F487335

General Info

Members Datasets Scaffolds Average Seq Length
979 408 979 387

Family's Representative Sequence

Representative Sequence 3300031090|Ga0265760_10006486|Ga0265760_100064862
Length 392
Sequence MKRSTDRILTTHVGSLIRPQALQEFLRAKQAGKPYDMAAYDKCLTASVADVVHKQAEVGIDVISDGEFGKSISWSQYVLERLSGFERRPINPGNKNPFTRGVDREQFAEFYAELDAREGVATTVEAVCVGPIAYTGQAELQRDIDNFKAALKGVNVVEAFLPVAAPASVIPDRKNEYYKTEEELIRAIGAAMRTEYRMIIDAGFVLQLDDARAAVTYDRMVPPGSFEDYRKWLRLQVEVLNEAIAGLPPDRIRYHVCWGSWPGPHTTDVALKDIVDLILGMNVGAFVIEGANPRHEHEWRVWENAKLPKDKVLIPGVISHATNVVEHPELVAERIVRLAKLVGRENVLAGTDCGFAQGPFHRRVHPSIMWAKLGALVEGAGIASAELWRKAA

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
7 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
16 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
17 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
18 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
19 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
20 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
94 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
95 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
96 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
100 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
101 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
104 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
105 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
106 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
113 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
114 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
145 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
147 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
216 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
217 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
218 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
220 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
221 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
222 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
223 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
224 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
225 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
226 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
227 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
228 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
229 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
230 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
231 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
232 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
233 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
234 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
235 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
236 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
237 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
238 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
239 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
240 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
241 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
242 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
243 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
244 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
245 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
246 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
247 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
248 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
249 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
250 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
251 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
252 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
253 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
254 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
255 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
256 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
257 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
258 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
259 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
260 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
261 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
262 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
263 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
264 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
265 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
266 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
267 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
268 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
269 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
270 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
271 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
272 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
273 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
274 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
275 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
276 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
277 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
278 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
279 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
280 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
281 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
282 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
283 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
284 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
285 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
286 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
287 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
288 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
289 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
290 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
291 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
292 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
293 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
294 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
295 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
296 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
297 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
298 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
299 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
300 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
301 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
302 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
303 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
304 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
305 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
306 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
307 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
308 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
309 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
310 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
311 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
312 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
313 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
314 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
315 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
316 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
317 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
318 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
319 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
320 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
321 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
322 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
323 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
324 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
325 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
326 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
327 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
328 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
329 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
330 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
331 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
332 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
333 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
334 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
338 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
339 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
340 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
341 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
342 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
343 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
344 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
345 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
346 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
347 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
348 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
349 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
350 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
366 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
367 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
368 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
369 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
370 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
371 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
372 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
373 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
374 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
375 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
376 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
377 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
378 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
379 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
382 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
383 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
384 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
385 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
386 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
387 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
388 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
389 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
390 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
391 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
392 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
393 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
394 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
395 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
396 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
397 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
398 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
399 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
400 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
401 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
402 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
403 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
404 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
405 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
406 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
407 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
408 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.76
Nodule 0
Rhizoplane 8.17
Rhizosphere 88.46
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214911850 2209111006 Bacteria 7117
2 ARcpr5yngRDRAFT_c000600 3300000043 Bacteria 4526
3 ARSoilOldRDRAFT_c000023 3300000044 Bacteria 34965
4 ARCol0oldRDRAFT_c00462 3300000045 Bacteria 3835
5 ARCol0yngRDRAFT_1000216 3300000652 Bacteria 9710
6 JGI24032J14994_100292 3300001430 Bacteria 2646
7 JGI24746J21847_1000047 3300001977 Bacteria 11979
8 JGI24739J22299_10000148 3300001989 Bacteria 22525
9 JGI24737J22298_10000458 3300001990 Bacteria 14018
10 JGI24737J22298_10003428 3300001990 Bacteria 5606
11 JGI24743J22301_10001360 3300001991 Bacteria 3359
12 JGI24750J21931_1000011 3300002070 Bacteria 22441
13 JGI24738J21930_10000236 3300002075 Bacteria 15024
14 JGI24749J21850_1000378 3300002076 Bacteria 6650
15 JGI24744J21845_10008543 3300002077 Bacteria 2105
16 JGI24744J21845_10010109 3300002077 Bacteria 1935
17 JGI24035J26624_1001314 3300002126 Bacteria 2353
18 JGI24033J26618_1001259 3300002155 Bacteria 2487
19 JGI24034J26672_10000483 3300002239 Bacteria 5147
20 JGI24742J22300_10000248 3300002244 Bacteria 8017
21 JGI24751J29686_10007458 3300002459 Bacteria 2233
22 JGI25404J52841_10000611 3300003659 Bacteria 5354
23 Ga0065716_1002142 3300005277 Bacteria 2189
24 Ga0065712_10072517 3300005290 Bacteria 4722
25 Ga0065712_10077915 3300005290 Bacteria 3425
26 Ga0065715_10001564 3300005293 Bacteria 10196
27 Ga0065715_10088960 3300005293 Bacteria 20217
28 Ga0065715_10146095 3300005293 Bacteria 1787
29 Ga0070658_10206441 3300005327 Bacteria 1659
30 Ga0070658_10287789 3300005327 Bacteria 1400
31 Ga0070676_10000536 3300005328 Bacteria 18324
32 Ga0070683_100000144 3300005329 Bacteria 45900
33 Ga0070683_100103835 3300005329 Bacteria 2679
34 Ga0070690_100001428 3300005330 Bacteria 12481
35 Ga0070690_100028441 3300005330 Bacteria 3463
36 Ga0070690_100044603 3300005330 Bacteria 2815
37 Ga0070670_100000437 3300005331 Bacteria 34047
38 Ga0070670_100011345 3300005331 Bacteria 7616
39 Ga0070677_10008501 3300005333 Bacteria 3457
40 Ga0068869_100000035 3300005334 Bacteria 55467
41 Ga0070666_10006881 3300005335 Bacteria 7005
42 Ga0070666_10033534 3300005335 Bacteria 3398
43 Ga0070666_10033695 3300005335 Bacteria 3391
44 Ga0070680_100001482 3300005336 Bacteria 17052
45 Ga0070680_100010932 3300005336 Bacteria 7015
46 Ga0070680_100015993 3300005336 Bacteria 5895
47 Ga0070680_100023460 3300005336 Bacteria 4920
48 Ga0070682_100002219 3300005337 Bacteria 10771
49 Ga0070682_100013572 3300005337 Bacteria 4690
50 Ga0068868_100001888 3300005338 Bacteria 14384
51 Ga0068868_100119761 3300005338 Bacteria 2146
52 Ga0070660_100001344 3300005339 Bacteria 16702
53 Ga0070660_100008614 3300005339 Bacteria 7139
54 Ga0070689_100000207 3300005340 Bacteria 35559
55 Ga0070689_100043423 3300005340 Bacteria 3455
56 Ga0070689_100068592 3300005340 Bacteria 2766
57 Ga0070691_10001234 3300005341 Bacteria 10769
58 Ga0070687_100000261 3300005343 Bacteria 17944
59 Ga0070661_100000017 3300005344 Bacteria 153232
60 Ga0070692_10000008 3300005345 Bacteria 47438
61 Ga0070668_100000699 3300005347 Bacteria 22898
62 Ga0070668_100062678 3300005347 Bacteria 2881
63 Ga0070669_100000250 3300005353 Bacteria 44115
64 Ga0070669_100078587 3300005353 Bacteria 2453
65 Ga0070675_100000246 3300005354 Bacteria 35225
66 Ga0070675_100152209 3300005354 Unclassified 1984
67 Ga0070671_100003025 3300005355 Bacteria 13092
68 Ga0070674_100000355 3300005356 Bacteria 22844
69 Ga0070673_100000032 3300005364 Bacteria 61665
70 Ga0070673_100037972 3300005364 Bacteria 3674
71 Ga0070688_100000669 3300005365 Bacteria 17042
