_c1 | nmdc:mga0yw44_79114_c1_493_1725 | 388 |
| 400 | 3300050507 | nmdc:mga05p37_203690_c1 | nmdc:mga05p37_203690_c1_844_2088 | 388 |
| 401 | 3300050507 | nmdc:mga05p37_20453_c1 | nmdc:mga05p37_20453_c1_3287_4453 | 388 |
| 402 | 3300050509 | nmdc:mga0qj67_60210_c1 | nmdc:mga0qj67_60210_c1_317_1630 | 388 |
| 403 | 3300050509 | nmdc:mga0qj67_930_c1 | nmdc:mga0qj67_930_c1_4773_5939 | 388 |
| 404 | 3300050510 | nmdc:mga06r32_158351_c1 | nmdc:mga06r32_158351_c1_406_1575 | 388 |
| 405 | 3300050510 | nmdc:mga06r32_34777_c1 | nmdc:mga06r32_34777_c1_1458_2762 | 388 |
| 406 | 3300050510 | nmdc:mga06r32_38341_c1 | nmdc:mga06r32_38341_c1_2002_3168 | 388 |
| 407 | 3300050511 | nmdc:mga08y16_215960_c1 | nmdc:mga08y16_215960_c1_792_1958 | 388 |
| 408 | 3300050511 | nmdc:mga08y16_60333_c1 | nmdc:mga08y16_60333_c1_840_2009 | 388 |
| 409 | 3300050512 | nmdc:mga0n895_167961_c1 | nmdc:mga0n895_167961_c1_84_1250 | 388 |
| 410 | 3300050512 | nmdc:mga0n895_48732_c1 | nmdc:mga0n895_48732_c1_2102_3277 | 388 |
| 411 | 3300050512 | nmdc:mga0n895_65635_c1 | nmdc:mga0n895_65635_c1_352_1518 | 388 |
| 412 | 3300050512 | nmdc:mga0n895_76804_c1 | nmdc:mga0n895_76804_c1_321_1487 | 388 |
| 413 | 3300050513 | nmdc:mga0rr50_2286_c1 | nmdc:mga0rr50_2286_c1_1268_2449 | 388 |
| 414 | 3300050513 | nmdc:mga0rr50_28329_c1 | nmdc:mga0rr50_28329_c1_2185_3351 | 388 |
| 415 | 3300050516 | nmdc:mga0sz30_25919_c1 | nmdc:mga0sz30_25919_c1_376_1608 | 388 |
| 416 | 3300053077 | Ga0495601_0000010 | Ga0495601_0000010_243042_244208 | 388 |
| 417 | 3300053077 | Ga0495601_0003343 | Ga0495601_0003343_163_1329 | 388 |
| 418 | 3300053078 | Ga0495612_0000002 | Ga0495612_0000002_256225_257391 | 388 |
| 419 | 3300053078 | Ga0495612_0001550 | Ga0495612_0001550_5970_7136 | 388 |
| 420 | 3300053084 | Ga0495595_0000110 | Ga0495595_0000110_14481_15647 | 388 |
| 421 | 3300053085 | Ga0495619_0000002 | Ga0495619_0000002_344632_345798 | 388 |
| 422 | 3300053085 | Ga0495619_0001919 | Ga0495619_0001919_3354_4520 | 388 |
| 423 | 3300053085 | Ga0495619_0017692 | Ga0495619_0017692_557_1723 | 388 |
| 424 | 3300053096 | Ga0500641_0034247 | Ga0500641_0034247_642_1808 | 388 |
| 425 | 3300061734 | Ga0530510_0083164 | Ga0530510_0083164_278_1444 | 388 |
| 426 | 2209111006 | 2214911850 | 2213970326 | 389 |
| 427 | 3300000043 | ARcpr5yngRDRAFT_c000600 | ARcpr5yngRDRAFT_0006003 | 389 |
| 428 | 3300000044 | ARSoilOldRDRAFT_c000023 | ARSoilOldRDRAFT_00002321 | 389 |
| 429 | 3300000045 | ARCol0oldRDRAFT_c00462 | ARCol0oldRDRAFT_004623 | 389 |
| 430 | 3300000652 | ARCol0yngRDRAFT_1000216 | ARCol0yngRDRAFT_10002163 | 389 |
| 431 | 3300001430 | JGI24032J14994_100292 | JGI24032J14994_1002922 | 389 |
| 432 | 3300001977 | JGI24746J21847_1000047 | JGI24746J21847_10000477 | 389 |
| 433 | 3300001989 | JGI24739J22299_10000148 | JGI24739J22299_1000014810 | 389 |
| 434 | 3300001990 | JGI24737J22298_10000458 | JGI24737J22298_100004586 | 389 |
| 435 | 3300001990 | JGI24737J22298_10003428 | JGI24737J22298_100034285 | 389 |
| 436 | 3300002070 | JGI24750J21931_1000011 | JGI24750J21931_10000119 | 389 |
| 437 | 3300002075 | JGI24738J21930_10000236 | JGI24738J21930_100002367 | 389 |
| 438 | 3300002076 | JGI24749J21850_1000378 | JGI24749J21850_10003785 | 389 |
| 439 | 3300002077 | JGI24744J21845_10010109 | JGI24744J21845_100101092 | 389 |
| 440 | 3300002126 | JGI24035J26624_1001314 | JGI24035J26624_10013142 | 389 |
| 441 | 3300002155 | JGI24033J26618_1001259 | JGI24033J26618_10012591 | 389 |
| 442 | 3300002239 | JGI24034J26672_10000483 | JGI24034J26672_100004835 | 389 |
| 443 | 3300002244 | JGI24742J22300_10000248 | JGI24742J22300_100002484 | 389 |
| 444 | 3300002459 | JGI24751J29686_10007458 | JGI24751J29686_100074582 | 389 |
| 445 | 3300005277 | Ga0065716_1002142 | Ga0065716_10021422 | 389 |
| 446 | 3300005290 | Ga0065712_10072517 | Ga0065712_100725175 | 389 |
| 447 | 3300005290 | Ga0065712_10077915 | Ga0065712_100779152 | 389 |
| 448 | 3300005293 | Ga0065715_10001564 | Ga0065715_1000156410 | 389 |
| 449 | 3300005293 | Ga0065715_10088960 | Ga0065715_1008896012 | 389 |
| 450 | 3300005293 | Ga0065715_10146095 | Ga0065715_101460952 | 389 |
| 451 | 3300005327 | Ga0070658_10287789 | Ga0070658_102877891 | 389 |
| 452 | 3300005328 | Ga0070676_10000536 | Ga0070676_1000053615 | 389 |
| 453 | 3300005329 | Ga0070683_100000144 | Ga0070683_10000014419 | 389 |
| 454 | 3300005330 | Ga0070690_100001428 | Ga0070690_1000014282 | 389 |
| 455 | 3300005330 | Ga0070690_100028441 | Ga0070690_1000284413 | 389 |
| 456 | 3300005331 | Ga0070670_100000437 | Ga0070670_10000043714 | 389 |
| 457 | 3300005333 | Ga0070677_10008501 | Ga0070677_100085013 | 389 |
| 458 | 3300005334 | Ga0068869_100000035 | Ga0068869_10000003518 | 389 |
| 459 | 3300005335 | Ga0070666_10006881 | Ga0070666_100068815 | 389 |
| 460 | 3300005335 | Ga0070666_10033695 | Ga0070666_100336951 | 389 |
| 461 | 3300005336 | Ga0070680_100001482 | Ga0070680_1000014829 | 389 |
| 462 | 3300005336 | Ga0070680_100010932 | Ga0070680_1000109322 | 389 |
| 463 | 3300005336 | Ga0070680_100023460 | Ga0070680_1000234605 | 389 |
| 464 | 3300005337 | Ga0070682_100002219 | Ga0070682_1000022193 | 389 |
| 465 | 3300005337 | Ga0070682_100013572 | Ga0070682_1000135723 | 389 |
| 466 | 3300005338 | Ga0068868_100001888 | Ga0068868_10000188814 | 389 |
| 467 | 3300005339 | Ga0070660_100001344 | Ga0070660_1000013445 | 389 |
| 468 | 3300005339 | Ga0070660_100008614 | Ga0070660_1000086146 | 389 |
| 469 | 3300005340 | Ga0070689_100000207 | Ga0070689_10000020735 | 389 |
| 470 | 3300005340 | Ga0070689_100068592 | Ga0070689_1000685922 | 389 |
| 471 | 3300005341 | Ga0070691_10001234 | Ga0070691_100012343 | 389 |
| 472 | 3300005343 | Ga0070687_100000261 | Ga0070687_10000026118 | 389 |
| 473 | 3300005344 | Ga0070661_100000017 | Ga0070661_10000001729 | 389 |
| 474 | 3300005345 | Ga0070692_10000008 | Ga0070692_100000084 | 389 |
| 475 | 3300005347 | Ga0070668_100000699 | Ga0070668_10000069915 | 389 |
| 476 | 3300005347 | Ga0070668_100062678 | Ga0070668_1000626782 | 389 |
| 477 | 3300005353 | Ga0070669_100000250 | Ga0070669_10000025020 | 389 |
| 478 | 3300005353 | Ga0070669_100078587 | Ga0070669_1000785872 | 389 |
| 479 | 3300005354 | Ga0070675_100000246 | Ga0070675_1000002463 | 389 |
| 480 | 3300005355 | Ga0070671_100003025 | Ga0070671_1000030252 | 389 |
| 481 | 3300005356 | Ga0070674_100000355 | Ga0070674_10000035519 | 389 |
| 482 | 3300005364 | Ga0070673_100000032 | Ga0070673_10000003214 | 389 |
| 483 | 3300005364 | Ga0070673_100037972 | Ga0070673_1000379724 | 389 |
| 484 | 3300005365 | Ga0070688_100000669 | Ga0070688_1000006693 | 389 |
| 485 | 3300005366 | Ga0070659_100000214 | Ga0070659_10000021421 | 389 |
| 486 | 3300005366 | Ga0070659_100009561 | Ga0070659_1000095617 | 389 |
| 487 | 3300005367 | Ga0070667_100000816 | Ga0070667_10000081623 | 389 |
| 488 | 3300005367 | Ga0070667_100067811 | Ga0070667_1000678114 | 389 |
| 489 | 3300005367 | Ga0070667_100135426 | Ga0070667_1001354261 | 389 |
| 490 | 3300005406 | Ga0070703_10003001 | Ga0070703_100030014 | 389 |
| 491 | 3300005434 | Ga0070709_10008980 | Ga0070709_100089805 | 389 |
| 492 | 3300005435 | Ga0070714_100057751 | Ga0070714_1000577514 | 389 |
| 493 | 3300005436 | Ga0070713_100020676 | Ga0070713_1000206765 | 389 |
| 494 | 3300005437 | Ga0070710_10033187 | Ga0070710_100331872 | 389 |
| 495 | 3300005438 | Ga0070701_10000099 | Ga0070701_1000009923 | 389 |
| 496 | 3300005438 | Ga0070701_10056293 | Ga0070701_100562932 | 389 |
| 497 | 3300005440 | Ga0070705_100002586 | Ga0070705_1000025863 | 389 |
| 498 | 3300005440 | Ga0070705_100052781 | Ga0070705_1000527812 | 389 |
| 499 | 3300005441 | Ga0070700_100000234 | Ga0070700_10000023413 | 389 |
| 500 | 3300005441 | Ga0070700_100005017 | Ga0070700_1000050172 | 389 |
| 501 | 3300005444 | Ga0070694_100000247 | Ga0070694_10000024711 | 389 |
| 502 | 3300005455 | Ga0070663_100000201 | Ga0070663_1000002019 | 389 |
| 503 | 3300005456 | Ga0070678_100003298 | Ga0070678_1000032982 | 389 |
| 504 | 3300005456 | Ga0070678_100015873 | Ga0070678_1000158733 | 389 |
| 505 | 3300005457 | Ga0070662_100009709 | Ga0070662_1000097093 | 389 |
| 506 | 3300005457 | Ga0070662_100010369 | Ga0070662_1000103693 | 389 |
| 507 | 3300005457 | Ga0070662_100042269 | Ga0070662_1000422693 | 389 |
| 508 | 3300005458 | Ga0070681_10000401 | Ga0070681_1000040120 | 389 |
| 509 | 3300005458 | Ga0070681_10332233 | Ga0070681_103322332 | 389 |
| 510 | 3300005459 | Ga0068867_100000190 | Ga0068867_10000019027 | 389 |
| 511 | 3300005466 | Ga0070685_10009054 | Ga0070685_100090545 | 389 |
| 512 | 3300005468 | Ga0070707_100187753 | Ga0070707_1001877532 | 389 |
| 513 | 3300005530 | Ga0070679_100000847 | Ga0070679_10000084710 | 389 |
| 514 | 3300005530 | Ga0070679_100025113 | Ga0070679_1000251137 | 389 |
| 515 | 3300005530 | Ga0070679_100177188 | Ga0070679_1001771882 | 389 |
| 516 | 3300005535 | Ga0070684_100000904 | Ga0070684_10000090412 | 389 |
| 517 | 3300005535 | Ga0070684_100061415 | Ga0070684_1000614153 | 389 |
| 518 | 3300005539 | Ga0068853_100003019 | Ga0068853_10000301911 | 389 |
| 519 | 3300005539 | Ga0068853_100023115 | Ga0068853_1000231152 | 389 |
| 520 | 3300005543 | Ga0070672_100000807 | Ga0070672_10000080712 | 389 |
| 521 | 3300005544 | Ga0070686_100010404 | Ga0070686_1000104045 | 389 |
| 522 | 3300005544 | Ga0070686_100033721 | Ga0070686_1000337212 | 389 |
| 523 | 3300005545 | Ga0070695_100000406 | Ga0070695_10000040620 | 389 |
| 524 | 3300005545 | Ga0070695_100011865 | Ga0070695_1000118654 | 389 |
| 525 | 3300005545 | Ga0070695_100014581 | Ga0070695_1000145812 | 389 |
| 526 | 3300005546 | Ga0070696_100000304 | Ga0070696_10000030415 | 389 |
| 527 | 3300005546 | Ga0070696_100064387 | Ga0070696_1000643873 | 389 |
| 528 | 3300005547 | Ga0070693_100000546 | Ga0070693_10000054612 | 389 |
| 529 | 3300005547 | Ga0070693_100062362 | Ga0070693_1000623622 | 389 |
| 530 | 3300005549 | Ga0070704_100000385 | Ga0070704_10000038512 | 389 |
| 531 | 3300005549 | Ga0070704_100003857 | Ga0070704_1000038572 | 389 |
| 532 | 3300005563 | Ga0068855_100019930 | Ga0068855_1000199306 | 389 |
| 533 | 3300005563 | Ga0068855_100222335 | Ga0068855_1002223352 | 389 |
| 534 | 3300005564 | Ga0070664_100000912 | Ga0070664_10000091213 | 389 |
| 535 | 3300005577 | Ga0068857_100000494 | Ga0068857_10000049410 | 389 |
| 536 | 3300005577 | Ga0068857_100209625 | Ga0068857_1002096252 | 389 |
| 537 | 3300005578 | Ga0068854_100000139 | Ga0068854_10000013917 | 389 |
| 538 | 3300005614 | Ga0068856_100005193 | Ga0068856_1000051933 | 389 |
| 539 | 3300005615 | Ga0070702_100000177 | Ga0070702_10000017713 | 389 |
| 540 | 3300005615 | Ga0070702_100011837 | Ga0070702_1000118374 | 389 |
| 541 | 3300005616 | Ga0068852_100000193 | Ga0068852_10000019321 | 389 |
| 542 | 3300005616 | Ga0068852_100042613 | Ga0068852_1000426135 | 389 |
| 543 | 3300005616 | Ga0068852_100087017 | Ga0068852_1000870172 | 389 |
| 544 | 3300005617 | Ga0068859_100002972 | Ga0068859_1000029722 | 389 |
| 545 | 3300005618 | Ga0068864_100000226 | Ga0068864_10000022621 | 389 |
| 546 | 3300005618 | Ga0068864_100080542 | Ga0068864_1000805423 | 389 |
| 547 | 3300005718 | Ga0068866_10000199 | Ga0068866_1000019917 | 389 |
| 548 | 3300005719 | Ga0068861_100000328 | Ga0068861_10000032825 | 389 |
| 549 | 3300005834 | Ga0068851_10084106 | Ga0068851_100841062 | 389 |
| 550 | 3300005840 | Ga0068870_10000388 | Ga0068870_100003889 | 389 |