72 Ga0070659_100000214 3300005366 Bacteria 44422
73 Ga0070659_100009561 3300005366 Bacteria 7124
74 Ga0070667_100000816 3300005367 Bacteria 29087
75 Ga0070667_100067811 3300005367 Bacteria 3035
76 Ga0070667_100135426 3300005367 Bacteria 2153
77 Ga0070703_10003001 3300005406 Bacteria 4821
78 Ga0070709_10008980 3300005434 Bacteria 5505
79 Ga0070714_100057751 3300005435 Bacteria 3322
80 Ga0070714_100359436 3300005435 Bacteria 1369
81 Ga0070713_100020676 3300005436 Bacteria 5050
82 Ga0070710_10033187 3300005437 Bacteria 2801
83 Ga0070701_10000099 3300005438 Bacteria 24473
84 Ga0070701_10036265 3300005438 Bacteria 2484
85 Ga0070701_10056293 3300005438 Bacteria 2057
86 Ga0070711_100147157 3300005439 Bacteria 1773
87 Ga0070705_100002586 3300005440 Bacteria 9071
88 Ga0070705_100028007 3300005440 Bacteria 3082
89 Ga0070705_100052781 3300005440 Bacteria 2376
90 Ga0070700_100000234 3300005441 Bacteria 30487
91 Ga0070700_100005017 3300005441 Bacteria 6979
92 Ga0070694_100000247 3300005444 Bacteria 28607
93 Ga0070663_100000201 3300005455 Bacteria 29751
94 Ga0070678_100003298 3300005456 Bacteria 8975
95 Ga0070678_100015873 3300005456 Bacteria 4799
96 Ga0070662_100009709 3300005457 Bacteria 6298
97 Ga0070662_100010369 3300005457 Bacteria 6110
98 Ga0070662_100042269 3300005457 Bacteria 3255
99 Ga0070681_10000401 3300005458 Bacteria 35170
100 Ga0070681_10001364 3300005458 Bacteria 21350
101 Ga0070681_10332233 3300005458 Bacteria 1429
102 Ga0068867_100000190 3300005459 Bacteria 40626
103 Ga0068867_100123667 3300005459 Bacteria 2002
104 Ga0070685_10009054 3300005466 Bacteria 5136
105 Ga0070707_100187753 3300005468 Bacteria 2015
106 Ga0070679_100000512 3300005530 Bacteria 32969
107 Ga0070679_100000847 3300005530 Bacteria 26675
108 Ga0070679_100025113 3300005530 Bacteria 5844
109 Ga0070679_100057996 3300005530 Unclassified 3859
110 Ga0070679_100177188 3300005530 Bacteria 2104
111 Ga0070684_100000904 3300005535 Bacteria 21016
112 Ga0070684_100061415 3300005535 Bacteria 3289
113 Ga0068853_100003019 3300005539 Bacteria 12851
114 Ga0068853_100023115 3300005539 Bacteria 5203
115 Ga0070672_100000807 3300005543 Bacteria 18712
116 Ga0070672_100142029 3300005543 Bacteria 1981
117 Ga0070686_100010404 3300005544 Bacteria 5243
118 Ga0070686_100033721 3300005544 Bacteria 3148
119 Ga0070695_100000406 3300005545 Bacteria 22313
120 Ga0070695_100011865 3300005545 Bacteria 5215
121 Ga0070695_100014581 3300005545 Bacteria 4738
122 Ga0070696_100000304 3300005546 Bacteria 29759
123 Ga0070696_100064387 3300005546 Bacteria 2569
124 Ga0070693_100000546 3300005547 Bacteria 16772
125 Ga0070693_100010607 3300005547 Bacteria 4619
126 Ga0070693_100062362 3300005547 Bacteria 2169
127 Ga0070704_100000385 3300005549 Bacteria 20151
128 Ga0070704_100003857 3300005549 Bacteria 8632
129 Ga0068855_100019930 3300005563 Bacteria 8055
130 Ga0068855_100222335 3300005563 Bacteria 2117
131 Ga0070664_100000912 3300005564 Bacteria 23051
132 Ga0068857_100000494 3300005577 Bacteria 28282
133 Ga0068857_100124549 3300005577 Bacteria 2322
134 Ga0068857_100209625 3300005577 Bacteria 1778
135 Ga0068854_100000139 3300005578 Bacteria 50270
136 Ga0068856_100005193 3300005614 Bacteria 12858
137 Ga0068856_100359006 3300005614 Bacteria 1476
138 Ga0070702_100000177 3300005615 Bacteria 20344
139 Ga0070702_100011837 3300005615 Bacteria 4351
140 Ga0068852_100000193 3300005616 Bacteria 41505
141 Ga0068852_100042613 3300005616 Bacteria 3843
142 Ga0068852_100087017 3300005616 Bacteria 2787
143 Ga0068859_100002972 3300005617 Bacteria 17185
144 Ga0068864_100000226 3300005618 Bacteria 50929
145 Ga0068864_100012607 3300005618 Bacteria 6989
146 Ga0068864_100080542 3300005618 Bacteria 2853
147 Ga0068866_10000199 3300005718 Bacteria 28222
148 Ga0068861_100000328 3300005719 Bacteria 26783
149 Ga0068851_10084106 3300005834 Bacteria 1666
150 Ga0068851_10161546 3300005834 Bacteria 1231
151 Ga0068870_10000388 3300005840 Bacteria 16520
152 Ga0068863_100001877 3300005841 Bacteria 20878
153 Ga0068863_100144226 3300005841 Bacteria 2277
154 Ga0068858_100000512 3300005842 Bacteria 40596
155 Ga0068858_100096035 3300005842 Bacteria 2762
156 Ga0068860_100001525 3300005843 Bacteria 24947
157 Ga0068860_100154993 3300005843 Bacteria 2207
158 Ga0068862_100000557 3300005844 Bacteria 38898
159 Ga0081455_10000035 3300005937 Bacteria 136366
160 Ga0081455_10002005 3300005937 Bacteria 24324
161 Ga0081540_1000001 3300005983 Bacteria 293507
162 Ga0081540_1014473 3300005983 Bacteria 5051
163 Ga0081540_1054104 3300005983 Bacteria 1963
164 Ga0081539_10010875 3300005985 Bacteria 7308
165 Ga0081539_10074748 3300005985 Bacteria 1803
166 Ga0070717_10003781 3300006028 Bacteria 10877
167 Ga0075365_10007896 3300006038 Bacteria 5995
168 Ga0075365_10051815 3300006038 Bacteria 2712
169 Ga0075365_10151866 3300006038 Bacteria 1611
170 Ga0075363_100089185 3300006048 Bacteria 1696
171 Ga0070712_100037167 3300006175 Bacteria 3317
172 Ga0070712_100065830 3300006175 Bacteria 2573
173 Ga0070712_100077344 3300006175 Bacteria 2398
174 Ga0075367_10053116 3300006178 Bacteria 2400
175 Ga0075367_10083357 3300006178 Bacteria 1937
176 Ga0075369_10022612 3300006186 Bacteria 2594
177 Ga0097621_100000049 3300006237 Bacteria 61062
178 Ga0097621_100037890 3300006237 Bacteria 3867
179 Ga0068871_100000097 3300006358 Bacteria 52015
180 Ga0068871_100005912 3300006358 Bacteria 8608
181 Ga0068871_100045059 3300006358 Bacteria 3549
182 Ga0075428_100184226 3300006844 Bacteria 2259
183 Ga0075428_100195351 3300006844 Bacteria 2188
184 Ga0075430_100000476 3300006846 Bacteria 30038
185 Ga0075431_100186739 3300006847 Bacteria 2125
186 Ga0075431_100306184 3300006847 Unclassified 1604
187 Ga0075434_100000383 3300006871 Bacteria 32396
188 Ga0075434_100068480 3300006871 Bacteria 3536
189 Ga0075434_100078639 3300006871 Unclassified 3294
190 Ga0075434_100127207 3300006871 Bacteria 2565
191 Ga0075434_100339957 3300006871 Bacteria 1522
192 Ga0075429_100038157 3300006880 Bacteria 4182
193 Ga0075429_100101556 3300006880 Bacteria 2511
194 Ga0068865_100000119 3300006881 Bacteria 39895
195 Ga0097620_100002972 3300006931 Bacteria 17185
196 Ga0075435_100003932 3300007076 Bacteria 10158
197 Ga0075435_100034684 3300007076 Bacteria 4000
198 Ga0075435_100045146 3300007076 Bacteria 3531
199 Ga0099794_10014583 3300007265 Bacteria 3447
200 Ga0099795_10000065 3300007788 Bacteria 18517
201 Ga0105251_10024945 3300009011 Bacteria 3064
202 Ga0105240_10134204 3300009093 Bacteria 2965
203 Ga0105240_10200443 3300009093 Bacteria 2339
204 Ga0111539_10000237 3300009094 Bacteria 65638
205 Ga0111539_10001512 3300009094 Bacteria 31036
206 Ga0111539_10268889 3300009094 Bacteria 1984
207 Ga0111539_10295857 3300009094 Bacteria 1884
208 Ga0105245_10000202 3300009098 Bacteria 57012
209 Ga0105245_10003663 3300009098 Bacteria 13721
210 Ga0105245_10037311 3300009098 Bacteria 4320
211 Ga0105247_10003839 3300009101 Bacteria 9725
212 Ga0105247_10010332 3300009101 Bacteria 5646
213 Ga0105247_10211918 3300009101 Bacteria 1307
214 Ga0114129_10207613 3300009147 Bacteria 2650
215 Ga0105243_10001790 3300009148 Bacteria 18452
216 Ga0105243_10026091 3300009148 Bacteria 4471
217 Ga0105241_10000430 3300009174 Bacteria 31789
218 Ga0105242_10002429 3300009176 Bacteria 14632
219 Ga0105242_10132857 3300009176 Bacteria 2151
220 Ga0105242_10158731 3300009176 Bacteria 1978
221 Ga0105248_10001335 3300009177 Bacteria 27466
222 Ga0105248_10098539 3300009177 Bacteria 3293
223 Ga0105237_10011108 3300009545 Bacteria 9545
224 Ga0105237_10232742 3300009545 Bacteria 1843
225 Ga0105237_10511193 3300009545 Bacteria 1208
226 Ga0105238_10013781 3300009551 Bacteria 8171
227 Ga0105238_10054694 3300009551 Bacteria 4007
228 Ga0105238_10215181 3300009551 Bacteria 1898
229 Ga0105249_10000215 3300009553 Bacteria 66439
230 Ga0105249_10039083 3300009553 Bacteria 4307
231 Ga0105239_10028262 3300010375 Bacteria 6169
232 Ga0105239_10048716 3300010375 Bacteria 4646
233 Ga0105239_10369213 3300010375 Bacteria 1621
234 Ga0105246_10000019 3300011119 Bacteria 62666
235 Ga0105246_10176718 3300011119 Bacteria 1640
236 Ga0105246_10189296 3300011119 Bacteria 1591
237 Ga0157373_10039499 3300013100 Bacteria 3379
238 Ga0157373_10106324 3300013100 Bacteria 1973
239 Ga0157371_10018650 3300013102 Bacteria 5126
240 Ga0157371_10140280 3300013102 Bacteria 1722
241 Ga0157370_10004500 3300013104 Bacteria 15977
242 Ga0157370_10051700 3300013104 Bacteria 3924
243 Ga0157369_10005666 3300013105 Bacteria 14509
244 Ga0157374_10001742 3300013296 Bacteria 18255
245 Ga0157374_10065644 3300013296 Bacteria 3409
246 Ga0157374_10163948 3300013296 Bacteria 2166
247 Ga0157378_10002701 3300013297 Bacteria 15807
248 Ga0157378_10054488 3300013297 Bacteria 3560
249 Ga0157378_10119950 3300013297 Bacteria 2423
250 Ga0163162_10001187 3300013306 Bacteria 24299
251 Ga0163162_10192309 3300013306 Bacteria 2168
252 Ga0163162_10461116 3300013306 Unclassified 1402
253 Ga0157372_10123858 3300013307 Bacteria 2971
254 Ga0157375_10000135 3300013308 Bacteria 73281
255 Ga0157375_10010957 3300013308 Bacteria 7996
256 Ga0157375_10121543 3300013308 Bacteria 2721
257 Ga0163163_10011189 3300014325 Bacteria 8127
258 Ga0163163_10019264 3300014325 Bacteria 6406
259 Ga0163163_10259652 3300014325 Bacteria 1788
260 Ga0163163_10268805 3300014325 Bacteria 1756
261 Ga0157380_10000284 3300014326 Bacteria 30507
262 Ga0157380_10119042 3300014326 Bacteria 2233
263 Ga0157380_10308622 3300014326 Bacteria 1461
264 Ga0182008_10005672 3300014497 Bacteria 7070
265 Ga0157379_10000065 3300014968 Bacteria 67475
266 Ga0157379_10075984 3300014968 Bacteria 3008
267 Ga0157379_10210808 3300014968 Bacteria 1759
268 Ga0157379_10269787 3300014968 Bacteria 1547
269 Ga0157376_10000180 3300014969 Bacteria 43524
270 Ga0157376_10163553 3300014969 Bacteria 2020
271 Ga0157376_10194758 3300014969 Bacteria 1861
272 Ga0163161_10001579 3300017792 Bacteria 16787
273 Ga0213876_10050387 3300021384 Bacteria 2200
274 Ga0207666_1000078 3300025271 Bacteria 16262
275 Ga0207666_1000744 3300025271 Bacteria 3908
276 Ga0207673_1000034 3300025290 Bacteria 10698
277 Ga0207697_10000370 3300025315 Bacteria 25198
278 Ga0207697_10003696 3300025315 Bacteria 7483
279 Ga0207656_10068370 3300025321 Bacteria 1574
280 Ga0207653_10001699 3300025885 Bacteria 7037
281 Ga0207682_10000304 3300025893 Bacteria 22182
282 Ga0207642_10000268 3300025899 Bacteria 15628
283 Ga0207642_10070941 3300025899 Bacteria 1657
284 Ga0207642_10082622 3300025899 Bacteria 1564
285 Ga0207710_10055539 3300025900 Bacteria 1785
286 Ga0207688_10000014 3300025901 Bacteria 59269
287 Ga0207688_10004456 3300025901 Bacteria 7625
288 Ga0207688_10044106 3300025901 Bacteria 2485
289 Ga0207680_10006371 3300025903 Bacteria 5702
290 Ga0207680_10019425 3300025903 Bacteria 3634
291 Ga0207647_10004406 3300025904 Bacteria 10441
292 Ga0207647_10014236 3300025904 Bacteria 5488
293 Ga0207647_10043164 3300025904 Bacteria 2823
294 Ga0207699_10141012 3300025906 Bacteria 1584
295 Ga0207699_10162760 3300025906 Bacteria 1487
296 Ga0207645_10000160 3300025907 Bacteria 53155
297 Ga0207645_10111993 3300025907 Bacteria 1767
298 Ga0207645_10145884 3300025907 Bacteria 1543
299 Ga0207643_10000009 3300025908 Bacteria 160496
300 Ga0207643_10001904 3300025908 Bacteria 11507
301 Ga0207654_10000441 3300025911 Bacteria 23641
302 Ga0207654_10036529 3300025911 Bacteria 2745
303 Ga0207707_10000554 3300025912 Bacteria 37851
304 Ga0207707_10009645 3300025912 Bacteria 8375
305 Ga0207707_10061954 3300025912 Bacteria 3255
306 Ga0207707_10148250 3300025912 Bacteria 2051
307 Ga0207671_10011327 3300025914 Bacteria 7265
308 Ga0207671_10260066 3300025914 Bacteria 1366
309 Ga0207693_10015698 3300025915 Bacteria 6069
310 Ga0207693_10017770 3300025915 Bacteria 5671
311 Ga0207693_10018018 3300025915 Bacteria 5628
312 Ga0207693_10020784 3300025915 Bacteria 5220
313 Ga0207660_10000161 3300025917 Bacteria 41972
314 Ga0207660_10041014 3300025917 Bacteria 3242
315 Ga0207662_10004160 3300025918 Bacteria 7573
316 Ga0207662_10037644 3300025918 Bacteria 2832
317 Ga0207657_10000980 3300025919 Bacteria 30300
318 Ga0207657_10010318 3300025919 Bacteria 9328
319 Ga0207649_10000429 3300025920 Bacteria 30596
320 Ga0207652_10000364 3300025921 Bacteria 47007
321 Ga0207652_10026006 3300025921 Bacteria 4871
322 Ga0207652_10032435 3300025921 Bacteria 4391
323 Ga0207652_10045443 3300025921 Unclassified 3745
324 Ga0207652_10192469 3300025921 Bacteria 1835
325 Ga0207681_10000035 3300025923 Bacteria 161792
326 Ga0207694_10145574 3300025924 Bacteria 1907
327 Ga0207650_10002514 3300025925 Bacteria 12729
328 Ga0207650_10112041 3300025925 Bacteria 2113
329 Ga0207659_10000027 3300025926 Bacteria 135454
330 Ga0207659_10028682 3300025926 Bacteria 3784
331 Ga0207659_10066360 3300025926 Bacteria 2619
332 Ga0207687_10000551 3300025927 Bacteria 25176
333 Ga0207700_10004694 3300025928 Bacteria 8096
334 Ga0207700_10077925 3300025928 Bacteria 2576
335 Ga0207664_10154154 3300025929 Bacteria 1954
336 Ga0207664_10184443 3300025929 Bacteria 1793
337 Ga0207644_10014608 3300025931 Bacteria 5257
338 Ga0207644_10190907 3300025931 Bacteria 1610
339 Ga0207690_10000056 3300025932 Bacteria 101387
340 Ga0207690_10025916 3300025932 Bacteria 3688
341 Ga0207690_10044581 3300025932 Bacteria 2925
342 Ga0207706_10000307 3300025933 Bacteria 52944
343 Ga0207706_10013650 3300025933 Bacteria 7377
344 Ga0207706_10035216 3300025933 Bacteria 4452
345 Ga0207686_10001402 3300025934 Bacteria 13707
346 Ga0207686_10027578 3300025934 Bacteria 3327
347 Ga0207686_10066389 3300025934 Bacteria 2304
348 Ga0207686_10076969 3300025934 Bacteria 2165
349 Ga0207709_10000087 3300025935 Bacteria 155019
350 Ga0207670_10000263 3300025936 Bacteria 32926
351 Ga0207670_10049725 3300025936 Bacteria 2806
352 Ga0207670_10277822 3300025936 Bacteria 1304
353 Ga0207669_10000052 3300025937 Bacteria 58284
354 Ga0207669_10026216 3300025937 Bacteria 3166
355 Ga0207704_10000063 3300025938 Bacteria 74699
356 Ga0207665_10000631 3300025939 Bacteria 23652
357 Ga0207691_10000167 3300025940 Bacteria 60999
358 Ga0207691_10021468 3300025940 Bacteria 6096
359 Ga0207691_10055482 3300025940 Bacteria 3611
360 Ga0207691_10172496 3300025940 Bacteria 1893
361 Ga0207711_10006590 3300025941 Bacteria 9775
362 Ga0207711_10016598 3300025941 Bacteria 6115
363 Ga0207689_10000155 3300025942 Bacteria 59178
364 Ga0207689_10036982 3300025942 Bacteria 4052
365 Ga0207689_10039328 3300025942 Bacteria 3916
366 Ga0207661_10000072 3300025944 Bacteria 69126
367 Ga0207661_10015191 3300025944 Bacteria 5662
368 Ga0207679_10000057 3300025945 Bacteria 104912
369 Ga0207679_10003395 3300025945 Bacteria 9824
370 Ga0207679_10326299 3300025945 Bacteria 1331
371 Ga0207679_10353677 3300025945 Bacteria 1281
372 Ga0207667_10113025 3300025949 Bacteria 2800
373 Ga0207667_10256828 3300025949 Bacteria 1787
374 Ga0207651_10000087 3300025960 Bacteria 41160
375 Ga0207651_10037972 3300025960 Bacteria 3160
376 Ga0207712_10000122 3300025961 Bacteria 83730
377 Ga0207712_10019090 3300025961 Bacteria 4473
378 Ga0207668_10000084 3300025972 Bacteria 70850
379 Ga0207640_10000878 3300025981 Bacteria 17041
380 Ga0207658_10004557 3300025986 Bacteria 9613
381 Ga0207658_10015437 3300025986 Bacteria 5240
382 Ga0207658_10031452 3300025986 Bacteria 3769
383 Ga0207677_10000549 3300026023 Bacteria 23737
384 Ga0207703_10005829 3300026035 Bacteria 9867
385 Ga0207703_10081284 3300026035 Bacteria 2701