| 551 | 3300005841 | Ga0068863_100001877 | Ga0068863_1000018772 | 389 |
| 552 | 3300005842 | Ga0068858_100000512 | Ga0068858_10000051244 | 389 |
| 553 | 3300005842 | Ga0068858_100096035 | Ga0068858_1000960351 | 389 |
| 554 | 3300005843 | Ga0068860_100001525 | Ga0068860_10000152515 | 389 |
| 555 | 3300005843 | Ga0068860_100154993 | Ga0068860_1001549931 | 389 |
| 556 | 3300005844 | Ga0068862_100000557 | Ga0068862_10000055712 | 389 |
| 557 | 3300005937 | Ga0081455_10000035 | Ga0081455_1000003570 | 389 |
| 558 | 3300006028 | Ga0070717_10003781 | Ga0070717_100037818 | 389 |
| 559 | 3300006175 | Ga0070712_100037167 | Ga0070712_1000371673 | 389 |
| 560 | 3300006175 | Ga0070712_100065830 | Ga0070712_1000658302 | 389 |
| 561 | 3300006175 | Ga0070712_100077344 | Ga0070712_1000773442 | 389 |
| 562 | 3300006178 | Ga0075367_10053116 | Ga0075367_100531162 | 389 |
| 563 | 3300006178 | Ga0075367_10083357 | Ga0075367_100833572 | 389 |
| 564 | 3300006237 | Ga0097621_100000049 | Ga0097621_10000004921 | 389 |
| 565 | 3300006358 | Ga0068871_100000097 | Ga0068871_10000009722 | 389 |
| 566 | 3300006358 | Ga0068871_100005912 | Ga0068871_1000059121 | 389 |
| 567 | 3300006358 | Ga0068871_100045059 | Ga0068871_1000450593 | 389 |
| 568 | 3300006871 | Ga0075434_100000383 | Ga0075434_10000038317 | 389 |
| 569 | 3300006871 | Ga0075434_100127207 | Ga0075434_1001272073 | 389 |
| 570 | 3300006871 | Ga0075434_100339957 | Ga0075434_1003399572 | 389 |
| 571 | 3300006881 | Ga0068865_100000119 | Ga0068865_10000011923 | 389 |
| 572 | 3300006931 | Ga0097620_100002972 | Ga0097620_1000029722 | 389 |
| 573 | 3300007076 | Ga0075435_100034684 | Ga0075435_1000346841 | 389 |
| 574 | 3300007076 | Ga0075435_100045146 | Ga0075435_1000451462 | 389 |
| 575 | 3300009011 | Ga0105251_10024945 | Ga0105251_100249451 | 389 |
| 576 | 3300009094 | Ga0111539_10000237 | Ga0111539_1000023724 | 389 |
| 577 | 3300009094 | Ga0111539_10001512 | Ga0111539_100015123 | 389 |
| 578 | 3300009094 | Ga0111539_10295857 | Ga0111539_102958572 | 389 |
| 579 | 3300009098 | Ga0105245_10000202 | Ga0105245_1000020224 | 389 |
| 580 | 3300009098 | Ga0105245_10003663 | Ga0105245_100036639 | 389 |
| 581 | 3300009098 | Ga0105245_10037311 | Ga0105245_100373111 | 389 |
| 582 | 3300009101 | Ga0105247_10010332 | Ga0105247_100103322 | 389 |
| 583 | 3300009101 | Ga0105247_10211918 | Ga0105247_102119181 | 389 |
| 584 | 3300009148 | Ga0105243_10001790 | Ga0105243_100017909 | 389 |
| 585 | 3300009148 | Ga0105243_10026091 | Ga0105243_100260914 | 389 |
| 586 | 3300009174 | Ga0105241_10000430 | Ga0105241_1000043015 | 389 |
| 587 | 3300009176 | Ga0105242_10002429 | Ga0105242_1000242911 | 389 |
| 588 | 3300009176 | Ga0105242_10158731 | Ga0105242_101587312 | 389 |
| 589 | 3300009177 | Ga0105248_10001335 | Ga0105248_1000133522 | 389 |
| 590 | 3300009177 | Ga0105248_10098539 | Ga0105248_100985393 | 389 |
| 591 | 3300009545 | Ga0105237_10011108 | Ga0105237_100111085 | 389 |
| 592 | 3300009545 | Ga0105237_10232742 | Ga0105237_102327422 | 389 |
| 593 | 3300009551 | Ga0105238_10013781 | Ga0105238_100137818 | 389 |
| 594 | 3300009551 | Ga0105238_10054694 | Ga0105238_100546943 | 389 |
| 595 | 3300009551 | Ga0105238_10215181 | Ga0105238_102151812 | 389 |
| 596 | 3300009553 | Ga0105249_10000215 | Ga0105249_1000021521 | 389 |
| 597 | 3300009553 | Ga0105249_10039083 | Ga0105249_100390833 | 389 |
| 598 | 3300010375 | Ga0105239_10028262 | Ga0105239_100282622 | 389 |
| 599 | 3300010375 | Ga0105239_10048716 | Ga0105239_100487163 | 389 |
| 600 | 3300011119 | Ga0105246_10000019 | Ga0105246_1000001932 | 389 |
| 601 | 3300011119 | Ga0105246_10176718 | Ga0105246_101767181 | 389 |
| 602 | 3300013100 | Ga0157373_10039499 | Ga0157373_100394993 | 389 |
| 603 | 3300013100 | Ga0157373_10106324 | Ga0157373_101063241 | 389 |
| 604 | 3300013102 | Ga0157371_10018650 | Ga0157371_100186502 | 389 |
| 605 | 3300013102 | Ga0157371_10140280 | Ga0157371_101402802 | 389 |
| 606 | 3300013104 | Ga0157370_10051700 | Ga0157370_100517002 | 389 |
| 607 | 3300013296 | Ga0157374_10001742 | Ga0157374_1000174212 | 389 |
| 608 | 3300013296 | Ga0157374_10065644 | Ga0157374_100656442 | 389 |
| 609 | 3300013296 | Ga0157374_10163948 | Ga0157374_101639482 | 389 |
| 610 | 3300013297 | Ga0157378_10002701 | Ga0157378_1000270111 | 389 |
| 611 | 3300013297 | Ga0157378_10054488 | Ga0157378_100544883 | 389 |
| 612 | 3300013297 | Ga0157378_10119950 | Ga0157378_101199502 | 389 |
| 613 | 3300013306 | Ga0163162_10001187 | Ga0163162_1000118711 | 389 |
| 614 | 3300013306 | Ga0163162_10192309 | Ga0163162_101923092 | 389 |
| 615 | 3300013306 | Ga0163162_10461116 | Ga0163162_104611162 | 389 |
| 616 | 3300013307 | Ga0157372_10123858 | Ga0157372_101238582 | 389 |
| 617 | 3300013308 | Ga0157375_10000135 | Ga0157375_1000013560 | 389 |
| 618 | 3300013308 | Ga0157375_10010957 | Ga0157375_100109573 | 389 |
| 619 | 3300013308 | Ga0157375_10121543 | Ga0157375_101215432 | 389 |
| 620 | 3300014325 | Ga0163163_10019264 | Ga0163163_100192644 | 389 |
| 621 | 3300014325 | Ga0163163_10259652 | Ga0163163_102596522 | 389 |
| 622 | 3300014325 | Ga0163163_10268805 | Ga0163163_102688052 | 389 |
| 623 | 3300014326 | Ga0157380_10000284 | Ga0157380_1000028420 | 389 |
| 624 | 3300014326 | Ga0157380_10308622 | Ga0157380_103086222 | 389 |
| 625 | 3300014968 | Ga0157379_10000065 | Ga0157379_1000006532 | 389 |
| 626 | 3300014968 | Ga0157379_10075984 | Ga0157379_100759843 | 389 |
| 627 | 3300014968 | Ga0157379_10210808 | Ga0157379_102108082 | 389 |
| 628 | 3300014969 | Ga0157376_10000180 | Ga0157376_1000018024 | 389 |
| 629 | 3300014969 | Ga0157376_10194758 | Ga0157376_101947582 | 389 |
| 630 | 3300017792 | Ga0163161_10001579 | Ga0163161_1000157913 | 389 |
| 631 | 3300025271 | Ga0207666_1000078 | Ga0207666_100007810 | 389 |
| 632 | 3300025271 | Ga0207666_1000744 | Ga0207666_10007442 | 389 |
| 633 | 3300025290 | Ga0207673_1000034 | Ga0207673_10000346 | 389 |
| 634 | 3300025315 | Ga0207697_10000370 | Ga0207697_1000037013 | 389 |
| 635 | 3300025315 | Ga0207697_10003696 | Ga0207697_100036967 | 389 |
| 636 | 3300025321 | Ga0207656_10068370 | Ga0207656_100683702 | 389 |
| 637 | 3300025885 | Ga0207653_10001699 | Ga0207653_100016995 | 389 |
| 638 | 3300025893 | Ga0207682_10000304 | Ga0207682_100003049 | 389 |
| 639 | 3300025899 | Ga0207642_10000268 | Ga0207642_100002682 | 389 |
| 640 | 3300025899 | Ga0207642_10070941 | Ga0207642_100709412 | 389 |
| 641 | 3300025899 | Ga0207642_10082622 | Ga0207642_100826221 | 389 |
| 642 | 3300025901 | Ga0207688_10000014 | Ga0207688_1000001453 | 389 |
| 643 | 3300025901 | Ga0207688_10044106 | Ga0207688_100441062 | 389 |
| 644 | 3300025903 | Ga0207680_10019425 | Ga0207680_100194253 | 389 |
| 645 | 3300025904 | Ga0207647_10004406 | Ga0207647_1000440610 | 389 |
| 646 | 3300025904 | Ga0207647_10043164 | Ga0207647_100431641 | 389 |
| 647 | 3300025906 | Ga0207699_10141012 | Ga0207699_101410121 | 389 |
| 648 | 3300025907 | Ga0207645_10000160 | Ga0207645_1000016013 | 389 |
| 649 | 3300025907 | Ga0207645_10111993 | Ga0207645_101119931 | 389 |
| 650 | 3300025908 | Ga0207643_10000009 | Ga0207643_10000009156 | 389 |
| 651 | 3300025911 | Ga0207654_10000441 | Ga0207654_100004413 | 389 |
| 652 | 3300025911 | Ga0207654_10036529 | Ga0207654_100365293 | 389 |
| 653 | 3300025912 | Ga0207707_10000554 | Ga0207707_1000055420 | 389 |
| 654 | 3300025912 | Ga0207707_10009645 | Ga0207707_100096457 | 389 |
| 655 | 3300025912 | Ga0207707_10148250 | Ga0207707_101482502 | 389 |
| 656 | 3300025914 | Ga0207671_10011327 | Ga0207671_100113272 | 389 |
| 657 | 3300025914 | Ga0207671_10260066 | Ga0207671_102600662 | 389 |
| 658 | 3300025915 | Ga0207693_10015698 | Ga0207693_100156982 | 389 |
| 659 | 3300025915 | Ga0207693_10017770 | Ga0207693_100177704 | 389 |
| 660 | 3300025917 | Ga0207660_10000161 | Ga0207660_1000016124 | 389 |
| 661 | 3300025918 | Ga0207662_10037644 | Ga0207662_100376442 | 389 |
| 662 | 3300025919 | Ga0207657_10000980 | Ga0207657_1000098029 | 389 |
| 663 | 3300025919 | Ga0207657_10010318 | Ga0207657_100103187 | 389 |
| 664 | 3300025920 | Ga0207649_10000429 | Ga0207649_1000042921 | 389 |
| 665 | 3300025921 | Ga0207652_10000364 | Ga0207652_100003647 | 389 |
| 666 | 3300025921 | Ga0207652_10026006 | Ga0207652_100260062 | 389 |
| 667 | 3300025921 | Ga0207652_10192469 | Ga0207652_101924692 | 389 |
| 668 | 3300025923 | Ga0207681_10000035 | Ga0207681_1000003551 | 389 |
| 669 | 3300025924 | Ga0207694_10145574 | Ga0207694_101455742 | 389 |
| 670 | 3300025925 | Ga0207650_10002514 | Ga0207650_100025142 | 389 |
| 671 | 3300025926 | Ga0207659_10000027 | Ga0207659_1000002787 | 389 |
| 672 | 3300025926 | Ga0207659_10028682 | Ga0207659_100286822 | 389 |
| 673 | 3300025927 | Ga0207687_10000551 | Ga0207687_100005516 | 389 |
| 674 | 3300025928 | Ga0207700_10004694 | Ga0207700_100046946 | 389 |
| 675 | 3300025929 | Ga0207664_10154154 | Ga0207664_101541542 | 389 |
| 676 | 3300025929 | Ga0207664_10184443 | Ga0207664_101844431 | 389 |
| 677 | 3300025931 | Ga0207644_10190907 | Ga0207644_101909072 | 389 |
| 678 | 3300025932 | Ga0207690_10000056 | Ga0207690_1000005664 | 389 |
| 679 | 3300025933 | Ga0207706_10000307 | Ga0207706_1000030713 | 389 |
| 680 | 3300025933 | Ga0207706_10035216 | Ga0207706_100352162 | 389 |
| 681 | 3300025934 | Ga0207686_10001402 | Ga0207686_1000140211 | 389 |
| 682 | 3300025934 | Ga0207686_10066389 | Ga0207686_100663892 | 389 |
| 683 | 3300025934 | Ga0207686_10076969 | Ga0207686_100769692 | 389 |
| 684 | 3300025935 | Ga0207709_10000087 | Ga0207709_1000008753 | 389 |
| 685 | 3300025936 | Ga0207670_10000263 | Ga0207670_100002634 | 389 |
| 686 | 3300025936 | Ga0207670_10049725 | Ga0207670_100497252 | 389 |
| 687 | 3300025936 | Ga0207670_10277822 | Ga0207670_102778221 | 389 |
| 688 | 3300025937 | Ga0207669_10000052 | Ga0207669_1000005239 | 389 |
| 689 | 3300025938 | Ga0207704_10000063 | Ga0207704_1000006324 | 389 |
| 690 | 3300025939 | Ga0207665_10000631 | Ga0207665_1000063123 | 389 |
| 691 | 3300025940 | Ga0207691_10000167 | Ga0207691_1000016713 | 389 |
| 692 | 3300025940 | Ga0207691_10055482 | Ga0207691_100554822 | 389 |
| 693 | 3300025940 | Ga0207691_10172496 | Ga0207691_101724962 | 389 |
| 694 | 3300025941 | Ga0207711_10006590 | Ga0207711_100065902 | 389 |
| 695 | 3300025941 | Ga0207711_10016598 | Ga0207711_100165985 | 389 |
| 696 | 3300025942 | Ga0207689_10000155 | Ga0207689_1000015551 | 389 |
| 697 | 3300025942 | Ga0207689_10036982 | Ga0207689_100369824 | 389 |
| 698 | 3300025944 | Ga0207661_10000072 | Ga0207661_1000007239 | 389 |
| 699 | 3300025945 | Ga0207679_10000057 | Ga0207679_1000005758 | 389 |
| 700 | 3300025945 | Ga0207679_10353677 | Ga0207679_103536771 | 389 |
| 701 | 3300025949 | Ga0207667_10113025 | Ga0207667_101130251 | 389 |
| 702 | 3300025949 | Ga0207667_10256828 | Ga0207667_102568282 | 389 |
| 703 | 3300025960 | Ga0207651_10000087 | Ga0207651_1000008713 | 389 |
| 704 | 3300025960 | Ga0207651_10037972 | Ga0207651_100379722 | 389 |
| 705 | 3300025961 | Ga0207712_10000122 | Ga0207712_1000012251 | 389 |
| 706 | 3300025972 | Ga0207668_10000084 | Ga0207668_1000008457 | 389 |
| 707 | 3300025981 | Ga0207640_10000878 | Ga0207640_1000087810 | 389 |
| 708 | 3300025986 | Ga0207658_10004557 | Ga0207658_100045578 | 389 |
| 709 | 3300025986 | Ga0207658_10015437 | Ga0207658_100154375 | 389 |