386 Ga0207639_10001925 3300026041 Bacteria 13946
387 Ga0207639_10047666 3300026041 Bacteria 3240
388 Ga0207678_10000187 3300026067 Bacteria 53154
389 Ga0207678_10027526 3300026067 Bacteria 4961
390 Ga0207678_10036968 3300026067 Bacteria 4250
391 Ga0207708_10000158 3300026075 Bacteria 53154
392 Ga0207708_10002015 3300026075 Bacteria 14967
393 Ga0207708_10002641 3300026075 Bacteria 13186
394 Ga0207702_10001960 3300026078 Bacteria 20035
395 Ga0207702_10073421 3300026078 Bacteria 2949
396 Ga0207641_10000896 3300026088 Bacteria 31014
397 Ga0207641_10012014 3300026088 Bacteria 7105
398 Ga0207648_10001167 3300026089 Bacteria 29390
399 Ga0207648_10003124 3300026089 Bacteria 17485
400 Ga0207648_10038868 3300026089 Bacteria 4187
401 Ga0207676_10000089 3300026095 Bacteria 82462
402 Ga0207676_10009698 3300026095 Bacteria 6845
403 Ga0207676_10074074 3300026095 Bacteria 2742
404 Ga0207676_10349171 3300026095 Bacteria 1367
405 Ga0207674_10001478 3300026116 Bacteria 30348
406 Ga0207675_100000229 3300026118 Bacteria 52966
407 Ga0207675_100014980 3300026118 Bacteria 7237
408 Ga0207675_100028481 3300026118 Bacteria 5201
409 Ga0207683_10000525 3300026121 Bacteria 35508
410 Ga0207683_10045639 3300026121 Bacteria 3832
411 Ga0209983_1004225 3300027665 Bacteria 3027
412 Ga0209971_1009585 3300027682 Bacteria 2294
413 Ga0209998_10000949 3300027717 Bacteria 7357
414 Ga0209974_10003008 3300027876 Bacteria 6101
415 Ga0207428_10000037 3300027907 Bacteria 218857
416 Ga0207428_10000308 3300027907 Bacteria 64810
417 Ga0207428_10122931 3300027907 Bacteria 1989
418 Ga0207428_10166664 3300027907 Bacteria 1670
419 Ga0268266_10140836 3300028379 Bacteria 2164
420 Ga0268265_10000195 3300028380 Bacteria 70871
421 Ga0268264_10000526 3300028381 Bacteria 48503
422 Ga0268264_10045619 3300028381 Bacteria 3639
423 Ga0268264_10316118 3300028381 Unclassified 1475
424 Ga0265337_1000963 3300028556 Bacteria 15083
425 Ga0265337_1002095 3300028556 Bacteria 9423
426 Ga0265334_10002101 3300028573 Bacteria 9409
427 Ga0265338_10016636 3300028800 Bacteria 7979
428 Ga0265338_10043272 3300028800 Bacteria 4179
429 Ga0265760_10006486 3300031090 Bacteria 3344
430 Ga0265330_10003043 3300031235 Bacteria 8895
431 Ga0265325_10000352 3300031241 Bacteria 32405
432 Ga0265325_10000736 3300031241 Bacteria 23678
433 Ga0265325_10010060 3300031241 Bacteria 5494
434 Ga0265339_10005391 3300031249 Bacteria 8520
435 Ga0265339_10042125 3300031249 Bacteria 2529
436 Ga0265313_10000106 3300031595 Bacteria 83923
437 Ga0265313_10000686 3300031595 Bacteria 34918
438 Ga0265313_10045737 3300031595 Bacteria 2129
439 Ga0316575_10045914 3300031665 Bacteria 1735
440 Ga0265314_10003780 3300031711 Bacteria 14466
441 Ga0265342_10000882 3300031712 Bacteria 29894
442 Ga0265342_10004819 3300031712 Bacteria 10468
443 Ga0307416_100339168 3300032002 Bacteria 1515
444 Ga0316583_10000161 3300032133 Bacteria 16491
445 Ga0373930_0000020 3300034816 Bacteria 15356
446 Ga0373948_0000371 3300034817 Bacteria 5533
447 Ga0373948_0008576 3300034817 Bacteria 1743
448 Ga0373958_0000533 3300034819 Bacteria 4759
449 Ga0373958_0000699 3300034819 Bacteria 4250
450 Ga0373959_0000539 3300034820 Bacteria 6764
451 Ga0373938_0000748 3300034957 Bacteria 5254
452 Ga0373926_0022850 3300035083 Bacteria 2170
453 Ga0373926_0026611 3300035083 Bacteria 2024
454 Ga0373928_0001398 3300035084 Bacteria 4709
455 Ga0373929_0001728 3300035085 Bacteria 4107
456 Ga0373934_0018802 3300035086 Bacteria 2647
457 Ga0373934_0020424 3300035086 Bacteria 2545
458 Ga0373940_0000325 3300035088 Bacteria 7005
459 Ga0373944_0006563 3300035089 Bacteria 3091
460 Ga0373944_0010969 3300035089 Bacteria 2478
461 Ga0373949_0001003 3300035090 Bacteria 8717
462 Ga0373949_0001117 3300035090 Bacteria 8122
463 Ga0373949_0006408 3300035090 Bacteria 2588
464 Ga0373951_0000547 3300035091 Bacteria 10574
465 Ga0373952_0000114 3300035092 Bacteria 10971
466 Ga0373952_0000713 3300035092 Bacteria 5943
467 Ga0373932_0001186 3300035112 Bacteria 7459
468 Ga0373932_0002300 3300035112 Bacteria 4857
469 Ga0373932_0009525 3300035112 Bacteria 2336
470 Ga0373936_0004882 3300035113 Bacteria 5055
471 Ga0373939_0000261 3300035114 Bacteria 14162
472 Ga0373939_0000360 3300035114 Bacteria 11493
473 Ga0373939_0042053 3300035114 Bacteria 1380
474 Ga0373941_0001573 3300035115 Bacteria 4850
475 Ga0373941_0001805 3300035115 Bacteria 4608
476 Ga0373945_0008327 3300035116 Bacteria 3373
477 Ga0373945_0008419 3300035116 Bacteria 3361
478 Ga0373945_0020000 3300035116 Bacteria 2289
479 Ga0373953_0000785 3300035117 Bacteria 8844
480 Ga0373953_0001943 3300035117 Bacteria 6145
481 Ga0373953_0032058 3300035117 Bacteria 2047
482 Ga0373954_0000969 3300035118 Bacteria 11258
483 Ga0373954_0009797 3300035118 Bacteria 4217
484 Ga0373956_0011124 3300035119 Bacteria 3705
485 Ga0373956_0054836 3300035119 Bacteria 1797
486 Ga0373957_0005912 3300035120 Bacteria 3826
487 Ga0373960_0003891 3300035121 Bacteria 3403
488 Ga0373960_0008095 3300035121 Bacteria 2510
489 Ga0373960_0017544 3300035121 Bacteria 1856
490 Ga0373943_0000306 3300035170 Bacteria 20449
491 Ga0373943_0001944 3300035170 Bacteria 9358
492 Ga0373943_0020329 3300035170 Bacteria 3059
493 Ga0373946_0001059 3300035171 Bacteria 9481
494 Ga0373946_0022197 3300035171 Bacteria 2468
495 Ga0373946_0026560 3300035171 Bacteria 2285
496 Ga0373946_0084295 3300035171 Bacteria 1397
497 Ga0373955_0000039 3300035172 Bacteria 51994
498 Ga0373955_0010587 3300035172 Bacteria 4361
499 Ga0373955_0114296 3300035172 Bacteria 1563
500 Ga0373942_0001477 3300035207 Bacteria 6050
501 Ga0373942_0003320 3300035207 Bacteria 3782
502 Ga0373961_0001845 3300035241 Bacteria 5795
503 Ga0373962_0000273 3300035242 Bacteria 11116
504 Ga0373962_0000354 3300035242 Bacteria 10085
505 Ga0373962_0006957 3300035242 Bacteria 2757
506 Ga0373962_0037273 3300035242 Unclassified 1357
507 Ga0373924_0045126 3300035410 Bacteria 1812
508 Ga0373924_0047222 3300035410 Bacteria 1776
509 Ga0373931_0000082 3300035691 Bacteria 44600
510 Ga0373931_0007665 3300035691 Bacteria 5092
511 Ga0373931_0010622 3300035691 Bacteria 4427
512 Ga0373931_0151827 3300035691 Bacteria 1351
513 Ga0373935_0000079 3300035692 Bacteria 41989
514 Ga0373935_0003255 3300035692 Bacteria 9390
515 Ga0373935_0010573 3300035692 Bacteria 5538
516 Ga0373935_0116947 3300035692 Unclassified 1776
517 Ga0373927_0013767 3300035695 Bacteria 5368
518 Ga0373927_0023394 3300035695 Bacteria 4046
519 Ga0373927_0027655 3300035695 Bacteria 3702
520 Ga0373927_0029598 3300035695 Bacteria 3570
521 Ga0373927_0033383 3300035695 Bacteria 3351
522 Ga0373927_0052750 3300035695 Unclassified 2629
523 Ga0373933_0004704 3300035724 Bacteria 7475
524 Ga0373933_0022723 3300035724 Bacteria 3575
525 Ga0373933_0031487 3300035724 Bacteria 3077
526 Ga0373933_0101185 3300035724 Bacteria 1788
527 Ga0373947_0001044 3300035725 Bacteria 16908
528 Ga0373947_0013808 3300035725 Bacteria 4629
529 Ga0373937_0000223 3300036401 Bacteria 54957
530 Ga0373937_0003786 3300036401 Bacteria 12792
531 Ga0373937_0005292 3300036401 Bacteria 11025
532 Ga0373937_0011036 3300036401 Bacteria 7921
533 Ga0373937_0029554 3300036401 Bacteria 4964
534 Ga0373937_0112702 3300036401 Bacteria 2530
535 Ga0373937_0112952 3300036401 Bacteria 2527
536 Ga0373937_0307400 3300036401 Bacteria 1499
537 Ga0316582_0129027 3300036647 Bacteria 1697
538 Ga0373925_0000002 3300037068 Bacteria 368879
539 Ga0373925_0005123 3300037068 Bacteria 9818
540 Ga0373925_0008940 3300037068 Bacteria 7298
541 Ga0373925_0036705 3300037068 Bacteria 3616
542 Ga0395899_0036755 3300037312 Bacteria 3672
543 Ga0395899_0210759 3300037312 Bacteria 1350
544 Ga0395900_0008255 3300037418 Bacteria 10721
545 Ga0395900_0238696 3300037418 Bacteria 1824
546 Ga0395898_0011916 3300037466 Bacteria 9006
547 Ga0436364_0562385 3300037853 Bacteria 3895
548 Ga0436364_0575338 3300037853 Bacteria 1455
549 Ga0395901_0009281 3300038443 Bacteria 9972
550 Ga0395901_0014372 3300038443 Bacteria 8058
551 Ga0242420_008230 3300038996 Bacteria 1687
552 Ga0436365_0855986 3300039437 Bacteria 7757
553 Ga0436365_1407541 3300039437 Bacteria 11292
554 Ga0436360_0966528 3300039438 Bacteria 2511
555 Ga0436363_0889203 3300039450 Bacteria 4880
556 Ga0439443_000439 3300042003 Bacteria 3624
557 Ga0439444_0000655 3300042437 Bacteria 4021
558 Ga0439464_0007110 3300042439 Bacteria 2925
559 Ga0439460_0005185 3300042461 Bacteria 3191
560 Ga0439460_0027028 3300042461 Bacteria 1609
561 Ga0466965_0136901 3300044683 Bacteria 1273
562 Ga0466963_0055121 3300044694 Bacteria 2643
563 Ga0466971_0091002 3300044719 Bacteria 1397
564 Ga0466959_0027730 3300045049 Bacteria 4200
565 Ga0466959_0184081 3300045049 Bacteria 1460
566 Ga0466958_0036333 3300045836 Bacteria 2948
567 Ga0466967_0075883 3300045976 Bacteria 3022
568 Ga0466967_0102678 3300045976 Bacteria 2616
569 Ga0495592_0000475 3300046454 Bacteria 29441
570 Ga0495592_0070656 3300046454 Bacteria 2542
571 Ga0495603_0033346 3300046455 Bacteria 3098
572 Ga0495603_0109535 3300046455 Bacteria 1611
573 Ga0495629_0000222 3300046459 Bacteria 50600
574 Ga0495629_0025089 3300046459 Bacteria 4240
575 Ga0495629_0114884 3300046459 Unclassified 1876
576 Ga0495641_0038095 3300046461 Bacteria 2248
577 Ga0495641_0052254 3300046461 Bacteria 1863
578 Ga0495651_0005638 3300046462 Bacteria 9539
579 Ga0495651_0014733 3300046462 Bacteria 6046
580 Ga0495651_0094361 3300046462 Bacteria 2239
581 Ga0495653_0000006 3300046463 Bacteria 363285
582 Ga0495580_0023974 3300046472 Bacteria 4473
583 Ga0495580_0034407 3300046472 Bacteria 3648
584 Ga0495580_0047493 3300046472 Bacteria 3043
585 Ga0495582_0008516 3300046473 Bacteria 5657
586 Ga0495582_0028249 3300046473 Bacteria 3078
587 Ga0495582_0196782 3300046473 Unclassified 1150
588 Ga0495662_0001482 3300046476 Bacteria 11622
589 Ga0495662_0008512 3300046476 Bacteria 5042
590 Ga0495662_0009876 3300046476 Bacteria 4688
591 Ga0495664_0000002 3300046477 Bacteria 625183
592 Ga0495664_0000553 3300046477 Bacteria 18839
593 Ga0495664_0003233 3300046477 Bacteria 8850
594 Ga0495584_0011722 3300046491 Bacteria 4483
595 Ga0495594_0017544 3300046499 Bacteria 3783
596 Ga0495594_0059828 3300046499 Bacteria 2107
597 Ga0495594_0136075 3300046499 Bacteria 1392
598 Ga0495608_0000009 3300046511 Bacteria 266614
599 Ga0495608_0002323 3300046511 Bacteria 13726
600 Ga0495608_0068939 3300046511 Bacteria 2312
601 Ga0495618_0000005 3300046514 Bacteria 230421
602 Ga0495618_0002320 3300046514 Bacteria 12323
603 Ga0495618_0006486 3300046514 Bacteria 7103
604 Ga0495618_0087504 3300046514 Bacteria 1992
605 Ga0495628_0000002 3300046516 Bacteria 589399
606 Ga0495628_0011343 3300046516 Bacteria 7543
607 Ga0495630_0000240 3300046517 Bacteria 43911
608 Ga0495630_0055666 3300046517 Bacteria 2964
609 Ga0495630_0192869 3300046517 Bacteria 1554
610 Ga0495630_0270771 3300046517 Unclassified 1297
611 Ga0495652_0000004 3300046529 Bacteria 588877
612 Ga0495652_0015928 3300046529 Bacteria 6728
613 Ga0495652_0034412 3300046529 Bacteria 4415
614 Ga0495652_0039358 3300046529 Bacteria 4088
615 Ga0495652_0095921 3300046529 Bacteria 2416
616 Ga0495665_0003071 3300046531 Bacteria 9032
617 Ga0495665_0004921 3300046531 Bacteria 7200
618 Ga0495665_0012467 3300046531 Bacteria 4600
619 Ga0495640_0000005 3300046533 Bacteria 318271
620 Ga0495640_0008496 3300046533 Bacteria 8049
621 Ga0495640_0014607 3300046533 Bacteria 5934
622 Ga0495640_0019242 3300046533 Bacteria 5043
623 Ga0495640_0052361 3300046533 Bacteria 2803
624 Ga0495586_0006088 3300046535 Bacteria 6450
625 Ga0495586_0016023 3300046535 Bacteria 3988
626 Ga0495586_0058039 3300046535 Unclassified 2101
627 Ga0495586_0058565 3300046535 Bacteria 2092
628 Ga0495587_0000007 3300046536 Bacteria 290788
629 Ga0495587_0006576 3300046536 Bacteria 7568
630 Ga0495587_0024692 3300046536 Bacteria 3681
631 Ga0495645_0000003 3300046543 Bacteria 570133
632 Ga0495645_0020641 3300046543 Bacteria 4756
633 Ga0495645_0025774 3300046543 Bacteria 4268
634 Ga0495622_0060647 3300046557 Unclassified 1752
635 Ga0495667_0000002 3300046559 Bacteria 437535
636 Ga0495667_0002675 3300046559 Bacteria 11909
637 Ga0495667_0019291 3300046559 Bacteria 4601
638 Ga0495667_0045829 3300046559 Bacteria 2893
639 Ga0495656_0060932 3300046615 Bacteria 1646
640 Ga0495656_0091601 3300046615 Bacteria 1391
641 Ga0495634_0000129 3300046642 Bacteria 65082
642 Ga0495634_0008810 3300046642 Bacteria 7481
643 Ga0495634_0035176 3300046642 Bacteria 3433
644 Ga0495634_0118185 3300046642 Unclassified 1699
645 Ga0495634_0141283 3300046642 Bacteria 1528
646 Ga0495635_0000020 3300046663 Bacteria 189698
647 Ga0495635_0002537 3300046663 Bacteria 12495
648 Ga0495635_0002623 3300046663 Bacteria 12304
649 Ga0495635_0081225 3300046663 Bacteria 2218
650 Ga0495657_0004771 3300046675 Bacteria 10810
651 Ga0495657_0045424 3300046675 Bacteria 2981
652 Ga0495657_0099372 3300046675 Bacteria 1856
653 Ga0495599_0000001 3300046678 Bacteria 537563
654 Ga0495599_0041642 3300046678 Bacteria 2883
655 Ga0495623_0000001 3300046679 Bacteria 313861
656 Ga0495623_0001394 3300046679 Bacteria 16421
657 Ga0495646_0000013 3300046680 Bacteria 159700
658 Ga0495646_0001135 3300046680 Bacteria 15537
659 Ga0495647_0003047 3300046681 Bacteria 5340
660 Ga0495647_0003641 3300046681 Bacteria 4947
661 Ga0495647_0006607 3300046681 Bacteria 3849
662 Ga0495647_0025809 3300046681 Bacteria 2149
663 Ga0495658_0000656 3300046683 Bacteria 18755
664 Ga0495658_0010561 3300046683 Bacteria 4621
665 Ga0495658_0031947 3300046683 Bacteria 2871
666 Ga0495613_0004890 3300046689 Bacteria 10065
667 Ga0495613_0017049 3300046689 Bacteria 5407
668 Ga0495613_0028418 3300046689 Bacteria 4159
669 Ga0495613_0134125 3300046689 Bacteria 1772
670 Ga0495613_0155919 3300046689 Bacteria 1627
671 Ga0495624_0004432 3300046690 Bacteria 10272
672 Ga0495624_0005773 3300046690 Bacteria 8865
673 Ga0495671_0124558 3300046692 Bacteria 1257
674 Ga0495600_0000041 3300046809 Bacteria 75747
675 Ga0495600_0000708 3300046809 Bacteria 17501
676 Ga0495600_0038262 3300046809 Bacteria 3121
677 Ga0495581_0003767 3300047315 Bacteria 8729
678 Ga0495581_0011746 3300047315 Bacteria 5071
679 Ga0495581_0046261 3300047315 Bacteria 2514
680 Ga0495604_0000005 3300047317 Bacteria 424516
681 Ga0495604_0007332 3300047317 Bacteria 8734
682 Ga0495604_0031950 3300047317 Bacteria 4174
683 Ga0495604_0127480 3300047317 Bacteria 1833
684 Ga0495674_0000003 3300047319 Bacteria 562126
685 Ga0495674_0002023 3300047319 Bacteria 19947
686 Ga0495674_0003325 3300047319 Bacteria 15611
687 Ga0495676_0036509 3300047321 Bacteria 4102
688 Ga0495676_0042309 3300047321 Bacteria 3741
689 Ga0495680_0000002 3300047322 Bacteria 197533
690 Ga0495680_0005048 3300047322 Bacteria 12467
691 Ga0495680_0009889 3300047322 Bacteria 8550
692 Ga0495680_0070207 3300047322 Bacteria 2671
693 Ga0495675_0000383 3300047444 Bacteria 30552
694 Ga0495675_0003495 3300047444 Bacteria 9466
695 Ga0495679_025931 3300047446 Bacteria 1953
696 Ga0495684_0000020 3300047471 Bacteria 148507
697 Ga0495684_0001619 3300047471 Bacteria 18049
698 Ga0495684_0008545 3300047471 Bacteria 7929
699 Ga0495684_0096579 3300047471 Bacteria 2236
700 Ga0495684_0175691 3300047471 Bacteria 1590
701 Ga0495593_0001985 3300047673 Bacteria 12195
702 Ga0495593_0097929 3300047673 Bacteria 1506
703 Ga0495602_0000027 3300048088 Bacteria 145010
704 Ga0495602_0036787 3300048088 Bacteria 4551
705 Ga0495602_0113829 3300048088 Bacteria 2192
706 Ga0495614_0005475 3300048089 Bacteria 5723