| 710 | 3300026023 | Ga0207677_10000549 | Ga0207677_1000054917 | 389 |
| 711 | 3300026035 | Ga0207703_10005829 | Ga0207703_100058293 | 389 |
| 712 | 3300026035 | Ga0207703_10081284 | Ga0207703_100812841 | 389 |
| 713 | 3300026041 | Ga0207639_10001925 | Ga0207639_100019255 | 389 |
| 714 | 3300026041 | Ga0207639_10047666 | Ga0207639_100476662 | 389 |
| 715 | 3300026067 | Ga0207678_10000187 | Ga0207678_1000018713 | 389 |
| 716 | 3300026067 | Ga0207678_10027526 | Ga0207678_100275263 | 389 |
| 717 | 3300026067 | Ga0207678_10036968 | Ga0207678_100369682 | 389 |
| 718 | 3300026075 | Ga0207708_10000158 | Ga0207708_1000015813 | 389 |
| 719 | 3300026075 | Ga0207708_10002641 | Ga0207708_1000264112 | 389 |
| 720 | 3300026078 | Ga0207702_10001960 | Ga0207702_1000196019 | 389 |
| 721 | 3300026078 | Ga0207702_10073421 | Ga0207702_100734212 | 389 |
| 722 | 3300026088 | Ga0207641_10000896 | Ga0207641_1000089620 | 389 |
| 723 | 3300026089 | Ga0207648_10001167 | Ga0207648_1000116718 | 389 |
| 724 | 3300026089 | Ga0207648_10038868 | Ga0207648_100388685 | 389 |
| 725 | 3300026095 | Ga0207676_10000089 | Ga0207676_1000008951 | 389 |
| 726 | 3300026095 | Ga0207676_10074074 | Ga0207676_100740743 | 389 |
| 727 | 3300026095 | Ga0207676_10349171 | Ga0207676_103491711 | 389 |
| 728 | 3300026116 | Ga0207674_10001478 | Ga0207674_1000147813 | 389 |
| 729 | 3300026118 | Ga0207675_100000229 | Ga0207675_10000022913 | 389 |
| 730 | 3300026118 | Ga0207675_100028481 | Ga0207675_1000284815 | 389 |
| 731 | 3300026121 | Ga0207683_10000525 | Ga0207683_1000052514 | 389 |
| 732 | 3300026121 | Ga0207683_10045639 | Ga0207683_100456392 | 389 |
| 733 | 3300027717 | Ga0209998_10000949 | Ga0209998_100009497 | 389 |
| 734 | 3300027876 | Ga0209974_10003008 | Ga0209974_100030086 | 389 |
| 735 | 3300027907 | Ga0207428_10000037 | Ga0207428_1000003775 | 389 |
| 736 | 3300027907 | Ga0207428_10000308 | Ga0207428_1000030856 | 389 |
| 737 | 3300028379 | Ga0268266_10140836 | Ga0268266_101408362 | 389 |
| 738 | 3300028380 | Ga0268265_10000195 | Ga0268265_1000019529 | 389 |
| 739 | 3300028381 | Ga0268264_10000526 | Ga0268264_1000052614 | 389 |
| 740 | 3300028381 | Ga0268264_10316118 | Ga0268264_103161182 | 389 |
| 741 | 3300028556 | Ga0265337_1000963 | Ga0265337_100096313 | 389 |
| 742 | 3300028800 | Ga0265338_10043272 | Ga0265338_100432723 | 389 |
| 743 | 3300031090 | Ga0265760_10006486 | Ga0265760_100064862 | 389 |
| 744 | 3300031235 | Ga0265330_10003043 | Ga0265330_100030434 | 389 |
| 745 | 3300031241 | Ga0265325_10000352 | Ga0265325_1000035221 | 389 |
| 746 | 3300031241 | Ga0265325_10000736 | Ga0265325_1000073616 | 389 |
| 747 | 3300031249 | Ga0265339_10005391 | Ga0265339_100053915 | 389 |
| 748 | 3300031249 | Ga0265339_10042125 | Ga0265339_100421251 | 389 |
| 749 | 3300031595 | Ga0265313_10000686 | Ga0265313_1000068613 | 389 |
| 750 | 3300031595 | Ga0265313_10045737 | Ga0265313_100457371 | 389 |
| 751 | 3300031665 | Ga0316575_10045914 | Ga0316575_100459142 | 389 |
| 752 | 3300031711 | Ga0265314_10003780 | Ga0265314_100037804 | 389 |
| 753 | 3300031712 | Ga0265342_10000882 | Ga0265342_1000088218 | 389 |
| 754 | 3300031712 | Ga0265342_10004819 | Ga0265342_1000481910 | 389 |
| 755 | 3300032133 | Ga0316583_10000161 | Ga0316583_1000016116 | 389 |
| 756 | 3300034816 | Ga0373930_0000020 | Ga0373930_0000020_9018_10187 | 389 |
| 757 | 3300034817 | Ga0373948_0000371 | Ga0373948_0000371_1209_2378 | 389 |
| 758 | 3300034817 | Ga0373948_0008576 | Ga0373948_0008576_253_1422 | 389 |
| 759 | 3300034819 | Ga0373958_0000533 | Ga0373958_0000533_1374_2543 | 389 |
| 760 | 3300034819 | Ga0373958_0000699 | Ga0373958_0000699_2597_3766 | 389 |
| 761 | 3300034820 | Ga0373959_0000539 | Ga0373959_0000539_5033_6202 | 389 |
| 762 | 3300034957 | Ga0373938_0000748 | Ga0373938_0000748_1449_2618 | 389 |
| 763 | 3300035084 | Ga0373928_0001398 | Ga0373928_0001398_2041_3210 | 389 |
| 764 | 3300035085 | Ga0373929_0001728 | Ga0373929_0001728_1595_2764 | 389 |
| 765 | 3300035086 | Ga0373934_0020424 | Ga0373934_0020424_637_1806 | 389 |
| 766 | 3300035088 | Ga0373940_0000325 | Ga0373940_0000325_553_1722 | 389 |
| 767 | 3300035089 | Ga0373944_0010969 | Ga0373944_0010969_1124_2293 | 389 |
| 768 | 3300035090 | Ga0373949_0001003 | Ga0373949_0001003_2029_3198 | 389 |
| 769 | 3300035090 | Ga0373949_0001117 | Ga0373949_0001117_6080_7249 | 389 |
| 770 | 3300035090 | Ga0373949_0006408 | Ga0373949_0006408_1230_2399 | 389 |
| 771 | 3300035091 | Ga0373951_0000547 | Ga0373951_0000547_7851_9020 | 389 |
| 772 | 3300035092 | Ga0373952_0000114 | Ga0373952_0000114_5566_6735 | 389 |
| 773 | 3300035092 | Ga0373952_0000713 | Ga0373952_0000713_3517_4686 | 389 |
| 774 | 3300035112 | Ga0373932_0001186 | Ga0373932_0001186_4706_5875 | 389 |
| 775 | 3300035112 | Ga0373932_0002300 | Ga0373932_0002300_2251_3420 | 389 |
| 776 | 3300035112 | Ga0373932_0009525 | Ga0373932_0009525_464_1633 | 389 |
| 777 | 3300035114 | Ga0373939_0000261 | Ga0373939_0000261_11484_12653 | 389 |
| 778 | 3300035114 | Ga0373939_0000360 | Ga0373939_0000360_7326_8495 | 389 |
| 779 | 3300035115 | Ga0373941_0001573 | Ga0373941_0001573_2043_3212 | 389 |
| 780 | 3300035115 | Ga0373941_0001805 | Ga0373941_0001805_675_1844 | 389 |
| 781 | 3300035117 | Ga0373953_0001943 | Ga0373953_0001943_3597_4766 | 389 |
| 782 | 3300035117 | Ga0373953_0032058 | Ga0373953_0032058_638_1807 | 389 |
| 783 | 3300035118 | Ga0373954_0009797 | Ga0373954_0009797_2947_4116 | 389 |
| 784 | 3300035119 | Ga0373956_0011124 | Ga0373956_0011124_2420_3589 | 389 |
| 785 | 3300035120 | Ga0373957_0005912 | Ga0373957_0005912_304_1473 | 389 |
| 786 | 3300035121 | Ga0373960_0003891 | Ga0373960_0003891_1677_2846 | 389 |
| 787 | 3300035121 | Ga0373960_0008095 | Ga0373960_0008095_204_1373 | 389 |