707 Ga0496100_0000189 3300048903 Bacteria 34151
708 Ga0496100_0001161 3300048903 Bacteria 12807
709 Ga0496100_0037778 3300048903 Bacteria 3055
710 Ga0496100_0056282 3300048903 Bacteria 2572
711 Ga0496100_0143964 3300048903 Bacteria 1693
712 Ga0496101_0000367 3300048904 Bacteria 29989
713 Ga0496101_0014471 3300048904 Bacteria 5303
714 Ga0496101_0025023 3300048904 Bacteria 4138
715 Ga0496102_0002863 3300048905 Bacteria 14654
716 Ga0496102_0005220 3300048905 Bacteria 11029
717 Ga0496102_0009146 3300048905 Bacteria 8498
718 Ga0496102_0033628 3300048905 Bacteria 4608
719 Ga0496102_0198971 3300048905 Bacteria 1888
720 Ga0496103_0001608 3300048906 Bacteria 14839
721 Ga0496103_0099495 3300048906 Bacteria 1839
722 Ga0496103_0116901 3300048906 Bacteria 1697
723 Ga0496104_0000116 3300048907 Bacteria 74423
724 Ga0496104_0001130 3300048907 Bacteria 22846
725 Ga0496104_0015135 3300048907 Bacteria 6981
726 Ga0496104_0021724 3300048907 Bacteria 5895
727 Ga0496104_0040929 3300048907 Bacteria 4344
728 Ga0496104_0104391 3300048907 Bacteria 2715
729 Ga0496104_0179542 3300048907 Bacteria 2027
730 Ga0496104_0224927 3300048907 Bacteria 1788
731 Ga0496105_0000550 3300048908 Bacteria 24744
732 Ga0496105_0002424 3300048908 Bacteria 13516
733 Ga0496105_0003830 3300048908 Bacteria 11224
734 Ga0496105_0006935 3300048908 Bacteria 8725
735 Ga0496105_0007809 3300048908 Bacteria 8303
736 Ga0496105_0172991 3300048908 Bacteria 1770
737 Ga0496105_0181825 3300048908 Bacteria 1721
738 Ga0496105_0248499 3300048908 Bacteria 1441
739 Ga0496105_0302820 3300048908 Unclassified 1285
740 Ga0496106_0000736 3300048909 Bacteria 23593
741 Ga0496106_0004342 3300048909 Bacteria 10529
742 Ga0496106_0006742 3300048909 Bacteria 8505
743 Ga0496106_0019354 3300048909 Bacteria 5048
744 Ga0496106_0022228 3300048909 Bacteria 4711
745 Ga0496106_0049486 3300048909 Bacteria 3166
746 Ga0496106_0076675 3300048909 Bacteria 2563
747 Ga0496107_0000080 3300048910 Bacteria 46272
748 Ga0496107_0000646 3300048910 Bacteria 19609
749 Ga0496107_0020206 3300048910 Bacteria 4702
750 Ga0496107_0048652 3300048910 Bacteria 3055
751 Ga0496107_0063030 3300048910 Bacteria 2686
752 Ga0496107_0257166 3300048910 Unclassified 1299
753 Ga0496108_0004997 3300048911 Bacteria 10716
754 Ga0496108_0006587 3300048911 Bacteria 9421
755 Ga0496108_0031303 3300048911 Bacteria 4413
756 Ga0496108_0172168 3300048911 Bacteria 1873
757 Ga0496109_0000737 3300048912 Bacteria 27192
758 Ga0496109_0005620 3300048912 Bacteria 10492
759 Ga0496109_0010007 3300048912 Bacteria 8096
760 Ga0496109_0014904 3300048912 Bacteria 6765
761 Ga0496109_0125953 3300048912 Bacteria 2388
762 Ga0496109_0252596 3300048912 Unclassified 1660
763 Ga0496110_0028924 3300048913 Bacteria 4763
764 Ga0496110_0060408 3300048913 Bacteria 3343
765 Ga0496110_0062381 3300048913 Bacteria 3292
766 Ga0496110_0284624 3300048913 Bacteria 1505
767 Ga0496111_0004597 3300048914 Bacteria 8737
768 Ga0496111_0050125 3300048914 Bacteria 3010
769 Ga0496111_0153359 3300048914 Bacteria 1709
770 Ga0496112_0006007 3300048915 Bacteria 10597
771 Ga0496112_0011362 3300048915 Bacteria 8127
772 Ga0496112_0353962 3300048915 Unclassified 1410
773 Ga0496113_0000682 3300048916 Bacteria 17292
774 Ga0496113_0000721 3300048916 Bacteria 16927
775 Ga0496113_0005126 3300048916 Bacteria 8141
776 Ga0496114_0005823 3300048917 Bacteria 9677
777 Ga0496114_0007885 3300048917 Bacteria 8425
778 Ga0496114_0027379 3300048917 Bacteria 4668
779 Ga0496114_0031377 3300048917 Bacteria 4373
780 Ga0496114_0173948 3300048917 Bacteria 1878
781 Ga0496115_0001413 3300048918 Bacteria 17185
782 Ga0496115_0009214 3300048918 Bacteria 7328
783 Ga0496115_0022768 3300048918 Bacteria 4857
784 Ga0496115_0024635 3300048918 Bacteria 4680
785 Ga0496115_0054167 3300048918 Bacteria 3220
786 Ga0496115_0212539 3300048918 Bacteria 1597
787 Ga0501031_0097875 3300049568 Bacteria 1915
788 Ga0501032_0022662 3300049569 Bacteria 4351
789 Ga0501032_0037377 3300049569 Bacteria 3311
790 Ga0501033_0005800 3300049570 Bacteria 9718
791 Ga0501033_0020328 3300049570 Bacteria 5016
792 Ga0501034_0000247 3300049571 Bacteria 99828
793 Ga0501034_0001519 3300049571 Bacteria 30483
794 Ga0501034_0027708 3300049571 Bacteria 5761
795 Ga0501034_0060022 3300049571 Bacteria 3820
796 Ga0501034_0093689 3300049571 Bacteria 3000
797 Ga0501036_0000124 3300049572 Bacteria 48755
798 Ga0501036_0001768 3300049572 Bacteria 16772
799 Ga0501036_0028767 3300049572 Bacteria 4696
800 Ga0501036_0146536 3300049572 Bacteria 1991
801 Ga0501037_0005176 3300049573 Bacteria 9490
802 Ga0501037_0023211 3300049573 Bacteria 4587
803 Ga0501037_0039212 3300049573 Bacteria 3488
804 Ga0501037_0128912 3300049573 Bacteria 1815
805 Ga0501038_0006330 3300049574 Bacteria 10953
806 Ga0501038_0018465 3300049574 Bacteria 6296
807 Ga0501038_0040136 3300049574 Bacteria 4090
808 Ga0501038_0041971 3300049574 Bacteria 3986
809 Ga0501038_0056279 3300049574 Bacteria 3377
810 Ga0501038_0069953 3300049574 Bacteria 2980
811 Ga0501038_0104008 3300049574 Bacteria 2360
812 Ga0501039_0012756 3300049575 Bacteria 6423
813 Ga0501039_0019747 3300049575 Bacteria 5167
814 Ga0501039_0030461 3300049575 Bacteria 4161
815 Ga0501039_0040389 3300049575 Bacteria 3601
816 Ga0501039_0076368 3300049575 Bacteria 2604
817 Ga0501040_0000194 3300049576 Bacteria 35298
818 Ga0501040_0019715 3300049576 Bacteria 4488
819 Ga0501040_0109933 3300049576 Bacteria 1927
820 Ga0501041_0001330 3300049577 Bacteria 13598
821 Ga0501041_0016275 3300049577 Bacteria 4421
822 Ga0501042_0042626 3300049578 Bacteria 3231
823 Ga0501042_0058670 3300049578 Bacteria 2747
824 Ga0501042_0102899 3300049578 Bacteria 2054
825 Ga0501043_0001829 3300049579 Bacteria 18264
826 Ga0501043_0046400 3300049579 Bacteria 3416
827 Ga0501043_0061543 3300049579 Bacteria 2948
828 Ga0501043_0074181 3300049579 Bacteria 2672
829 Ga0501046_0000501 3300049580 Bacteria 39127
830 Ga0501046_0016004 3300049580 Bacteria 6292
831 Ga0501046_0041776 3300049580 Bacteria 3658
832 Ga0501046_0058359 3300049580 Bacteria 3026
833 Ga0501046_0091010 3300049580 Bacteria 2346
834 Ga0501047_0000010 3300049581 Bacteria 429357
835 Ga0501047_0011285 3300049581 Bacteria 8457
836 Ga0501047_0012811 3300049581 Bacteria 7945
837 Ga0501047_0047155 3300049581 Bacteria 4163
838 Ga0501047_0057389 3300049581 Bacteria 3765
839 Ga0501048_0000554 3300049582 Bacteria 26430
840 Ga0501048_0207393 3300049582 Bacteria 1390
841 Ga0501068_0009707 3300049584 Bacteria 5388
842 Ga0501068_0062183 3300049584 Bacteria 2269
843 Ga0501069_0111223 3300049585 Bacteria 1560
844 Ga0501070_0008050 3300049586 Bacteria 8921
845 Ga0501070_0029949 3300049586 Bacteria 4560
846 Ga0501070_0036241 3300049586 Bacteria 4119
847 Ga0501070_0050777 3300049586 Bacteria 3442
848 Ga0501070_0076061 3300049586 Bacteria 2779
849 Ga0501070_0084146 3300049586 Bacteria 2634
850 Ga0501071_0004671 3300049587 Bacteria 8701
851 Ga0501071_0011158 3300049587 Bacteria 6042
852 Ga0501072_0000412 3300049588 Bacteria 30560
853 Ga0501072_0003559 3300049588 Bacteria 11726
854 Ga0501072_0053922 3300049588 Bacteria 3167
855 Ga0501072_0083789 3300049588 Bacteria 2528
856 Ga0501073_0027991 3300049589 Bacteria 4026
857 Ga0501073_0058146 3300049589 Bacteria 2703
858 Ga0501074_0018217 3300049590 Bacteria 5101
859 Ga0501074_0029915 3300049590 Bacteria 3947
860 Ga0501074_0106604 3300049590 Bacteria 2006
861 Ga0501074_0247900 3300049590 Bacteria 1266
862 Ga0501075_0000046 3300049591 Bacteria 50813
863 Ga0501075_0006556 3300049591 Bacteria 8017
864 Ga0501075_0066325 3300049591 Bacteria 2724
865 Ga0501076_0000768 3300049592 Bacteria 20719
866 Ga0501076_0168865 3300049592 Bacteria 1783
867 Ga0501076_0266446 3300049592 Bacteria 1403
868 Ga0501077_0002139 3300049593 Bacteria 11923
869 Ga0501077_0037790 3300049593 Bacteria 3074
870 Ga0501077_0061505 3300049593 Bacteria 2383
871 Ga0501079_0007157 3300049741 Bacteria 8422
872 Ga0501079_0011365 3300049741 Bacteria 6794
873 Ga0501079_0020439 3300049741 Bacteria 5061
874 Ga0501079_0125432 3300049741 Bacteria 1997
875 Ga0501079_0179289 3300049741 Bacteria 1653
876 Ga0501080_0000100 3300049742 Bacteria 58925
877 Ga0501080_0018292 3300049742 Bacteria 6486
878 Ga0501080_0058906 3300049742 Bacteria 3574
879 Ga0501080_0151023 3300049742 Bacteria 2147
880 Ga0501081_0000517 3300049743 Bacteria 21705
881 Ga0501081_0005416 3300049743 Bacteria 8237
882 Ga0501083_0003213 3300049744 Bacteria 11384
883 Ga0501083_0006706 3300049744 Bacteria 8171
884 Ga0501035_0002939 3300049822 Bacteria 16395
885 Ga0501035_0056982 3300049822 Bacteria 3485
886 Ga0501035_0061789 3300049822 Bacteria 3333
887 Ga0501035_0255409 3300049822 Bacteria 1487
888 Ga0501035_0258253 3300049822 Bacteria 1478
889 Ga0501044_0022356 3300049823 Bacteria 6740
890 Ga0501044_0022773 3300049823 Bacteria 6671
891 Ga0501044_0046008 3300049823 Bacteria 4519
892 Ga0501044_0047839 3300049823 Bacteria 4422
893 Ga0501044_0066871 3300049823 Bacteria 3663
894 Ga0501044_0144331 3300049823 Bacteria 2367
895 Ga0501044_0170875 3300049823 Bacteria 2145
896 Ga0501044_0288425 3300049823 Bacteria 1573
897 Ga0501045_0001084 3300049824 Bacteria 17987
898 Ga0501045_0001975 3300049824 Bacteria 13865
899 nmdc:mga03n38_8389_c1 3300050490 Bacteria 3707
900 nmdc:mga00v17_59794_c1 3300050491 Bacteria 2339
901 nmdc:mga0yw44_28208_c1 3300050492 Bacteria 3227
902 nmdc:mga0yw44_28951_c1 3300050492 Bacteria 3192
903 nmdc:mga0yw44_31737_c1 3300050492 Bacteria 3074
904 nmdc:mga0yw44_34879_c1 3300050492 Bacteria 2952
905 nmdc:mga0yw44_79114_c1 3300050492 Bacteria 2057
906 nmdc:mga0yw44_87700_c1 3300050492 Bacteria 1962
907 nmdc:mga06z11_100582_c1 3300050494 Bacteria 1585
908 nmdc:mga05p37_203690_c1 3300050507 Bacteria 2395
909 nmdc:mga05p37_20453_c1 3300050507 Bacteria 8005
910 nmdc:mga09592_192647_c1 3300050508 Bacteria 1765
911 nmdc:mga0qj67_10975_c1 3300050509 Bacteria 6780
912 nmdc:mga0qj67_60210_c1 3300050509 Bacteria 3012
913 nmdc:mga0qj67_82695_c1 3300050509 Bacteria 2575
914 nmdc:mga0qj67_930_c1 3300050509 Bacteria 20158
915 nmdc:mga06r32_158351_c1 3300050510 Bacteria 2246
916 nmdc:mga06r32_34777_c1 3300050510 Bacteria 4753
917 nmdc:mga06r32_38341_c1 3300050510 Bacteria 4540
918 nmdc:mga08y16_215960_c1 3300050511 Bacteria 1986
919 nmdc:mga08y16_4316_c1 3300050511 Bacteria 14850
920 nmdc:mga08y16_55553_c1 3300050511 Bacteria 4137
921 nmdc:mga08y16_60333_c1 3300050511 Unclassified 3962
922 nmdc:mga08y16_738_c1 3300050511 Bacteria 31085
923 nmdc:mga0n895_121065_c1 3300050512 Bacteria 2638
924 nmdc:mga0n895_167961_c1 3300050512 Bacteria 2226
925 nmdc:mga0n895_178316_c1 3300050512 Unclassified 2156
926 nmdc:mga0n895_313274_c1 3300050512 Bacteria 1590
927 nmdc:mga0n895_48732_c1 3300050512 Bacteria 4148
928 nmdc:mga0n895_65635_c1 3300050512 Bacteria 3593
929 nmdc:mga0n895_76804_c1 3300050512 Unclassified 3321
930 nmdc:mga0n895_842_c1 3300050512 Bacteria 22003
931 nmdc:mga0rr50_214062_c1 3300050513 Unclassified 1589
932 nmdc:mga0rr50_2286_c1 3300050513 Bacteria 10743
933 nmdc:mga0rr50_27222_c1 3300050513 Bacteria 3999
934 nmdc:mga0rr50_28329_c1 3300050513 Bacteria 3936
935 nmdc:mga0rr50_67088_c1 3300050513 Bacteria 2724
936 nmdc:mga0a205_32568_c1 3300050515 Bacteria 4997
937 nmdc:mga0sz30_25919_c1 3300050516 Bacteria 2400
938 Ga0495601_0000010 3300053077 Bacteria 266222
939 Ga0495601_0003343 3300053077 Bacteria 9183
940 Ga0495601_0012889 3300053077 Bacteria 5018
941 Ga0495601_0013244 3300053077 Bacteria 4958
942 Ga0495601_0024831 3300053077 Bacteria 3691
943 Ga0495601_0060814 3300053077 Bacteria 2397
944 Ga0495601_0061768 3300053077 Bacteria 2378
945 Ga0495601_0130310 3300053077 Bacteria 1638
946 Ga0495612_0000002 3300053078 Bacteria 310466
947 Ga0495612_0001058 3300053078 Bacteria 11257
948 Ga0495612_0001550 3300053078 Bacteria 9471
949 Ga0495612_0052073 3300053078 Bacteria 1683
950 Ga0495595_0000110 3300053084 Bacteria 37533
951 Ga0495595_0000762 3300053084 Bacteria 12239
952 Ga0495595_0018683 3300053084 Bacteria 2998
953 Ga0495595_0032506 3300053084 Bacteria 2350
954 Ga0495595_0035761 3300053084 Bacteria 2251
955 Ga0495619_0000002 3300053085 Bacteria 530226
956 Ga0495619_0000271 3300053085 Bacteria 37662
957 Ga0495619_0001919 3300053085 Bacteria 13857
958 Ga0495619_0002564 3300053085 Bacteria 11890
959 Ga0495619_0007587 3300053085 Bacteria 6868
960 Ga0495619_0017692 3300053085 Bacteria 4515
961 Ga0495619_0022184 3300053085 Bacteria 4060
962 Ga0495619_0033071 3300053085 Unclassified 3357
963 Ga0495619_0062525 3300053085 Bacteria 2478
964 Ga0500651_0001961 3300053093 Bacteria 10665
965 Ga0500641_0034247 3300053096 Bacteria 2020
966 Ga0500593_052637 3300053117 Bacteria 1803
967 Ga0500595_000062 3300053119 Bacteria 77506
968 Ga0500595_019155 3300053119 Bacteria 2488
969 Ga0500652_000016 3300053131 Bacteria 126768
970 Ga0500652_005922 3300053131 Bacteria 3892
971 Ga0500616_0000006 3300053153 Bacteria 944738
972 Ga0500616_0043385 3300053153 Bacteria 2403
973 Ga0500645_000282 3300053730 Bacteria 36379
974 Ga0501084_0001795 3300054114 Bacteria 17098
975 Ga0501084_0072537 3300054114 Bacteria 2883
976 Ga0501082_0002559 3300060353 Bacteria 15919
977 Ga0530510_0000097 3300061734 Bacteria 47406
978 Ga0530510_0001449 3300061734 Bacteria 15902
979 Ga0530510_0083164 3300061734 Bacteria 2331

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046473 Ga0495582_0196782 Ga0495582_0196782_23_1096 357
2 3300006048 Ga0075363_100089185 Ga0075363_1000891852 360
3 3300050492 nmdc:mga0yw44_87700_c1 nmdc:mga0yw44_87700_c1_397_1620 360
4 3300001991 JGI24743J22301_10001360 JGI24743J22301_100013602 361
5 3300002077 JGI24744J21845_10008543 JGI24744J21845_100085432 361
6 3300005329 Ga0070683_100103835 Ga0070683_1001038352 361
7 3300005330 Ga0070690_100044603 Ga0070690_1000446032 361
8 3300005335 Ga0070666_10033534 Ga0070666_100335343 361
9 3300005338 Ga0068868_100119761 Ga0068868_1001197612 361
10 3300005439 Ga0070711_100147157 Ga0070711_1001471572 361
11 3300005440 Ga0070705_100028007 Ga0070705_1000280073 361
12 3300005459 Ga0068867_100123667 Ga0068867_1001236672 361
13 3300005543 Ga0070672_100142029 Ga0070672_1001420292 361
14 3300005547 Ga0070693_100010607 Ga0070693_1000106072 361
15 3300005614 Ga0068856_100359006 Ga0068856_1003590062 361
16 3300005618 Ga0068864_100012607 Ga0068864_1000126076 361
17 3300005834 Ga0068851_10161546 Ga0068851_101615461 361
18 3300006038 Ga0075365_10051815 Ga0075365_100518152 361
19 3300006237 Ga0097621_100037890 Ga0097621_1000378903 361
20 3300009101 Ga0105247_10003839 Ga0105247_100038399 361
21 3300014968 Ga0157379_10269787 Ga0157379_102697872 361
22 3300014969 Ga0157376_10163553 Ga0157376_101635532 361
23 3300025900 Ga0207710_10055539 Ga0207710_100555392 361
24 3300025901 Ga0207688_10004456 Ga0207688_100044562 361
25 3300025904 Ga0207647_10014236 Ga0207647_100142364 361
26 3300025908 Ga0207643_10001904 Ga0207643_100019048 361
27 3300025918 Ga0207662_10004160 Ga0207662_100041606 361
28 3300025926 Ga0207659_10066360 Ga0207659_100663602 361
29 3300025931 Ga0207644_10014608 Ga0207644_100146082 361
30 3300025932 Ga0207690_10044581 Ga0207690_100445812 361
31 3300025933 Ga0207706_10013650 Ga0207706_100136505 361
32 3300025934 Ga0207686_10027578 Ga0207686_100275784 361
33 3300025937 Ga0207669_10026216 Ga0207669_100262163 361
34 3300025940 Ga0207691_10021468 Ga0207691_100214682 361
35 3300025942 Ga0207689_10039328 Ga0207689_100393283 361
36 3300025944 Ga0207661_10015191 Ga0207661_100151913 361