| 788 | 3300035121 | Ga0373960_0017544 | Ga0373960_0017544_60_1229 | 389 |
| 789 | 3300035171 | Ga0373946_0001059 | Ga0373946_0001059_2381_3550 | 389 |
| 790 | 3300035172 | Ga0373955_0010587 | Ga0373955_0010587_2162_3331 | 389 |
| 791 | 3300035172 | Ga0373955_0114296 | Ga0373955_0114296_173_1342 | 389 |
| 792 | 3300035207 | Ga0373942_0001477 | Ga0373942_0001477_2269_3438 | 389 |
| 793 | 3300035207 | Ga0373942_0003320 | Ga0373942_0003320_874_2043 | 389 |
| 794 | 3300035241 | Ga0373961_0001845 | Ga0373961_0001845_3504_4673 | 389 |
| 795 | 3300035242 | Ga0373962_0000273 | Ga0373962_0000273_6373_7542 | 389 |
| 796 | 3300035242 | Ga0373962_0000354 | Ga0373962_0000354_2166_3335 | 389 |
| 797 | 3300035242 | Ga0373962_0037273 | Ga0373962_0037273_115_1284 | 389 |
| 798 | 3300035410 | Ga0373924_0045126 | Ga0373924_0045126_31_1212 | 389 |
| 799 | 3300035410 | Ga0373924_0047222 | Ga0373924_0047222_424_1593 | 389 |
| 800 | 3300035691 | Ga0373931_0000082 | Ga0373931_0000082_35816_36985 | 389 |
| 801 | 3300035691 | Ga0373931_0007665 | Ga0373931_0007665_3648_4817 | 389 |
| 802 | 3300035691 | Ga0373931_0010622 | Ga0373931_0010622_733_1902 | 389 |
| 803 | 3300035692 | Ga0373935_0003255 | Ga0373935_0003255_691_1860 | 389 |
| 804 | 3300035692 | Ga0373935_0116947 | Ga0373935_0116947_404_1573 | 389 |
| 805 | 3300035695 | Ga0373927_0027655 | Ga0373927_0027655_2330_3499 | 389 |
| 806 | 3300035695 | Ga0373927_0033383 | Ga0373927_0033383_873_2042 | 389 |
| 807 | 3300035695 | Ga0373927_0052750 | Ga0373927_0052750_591_1760 | 389 |
| 808 | 3300035724 | Ga0373933_0022723 | Ga0373933_0022723_482_1651 | 389 |
| 809 | 3300035724 | Ga0373933_0031487 | Ga0373933_0031487_218_1387 | 389 |
| 810 | 3300036401 | Ga0373937_0005292 | Ga0373937_0005292_6163_7332 | 389 |
| 811 | 3300036401 | Ga0373937_0011036 | Ga0373937_0011036_6189_7358 | 389 |
| 812 | 3300036401 | Ga0373937_0112952 | Ga0373937_0112952_647_1816 | 389 |
| 813 | 3300036647 | Ga0316582_0129027 | Ga0316582_0129027_156_1337 | 389 |
| 814 | 3300037068 | Ga0373925_0008940 | Ga0373925_0008940_2135_3304 | 389 |
| 815 | 3300037312 | Ga0395899_0036755 | Ga0395899_0036755_17_1198 | 389 |
| 816 | 3300037312 | Ga0395899_0210759 | Ga0395899_0210759_118_1299 | 389 |
| 817 | 3300037418 | Ga0395900_0008255 | Ga0395900_0008255_8764_9945 | 389 |
| 818 | 3300037418 | Ga0395900_0238696 | Ga0395900_0238696_12_1193 | 389 |
| 819 | 3300037466 | Ga0395898_0011916 | Ga0395898_0011916_7589_8770 | 389 |
| 820 | 3300037853 | Ga0436364_0575338 | Ga0436364_0575338_264_1433 | 389 |
| 821 | 3300038443 | Ga0395901_0009281 | Ga0395901_0009281_3422_4603 | 389 |
| 822 | 3300038443 | Ga0395901_0014372 | Ga0395901_0014372_3748_4929 | 389 |
| 823 | 3300038996 | Ga0242420_008230 | Ga0242420_008230_315_1484 | 389 |
| 824 | 3300039437 | Ga0436365_0855986 | Ga0436365_0855986_2661_3830 | 389 |
| 825 | 3300039438 | Ga0436360_0966528 | Ga0436360_0966528_1152_2321 | 389 |
| 826 | 3300042439 | Ga0439464_0007110 | Ga0439464_0007110_699_1868 | 389 |
| 827 | 3300044683 | Ga0466965_0136901 | Ga0466965_0136901_70_1251 | 389 |
| 828 | 3300044719 | Ga0466971_0091002 | Ga0466971_0091002_185_1366 | 389 |
| 829 | 3300045049 | Ga0466959_0184081 | Ga0466959_0184081_143_1324 | 389 |
| 830 | 3300046455 | Ga0495603_0033346 | Ga0495603_0033346_114_1283 | 389 |
| 831 | 3300046459 | Ga0495629_0000222 | Ga0495629_0000222_21785_22954 | 389 |
| 832 | 3300046461 | Ga0495641_0052254 | Ga0495641_0052254_62_1231 | 389 |
| 833 | 3300046462 | Ga0495651_0014733 | Ga0495651_0014733_1081_2250 | 389 |
| 834 | 3300046462 | Ga0495651_0094361 | Ga0495651_0094361_935_2104 | 389 |
| 835 | 3300046473 | Ga0495582_0008516 | Ga0495582_0008516_1401_2570 | 389 |
| 836 | 3300046476 | Ga0495662_0009876 | Ga0495662_0009876_1389_2558 | 389 |
| 837 | 3300046477 | Ga0495664_0003233 | Ga0495664_0003233_5193_6362 | 389 |
| 838 | 3300046499 | Ga0495594_0017544 | Ga0495594_0017544_1318_2487 | 389 |
| 839 | 3300046499 | Ga0495594_0136075 | Ga0495594_0136075_79_1248 | 389 |
| 840 | 3300046511 | Ga0495608_0002323 | Ga0495608_0002323_6713_7882 | 389 |
| 841 | 3300046511 | Ga0495608_0068939 | Ga0495608_0068939_882_2051 | 389 |
| 842 | 3300046514 | Ga0495618_0006486 | Ga0495618_0006486_4737_5906 | 389 |
| 843 | 3300046516 | Ga0495628_0011343 | Ga0495628_0011343_37_1206 | 389 |
| 844 | 3300046517 | Ga0495630_0192869 | Ga0495630_0192869_357_1526 | 389 |
| 845 | 3300046529 | Ga0495652_0034412 | Ga0495652_0034412_2401_3570 | 389 |
| 846 | 3300046529 | Ga0495652_0039358 | Ga0495652_0039358_435_1604 | 389 |
| 847 | 3300046529 | Ga0495652_0095921 | Ga0495652_0095921_911_2080 | 389 |
| 848 | 3300046531 | Ga0495665_0003071 | Ga0495665_0003071_2618_3787 | 389 |
| 849 | 3300046533 | Ga0495640_0019242 | Ga0495640_0019242_3297_4466 | 389 |
| 850 | 3300046533 | Ga0495640_0052361 | Ga0495640_0052361_1038_2207 | 389 |
| 851 | 3300046535 | Ga0495586_0006088 | Ga0495586_0006088_577_1746 | 389 |
| 852 | 3300046535 | Ga0495586_0016023 | Ga0495586_0016023_2588_3757 | 389 |
| 853 | 3300046536 | Ga0495587_0006576 | Ga0495587_0006576_2873_4042 | 389 |
| 854 | 3300046536 | Ga0495587_0024692 | Ga0495587_0024692_2356_3525 | 389 |
| 855 | 3300046543 | Ga0495645_0020641 | Ga0495645_0020641_1132_2301 | 389 |
| 856 | 3300046559 | Ga0495667_0002675 | Ga0495667_0002675_6371_7540 | 389 |
| 857 | 3300046559 | Ga0495667_0019291 | Ga0495667_0019291_1188_2357 | 389 |
| 858 | 3300046559 | Ga0495667_0045829 | Ga0495667_0045829_100_1269 | 389 |
| 859 | 3300046642 | Ga0495634_0118185 | Ga0495634_0118185_476_1645 | 389 |
| 860 | 3300046663 | Ga0495635_0002537 | Ga0495635_0002537_6046_7215 | 389 |