37 3300025945 Ga0207679_10003395 Ga0207679_100033957 361
38 3300025961 Ga0207712_10019090 Ga0207712_100190904 361
39 3300025986 Ga0207658_10031452 Ga0207658_100314522 361
40 3300026075 Ga0207708_10002015 Ga0207708_1000201514 361
41 3300026088 Ga0207641_10012014 Ga0207641_100120145 361
42 3300026089 Ga0207648_10003124 Ga0207648_1000312414 361
43 3300026095 Ga0207676_10009698 Ga0207676_100096985 361
44 3300026118 Ga0207675_100014980 Ga0207675_1000149805 361
45 3300027907 Ga0207428_10122931 Ga0207428_101229312 361
46 3300028381 Ga0268264_10045619 Ga0268264_100456193 361
47 3300035116 Ga0373945_0008327 Ga0373945_0008327_1628_2794 361
48 3300035170 Ga0373943_0020329 Ga0373943_0020329_1419_2585 361
49 3300035171 Ga0373946_0084295 Ga0373946_0084295_135_1301 361
50 3300046461 Ga0495641_0038095 Ga0495641_0038095_319_1485 361
51 3300046472 Ga0495580_0023974 Ga0495580_0023974_1740_2906 361
52 3300046473 Ga0495582_0028249 Ga0495582_0028249_525_1691 361
53 3300046557 Ga0495622_0060647 Ga0495622_0060647_423_1589 361
54 3300046615 Ga0495656_0060932 Ga0495656_0060932_70_1236 361
55 3300046681 Ga0495647_0006607 Ga0495647_0006607_623_1789 361
56 3300046689 Ga0495613_0155919 Ga0495613_0155919_238_1404 361
57 3300047315 Ga0495581_0011746 Ga0495581_0011746_3028_4194 361
58 3300047446 Ga0495679_025931 Ga0495679_025931_336_1502 361
59 3300048903 Ga0496100_0001161 Ga0496100_0001161_1981_3147 361
60 3300048904 Ga0496101_0014471 Ga0496101_0014471_3035_4201 361
61 3300048906 Ga0496103_0001608 Ga0496103_0001608_12457_13623 361
62 3300048907 Ga0496104_0040929 Ga0496104_0040929_747_1913 361
63 3300048908 Ga0496105_0007809 Ga0496105_0007809_1958_3124 361
64 3300048909 Ga0496106_0004342 Ga0496106_0004342_225_1391 361
65 3300048910 Ga0496107_0000646 Ga0496107_0000646_12980_14146 361
66 3300048911 Ga0496108_0031303 Ga0496108_0031303_3070_4236 361
67 3300048912 Ga0496109_0005620 Ga0496109_0005620_6093_7259 361
68 3300048913 Ga0496110_0028924 Ga0496110_0028924_1919_3085 361
69 3300048914 Ga0496111_0153359 Ga0496111_0153359_179_1345 361
70 3300048916 Ga0496113_0000682 Ga0496113_0000682_3561_4727 361
71 3300048917 Ga0496114_0027379 Ga0496114_0027379_3478_4644 361
72 3300048918 Ga0496115_0001413 Ga0496115_0001413_13026_14192 361
73 3300050492 nmdc:mga0yw44_31737_c1 nmdc:mga0yw44_31737_c1_1044_2258 361
74 3300050511 nmdc:mga08y16_55553_c1 nmdc:mga08y16_55553_c1_2730_3896 361
75 3300053077 Ga0495601_0060814 Ga0495601_0060814_606_1772 361
76 3300049568 Ga0501031_0097875 Ga0501031_0097875_211_1371 362
77 3300049588 Ga0501072_0083789 Ga0501072_0083789_1235_2395 362
78 3300049741 Ga0501079_0179289 Ga0501079_0179289_78_1238 362
79 3300009176 Ga0105242_10132857 Ga0105242_101328572 366
80 3300005985 Ga0081539_10074748 Ga0081539_100747482 367
81 3300035691 Ga0373931_0151827 Ga0373931_0151827_204_1307 367
82 3300049590 Ga0501074_0247900 Ga0501074_0247900_125_1240 367
83 3300046454 Ga0495592_0070656 Ga0495592_0070656_43_1149 368
84 3300046499 Ga0495594_0059828 Ga0495594_0059828_983_2089 368
85 3300046533 Ga0495640_0014607 Ga0495640_0014607_4686_5792 368
86 3300048917 Ga0496114_0173948 Ga0496114_0173948_576_1742 368
87 3300048918 Ga0496115_0212539 Ga0496115_0212539_250_1416 368
88 3300053077 Ga0495601_0012889 Ga0495601_0012889_55_1161 368
89 3300053085 Ga0495619_0022184 Ga0495619_0022184_55_1161 368
90 3300053153 Ga0500616_0043385 Ga0500616_0043385_15_1121 368
91 3300046455 Ga0495603_0109535 Ga0495603_0109535_199_1317 372
92 3300049584 Ga0501068_0009707 Ga0501068_0009707_4238_5371 373
93 3300009545 Ga0105237_10511193 Ga0105237_105111931 378
94 3300009093 Ga0105240_10200443 Ga0105240_102004432 380
95 3300025912 Ga0207707_10061954 Ga0207707_100619543 382
96 3300049570 Ga0501033_0020328 Ga0501033_0020328_1341_2516 386
97 3300049572 Ga0501036_0000124 Ga0501036_0000124_22689_23864 386
98 3300049573 Ga0501037_0023211 Ga0501037_0023211_2390_3565 386
99 3300049574 Ga0501038_0006330 Ga0501038_0006330_3876_5051 386
100 3300049575 Ga0501039_0040389 Ga0501039_0040389_1010_2185 386
101 3300049576 Ga0501040_0000194 Ga0501040_0000194_16917_18092 386
102 3300049577 Ga0501041_0001330 Ga0501041_0001330_316_1491 386
103 3300049578 Ga0501042_0058670 Ga0501042_0058670_22_1197 386
104 3300049579 Ga0501043_0061543 Ga0501043_0061543_1377_2552 386
105 3300049580 Ga0501046_0000501 Ga0501046_0000501_12852_14027 386
106 3300049580 Ga0501046_0058359 Ga0501046_0058359_517_1683 386
107 3300049581 Ga0501047_0012811 Ga0501047_0012811_5470_6636 386
108 3300049587 Ga0501071_0004671 Ga0501071_0004671_752_1927 386
109 3300049588 Ga0501072_0000412 Ga0501072_0000412_16511_17686 386
110 3300049589 Ga0501073_0058146 Ga0501073_0058146_493_1668 386
111 3300049590 Ga0501074_0029915 Ga0501074_0029915_1354_2529 386
112 3300049591 Ga0501075_0000046 Ga0501075_0000046_48094_49269 386
113 3300049593 Ga0501077_0002139 Ga0501077_0002139_9754_10929 386
114 3300049741 Ga0501079_0011365 Ga0501079_0011365_4902_6077 386
115 3300049742 Ga0501080_0018292 Ga0501080_0018292_2997_4163 386
116 3300049742 Ga0501080_0058906 Ga0501080_0058906_1632_2807 386
117 3300049743 Ga0501081_0000517 Ga0501081_0000517_4370_5545 386
118 3300049823 Ga0501044_0066871 Ga0501044_0066871_1904_3070 386
119 3300049823 Ga0501044_0288425 Ga0501044_0288425_286_1461 386
120 3300049824 Ga0501045_0001084 Ga0501045_0001084_4426_5601 386
121 3300054114 Ga0501084_0072537 Ga0501084_0072537_1308_2483 386
122 3300061734 Ga0530510_0001449 Ga0530510_0001449_1024_2199 386
123 3300005530 Ga0070679_100057996 Ga0070679_1000579964 387
124 3300006847 Ga0075431_100186739 Ga0075431_1001867393 387
125 3300006880 Ga0075429_100038157 Ga0075429_1000381573 387
126 3300007788 Ga0099795_10000065 Ga0099795_100000659 387
127 3300025906 Ga0207699_10162760 Ga0207699_101627602 387
128 3300025921 Ga0207652_10045443 Ga0207652_100454432 387
129 3300027665 Ga0209983_1004225 Ga0209983_10042253 387
130 3300027682 Ga0209971_1009585 Ga0209971_10095852 387
131 3300028556 Ga0265337_1002095 Ga0265337_10020957 387
132 3300028573 Ga0265334_10002101 Ga0265334_100021019 387
133 3300028800 Ga0265338_10016636 Ga0265338_100166364 387
134 3300042003 Ga0439443_000439 Ga0439443_000439_16_1224 387
135 3300042437 Ga0439444_0000655 Ga0439444_0000655_2015_3223 387
136 3300042461 Ga0439460_0005185 Ga0439460_0005185_1183_2391 387
137 3300042461 Ga0439460_0027028 Ga0439460_0027028_51_1229 387
138 3300046459 Ga0495629_0114884 Ga0495629_0114884_306_1469 387
139 3300046472 Ga0495580_0047493 Ga0495580_0047493_1820_2983 387
140 3300046531 Ga0495665_0012467 Ga0495665_0012467_3115_4278 387
141 3300046535 Ga0495586_0058039 Ga0495586_0058039_285_1448 387
142 3300046642 Ga0495634_0035176 Ga0495634_0035176_370_1533 387
143 3300049574 Ga0501038_0056279 Ga0501038_0056279_178_1356 387
144 3300049575 Ga0501039_0019747 Ga0501039_0019747_1034_2212 387
145 3300049576 Ga0501040_0109933 Ga0501040_0109933_590_1768 387
146 3300049577 Ga0501041_0016275 Ga0501041_0016275_1236_2414 387
147 3300049578 Ga0501042_0042626 Ga0501042_0042626_1977_3155 387
148 3300049578 Ga0501042_0102899 Ga0501042_0102899_447_1625 387
149 3300049580 Ga0501046_0016004 Ga0501046_0016004_2970_4148 387
150 3300049587 Ga0501071_0011158 Ga0501071_0011158_2201_3379 387
151 3300049588 Ga0501072_0003559 Ga0501072_0003559_4659_5837 387
152 3300049590 Ga0501074_0106604 Ga0501074_0106604_787_1965 387
153 3300049591 Ga0501075_0006556 Ga0501075_0006556_2593_3771 387
154 3300049592 Ga0501076_0000768 Ga0501076_0000768_13616_14794 387
155 3300049593 Ga0501077_0037790 Ga0501077_0037790_1300_2478 387
156 3300049741 Ga0501079_0007157 Ga0501079_0007157_3084_4262 387
157 3300049743 Ga0501081_0005416 Ga0501081_0005416_2964_4142 387
158 3300049822 Ga0501035_0255409 Ga0501035_0255409_196_1374 387
159 3300049824 Ga0501045_0001975 Ga0501045_0001975_10419_11597 387
160 3300050508 nmdc:mga09592_192647_c1 nmdc:mga09592_192647_c1_76_1254 387
161 3300050509 nmdc:mga0qj67_82695_c1 nmdc:mga0qj67_82695_c1_896_2074 387
162 3300054114 Ga0501084_0001795 Ga0501084_0001795_3369_4547 387
163 3300060353 Ga0501082_0002559 Ga0501082_0002559_12114_13292 387
164 3300061734 Ga0530510_0000097 Ga0530510_0000097_20609_21787 387
165 3300003659 JGI25404J52841_10000611 JGI25404J52841_100006111 388
166 3300005327 Ga0070658_10206441 Ga0070658_102064411 388
167 3300005331 Ga0070670_100011345 Ga0070670_1000113452 388
168 3300005336 Ga0070680_100015993 Ga0070680_1000159931 388
169 3300005340 Ga0070689_100043423 Ga0070689_1000434233 388
170 3300005354 Ga0070675_100152209 Ga0070675_1001522091 388
171 3300005435 Ga0070714_100359436 Ga0070714_1003594361 388
172 3300005438 Ga0070701_10036265 Ga0070701_100362653 388
173 3300005458 Ga0070681_10001364 Ga0070681_1000136415 388
174 3300005530 Ga0070679_100000512 Ga0070679_1000005124 388
175 3300005577 Ga0068857_100124549 Ga0068857_1001245493 388
176 3300005841 Ga0068863_100144226 Ga0068863_1001442262 388
177 3300005937 Ga0081455_10002005 Ga0081455_100020053 388
178 3300005983 Ga0081540_1000001 Ga0081540_1000001178 388
179 3300005983 Ga0081540_1014473 Ga0081540_10144733 388
180 3300005983 Ga0081540_1054104 Ga0081540_10541042 388
181 3300005985 Ga0081539_10010875 Ga0081539_100108752 388
182 3300006038 Ga0075365_10007896 Ga0075365_100078966 388
183 3300006038 Ga0075365_10151866 Ga0075365_101518662 388
184 3300006186 Ga0075369_10022612 Ga0075369_100226122 388
185 3300006844 Ga0075428_100184226 Ga0075428_1001842261 388
186 3300006844 Ga0075428_100195351 Ga0075428_1001953512 388
187 3300006846 Ga0075430_100000476 Ga0075430_10000047612 388
188 3300006847 Ga0075431_100306184 Ga0075431_1003061841 388
189 3300006871 Ga0075434_100068480 Ga0075434_1000684803 388
190 3300006871 Ga0075434_100078639 Ga0075434_1000786393 388
191 3300006880 Ga0075429_100101556 Ga0075429_1001015561 388
192 3300007076 Ga0075435_100003932 Ga0075435_1000039323 388
193 3300007265 Ga0099794_10014583 Ga0099794_100145833 388
194 3300009093 Ga0105240_10134204 Ga0105240_101342043 388
195 3300009094 Ga0111539_10268889 Ga0111539_102688892 388
196 3300009147 Ga0114129_10207613 Ga0114129_102076131 388
197 3300010375 Ga0105239_10369213 Ga0105239_103692132 388
198 3300011119 Ga0105246_10189296 Ga0105246_101892961 388
199 3300013104 Ga0157370_10004500 Ga0157370_1000450011 388
200 3300013105 Ga0157369_10005666 Ga0157369_1000566611 388
201 3300014325 Ga0163163_10011189 Ga0163163_100111896 388
202 3300014326 Ga0157380_10119042 Ga0157380_101190421 388
203 3300014497 Ga0182008_10005672 Ga0182008_100056724 388
204 3300021384 Ga0213876_10050387 Ga0213876_100503872 388
205 3300025903 Ga0207680_10006371 Ga0207680_100063713 388
206 3300025907 Ga0207645_10145884 Ga0207645_101458841 388
207 3300025915 Ga0207693_10018018 Ga0207693_100180181 388
208 3300025915 Ga0207693_10020784 Ga0207693_100207843 388
209 3300025917 Ga0207660_10041014 Ga0207660_100410143 388
210 3300025921 Ga0207652_10032435 Ga0207652_100324354 388
211 3300025925 Ga0207650_10112041 Ga0207650_101120412 388
212 3300025928 Ga0207700_10077925 Ga0207700_100779252 388
213 3300025932 Ga0207690_10025916 Ga0207690_100259162 388
214 3300025945 Ga0207679_10326299 Ga0207679_103262992 388
215 3300027907 Ga0207428_10166664 Ga0207428_101666642 388
216 3300031241 Ga0265325_10010060 Ga0265325_100100605 388
217 3300031595 Ga0265313_10000106 Ga0265313_100001065 388
218 3300032002 Ga0307416_100339168 Ga0307416_1003391682 388
219 3300035083 Ga0373926_0022850 Ga0373926_0022850_432_1598 388
220 3300035083 Ga0373926_0026611 Ga0373926_0026611_483_1649 388
221 3300035086 Ga0373934_0018802 Ga0373934_0018802_163_1329 388
222 3300035089 Ga0373944_0006563 Ga0373944_0006563_1801_2967 388
223 3300035113 Ga0373936_0004882 Ga0373936_0004882_420_1586 388
224 3300035114 Ga0373939_0042053 Ga0373939_0042053_97_1263 388
225 3300035116 Ga0373945_0008419 Ga0373945_0008419_1135_2301 388
226 3300035116 Ga0373945_0020000 Ga0373945_0020000_348_1514 388
227 3300035117 Ga0373953_0000785 Ga0373953_0000785_6252_7418 388
228 3300035118 Ga0373954_0000969 Ga0373954_0000969_1451_2617 388
229 3300035119 Ga0373956_0054836 Ga0373956_0054836_499_1665 388
230 3300035170 Ga0373943_0000306 Ga0373943_0000306_17458_18624 388
231 3300035170 Ga0373943_0001944 Ga0373943_0001944_2729_3895 388
232 3300035171 Ga0373946_0022197 Ga0373946_0022197_971_2137 388
233 3300035171 Ga0373946_0026560 Ga0373946_0026560_887_2053 388
234 3300035172 Ga0373955_0000039 Ga0373955_0000039_20521_21687 388
235 3300035242 Ga0373962_0006957 Ga0373962_0006957_808_1974 388
236 3300035692 Ga0373935_0000079 Ga0373935_0000079_29244_30410 388
237 3300035692 Ga0373935_0010573 Ga0373935_0010573_4294_5460 388
238 3300035695 Ga0373927_0013767 Ga0373927_0013767_3680_4846 388
239 3300035695 Ga0373927_0023394 Ga0373927_0023394_523_1689 388
240 3300035695 Ga0373927_0029598 Ga0373927_0029598_2011_3177 388
241 3300035724 Ga0373933_0004704 Ga0373933_0004704_5569_6735 388
242 3300035724 Ga0373933_0101185 Ga0373933_0101185_37_1221 388
243 3300035725 Ga0373947_0001044 Ga0373947_0001044_2737_3903 388
244 3300035725 Ga0373947_0013808 Ga0373947_0013808_2862_4028 388
245 3300036401 Ga0373937_0000223 Ga0373937_0000223_14051_15217 388
246 3300036401 Ga0373937_0003786 Ga0373937_0003786_6337_7503 388
247 3300036401 Ga0373937_0029554 Ga0373937_0029554_1869_3182 388
248 3300036401 Ga0373937_0112702 Ga0373937_0112702_911_2077 388
249 3300036401 Ga0373937_0307400 Ga0373937_0307400_260_1426 388
250 3300037068 Ga0373925_0000002 Ga0373925_0000002_344462_345628 388
251 3300037068 Ga0373925_0005123 Ga0373925_0005123_5416_6582 388
252 3300037068 Ga0373925_0036705 Ga0373925_0036705_54_1220 388
253 3300037853 Ga0436364_0562385 Ga0436364_0562385_2215_3435 388
254 3300039437 Ga0436365_1407541 Ga0436365_1407541_7935_9101 388
255 3300039450 Ga0436363_0889203 Ga0436363_0889203_138_1304 388
256 3300044694 Ga0466963_0055121 Ga0466963_0055121_1246_2412 388
257 3300045049 Ga0466959_0027730 Ga0466959_0027730_643_1809 388
258 3300045836 Ga0466958_0036333 Ga0466958_0036333_726_1892 388
259 3300045976 Ga0466967_0075883 Ga0466967_0075883_1237_2415 388
260 3300045976 Ga0466967_0102678 Ga0466967_0102678_891_2234 388
261 3300046454 Ga0495592_0000475 Ga0495592_0000475_17322_18488 388
262 3300046459 Ga0495629_0025089 Ga0495629_0025089_1744_2910 388
263 3300046462 Ga0495651_0005638 Ga0495651_0005638_2295_3461 388
264 3300046463 Ga0495653_0000006 Ga0495653_0000006_344610_345776 388
265 3300046472 Ga0495580_0034407 Ga0495580_0034407_374_1540 388
266 3300046476 Ga0495662_0001482 Ga0495662_0001482_9702_10868 388
267 3300046476 Ga0495662_0008512 Ga0495662_0008512_3425_4591 388
268 3300046477 Ga0495664_0000002 Ga0495664_0000002_380244_381410 388
269 3300046477 Ga0495664_0000553 Ga0495664_0000553_9499_10665 388
270 3300046491 Ga0495584_0011722 Ga0495584_0011722_276_1442 388
271 3300046511 Ga0495608_0000009 Ga0495608_0000009_99025_100191 388
272 3300046514 Ga0495618_0000005 Ga0495618_0000005_157603_158769 388
273 3300046514 Ga0495618_0002320 Ga0495618_0002320_7380_8546 388
274 3300046514 Ga0495618_0087504 Ga0495618_0087504_319_1485 388
275 3300046516 Ga0495628_0000002 Ga0495628_0000002_344629_345795 388
276 3300046517 Ga0495630_0000240 Ga0495630_0000240_36247_37413 388
277 3300046517 Ga0495630_0055666 Ga0495630_0055666_1262_2428 388
278 3300046517 Ga0495630_0270771 Ga0495630_0270771_113_1279 388
279 3300046529 Ga0495652_0000004 Ga0495652_0000004_243088_244254 388
280 3300046529 Ga0495652_0015928 Ga0495652_0015928_2625_3791 388
281 3300046531 Ga0495665_0004921 Ga0495665_0004921_599_1765 388
282 3300046533 Ga0495640_0000005 Ga0495640_0000005_99040_100206 388
283 3300046533 Ga0495640_0008496 Ga0495640_0008496_3100_4266 388
284 3300046535 Ga0495586_0058565 Ga0495586_0058565_606_1772 388
285 3300046536 Ga0495587_0000007 Ga0495587_0000007_218036_219202 388
286 3300046543 Ga0495645_0000003 Ga0495645_0000003_325880_327046 388
287 3300046543 Ga0495645_0025774 Ga0495645_0025774_363_1529 388
288 3300046559 Ga0495667_0000002 Ga0495667_0000002_91928_93094 388
289 3300046615 Ga0495656_0091601 Ga0495656_0091601_96_1262 388
290 3300046642 Ga0495634_0000129 Ga0495634_0000129_10896_12062 388
291 3300046642 Ga0495634_0008810 Ga0495634_0008810_3533_4699 388
292 3300046642 Ga0495634_0141283 Ga0495634_0141283_269_1435 388
293 3300046663 Ga0495635_0000020 Ga0495635_0000020_154002_155168 388
294 3300046663 Ga0495635_0002623 Ga0495635_0002623_3881_5047 388
295 3300046678 Ga0495599_0000001 Ga0495599_0000001_483307_484473 388
296 3300046679 Ga0495623_0000001 Ga0495623_0000001_252252_253418 388
297 3300046680 Ga0495646_0000013 Ga0495646_0000013_102885_104051 388
298 3300046681 Ga0495647_0025809 Ga0495647_0025809_531_1697 388
299 3300046683 Ga0495658_0010561 Ga0495658_0010561_541_1707 388
300 3300046689 Ga0495613_0017049 Ga0495613_0017049_2696_3862 388
301 3300046689 Ga0495613_0028418 Ga0495613_0028418_1155_2321 388
302 3300046689 Ga0495613_0134125 Ga0495613_0134125_362_1528 388
303 3300046690 Ga0495624_0004432 Ga0495624_0004432_5040_6206 388
304 3300046690 Ga0495624_0005773 Ga0495624_0005773_4265_5431 388
305 3300046692 Ga0495671_0124558 Ga0495671_0124558_73_1239 388
306 3300046809 Ga0495600_0000041 Ga0495600_0000041_61874_63040 388
307 3300047315 Ga0495581_0003767 Ga0495581_0003767_6400_7566 388
308 3300047315 Ga0495581_0046261 Ga0495581_0046261_291_1457 388
309 3300047317 Ga0495604_0000005 Ga0495604_0000005_370273_371439 388
310 3300047317 Ga0495604_0127480 Ga0495604_0127480_175_1341 388
311 3300047319 Ga0495674_0000003 Ga0495674_0000003_216331_217497 388
312 3300047319 Ga0495674_0003325 Ga0495674_0003325_6096_7262 388
313 3300047321 Ga0495676_0036509 Ga0495676_0036509_1083_2249 388
314 3300047322 Ga0495680_0000002 Ga0495680_0000002_147696_148862 388
315 3300047444 Ga0495675_0000383 Ga0495675_0000383_22356_23522 388
316 3300047471 Ga0495684_0000020 Ga0495684_0000020_94289_95455 388
317 3300047471 Ga0495684_0001619 Ga0495684_0001619_7314_8480 388
318 3300047471 Ga0495684_0008545 Ga0495684_0008545_3225_4391 388
319 3300047471 Ga0495684_0096579 Ga0495684_0096579_1017_2183 388
320 3300047673 Ga0495593_0001985 Ga0495593_0001985_8534_9700 388
321 3300047673 Ga0495593_0097929 Ga0495593_0097929_104_1270 388
322 3300048088 Ga0495602_0000027 Ga0495602_0000027_72189_73355 388
323 3300048903 Ga0496100_0143964 Ga0496100_0143964_467_1633 388
324 3300048905 Ga0496102_0002863 Ga0496102_0002863_12698_13864 388
325 3300048907 Ga0496104_0001130 Ga0496104_0001130_10229_11395 388
326 3300048907 Ga0496104_0015135 Ga0496104_0015135_4833_5999 388
327 3300048907 Ga0496104_0021724 Ga0496104_0021724_1981_3147 388
328 3300048907 Ga0496104_0179542 Ga0496104_0179542_788_1987 388
329 3300048908 Ga0496105_0002424 Ga0496105_0002424_8105_9271 388
330 3300048908 Ga0496105_0003830 Ga0496105_0003830_5323_6489 388
331 3300048908 Ga0496105_0172991 Ga0496105_0172991_183_1352 388
332 3300048909 Ga0496106_0019354 Ga0496106_0019354_835_2001 388
333 3300048911 Ga0496108_0006587 Ga0496108_0006587_3402_4568 388
334 3300048912 Ga0496109_0010007 Ga0496109_0010007_2107_3273 388
335 3300048914 Ga0496111_0004597 Ga0496111_0004597_3855_5021 388
336 3300048915 Ga0496112_0011362 Ga0496112_0011362_4855_6021 388
337 3300048916 Ga0496113_0005126 Ga0496113_0005126_2107_3273 388
338 3300048917 Ga0496114_0005823 Ga0496114_0005823_3412_4611 388
339 3300048917 Ga0496114_0031377 Ga0496114_0031377_1624_2790 388
340 3300049569 Ga0501032_0022662 Ga0501032_0022662_1920_3098 388
341 3300049569 Ga0501032_0037377 Ga0501032_0037377_1570_2748 388
342 3300049570 Ga0501033_0005800 Ga0501033_0005800_1695_2861 388
343 3300049571 Ga0501034_0000247 Ga0501034_0000247_48178_49356 388
344 3300049571 Ga0501034_0001519 Ga0501034_0001519_23300_24478 388
345 3300049571 Ga0501034_0027708 Ga0501034_0027708_4201_5367 388
346 3300049571 Ga0501034_0060022 Ga0501034_0060022_100_1266 388
347 3300049571 Ga0501034_0093689 Ga0501034_0093689_1088_2266 388
348 3300049572 Ga0501036_0001768 Ga0501036_0001768_8973_10151 388
349 3300049572 Ga0501036_0028767 Ga0501036_0028767_1447_2625 388
350 3300049572 Ga0501036_0146536 Ga0501036_0146536_547_1725 388
351 3300049573 Ga0501037_0005176 Ga0501037_0005176_4569_5747 388
352 3300049573 Ga0501037_0039212 Ga0501037_0039212_1237_2403 388
353 3300049574 Ga0501038_0018465 Ga0501038_0018465_1409_2587 388
354 3300049574 Ga0501038_0040136 Ga0501038_0040136_1768_2946 388
355 3300049574 Ga0501038_0041971 Ga0501038_0041971_2321_3499 388
356 3300049574 Ga0501038_0069953 Ga0501038_0069953_280_1458 388
357 3300049574 Ga0501038_0104008 Ga0501038_0104008_123_1289 388
358 3300049575 Ga0501039_0012756 Ga0501039_0012756_726_1904 388
359 3300049575 Ga0501039_0030461 Ga0501039_0030461_2853_4019 388
360 3300049575 Ga0501039_0076368 Ga0501039_0076368_863_2041 388
361 3300049576 Ga0501040_0019715 Ga0501040_0019715_2964_4142 388
362 3300049579 Ga0501043_0001829 Ga0501043_0001829_5100_6278 388
363 3300049579 Ga0501043_0046400 Ga0501043_0046400_1678_2856 388
364 3300049579 Ga0501043_0074181 Ga0501043_0074181_949_2127 388
365 3300049580 Ga0501046_0041776 Ga0501046_0041776_614_1792 388
366 3300049580 Ga0501046_0091010 Ga0501046_0091010_529_1707 388
367 3300049581 Ga0501047_0000010 Ga0501047_0000010_174882_176060 388
368 3300049581 Ga0501047_0011285 Ga0501047_0011285_6338_7504 388
369 3300049581 Ga0501047_0047155 Ga0501047_0047155_1333_2511 388
370 3300049582 Ga0501048_0000554 Ga0501048_0000554_16403_17581 388
371 3300049584 Ga0501068_0062183 Ga0501068_0062183_529_1707 388
372 3300049586 Ga0501070_0029949 Ga0501070_0029949_206_1372 388
373 3300049586 Ga0501070_0036241 Ga0501070_0036241_2652_3830 388
374 3300049586 Ga0501070_0050777 Ga0501070_0050777_2056_3234 388
375 3300049586 Ga0501070_0084146 Ga0501070_0084146_12_1190 388
376 3300049588 Ga0501072_0053922 Ga0501072_0053922_774_1952 388
377 3300049589 Ga0501073_0027991 Ga0501073_0027991_2106_3284 388
378 3300049590 Ga0501074_0018217 Ga0501074_0018217_1831_3009 388
379 3300049591 Ga0501075_0066325 Ga0501075_0066325_521_1687 388
380 3300049592 Ga0501076_0266446 Ga0501076_0266446_84_1250 388
381 3300049593 Ga0501077_0061505 Ga0501077_0061505_989_2155 388
382 3300049741 Ga0501079_0020439 Ga0501079_0020439_2329_3507 388
383 3300049741 Ga0501079_0125432 Ga0501079_0125432_564_1742 388
384 3300049742 Ga0501080_0000100 Ga0501080_0000100_10005_11183 388
385 3300049744 Ga0501083_0003213 Ga0501083_0003213_6509_7687 388
386 3300049822 Ga0501035_0056982 Ga0501035_0056982_1435_2613 388
387 3300049822 Ga0501035_0061789 Ga0501035_0061789_436_1602 388
388 3300049822 Ga0501035_0258253 Ga0501035_0258253_108_1286 388
389 3300049823 Ga0501044_0022356 Ga0501044_0022356_1298_2464 388
390 3300049823 Ga0501044_0022773 Ga0501044_0022773_4072_5250 388
391 3300049823 Ga0501044_0046008 Ga0501044_0046008_2412_3590 388
392 3300049823 Ga0501044_0047839 Ga0501044_0047839_2859_4037 388
393 3300049823 Ga0501044_0144331 Ga0501044_0144331_334_1512 388
394 3300049823 Ga0501044_0170875 Ga0501044_0170875_930_2108 388
395 3300050491 nmdc:mga00v17_59794_c1 nmdc:mga00v17_59794_c1_1137_2303 388
396 3300050492 nmdc:mga0yw44_28208_c1 nmdc:mga0yw44_28208_c1_524_1690 388
397 3300050492 nmdc:mga0yw44_28951_c1 nmdc:mga0yw44_28951_c1_406_1572 388
398 3300050492 nmdc:mga0yw44_34879_c1 nmdc:mga0yw44_34879_c1_643_1809 388
399 3300050492 nmdc:mga0yw44_79114_c1 nmdc:mga0yw44_79114_c1_493_1725 388
400 3300050507 nmdc:mga05p37_203690_c1 nmdc:mga05p37_203690_c1_844_2088 388
401 3300050507 nmdc:mga05p37_20453_c1 nmdc:mga05p37_20453_c1_3287_4453 388
402 3300050509 nmdc:mga0qj67_60210_c1 nmdc:mga0qj67_60210_c1_317_1630 388
403 3300050509 nmdc:mga0qj67_930_c1 nmdc:mga0qj67_930_c1_4773_5939 388
404 3300050510 nmdc:mga06r32_158351_c1 nmdc:mga06r32_158351_c1_406_1575 388
405 3300050510 nmdc:mga06r32_34777_c1 nmdc:mga06r32_34777_c1_1458_2762 388
406 3300050510 nmdc:mga06r32_38341_c1 nmdc:mga06r32_38341_c1_2002_3168 388
407 3300050511 nmdc:mga08y16_215960_c1 nmdc:mga08y16_215960_c1_792_1958 388
408 3300050511 nmdc:mga08y16_60333_c1 nmdc:mga08y16_60333_c1_840_2009 388
409 3300050512 nmdc:mga0n895_167961_c1 nmdc:mga0n895_167961_c1_84_1250 388
410 3300050512 nmdc:mga0n895_48732_c1 nmdc:mga0n895_48732_c1_2102_3277 388
411 3300050512 nmdc:mga0n895_65635_c1 nmdc:mga0n895_65635_c1_352_1518 388
412 3300050512 nmdc:mga0n895_76804_c1 nmdc:mga0n895_76804_c1_321_1487 388
413 3300050513 nmdc:mga0rr50_2286_c1 nmdc:mga0rr50_2286_c1_1268_2449 388
414 3300050513 nmdc:mga0rr50_28329_c1 nmdc:mga0rr50_28329_c1_2185_3351 388
415 3300050516 nmdc:mga0sz30_25919_c1 nmdc:mga0sz30_25919_c1_376_1608 388
416 3300053077 Ga0495601_0000010 Ga0495601_0000010_243042_244208 388
417 3300053077 Ga0495601_0003343 Ga0495601_0003343_163_1329 388
418 3300053078 Ga0495612_0000002 Ga0495612_0000002_256225_257391 388
419 3300053078 Ga0495612_0001550 Ga0495612_0001550_5970_7136 388
420 3300053084 Ga0495595_0000110 Ga0495595_0000110_14481_15647 388
421 3300053085 Ga0495619_0000002 Ga0495619_0000002_344632_345798 388
422 3300053085 Ga0495619_0001919 Ga0495619_0001919_3354_4520 388
423 3300053085 Ga0495619_0017692 Ga0495619_0017692_557_1723 388
424 3300053096 Ga0500641_0034247 Ga0500641_0034247_642_1808 388
425 3300061734 Ga0530510_0083164 Ga0530510_0083164_278_1444 388
426 2209111006 2214911850 2213970326 389
427 3300000043 ARcpr5yngRDRAFT_c000600 ARcpr5yngRDRAFT_0006003 389
428 3300000044 ARSoilOldRDRAFT_c000023 ARSoilOldRDRAFT_00002321 389
429 3300000045 ARCol0oldRDRAFT_c00462 ARCol0oldRDRAFT_004623 389
430 3300000652 ARCol0yngRDRAFT_1000216 ARCol0yngRDRAFT_10002163 389
431 3300001430 JGI24032J14994_100292 JGI24032J14994_1002922 389
432 3300001977 JGI24746J21847_1000047 JGI24746J21847_10000477 389
433 3300001989 JGI24739J22299_10000148 JGI24739J22299_1000014810 389
434 3300001990 JGI24737J22298_10000458 JGI24737J22298_100004586 389
435 3300001990 JGI24737J22298_10003428 JGI24737J22298_100034285 389
436 3300002070 JGI24750J21931_1000011 JGI24750J21931_10000119 389
437 3300002075 JGI24738J21930_10000236 JGI24738J21930_100002367 389
438 3300002076 JGI24749J21850_1000378 JGI24749J21850_10003785 389
439 3300002077 JGI24744J21845_10010109 JGI24744J21845_100101092 389
440 3300002126 JGI24035J26624_1001314 JGI24035J26624_10013142 389
441 3300002155 JGI24033J26618_1001259 JGI24033J26618_10012591 389
442 3300002239 JGI24034J26672_10000483 JGI24034J26672_100004835 389
443 3300002244 JGI24742J22300_10000248 JGI24742J22300_100002484 389
444 3300002459 JGI24751J29686_10007458 JGI24751J29686_100074582 389
445 3300005277 Ga0065716_1002142 Ga0065716_10021422 389
446 3300005290 Ga0065712_10072517 Ga0065712_100725175 389
447 3300005290 Ga0065712_10077915 Ga0065712_100779152 389
448 3300005293 Ga0065715_10001564 Ga0065715_1000156410 389
449 3300005293 Ga0065715_10088960 Ga0065715_1008896012 389
450 3300005293 Ga0065715_10146095 Ga0065715_101460952 389
451 3300005327 Ga0070658_10287789 Ga0070658_102877891 389
452 3300005328 Ga0070676_10000536 Ga0070676_1000053615 389
453 3300005329 Ga0070683_100000144 Ga0070683_10000014419 389
454 3300005330 Ga0070690_100001428 Ga0070690_1000014282 389
455 3300005330 Ga0070690_100028441 Ga0070690_1000284413 389
456 3300005331 Ga0070670_100000437 Ga0070670_10000043714 389
457 3300005333 Ga0070677_10008501 Ga0070677_100085013 389
458 3300005334 Ga0068869_100000035 Ga0068869_10000003518 389
459 3300005335 Ga0070666_10006881 Ga0070666_100068815 389
460 3300005335 Ga0070666_10033695 Ga0070666_100336951 389
461 3300005336 Ga0070680_100001482 Ga0070680_1000014829 389
462 3300005336 Ga0070680_100010932 Ga0070680_1000109322 389
463 3300005336 Ga0070680_100023460 Ga0070680_1000234605 389
464 3300005337 Ga0070682_100002219 Ga0070682_1000022193 389
465 3300005337 Ga0070682_100013572 Ga0070682_1000135723 389
466 3300005338 Ga0068868_100001888 Ga0068868_10000188814 389
467 3300005339 Ga0070660_100001344 Ga0070660_1000013445 389
468 3300005339 Ga0070660_100008614 Ga0070660_1000086146 389
469 3300005340 Ga0070689_100000207 Ga0070689_10000020735 389
470 3300005340 Ga0070689_100068592 Ga0070689_1000685922 389
471 3300005341 Ga0070691_10001234 Ga0070691_100012343 389
472 3300005343 Ga0070687_100000261 Ga0070687_10000026118 389
473 3300005344 Ga0070661_100000017 Ga0070661_10000001729 389
474 3300005345 Ga0070692_10000008 Ga0070692_100000084 389
475 3300005347 Ga0070668_100000699 Ga0070668_10000069915 389
476 3300005347 Ga0070668_100062678 Ga0070668_1000626782 389
477 3300005353 Ga0070669_100000250 Ga0070669_10000025020 389
478 3300005353 Ga0070669_100078587 Ga0070669_1000785872 389
479 3300005354 Ga0070675_100000246 Ga0070675_1000002463 389
480 3300005355 Ga0070671_100003025 Ga0070671_1000030252 389
481 3300005356 Ga0070674_100000355 Ga0070674_10000035519 389
482 3300005364 Ga0070673_100000032 Ga0070673_10000003214 389
483 3300005364 Ga0070673_100037972 Ga0070673_1000379724 389
484 3300005365 Ga0070688_100000669 Ga0070688_1000006693 389
485 3300005366 Ga0070659_100000214 Ga0070659_10000021421 389
486 3300005366 Ga0070659_100009561 Ga0070659_1000095617 389
487 3300005367 Ga0070667_100000816 Ga0070667_10000081623 389
488 3300005367 Ga0070667_100067811 Ga0070667_1000678114 389
489 3300005367 Ga0070667_100135426 Ga0070667_1001354261 389
490 3300005406 Ga0070703_10003001 Ga0070703_100030014 389
491 3300005434 Ga0070709_10008980 Ga0070709_100089805 389
492 3300005435 Ga0070714_100057751 Ga0070714_1000577514 389
493 3300005436 Ga0070713_100020676 Ga0070713_1000206765 389
494 3300005437 Ga0070710_10033187 Ga0070710_100331872 389
495 3300005438 Ga0070701_10000099 Ga0070701_1000009923 389
496 3300005438 Ga0070701_10056293 Ga0070701_100562932 389
497 3300005440 Ga0070705_100002586 Ga0070705_1000025863 389
498 3300005440 Ga0070705_100052781 Ga0070705_1000527812 389
499 3300005441 Ga0070700_100000234 Ga0070700_10000023413 389
500 3300005441 Ga0070700_100005017 Ga0070700_1000050172 389
501 3300005444 Ga0070694_100000247 Ga0070694_10000024711 389
502 3300005455 Ga0070663_100000201 Ga0070663_1000002019 389
503 3300005456 Ga0070678_100003298 Ga0070678_1000032982 389
504 3300005456 Ga0070678_100015873 Ga0070678_1000158733 389
505 3300005457 Ga0070662_100009709 Ga0070662_1000097093 389
506 3300005457 Ga0070662_100010369 Ga0070662_1000103693 389
507 3300005457 Ga0070662_100042269 Ga0070662_1000422693 389
508 3300005458 Ga0070681_10000401 Ga0070681_1000040120 389
509 3300005458 Ga0070681_10332233 Ga0070681_103322332 389
510 3300005459 Ga0068867_100000190 Ga0068867_10000019027 389
511 3300005466 Ga0070685_10009054 Ga0070685_100090545 389
512 3300005468 Ga0070707_100187753 Ga0070707_1001877532 389
513 3300005530 Ga0070679_100000847 Ga0070679_10000084710 389
514 3300005530 Ga0070679_100025113 Ga0070679_1000251137 389
515 3300005530 Ga0070679_100177188 Ga0070679_1001771882 389
516 3300005535 Ga0070684_100000904 Ga0070684_10000090412 389