| 861 | 3300046663 | Ga0495635_0081225 | Ga0495635_0081225_10_1179 | 389 |
| 862 | 3300046675 | Ga0495657_0004771 | Ga0495657_0004771_6112_7281 | 389 |
| 863 | 3300046675 | Ga0495657_0045424 | Ga0495657_0045424_396_1565 | 389 |
| 864 | 3300046675 | Ga0495657_0099372 | Ga0495657_0099372_354_1523 | 389 |
| 865 | 3300046678 | Ga0495599_0041642 | Ga0495599_0041642_883_2052 | 389 |
| 866 | 3300046679 | Ga0495623_0001394 | Ga0495623_0001394_6047_7216 | 389 |
| 867 | 3300046680 | Ga0495646_0001135 | Ga0495646_0001135_8174_9343 | 389 |
| 868 | 3300046681 | Ga0495647_0003047 | Ga0495647_0003047_59_1228 | 389 |
| 869 | 3300046681 | Ga0495647_0003641 | Ga0495647_0003641_3310_4479 | 389 |
| 870 | 3300046683 | Ga0495658_0000656 | Ga0495658_0000656_8942_10111 | 389 |
| 871 | 3300046683 | Ga0495658_0031947 | Ga0495658_0031947_1581_2750 | 389 |
| 872 | 3300046689 | Ga0495613_0004890 | Ga0495613_0004890_6654_7823 | 389 |
| 873 | 3300046809 | Ga0495600_0000708 | Ga0495600_0000708_3491_4660 | 389 |
| 874 | 3300046809 | Ga0495600_0038262 | Ga0495600_0038262_555_1724 | 389 |
| 875 | 3300047317 | Ga0495604_0007332 | Ga0495604_0007332_6303_7472 | 389 |
| 876 | 3300047317 | Ga0495604_0031950 | Ga0495604_0031950_2706_3875 | 389 |
| 877 | 3300047319 | Ga0495674_0002023 | Ga0495674_0002023_16853_18022 | 389 |
| 878 | 3300047321 | Ga0495676_0042309 | Ga0495676_0042309_1849_3018 | 389 |
| 879 | 3300047322 | Ga0495680_0005048 | Ga0495680_0005048_5242_6411 | 389 |
| 880 | 3300047322 | Ga0495680_0009889 | Ga0495680_0009889_1854_3023 | 389 |
| 881 | 3300047322 | Ga0495680_0070207 | Ga0495680_0070207_1207_2376 | 389 |
| 882 | 3300047444 | Ga0495675_0003495 | Ga0495675_0003495_5497_6666 | 389 |
| 883 | 3300047471 | Ga0495684_0175691 | Ga0495684_0175691_75_1244 | 389 |
| 884 | 3300048088 | Ga0495602_0036787 | Ga0495602_0036787_1798_2967 | 389 |
| 885 | 3300048088 | Ga0495602_0113829 | Ga0495602_0113829_752_1921 | 389 |
| 886 | 3300048089 | Ga0495614_0005475 | Ga0495614_0005475_4443_5612 | 389 |
| 887 | 3300048903 | Ga0496100_0000189 | Ga0496100_0000189_11643_12812 | 389 |
| 888 | 3300048903 | Ga0496100_0037778 | Ga0496100_0037778_958_2127 | 389 |
| 889 | 3300048903 | Ga0496100_0056282 | Ga0496100_0056282_1067_2236 | 389 |
| 890 | 3300048904 | Ga0496101_0000367 | Ga0496101_0000367_1538_2707 | 389 |
| 891 | 3300048904 | Ga0496101_0025023 | Ga0496101_0025023_2724_3893 | 389 |
| 892 | 3300048905 | Ga0496102_0005220 | Ga0496102_0005220_2955_4124 | 389 |
| 893 | 3300048905 | Ga0496102_0009146 | Ga0496102_0009146_6714_7883 | 389 |
| 894 | 3300048905 | Ga0496102_0033628 | Ga0496102_0033628_790_1959 | 389 |
| 895 | 3300048905 | Ga0496102_0198971 | Ga0496102_0198971_550_1719 | 389 |
| 896 | 3300048906 | Ga0496103_0099495 | Ga0496103_0099495_107_1276 | 389 |
| 897 | 3300048906 | Ga0496103_0116901 | Ga0496103_0116901_182_1351 | 389 |
| 898 | 3300048907 | Ga0496104_0000116 | Ga0496104_0000116_34491_35660 | 389 |
| 899 | 3300048907 | Ga0496104_0104391 | Ga0496104_0104391_273_1442 | 389 |
| 900 | 3300048907 | Ga0496104_0224927 | Ga0496104_0224927_502_1671 | 389 |
| 901 | 3300048908 | Ga0496105_0000550 | Ga0496105_0000550_1316_2485 | 389 |
| 902 | 3300048908 | Ga0496105_0006935 | Ga0496105_0006935_7540_8709 | 389 |
| 903 | 3300048908 | Ga0496105_0181825 | Ga0496105_0181825_510_1679 | 389 |
| 904 | 3300048908 | Ga0496105_0248499 | Ga0496105_0248499_246_1415 | 389 |
| 905 | 3300048908 | Ga0496105_0302820 | Ga0496105_0302820_45_1214 | 389 |
| 906 | 3300048909 | Ga0496106_0000736 | Ga0496106_0000736_4734_5903 | 389 |
| 907 | 3300048909 | Ga0496106_0006742 | Ga0496106_0006742_353_1522 | 389 |
| 908 | 3300048909 | Ga0496106_0022228 | Ga0496106_0022228_959_2128 | 389 |
| 909 | 3300048909 | Ga0496106_0049486 | Ga0496106_0049486_1414_2583 | 389 |
| 910 | 3300048909 | Ga0496106_0076675 | Ga0496106_0076675_279_1448 | 389 |
| 911 | 3300048910 | Ga0496107_0000080 | Ga0496107_0000080_43685_44854 | 389 |
| 912 | 3300048910 | Ga0496107_0020206 | Ga0496107_0020206_3012_4181 | 389 |
| 913 | 3300048910 | Ga0496107_0048652 | Ga0496107_0048652_907_2076 | 389 |
| 914 | 3300048910 | Ga0496107_0063030 | Ga0496107_0063030_1086_2255 | 389 |
| 915 | 3300048910 | Ga0496107_0257166 | Ga0496107_0257166_60_1229 | 389 |
| 916 | 3300048911 | Ga0496108_0004997 | Ga0496108_0004997_8140_9309 | 389 |
| 917 | 3300048911 | Ga0496108_0172168 | Ga0496108_0172168_567_1736 | 389 |
| 918 | 3300048912 | Ga0496109_0000737 | Ga0496109_0000737_21472_22641 | 389 |
| 919 | 3300048912 | Ga0496109_0014904 | Ga0496109_0014904_2580_3749 | 389 |
| 920 | 3300048912 | Ga0496109_0125953 | Ga0496109_0125953_982_2151 | 389 |
| 921 | 3300048912 | Ga0496109_0252596 | Ga0496109_0252596_131_1300 | 389 |
| 922 | 3300048913 | Ga0496110_0060408 | Ga0496110_0060408_1329_2498 | 389 |
| 923 | 3300048913 | Ga0496110_0062381 | Ga0496110_0062381_457_1626 | 389 |
| 924 | 3300048913 | Ga0496110_0284624 | Ga0496110_0284624_57_1226 | 389 |
| 925 | 3300048914 | Ga0496111_0050125 | Ga0496111_0050125_1059_2228 | 389 |
| 926 | 3300048915 | Ga0496112_0006007 | Ga0496112_0006007_4540_5709 | 389 |
| 927 | 3300048915 | Ga0496112_0353962 | Ga0496112_0353962_71_1240 | 389 |
| 928 | 3300048916 | Ga0496113_0000721 | Ga0496113_0000721_6113_7282 | 389 |
| 929 | 3300048917 | Ga0496114_0007885 | Ga0496114_0007885_1844_3013 | 389 |
| 930 | 3300048918 | Ga0496115_0009214 | Ga0496115_0009214_3073_4242 | 389 |
| 931 | 3300048918 | Ga0496115_0022768 | Ga0496115_0022768_964_2133 | 389 |
| 932 | 3300048918 | Ga0496115_0024635 | Ga0496115_0024635_2479_3648 | 389 |
| 933 | 3300048918 | Ga0496115_0054167 | Ga0496115_0054167_1692_2861 | 389 |
| 934 | 3300049573 | Ga0501037_0128912 | Ga0501037_0128912_429_1598 | 389 |