517 3300005535 Ga0070684_100061415 Ga0070684_1000614153 389
518 3300005539 Ga0068853_100003019 Ga0068853_10000301911 389
519 3300005539 Ga0068853_100023115 Ga0068853_1000231152 389
520 3300005543 Ga0070672_100000807 Ga0070672_10000080712 389
521 3300005544 Ga0070686_100010404 Ga0070686_1000104045 389
522 3300005544 Ga0070686_100033721 Ga0070686_1000337212 389
523 3300005545 Ga0070695_100000406 Ga0070695_10000040620 389
524 3300005545 Ga0070695_100011865 Ga0070695_1000118654 389
525 3300005545 Ga0070695_100014581 Ga0070695_1000145812 389
526 3300005546 Ga0070696_100000304 Ga0070696_10000030415 389
527 3300005546 Ga0070696_100064387 Ga0070696_1000643873 389
528 3300005547 Ga0070693_100000546 Ga0070693_10000054612 389
529 3300005547 Ga0070693_100062362 Ga0070693_1000623622 389
530 3300005549 Ga0070704_100000385 Ga0070704_10000038512 389
531 3300005549 Ga0070704_100003857 Ga0070704_1000038572 389
532 3300005563 Ga0068855_100019930 Ga0068855_1000199306 389
533 3300005563 Ga0068855_100222335 Ga0068855_1002223352 389
534 3300005564 Ga0070664_100000912 Ga0070664_10000091213 389
535 3300005577 Ga0068857_100000494 Ga0068857_10000049410 389
536 3300005577 Ga0068857_100209625 Ga0068857_1002096252 389
537 3300005578 Ga0068854_100000139 Ga0068854_10000013917 389
538 3300005614 Ga0068856_100005193 Ga0068856_1000051933 389
539 3300005615 Ga0070702_100000177 Ga0070702_10000017713 389
540 3300005615 Ga0070702_100011837 Ga0070702_1000118374 389
541 3300005616 Ga0068852_100000193 Ga0068852_10000019321 389
542 3300005616 Ga0068852_100042613 Ga0068852_1000426135 389
543 3300005616 Ga0068852_100087017 Ga0068852_1000870172 389
544 3300005617 Ga0068859_100002972 Ga0068859_1000029722 389
545 3300005618 Ga0068864_100000226 Ga0068864_10000022621 389
546 3300005618 Ga0068864_100080542 Ga0068864_1000805423 389
547 3300005718 Ga0068866_10000199 Ga0068866_1000019917 389
548 3300005719 Ga0068861_100000328 Ga0068861_10000032825 389
549 3300005834 Ga0068851_10084106 Ga0068851_100841062 389
550 3300005840 Ga0068870_10000388 Ga0068870_100003889 389
551 3300005841 Ga0068863_100001877 Ga0068863_1000018772 389
552 3300005842 Ga0068858_100000512 Ga0068858_10000051244 389
553 3300005842 Ga0068858_100096035 Ga0068858_1000960351 389
554 3300005843 Ga0068860_100001525 Ga0068860_10000152515 389
555 3300005843 Ga0068860_100154993 Ga0068860_1001549931 389
556 3300005844 Ga0068862_100000557 Ga0068862_10000055712 389
557 3300005937 Ga0081455_10000035 Ga0081455_1000003570 389
558 3300006028 Ga0070717_10003781 Ga0070717_100037818 389
559 3300006175 Ga0070712_100037167 Ga0070712_1000371673 389
560 3300006175 Ga0070712_100065830 Ga0070712_1000658302 389
561 3300006175 Ga0070712_100077344 Ga0070712_1000773442 389
562 3300006178 Ga0075367_10053116 Ga0075367_100531162 389
563 3300006178 Ga0075367_10083357 Ga0075367_100833572 389
564 3300006237 Ga0097621_100000049 Ga0097621_10000004921 389
565 3300006358 Ga0068871_100000097 Ga0068871_10000009722 389
566 3300006358 Ga0068871_100005912 Ga0068871_1000059121 389
567 3300006358 Ga0068871_100045059 Ga0068871_1000450593 389
568 3300006871 Ga0075434_100000383 Ga0075434_10000038317 389
569 3300006871 Ga0075434_100127207 Ga0075434_1001272073 389
570 3300006871 Ga0075434_100339957 Ga0075434_1003399572 389
571 3300006881 Ga0068865_100000119 Ga0068865_10000011923 389
572 3300006931 Ga0097620_100002972 Ga0097620_1000029722 389
573 3300007076 Ga0075435_100034684 Ga0075435_1000346841 389
574 3300007076 Ga0075435_100045146 Ga0075435_1000451462 389
575 3300009011 Ga0105251_10024945 Ga0105251_100249451 389
576 3300009094 Ga0111539_10000237 Ga0111539_1000023724 389
577 3300009094 Ga0111539_10001512 Ga0111539_100015123 389
578 3300009094 Ga0111539_10295857 Ga0111539_102958572 389
579 3300009098 Ga0105245_10000202 Ga0105245_1000020224 389
580 3300009098 Ga0105245_10003663 Ga0105245_100036639 389
581 3300009098 Ga0105245_10037311 Ga0105245_100373111 389
582 3300009101 Ga0105247_10010332 Ga0105247_100103322 389
583 3300009101 Ga0105247_10211918 Ga0105247_102119181 389
584 3300009148 Ga0105243_10001790 Ga0105243_100017909 389
585 3300009148 Ga0105243_10026091 Ga0105243_100260914 389
586 3300009174 Ga0105241_10000430 Ga0105241_1000043015 389
587 3300009176 Ga0105242_10002429 Ga0105242_1000242911 389
588 3300009176 Ga0105242_10158731 Ga0105242_101587312 389
589 3300009177 Ga0105248_10001335 Ga0105248_1000133522 389
590 3300009177 Ga0105248_10098539 Ga0105248_100985393 389
591 3300009545 Ga0105237_10011108 Ga0105237_100111085 389
592 3300009545 Ga0105237_10232742 Ga0105237_102327422 389
593 3300009551 Ga0105238_10013781 Ga0105238_100137818 389
594 3300009551 Ga0105238_10054694 Ga0105238_100546943 389
595 3300009551 Ga0105238_10215181 Ga0105238_102151812 389
596 3300009553 Ga0105249_10000215 Ga0105249_1000021521 389
597 3300009553 Ga0105249_10039083 Ga0105249_100390833 389
598 3300010375 Ga0105239_10028262 Ga0105239_100282622 389
599 3300010375 Ga0105239_10048716 Ga0105239_100487163 389
600 3300011119 Ga0105246_10000019 Ga0105246_1000001932 389
601 3300011119 Ga0105246_10176718 Ga0105246_101767181 389
602 3300013100 Ga0157373_10039499 Ga0157373_100394993 389
603 3300013100 Ga0157373_10106324 Ga0157373_101063241 389
604 3300013102 Ga0157371_10018650 Ga0157371_100186502 389
605 3300013102 Ga0157371_10140280 Ga0157371_101402802 389
606 3300013104 Ga0157370_10051700 Ga0157370_100517002 389
607 3300013296 Ga0157374_10001742 Ga0157374_1000174212 389
608 3300013296 Ga0157374_10065644 Ga0157374_100656442 389
609 3300013296 Ga0157374_10163948 Ga0157374_101639482 389
610 3300013297 Ga0157378_10002701 Ga0157378_1000270111 389
611 3300013297 Ga0157378_10054488 Ga0157378_100544883 389
612 3300013297 Ga0157378_10119950 Ga0157378_101199502 389
613 3300013306 Ga0163162_10001187 Ga0163162_1000118711 389
614 3300013306 Ga0163162_10192309 Ga0163162_101923092 389
615 3300013306 Ga0163162_10461116 Ga0163162_104611162 389
616 3300013307 Ga0157372_10123858 Ga0157372_101238582 389
617 3300013308 Ga0157375_10000135 Ga0157375_1000013560 389
618 3300013308 Ga0157375_10010957 Ga0157375_100109573 389
619 3300013308 Ga0157375_10121543 Ga0157375_101215432 389
620 3300014325 Ga0163163_10019264 Ga0163163_100192644 389
621 3300014325 Ga0163163_10259652 Ga0163163_102596522 389
622 3300014325 Ga0163163_10268805 Ga0163163_102688052 389
623 3300014326 Ga0157380_10000284 Ga0157380_1000028420 389
624 3300014326 Ga0157380_10308622 Ga0157380_103086222 389
625 3300014968 Ga0157379_10000065 Ga0157379_1000006532 389
626 3300014968 Ga0157379_10075984 Ga0157379_100759843 389
627 3300014968 Ga0157379_10210808 Ga0157379_102108082 389
628 3300014969 Ga0157376_10000180 Ga0157376_1000018024 389
629 3300014969 Ga0157376_10194758 Ga0157376_101947582 389
630 3300017792 Ga0163161_10001579 Ga0163161_1000157913 389
631 3300025271 Ga0207666_1000078 Ga0207666_100007810 389
632 3300025271 Ga0207666_1000744 Ga0207666_10007442 389
633 3300025290 Ga0207673_1000034 Ga0207673_10000346 389
634 3300025315 Ga0207697_10000370 Ga0207697_1000037013 389
635 3300025315 Ga0207697_10003696 Ga0207697_100036967 389
636 3300025321 Ga0207656_10068370 Ga0207656_100683702 389
637 3300025885 Ga0207653_10001699 Ga0207653_100016995 389
638 3300025893 Ga0207682_10000304 Ga0207682_100003049 389
639 3300025899 Ga0207642_10000268 Ga0207642_100002682 389
640 3300025899 Ga0207642_10070941 Ga0207642_100709412 389
641 3300025899 Ga0207642_10082622 Ga0207642_100826221 389
642 3300025901 Ga0207688_10000014 Ga0207688_1000001453 389
643 3300025901 Ga0207688_10044106 Ga0207688_100441062 389
644 3300025903 Ga0207680_10019425 Ga0207680_100194253 389
645 3300025904 Ga0207647_10004406 Ga0207647_1000440610 389
646 3300025904 Ga0207647_10043164 Ga0207647_100431641 389
647 3300025906 Ga0207699_10141012 Ga0207699_101410121 389
648 3300025907 Ga0207645_10000160 Ga0207645_1000016013 389
649 3300025907 Ga0207645_10111993 Ga0207645_101119931 389
650 3300025908 Ga0207643_10000009 Ga0207643_10000009156 389
651 3300025911 Ga0207654_10000441 Ga0207654_100004413 389
652 3300025911 Ga0207654_10036529 Ga0207654_100365293 389
653 3300025912 Ga0207707_10000554 Ga0207707_1000055420 389
654 3300025912 Ga0207707_10009645 Ga0207707_100096457 389
655 3300025912 Ga0207707_10148250 Ga0207707_101482502 389
656 3300025914 Ga0207671_10011327 Ga0207671_100113272 389
657 3300025914 Ga0207671_10260066 Ga0207671_102600662 389
658 3300025915 Ga0207693_10015698 Ga0207693_100156982 389
659 3300025915 Ga0207693_10017770 Ga0207693_100177704 389
660 3300025917 Ga0207660_10000161 Ga0207660_1000016124 389
661 3300025918 Ga0207662_10037644 Ga0207662_100376442 389
662 3300025919 Ga0207657_10000980 Ga0207657_1000098029 389
663 3300025919 Ga0207657_10010318 Ga0207657_100103187 389
664 3300025920 Ga0207649_10000429 Ga0207649_1000042921 389
665 3300025921 Ga0207652_10000364 Ga0207652_100003647 389
666 3300025921 Ga0207652_10026006 Ga0207652_100260062 389
667 3300025921 Ga0207652_10192469 Ga0207652_101924692 389
668 3300025923 Ga0207681_10000035 Ga0207681_1000003551 389
669 3300025924 Ga0207694_10145574 Ga0207694_101455742 389
670 3300025925 Ga0207650_10002514 Ga0207650_100025142 389
671 3300025926 Ga0207659_10000027 Ga0207659_1000002787 389
672 3300025926 Ga0207659_10028682 Ga0207659_100286822 389
673 3300025927 Ga0207687_10000551 Ga0207687_100005516 389
674 3300025928 Ga0207700_10004694 Ga0207700_100046946 389
675 3300025929 Ga0207664_10154154 Ga0207664_101541542 389
676 3300025929 Ga0207664_10184443 Ga0207664_101844431 389
677 3300025931 Ga0207644_10190907 Ga0207644_101909072 389
678 3300025932 Ga0207690_10000056 Ga0207690_1000005664 389
679 3300025933 Ga0207706_10000307 Ga0207706_1000030713 389
680 3300025933 Ga0207706_10035216 Ga0207706_100352162 389
681 3300025934 Ga0207686_10001402 Ga0207686_1000140211 389
682 3300025934 Ga0207686_10066389 Ga0207686_100663892 389
683 3300025934 Ga0207686_10076969 Ga0207686_100769692 389
684 3300025935 Ga0207709_10000087 Ga0207709_1000008753 389
685 3300025936 Ga0207670_10000263 Ga0207670_100002634 389
686 3300025936 Ga0207670_10049725 Ga0207670_100497252 389
687 3300025936 Ga0207670_10277822 Ga0207670_102778221 389
688 3300025937 Ga0207669_10000052 Ga0207669_1000005239 389
689 3300025938 Ga0207704_10000063 Ga0207704_1000006324 389
690 3300025939 Ga0207665_10000631 Ga0207665_1000063123 389
691 3300025940 Ga0207691_10000167 Ga0207691_1000016713 389
692 3300025940 Ga0207691_10055482 Ga0207691_100554822 389
693 3300025940 Ga0207691_10172496 Ga0207691_101724962 389
694 3300025941 Ga0207711_10006590 Ga0207711_100065902 389
695 3300025941 Ga0207711_10016598 Ga0207711_100165985 389
696 3300025942 Ga0207689_10000155 Ga0207689_1000015551 389
697 3300025942 Ga0207689_10036982 Ga0207689_100369824 389
698 3300025944 Ga0207661_10000072 Ga0207661_1000007239 389
699 3300025945 Ga0207679_10000057 Ga0207679_1000005758 389
700 3300025945 Ga0207679_10353677 Ga0207679_103536771 389
701 3300025949 Ga0207667_10113025 Ga0207667_101130251 389
702 3300025949 Ga0207667_10256828 Ga0207667_102568282 389
703 3300025960 Ga0207651_10000087 Ga0207651_1000008713 389
704 3300025960 Ga0207651_10037972 Ga0207651_100379722 389
705 3300025961 Ga0207712_10000122 Ga0207712_1000012251 389
706 3300025972 Ga0207668_10000084 Ga0207668_1000008457 389
707 3300025981 Ga0207640_10000878 Ga0207640_1000087810 389
708 3300025986 Ga0207658_10004557 Ga0207658_100045578 389
709 3300025986 Ga0207658_10015437 Ga0207658_100154375 389
710 3300026023 Ga0207677_10000549 Ga0207677_1000054917 389
711 3300026035 Ga0207703_10005829 Ga0207703_100058293 389
712 3300026035 Ga0207703_10081284 Ga0207703_100812841 389
713 3300026041 Ga0207639_10001925 Ga0207639_100019255 389
714 3300026041 Ga0207639_10047666 Ga0207639_100476662 389
715 3300026067 Ga0207678_10000187 Ga0207678_1000018713 389
716 3300026067 Ga0207678_10027526 Ga0207678_100275263 389
717 3300026067 Ga0207678_10036968 Ga0207678_100369682 389
718 3300026075 Ga0207708_10000158 Ga0207708_1000015813 389
719 3300026075 Ga0207708_10002641 Ga0207708_1000264112 389
720 3300026078 Ga0207702_10001960 Ga0207702_1000196019 389
721 3300026078 Ga0207702_10073421 Ga0207702_100734212 389
722 3300026088 Ga0207641_10000896 Ga0207641_1000089620 389
723 3300026089 Ga0207648_10001167 Ga0207648_1000116718 389
724 3300026089 Ga0207648_10038868 Ga0207648_100388685 389
725 3300026095 Ga0207676_10000089 Ga0207676_1000008951 389
726 3300026095 Ga0207676_10074074 Ga0207676_100740743 389
727 3300026095 Ga0207676_10349171 Ga0207676_103491711 389
728 3300026116 Ga0207674_10001478 Ga0207674_1000147813 389
729 3300026118 Ga0207675_100000229 Ga0207675_10000022913 389
730 3300026118 Ga0207675_100028481 Ga0207675_1000284815 389
731 3300026121 Ga0207683_10000525 Ga0207683_1000052514 389
732 3300026121 Ga0207683_10045639 Ga0207683_100456392 389
733 3300027717 Ga0209998_10000949 Ga0209998_100009497 389
734 3300027876 Ga0209974_10003008 Ga0209974_100030086 389
735 3300027907 Ga0207428_10000037 Ga0207428_1000003775 389
736 3300027907 Ga0207428_10000308 Ga0207428_1000030856 389
737 3300028379 Ga0268266_10140836 Ga0268266_101408362 389
738 3300028380 Ga0268265_10000195 Ga0268265_1000019529 389
739 3300028381 Ga0268264_10000526 Ga0268264_1000052614 389
740 3300028381 Ga0268264_10316118 Ga0268264_103161182 389
741 3300028556 Ga0265337_1000963 Ga0265337_100096313 389
742 3300028800 Ga0265338_10043272 Ga0265338_100432723 389
743 3300031090 Ga0265760_10006486 Ga0265760_100064862 389
744 3300031235 Ga0265330_10003043 Ga0265330_100030434 389
745 3300031241 Ga0265325_10000352 Ga0265325_1000035221 389
746 3300031241 Ga0265325_10000736 Ga0265325_1000073616 389
747 3300031249 Ga0265339_10005391 Ga0265339_100053915 389
748 3300031249 Ga0265339_10042125 Ga0265339_100421251 389
749 3300031595 Ga0265313_10000686 Ga0265313_1000068613 389
750 3300031595 Ga0265313_10045737 Ga0265313_100457371 389
751 3300031665 Ga0316575_10045914 Ga0316575_100459142 389
752 3300031711 Ga0265314_10003780 Ga0265314_100037804 389
753 3300031712 Ga0265342_10000882 Ga0265342_1000088218 389
754 3300031712 Ga0265342_10004819 Ga0265342_1000481910 389
755 3300032133 Ga0316583_10000161 Ga0316583_1000016116 389
756 3300034816 Ga0373930_0000020 Ga0373930_0000020_9018_10187 389
757 3300034817 Ga0373948_0000371 Ga0373948_0000371_1209_2378 389
758 3300034817 Ga0373948_0008576 Ga0373948_0008576_253_1422 389
759 3300034819 Ga0373958_0000533 Ga0373958_0000533_1374_2543 389
760 3300034819 Ga0373958_0000699 Ga0373958_0000699_2597_3766 389
761 3300034820 Ga0373959_0000539 Ga0373959_0000539_5033_6202 389
762 3300034957 Ga0373938_0000748 Ga0373938_0000748_1449_2618 389
763 3300035084 Ga0373928_0001398 Ga0373928_0001398_2041_3210 389
764 3300035085 Ga0373929_0001728 Ga0373929_0001728_1595_2764 389
765 3300035086 Ga0373934_0020424 Ga0373934_0020424_637_1806 389
766 3300035088 Ga0373940_0000325 Ga0373940_0000325_553_1722 389
767 3300035089 Ga0373944_0010969 Ga0373944_0010969_1124_2293 389
768 3300035090 Ga0373949_0001003 Ga0373949_0001003_2029_3198 389
769 3300035090 Ga0373949_0001117 Ga0373949_0001117_6080_7249 389
770 3300035090 Ga0373949_0006408 Ga0373949_0006408_1230_2399 389
771 3300035091 Ga0373951_0000547 Ga0373951_0000547_7851_9020 389
772 3300035092 Ga0373952_0000114 Ga0373952_0000114_5566_6735 389
773 3300035092 Ga0373952_0000713 Ga0373952_0000713_3517_4686 389
774 3300035112 Ga0373932_0001186 Ga0373932_0001186_4706_5875 389
775 3300035112 Ga0373932_0002300 Ga0373932_0002300_2251_3420 389
776 3300035112 Ga0373932_0009525 Ga0373932_0009525_464_1633 389
777 3300035114 Ga0373939_0000261 Ga0373939_0000261_11484_12653 389
778 3300035114 Ga0373939_0000360 Ga0373939_0000360_7326_8495 389
779 3300035115 Ga0373941_0001573 Ga0373941_0001573_2043_3212 389
780 3300035115 Ga0373941_0001805 Ga0373941_0001805_675_1844 389
781 3300035117 Ga0373953_0001943 Ga0373953_0001943_3597_4766 389
782 3300035117 Ga0373953_0032058 Ga0373953_0032058_638_1807 389
783 3300035118 Ga0373954_0009797 Ga0373954_0009797_2947_4116 389
784 3300035119 Ga0373956_0011124 Ga0373956_0011124_2420_3589 389
785 3300035120 Ga0373957_0005912 Ga0373957_0005912_304_1473 389
786 3300035121 Ga0373960_0003891 Ga0373960_0003891_1677_2846 389
787 3300035121 Ga0373960_0008095 Ga0373960_0008095_204_1373 389
788 3300035121 Ga0373960_0017544 Ga0373960_0017544_60_1229 389
789 3300035171 Ga0373946_0001059 Ga0373946_0001059_2381_3550 389
790 3300035172 Ga0373955_0010587 Ga0373955_0010587_2162_3331 389
791 3300035172 Ga0373955_0114296 Ga0373955_0114296_173_1342 389
792 3300035207 Ga0373942_0001477 Ga0373942_0001477_2269_3438 389
793 3300035207 Ga0373942_0003320 Ga0373942_0003320_874_2043 389
794 3300035241 Ga0373961_0001845 Ga0373961_0001845_3504_4673 389
795 3300035242 Ga0373962_0000273 Ga0373962_0000273_6373_7542 389
796 3300035242 Ga0373962_0000354 Ga0373962_0000354_2166_3335 389
797 3300035242 Ga0373962_0037273 Ga0373962_0037273_115_1284 389
798 3300035410 Ga0373924_0045126 Ga0373924_0045126_31_1212 389
799 3300035410 Ga0373924_0047222 Ga0373924_0047222_424_1593 389
800 3300035691 Ga0373931_0000082 Ga0373931_0000082_35816_36985 389
801 3300035691 Ga0373931_0007665 Ga0373931_0007665_3648_4817 389
802 3300035691 Ga0373931_0010622 Ga0373931_0010622_733_1902 389
803 3300035692 Ga0373935_0003255 Ga0373935_0003255_691_1860 389
804 3300035692 Ga0373935_0116947 Ga0373935_0116947_404_1573 389
805 3300035695 Ga0373927_0027655 Ga0373927_0027655_2330_3499 389
806 3300035695 Ga0373927_0033383 Ga0373927_0033383_873_2042 389
807 3300035695 Ga0373927_0052750 Ga0373927_0052750_591_1760 389
808 3300035724 Ga0373933_0022723 Ga0373933_0022723_482_1651 389
809 3300035724 Ga0373933_0031487 Ga0373933_0031487_218_1387 389
810 3300036401 Ga0373937_0005292 Ga0373937_0005292_6163_7332 389
811 3300036401 Ga0373937_0011036 Ga0373937_0011036_6189_7358 389
812 3300036401 Ga0373937_0112952 Ga0373937_0112952_647_1816 389
813 3300036647 Ga0316582_0129027 Ga0316582_0129027_156_1337 389
814 3300037068 Ga0373925_0008940 Ga0373925_0008940_2135_3304 389
815 3300037312 Ga0395899_0036755 Ga0395899_0036755_17_1198 389
816 3300037312 Ga0395899_0210759 Ga0395899_0210759_118_1299 389
817 3300037418 Ga0395900_0008255 Ga0395900_0008255_8764_9945 389
818 3300037418 Ga0395900_0238696 Ga0395900_0238696_12_1193 389
819 3300037466 Ga0395898_0011916 Ga0395898_0011916_7589_8770 389
820 3300037853 Ga0436364_0575338 Ga0436364_0575338_264_1433 389
821 3300038443 Ga0395901_0009281 Ga0395901_0009281_3422_4603 389
822 3300038443 Ga0395901_0014372 Ga0395901_0014372_3748_4929 389
823 3300038996 Ga0242420_008230 Ga0242420_008230_315_1484 389
824 3300039437 Ga0436365_0855986 Ga0436365_0855986_2661_3830 389
825 3300039438 Ga0436360_0966528 Ga0436360_0966528_1152_2321 389
826 3300042439 Ga0439464_0007110 Ga0439464_0007110_699_1868 389
827 3300044683 Ga0466965_0136901 Ga0466965_0136901_70_1251 389
828 3300044719 Ga0466971_0091002 Ga0466971_0091002_185_1366 389
829 3300045049 Ga0466959_0184081 Ga0466959_0184081_143_1324 389
830 3300046455 Ga0495603_0033346 Ga0495603_0033346_114_1283 389
831 3300046459 Ga0495629_0000222 Ga0495629_0000222_21785_22954 389
832 3300046461 Ga0495641_0052254 Ga0495641_0052254_62_1231 389
833 3300046462 Ga0495651_0014733 Ga0495651_0014733_1081_2250 389
834 3300046462 Ga0495651_0094361 Ga0495651_0094361_935_2104 389
835 3300046473 Ga0495582_0008516 Ga0495582_0008516_1401_2570 389
836 3300046476 Ga0495662_0009876 Ga0495662_0009876_1389_2558 389
837 3300046477 Ga0495664_0003233 Ga0495664_0003233_5193_6362 389
838 3300046499 Ga0495594_0017544 Ga0495594_0017544_1318_2487 389
839 3300046499 Ga0495594_0136075 Ga0495594_0136075_79_1248 389
840 3300046511 Ga0495608_0002323 Ga0495608_0002323_6713_7882 389
841 3300046511 Ga0495608_0068939 Ga0495608_0068939_882_2051 389
842 3300046514 Ga0495618_0006486 Ga0495618_0006486_4737_5906 389
843 3300046516 Ga0495628_0011343 Ga0495628_0011343_37_1206 389
844 3300046517 Ga0495630_0192869 Ga0495630_0192869_357_1526 389
845 3300046529 Ga0495652_0034412 Ga0495652_0034412_2401_3570 389
846 3300046529 Ga0495652_0039358 Ga0495652_0039358_435_1604 389
847 3300046529 Ga0495652_0095921 Ga0495652_0095921_911_2080 389
848 3300046531 Ga0495665_0003071 Ga0495665_0003071_2618_3787 389
849 3300046533 Ga0495640_0019242 Ga0495640_0019242_3297_4466 389
850 3300046533 Ga0495640_0052361 Ga0495640_0052361_1038_2207 389
851 3300046535 Ga0495586_0006088 Ga0495586_0006088_577_1746 389
852 3300046535 Ga0495586_0016023 Ga0495586_0016023_2588_3757 389
853 3300046536 Ga0495587_0006576 Ga0495587_0006576_2873_4042 389
854 3300046536 Ga0495587_0024692 Ga0495587_0024692_2356_3525 389
855 3300046543 Ga0495645_0020641 Ga0495645_0020641_1132_2301 389
856 3300046559 Ga0495667_0002675 Ga0495667_0002675_6371_7540 389
857 3300046559 Ga0495667_0019291 Ga0495667_0019291_1188_2357 389
858 3300046559 Ga0495667_0045829 Ga0495667_0045829_100_1269 389
859 3300046642 Ga0495634_0118185 Ga0495634_0118185_476_1645 389
860 3300046663 Ga0495635_0002537 Ga0495635_0002537_6046_7215 389
861 3300046663 Ga0495635_0081225 Ga0495635_0081225_10_1179 389
862 3300046675 Ga0495657_0004771 Ga0495657_0004771_6112_7281 389
863 3300046675 Ga0495657_0045424 Ga0495657_0045424_396_1565 389
864 3300046675 Ga0495657_0099372 Ga0495657_0099372_354_1523 389
865 3300046678 Ga0495599_0041642 Ga0495599_0041642_883_2052 389
866 3300046679 Ga0495623_0001394 Ga0495623_0001394_6047_7216 389
867 3300046680 Ga0495646_0001135 Ga0495646_0001135_8174_9343 389
868 3300046681 Ga0495647_0003047 Ga0495647_0003047_59_1228 389
869 3300046681 Ga0495647_0003641 Ga0495647_0003641_3310_4479 389
870 3300046683 Ga0495658_0000656 Ga0495658_0000656_8942_10111 389
871 3300046683 Ga0495658_0031947 Ga0495658_0031947_1581_2750 389
872 3300046689 Ga0495613_0004890 Ga0495613_0004890_6654_7823 389
873 3300046809 Ga0495600_0000708 Ga0495600_0000708_3491_4660 389
874 3300046809 Ga0495600_0038262 Ga0495600_0038262_555_1724 389
875 3300047317 Ga0495604_0007332 Ga0495604_0007332_6303_7472 389
876 3300047317 Ga0495604_0031950 Ga0495604_0031950_2706_3875 389
877 3300047319 Ga0495674_0002023 Ga0495674_0002023_16853_18022 389
878 3300047321 Ga0495676_0042309 Ga0495676_0042309_1849_3018 389
879 3300047322 Ga0495680_0005048 Ga0495680_0005048_5242_6411 389
880 3300047322 Ga0495680_0009889 Ga0495680_0009889_1854_3023 389
881 3300047322 Ga0495680_0070207 Ga0495680_0070207_1207_2376 389
882 3300047444 Ga0495675_0003495 Ga0495675_0003495_5497_6666 389
883 3300047471 Ga0495684_0175691 Ga0495684_0175691_75_1244 389
884 3300048088 Ga0495602_0036787 Ga0495602_0036787_1798_2967 389
885 3300048088 Ga0495602_0113829 Ga0495602_0113829_752_1921 389
886 3300048089 Ga0495614_0005475 Ga0495614_0005475_4443_5612 389
887 3300048903 Ga0496100_0000189 Ga0496100_0000189_11643_12812 389
888 3300048903 Ga0496100_0037778 Ga0496100_0037778_958_2127 389
889 3300048903 Ga0496100_0056282 Ga0496100_0056282_1067_2236 389
890 3300048904 Ga0496101_0000367 Ga0496101_0000367_1538_2707 389
891 3300048904 Ga0496101_0025023 Ga0496101_0025023_2724_3893 389
892 3300048905 Ga0496102_0005220 Ga0496102_0005220_2955_4124 389
893 3300048905 Ga0496102_0009146 Ga0496102_0009146_6714_7883 389
894 3300048905 Ga0496102_0033628 Ga0496102_0033628_790_1959 389
895 3300048905 Ga0496102_0198971 Ga0496102_0198971_550_1719 389
896 3300048906 Ga0496103_0099495 Ga0496103_0099495_107_1276 389
897 3300048906 Ga0496103_0116901 Ga0496103_0116901_182_1351 389
898 3300048907 Ga0496104_0000116 Ga0496104_0000116_34491_35660 389
899 3300048907 Ga0496104_0104391 Ga0496104_0104391_273_1442 389
900 3300048907 Ga0496104_0224927 Ga0496104_0224927_502_1671 389
901 3300048908 Ga0496105_0000550 Ga0496105_0000550_1316_2485 389
902 3300048908 Ga0496105_0006935 Ga0496105_0006935_7540_8709 389
903 3300048908 Ga0496105_0181825 Ga0496105_0181825_510_1679 389
904 3300048908 Ga0496105_0248499 Ga0496105_0248499_246_1415 389
905 3300048908 Ga0496105_0302820 Ga0496105_0302820_45_1214 389
906 3300048909 Ga0496106_0000736 Ga0496106_0000736_4734_5903 389
907 3300048909 Ga0496106_0006742 Ga0496106_0006742_353_1522 389
908 3300048909 Ga0496106_0022228 Ga0496106_0022228_959_2128 389
909 3300048909 Ga0496106_0049486 Ga0496106_0049486_1414_2583 389
910 3300048909 Ga0496106_0076675 Ga0496106_0076675_279_1448 389
911 3300048910 Ga0496107_0000080 Ga0496107_0000080_43685_44854 389
912 3300048910 Ga0496107_0020206 Ga0496107_0020206_3012_4181 389
913 3300048910 Ga0496107_0048652 Ga0496107_0048652_907_2076 389
914 3300048910 Ga0496107_0063030 Ga0496107_0063030_1086_2255 389
915 3300048910 Ga0496107_0257166 Ga0496107_0257166_60_1229 389
916 3300048911 Ga0496108_0004997 Ga0496108_0004997_8140_9309 389
917 3300048911 Ga0496108_0172168 Ga0496108_0172168_567_1736 389
918 3300048912 Ga0496109_0000737 Ga0496109_0000737_21472_22641 389
919 3300048912 Ga0496109_0014904 Ga0496109_0014904_2580_3749 389
920 3300048912 Ga0496109_0125953 Ga0496109_0125953_982_2151 389
921 3300048912 Ga0496109_0252596 Ga0496109_0252596_131_1300 389
922 3300048913 Ga0496110_0060408 Ga0496110_0060408_1329_2498 389
923 3300048913 Ga0496110_0062381 Ga0496110_0062381_457_1626 389
924 3300048913 Ga0496110_0284624 Ga0496110_0284624_57_1226 389
925 3300048914 Ga0496111_0050125 Ga0496111_0050125_1059_2228 389
926 3300048915 Ga0496112_0006007 Ga0496112_0006007_4540_5709 389
927 3300048915 Ga0496112_0353962 Ga0496112_0353962_71_1240 389
928 3300048916 Ga0496113_0000721 Ga0496113_0000721_6113_7282 389
929 3300048917 Ga0496114_0007885 Ga0496114_0007885_1844_3013 389
930 3300048918 Ga0496115_0009214 Ga0496115_0009214_3073_4242 389
931 3300048918 Ga0496115_0022768 Ga0496115_0022768_964_2133 389
932 3300048918 Ga0496115_0024635 Ga0496115_0024635_2479_3648 389
933 3300048918 Ga0496115_0054167 Ga0496115_0054167_1692_2861 389
934 3300049573 Ga0501037_0128912 Ga0501037_0128912_429_1598 389
935 3300049581 Ga0501047_0057389 Ga0501047_0057389_2287_3456 389
936 3300049582 Ga0501048_0207393 Ga0501048_0207393_205_1374 389
937 3300049585 Ga0501069_0111223 Ga0501069_0111223_20_1201 389
938 3300049586 Ga0501070_0008050 Ga0501070_0008050_4819_6000 389
939 3300049586 Ga0501070_0076061 Ga0501070_0076061_505_1686 389
940 3300049592 Ga0501076_0168865 Ga0501076_0168865_231_1400 389
941 3300049742 Ga0501080_0151023 Ga0501080_0151023_393_1574 389
942 3300049744 Ga0501083_0006706 Ga0501083_0006706_981_2150 389
943 3300049822 Ga0501035_0002939 Ga0501035_0002939_8654_9835 389
944 3300050490 nmdc:mga03n38_8389_c1 nmdc:mga03n38_8389_c1_1676_2845 389
945 3300050494 nmdc:mga06z11_100582_c1 nmdc:mga06z11_100582_c1_143_1312 389
946 3300050509 nmdc:mga0qj67_10975_c1 nmdc:mga0qj67_10975_c1_1433_2617 389
947 3300050511 nmdc:mga08y16_4316_c1 nmdc:mga08y16_4316_c1_875_2044 389
948 3300050511 nmdc:mga08y16_738_c1 nmdc:mga08y16_738_c1_26492_27661 389
949 3300050512 nmdc:mga0n895_121065_c1 nmdc:mga0n895_121065_c1_356_1537 389
950 3300050512 nmdc:mga0n895_178316_c1 nmdc:mga0n895_178316_c1_200_1369 389
951 3300050512 nmdc:mga0n895_313274_c1 nmdc:mga0n895_313274_c1_253_1422 389
952 3300050512 nmdc:mga0n895_842_c1 nmdc:mga0n895_842_c1_8985_10154 389
953 3300050513 nmdc:mga0rr50_214062_c1 nmdc:mga0rr50_214062_c1_96_1265 389
954 3300050513 nmdc:mga0rr50_27222_c1 nmdc:mga0rr50_27222_c1_2779_3948 389
955 3300050513 nmdc:mga0rr50_67088_c1 nmdc:mga0rr50_67088_c1_1426_2595 389
956 3300050515 nmdc:mga0a205_32568_c1 nmdc:mga0a205_32568_c1_2744_3913 389
957 3300053077 Ga0495601_0013244 Ga0495601_0013244_2292_3461 389
958 3300053077 Ga0495601_0024831 Ga0495601_0024831_1066_2235 389
959 3300053077 Ga0495601_0061768 Ga0495601_0061768_956_2125 389
960 3300053077 Ga0495601_0130310 Ga0495601_0130310_22_1191 389
961 3300053078 Ga0495612_0001058 Ga0495612_0001058_7333_8502 389
962 3300053078 Ga0495612_0052073 Ga0495612_0052073_261_1430 389
963 3300053084 Ga0495595_0000762 Ga0495595_0000762_4529_5698 389
964 3300053084 Ga0495595_0018683 Ga0495595_0018683_1661_2830 389
965 3300053084 Ga0495595_0032506 Ga0495595_0032506_455_1624 389
966 3300053084 Ga0495595_0035761 Ga0495595_0035761_462_1631 389
967 3300053085 Ga0495619_0000271 Ga0495619_0000271_22762_23931 389
968 3300053085 Ga0495619_0002564 Ga0495619_0002564_7224_8393 389
969 3300053085 Ga0495619_0007587 Ga0495619_0007587_3194_4363 389
970 3300053085 Ga0495619_0033071 Ga0495619_0033071_45_1214 389
971 3300053085 Ga0495619_0062525 Ga0495619_0062525_652_1821 389
972 3300053093 Ga0500651_0001961 Ga0500651_0001961_7262_8431 389
973 3300053117 Ga0500593_052637 Ga0500593_052637_226_1395 389
974 3300053119 Ga0500595_000062 Ga0500595_000062_75531_76700 389
975 3300053119 Ga0500595_019155 Ga0500595_019155_887_2056 389
976 3300053131 Ga0500652_000016 Ga0500652_000016_98338_99507 389
977 3300053131 Ga0500652_005922 Ga0500652_005922_83_1252 389
978 3300053153 Ga0500616_0000006 Ga0500616_0000006_867305_868474 389
979 3300053730 Ga0500645_000282 Ga0500645_000282_6327_7496 389

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xr2-assembly2.cif.gz_B crystal structure of oxidized t. maritima cobalamin-independent methionine synthase complexed with methyltetrahydrofolate 0.8749 7 388
3bq6-assembly2.cif.gz_B crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ (monoclinic) 0.865 8 385
3bq5-assembly2.cif.gz_B crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ and homocysteine (monoclinic) 0.8639 7 389
1xr2-assembly1.cif.gz_A crystal structure of oxidized t. maritima cobalamin-independent methionine synthase complexed with methyltetrahydrofolate 0.8589 8 387
3bq5-assembly1.cif.gz_A crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ and homocysteine (monoclinic) 0.8559 7 387
ID Description Score Start End Superfamily
1xdjA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8504 8 389 3.20.20.210
af_Q54X49_428_818_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8315 5 382 3.20.20.210
2nq5A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8261 7 385 3.20.20.210
af_K7MME4_84_171_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.808 296 382 3.20.20.210
4l61A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8077 6 385 3.20.20.210
ID Description Score Start End GO Terms
AF-A0A7J9ZCS0-F1-model_v4 Cobalamin-independent methionine synthase MetE C-terminal/archaeal domain-containing protein 0.9728 141 389 GO:0003871
GO:0008270
GO:0009086
AF-A0A2V8N9N3-F1-model_v4 Epoxyalkane--coenzyme M transferase 0.9695 245 389 GO:0016740
AF-A0A251XH34-F1-model_v4 Uncharacterized protein 0.9681 226 342
AF-A0A537W1R3-F1-model_v4 Epoxyalkane--coenzyme M transferase 0.9658 283 386 GO:0003871
GO:0008270
GO:0009086
AF-A0A1H4WMU6-F1-model_v4 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 0.9631 1 388 GO:0003871
GO:0008270
GO:0009086
GO:0032259

Feature Viewer

pLDDT pTM Quality
88.09 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map