| 935 | 3300049581 | Ga0501047_0057389 | Ga0501047_0057389_2287_3456 | 389 |
| 936 | 3300049582 | Ga0501048_0207393 | Ga0501048_0207393_205_1374 | 389 |
| 937 | 3300049585 | Ga0501069_0111223 | Ga0501069_0111223_20_1201 | 389 |
| 938 | 3300049586 | Ga0501070_0008050 | Ga0501070_0008050_4819_6000 | 389 |
| 939 | 3300049586 | Ga0501070_0076061 | Ga0501070_0076061_505_1686 | 389 |
| 940 | 3300049592 | Ga0501076_0168865 | Ga0501076_0168865_231_1400 | 389 |
| 941 | 3300049742 | Ga0501080_0151023 | Ga0501080_0151023_393_1574 | 389 |
| 942 | 3300049744 | Ga0501083_0006706 | Ga0501083_0006706_981_2150 | 389 |
| 943 | 3300049822 | Ga0501035_0002939 | Ga0501035_0002939_8654_9835 | 389 |
| 944 | 3300050490 | nmdc:mga03n38_8389_c1 | nmdc:mga03n38_8389_c1_1676_2845 | 389 |
| 945 | 3300050494 | nmdc:mga06z11_100582_c1 | nmdc:mga06z11_100582_c1_143_1312 | 389 |
| 946 | 3300050509 | nmdc:mga0qj67_10975_c1 | nmdc:mga0qj67_10975_c1_1433_2617 | 389 |
| 947 | 3300050511 | nmdc:mga08y16_4316_c1 | nmdc:mga08y16_4316_c1_875_2044 | 389 |
| 948 | 3300050511 | nmdc:mga08y16_738_c1 | nmdc:mga08y16_738_c1_26492_27661 | 389 |
| 949 | 3300050512 | nmdc:mga0n895_121065_c1 | nmdc:mga0n895_121065_c1_356_1537 | 389 |
| 950 | 3300050512 | nmdc:mga0n895_178316_c1 | nmdc:mga0n895_178316_c1_200_1369 | 389 |
| 951 | 3300050512 | nmdc:mga0n895_313274_c1 | nmdc:mga0n895_313274_c1_253_1422 | 389 |
| 952 | 3300050512 | nmdc:mga0n895_842_c1 | nmdc:mga0n895_842_c1_8985_10154 | 389 |
| 953 | 3300050513 | nmdc:mga0rr50_214062_c1 | nmdc:mga0rr50_214062_c1_96_1265 | 389 |
| 954 | 3300050513 | nmdc:mga0rr50_27222_c1 | nmdc:mga0rr50_27222_c1_2779_3948 | 389 |
| 955 | 3300050513 | nmdc:mga0rr50_67088_c1 | nmdc:mga0rr50_67088_c1_1426_2595 | 389 |
| 956 | 3300050515 | nmdc:mga0a205_32568_c1 | nmdc:mga0a205_32568_c1_2744_3913 | 389 |
| 957 | 3300053077 | Ga0495601_0013244 | Ga0495601_0013244_2292_3461 | 389 |
| 958 | 3300053077 | Ga0495601_0024831 | Ga0495601_0024831_1066_2235 | 389 |
| 959 | 3300053077 | Ga0495601_0061768 | Ga0495601_0061768_956_2125 | 389 |
| 960 | 3300053077 | Ga0495601_0130310 | Ga0495601_0130310_22_1191 | 389 |
| 961 | 3300053078 | Ga0495612_0001058 | Ga0495612_0001058_7333_8502 | 389 |
| 962 | 3300053078 | Ga0495612_0052073 | Ga0495612_0052073_261_1430 | 389 |
| 963 | 3300053084 | Ga0495595_0000762 | Ga0495595_0000762_4529_5698 | 389 |
| 964 | 3300053084 | Ga0495595_0018683 | Ga0495595_0018683_1661_2830 | 389 |
| 965 | 3300053084 | Ga0495595_0032506 | Ga0495595_0032506_455_1624 | 389 |
| 966 | 3300053084 | Ga0495595_0035761 | Ga0495595_0035761_462_1631 | 389 |
| 967 | 3300053085 | Ga0495619_0000271 | Ga0495619_0000271_22762_23931 | 389 |
| 968 | 3300053085 | Ga0495619_0002564 | Ga0495619_0002564_7224_8393 | 389 |
| 969 | 3300053085 | Ga0495619_0007587 | Ga0495619_0007587_3194_4363 | 389 |
| 970 | 3300053085 | Ga0495619_0033071 | Ga0495619_0033071_45_1214 | 389 |
| 971 | 3300053085 | Ga0495619_0062525 | Ga0495619_0062525_652_1821 | 389 |
| 972 | 3300053093 | Ga0500651_0001961 | Ga0500651_0001961_7262_8431 | 389 |
| 973 | 3300053117 | Ga0500593_052637 | Ga0500593_052637_226_1395 | 389 |
| 974 | 3300053119 | Ga0500595_000062 | Ga0500595_000062_75531_76700 | 389 |
| 975 | 3300053119 | Ga0500595_019155 | Ga0500595_019155_887_2056 | 389 |
| 976 | 3300053131 | Ga0500652_000016 | Ga0500652_000016_98338_99507 | 389 |
| 977 | 3300053131 | Ga0500652_005922 | Ga0500652_005922_83_1252 | 389 |
| 978 | 3300053153 | Ga0500616_0000006 | Ga0500616_0000006_867305_868474 | 389 |
| 979 | 3300053730 | Ga0500645_000282 | Ga0500645_000282_6327_7496 | 389 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xr2-assembly2.cif.gz_B | crystal structure of oxidized t. maritima cobalamin-independent methionine synthase complexed with methyltetrahydrofolate | 0.8749 | 7 | 388 |
| 3bq6-assembly2.cif.gz_B | crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ (monoclinic) | 0.865 | 8 | 385 |
| 3bq5-assembly2.cif.gz_B | crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ and homocysteine (monoclinic) | 0.8639 | 7 | 389 |
| 1xr2-assembly1.cif.gz_A | crystal structure of oxidized t. maritima cobalamin-independent methionine synthase complexed with methyltetrahydrofolate | 0.8589 | 8 | 387 |
| 3bq5-assembly1.cif.gz_A | crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ and homocysteine (monoclinic) | 0.8559 | 7 | 387 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xdjA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.8504 | 8 | 389 | 3.20.20.210 |
| af_Q54X49_428_818_3.20.20.210 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.8315 | 5 | 382 | 3.20.20.210 |
| 2nq5A02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.8261 | 7 | 385 | 3.20.20.210 |
| af_K7MME4_84_171_3.20.20.210 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.808 | 296 | 382 | 3.20.20.210 |
| 4l61A02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.8077 | 6 | 385 | 3.20.20.210 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J9ZCS0-F1-model_v4 | Cobalamin-independent methionine synthase MetE C-terminal/archaeal domain-containing protein | 0.9728 | 141 | 389 |
GO:0003871
GO:0008270 GO:0009086 |
| AF-A0A2V8N9N3-F1-model_v4 | Epoxyalkane--coenzyme M transferase | 0.9695 | 245 | 389 |
GO:0016740
|
| AF-A0A251XH34-F1-model_v4 | Uncharacterized protein | 0.9681 | 226 | 342 |
|
| AF-A0A537W1R3-F1-model_v4 | Epoxyalkane--coenzyme M transferase | 0.9658 | 283 | 386 |
GO:0003871
GO:0008270 GO:0009086 |
| AF-A0A1H4WMU6-F1-model_v4 | 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase | 0.9631 | 1 | 388 |
GO:0003871
GO:0008270 GO:0009086 GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar