F487308
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 978 | 402 | 1954 | 310 |
Family's Representative Sequence
| Representative Sequence | 3300046460|Ga0495638_0046706|Ga0495638_0046706_1519_2592 |
| Length | 357 |
| Sequence | LSIAKTYACSDAGLLSRSAWRLTSRGGAEHDHMTLNDPEIVMARRKLILDVDTGTDDAVAIMLAALHPGLELVACTTVNGNREIEHTTENTLRTLDHIGRGDIPVHAGLARPVGRLDFPTPRAARDPGVHFVEMPLAPSRSKASRTNAVEFLIETYRNATDEIVLVPVGPLSNIASALALFPKLVDCVPEVVIMGGGHAVSNVTASAEFNVWADPEAAALVFAAGFRKLTLVPLDATHKAVISSQQCKTLRASGGPAAEAAAIFVEKRIEGYRGYQLLADQDAAPVHDALCVASLIEPDMIETRDYHVDVETSGRLTVGRTVIDTNFRSGKEPNARVAMDADTERFGRFVLDTLINH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 10 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 11 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 17 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 128 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 201 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 203 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 204 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 207 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 208 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 209 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 210 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 211 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 212 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 213 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 216 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 217 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 219 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 220 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 222 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 223 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 224 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 225 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 226 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 227 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 229 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 230 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 233 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 237 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 240 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 241 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 242 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 245 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 246 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 247 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 248 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 249 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 250 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 251 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 252 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 253 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 254 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 255 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 256 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 257 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 258 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 259 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 260 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 261 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 262 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 263 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 264 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 265 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 308 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 309 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 310 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 311 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 312 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 313 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 316 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 317 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 318 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 319 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 320 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 321 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 322 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 323 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 324 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 325 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 326 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 327 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 328 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 353 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 366 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 367 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 368 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 369 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 370 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 371 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 374 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 375 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 376 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 377 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 378 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 379 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 380 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 381 | 2643221731 | Bacillus sp. Root147 | Isolate | Unclassified |
| 382 | 2643221732 | Bacillus sp. Root239 | Isolate | Unclassified |
| 383 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 384 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 385 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 386 | 2818991465 | Priestia megaterium 3291 | Isolate | Rhizosphere |
| 387 | 2842882022 | Bacillus sp. R-71893 | Isolate | Unclassified |
| 388 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 389 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 390 | 2904162308 | Paenibacillus sp. AD87 | Isolate | Unclassified |
| 391 | 2904524088 | Priestia megaterium 1428 | Isolate | Rhizosphere |
| 392 | 2919143609 | Priestia megaterium 1751 | Isolate | Rhizosphere |
| 393 | 2919517244 | Priestia aryabhattai 3820 | Isolate | Unclassified |
| 394 | 2919720352 | Priestia megaterium 4340 | Isolate | Unclassified |
| 395 | 2928093941 | Priestia aryabhattai 1389 | Isolate | Rhizosphere |
| 396 | 2929004312 | Priestia megaterium 1104 | Isolate | Unclassified |
| 397 | 2960319331 | Priestia megaterium AFS057444 | Isolate | Unclassified |
| 398 | 2960375949 | Priestia megaterium AFS067084 | Isolate | Unclassified |
| 399 | 3006984091 | Lederbergia citrea FJAT-49754 | Isolate | Rhizosphere |
| 400 | 8022893055 | Bacillus aryabhattai AFS007213 | Isolate | Unclassified |
| 401 | 8022914991 | Bacillus aryabhattai SQU-R12 | Isolate | Unclassified |
| 402 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.6 |
| Metatranscriptomes | 1.53 |
| Isolates | 2.86 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.19 |
| Nodule | 0.1 |
| Rhizoplane | 9.2 |
| Rhizosphere | 81.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495638_0046706 | 3300046460 | Bacteria | 2719 |
| 2 | JGI25159J45721_1003617 | 3300002987 | Bacteria | 5394 |
| 3 | JGI25159J45721_1009190 | 3300002987 | Bacteria | 2632 |
| 4 | JGI25151J46595_10002956 | 3300003187 | Bacteria | 9710 |
| 5 | JGI25151J46595_10005484 | 3300003187 | Bacteria | 6545 |
| 6 | JGI25406J46586_10010790 | 3300003203 | Bacteria | 4032 |
| 7 | rootH2_10101307 | 3300003320 | Bacteria | 3614 |
| 8 | rootL2_10008518 | 3300003322 | Bacteria | 82305 |
| 9 | rootL2_10104376 | 3300003322 | Bacteria | 14283 |
| 10 | rootH1_10000320 | 3300003323 | Bacteria | 36827 |
| 11 | JGI25160J50197_1000280 | 3300003354 | Bacteria | 37082 |
| 12 | JGI25160J50197_1000599 | 3300003354 | Bacteria | 20168 |
| 13 | JGI25161J50226_1000212 | 3300003374 | Bacteria | 37082 |
| 14 | JGI25161J50226_1000424 | 3300003374 | Bacteria | 20168 |
| 15 | Ga0006562J51391_1008419 | 3300003578 | Bacteria | 2266 |
| 16 | Ga0055532_1004722 | 3300003758 | Bacteria | 2011 |
| 17 | Ga0055536_1001185 | 3300003781 | Bacteria | 16236 |
| 18 | Ga0055528_1012898 | 3300003790 | Bacteria | 3207 |
| 19 | Ga0055540_1003516 | 3300003792 | Bacteria | 7529 |
| 20 | Ga0055543_1000049 | 3300004625 | Bacteria | 108101 |
| 21 | Ga0055543_1000576 | 3300004625 | Bacteria | 20206 |
| 22 | Ga0058862_10066796 | 3300004803 | Unclassified | 3856 |
| 23 | Ga0065165_1000338 | 3300005262 | Bacteria | 76912 |
| 24 | Ga0065165_1002596 | 3300005262 | Bacteria | 14818 |
| 25 | Ga0070658_10301505 | 3300005327 | Unclassified | 1366 |
| 26 | Ga0070683_100014581 | 3300005329 | Bacteria | 6881 |
| 27 | Ga0070683_100020230 | 3300005329 | Bacteria | 5921 |
| 28 | Ga0070683_100029495 | 3300005329 | Bacteria | 4967 |
| 29 | Ga0070683_100052523 | 3300005329 | Bacteria | 3776 |
| 30 | Ga0070683_100067252 | 3300005329 | Bacteria | 3338 |
| 31 | Ga0070683_100073168 | 3300005329 | Bacteria | 3200 |
| 32 | Ga0070683_100186699 | 3300005329 | Bacteria | 1968 |
| 33 | Ga0070683_100338718 | 3300005329 | Bacteria | 1432 |
| 34 | Ga0070683_100592423 | 3300005329 | Bacteria | 1061 |
| 35 | Ga0070690_100007365 | 3300005330 | Bacteria | 6301 |
| 36 | Ga0070690_100042731 | 3300005330 | Bacteria | 2871 |
| 37 | Ga0070670_100025034 | 3300005331 | Bacteria | 5134 |
| 38 | Ga0070680_100006204 | 3300005336 | Bacteria | 9067 |
| 39 | Ga0070680_100058175 | 3300005336 | Bacteria | 3161 |
| 40 | Ga0070680_100058588 | 3300005336 | Bacteria | 3150 |
| 41 | Ga0070680_100143875 | 3300005336 | Bacteria | 2000 |
| 42 | Ga0070680_100205944 | 3300005336 | Bacteria | 1659 |
| 43 | Ga0070682_100014132 | 3300005337 | Bacteria | 4611 |
| 44 | Ga0070682_100038522 | 3300005337 | Bacteria | 2932 |
| 45 | Ga0070682_100052612 | 3300005337 | Bacteria | 2549 |
| 46 | Ga0068868_100022657 | 3300005338 | Bacteria | 4744 |
| 47 | Ga0068868_100103727 | 3300005338 | Unclassified | 2304 |
| 48 | Ga0070660_100032090 | 3300005339 | Bacteria | 3950 |
| 49 | Ga0070660_100114021 | 3300005339 | Bacteria | 2152 |
| 50 | Ga0070660_100145619 | 3300005339 | Bacteria | 1902 |
| 51 | Ga0070660_100367410 | 3300005339 | Bacteria | 1186 |
| 52 | Ga0070689_100004976 | 3300005340 | Bacteria | 9027 |
| 53 | Ga0070689_100033094 | 3300005340 | Bacteria | 3936 |
| 54 | Ga0070691_10000784 | 3300005341 | Bacteria | 12621 |
| 55 | Ga0070691_10032921 | 3300005341 | Bacteria | 2437 |
| 56 | Ga0070687_100027766 | 3300005343 | Bacteria | 2738 |
| 57 | Ga0070661_100054617 | 3300005344 | Bacteria | 2925 |
| 58 | Ga0070661_100055105 | 3300005344 | Bacteria | 2912 |
| 59 | Ga0070661_100072623 | 3300005344 | Bacteria | 2532 |
| 60 | Ga0070661_100107380 | 3300005344 | Unclassified | 2082 |
| 61 | Ga0070661_100367604 | 3300005344 | Bacteria | 1131 |
| 62 | Ga0070675_100103286 | 3300005354 | Bacteria | 2403 |
| 63 | Ga0070675_100111035 | 3300005354 | Unclassified | 2320 |
| 64 | Ga0070671_100005356 | 3300005355 | Bacteria | 10229 |
| 65 | Ga0070671_100120784 | 3300005355 | Bacteria | 2205 |
| 66 | Ga0070674_100003471 | 3300005356 | Bacteria | 8855 |
| 67 | Ga0070674_100020601 | 3300005356 | Bacteria | 4218 |
| 68 | Ga0070673_100266702 | 3300005364 | Bacteria | 1497 |
| 69 | Ga0070688_100103242 | 3300005365 | Bacteria | 1883 |
| 70 | Ga0070659_100013745 | 3300005366 | Bacteria | 6035 |
| 71 | Ga0070659_100028119 | 3300005366 | Bacteria | 4339 |
| 72 | Ga0070659_100035242 | 3300005366 | Bacteria | 3896 |
| 73 | Ga0070714_100001916 | 3300005435 | Bacteria | 15178 |
| 74 | Ga0070714_100007234 | 3300005435 | Bacteria | 8621 |
| 75 | Ga0070714_100087163 | 3300005435 | Bacteria | 2730 |
| 76 | Ga0070714_100226713 | 3300005435 | Bacteria | 1720 |
| 77 | Ga0070714_100307645 | 3300005435 | Bacteria | 1479 |
| 78 | Ga0070714_100430541 | 3300005435 | Bacteria | 1251 |
| 79 | Ga0070713_100005171 | 3300005436 | Bacteria | 8882 |
| 80 | Ga0070713_100228118 | 3300005436 | Bacteria | 1692 |
| 81 | Ga0070713_100228375 | 3300005436 | Bacteria | 1691 |
| 82 | Ga0070713_100666141 | 3300005436 | Unclassified | 992 |
| 83 | Ga0070701_10023197 | 3300005438 | Bacteria | 2985 |
| 84 | Ga0070711_100079151 | 3300005439 | Bacteria | 2337 |
| 85 | Ga0070711_100089189 | 3300005439 | Bacteria | 2218 |
| 86 | Ga0070705_100022853 | 3300005440 | Bacteria | 3348 |
| 87 | Ga0070700_100017298 | 3300005441 | Bacteria | 4119 |
| 88 | Ga0070700_100116860 | 3300005441 | Bacteria | 1781 |
| 89 | Ga0070694_100046006 | 3300005444 | Bacteria | 2927 |
| 90 | Ga0070708_100007522 | 3300005445 | Bacteria | 8720 |
| 91 | Ga0070708_100020462 | 3300005445 | Bacteria | 5579 |
| 92 | Ga0070663_100002699 | 3300005455 | Bacteria | 10042 |
| 93 | Ga0070663_100010086 | 3300005455 | Bacteria | 5876 |
| 94 | Ga0070678_100024394 | 3300005456 | Bacteria | 4048 |
| 95 | Ga0070662_100045719 | 3300005457 | Bacteria | 3142 |
| 96 | Ga0070681_10000761 | 3300005458 | Bacteria | 26755 |
| 97 | Ga0070681_10010999 | 3300005458 | Bacteria | 8945 |
| 98 | Ga0070681_10019104 | 3300005458 | Bacteria | 6859 |
| 99 | Ga0070681_10042552 | 3300005458 | Bacteria | 4551 |
| 100 | Ga0070681_10045056 | 3300005458 | Bacteria | 4414 |
| 101 | Ga0070681_10067465 | 3300005458 | Bacteria | 3545 |
| 102 | Ga0070681_10080728 | 3300005458 | Bacteria | 3208 |
| 103 | Ga0070681_10097829 | 3300005458 | Bacteria | 2881 |
| 104 | Ga0070681_10207392 | 3300005458 | Bacteria | 1876 |
| 105 | Ga0070681_10239624 | 3300005458 | Bacteria | 1727 |
| 106 | Ga0070681_10362512 | 3300005458 | Bacteria | 1360 |
| 107 | Ga0068867_100035295 | 3300005459 | Bacteria | 3626 |
| 108 | Ga0068867_100133976 | 3300005459 | Bacteria | 1929 |
| 109 | Ga0070685_10025296 | 3300005466 | Bacteria | 3268 |
| 110 | Ga0070685_10043520 | 3300005466 | Bacteria | 2567 |
| 111 | Ga0070685_10111714 | 3300005466 | Bacteria | 1684 |
| 112 | Ga0070706_100022567 | 3300005467 | Bacteria | 5794 |
| 113 | Ga0070707_100092722 | 3300005468 | Bacteria | 2924 |
| 114 | Ga0070707_100137944 | 3300005468 | Bacteria | 2373 |
| 115 | Ga0070698_100021992 | 3300005471 | Bacteria | 6676 |
| 116 | Ga0070679_100001341 | 3300005530 | Bacteria | 21723 |
| 117 | Ga0070679_100026607 | 3300005530 | Bacteria | 5687 |
| 118 | Ga0070679_100027691 | 3300005530 | Bacteria | 5580 |
| 119 | Ga0070679_100055947 | 3300005530 | Bacteria | 3930 |
| 120 | Ga0070679_100058793 | 3300005530 | Bacteria | 3831 |
| 121 | Ga0070679_100091215 | 3300005530 | Bacteria | 3035 |
| 122 | Ga0070679_100140953 | 3300005530 | Bacteria | 2390 |
| 123 | Ga0070679_100171343 | 3300005530 | Bacteria | 2143 |
| 124 | Ga0070679_100306389 | 3300005530 | Bacteria | 1539 |
| 125 | Ga0070684_100029126 | 3300005535 | Bacteria | 4676 |
| 126 | Ga0070684_100098398 | 3300005535 | Bacteria | 2610 |
| 127 | Ga0070684_100139637 | 3300005535 | Bacteria | 2190 |
| 128 | Ga0068853_100029727 | 3300005539 | Bacteria | 4609 |
| 129 | Ga0068853_100086277 | 3300005539 | Bacteria | 2752 |
| 130 | Ga0068853_100247621 | 3300005539 | Bacteria | 1635 |
| 131 | Ga0070672_100146989 | 3300005543 | Bacteria | 1948 |
| 132 | Ga0070672_100411861 | 3300005543 | Bacteria | 1160 |
| 133 | Ga0070696_100060997 | 3300005546 | Bacteria | 2638 |
| 134 | Ga0070693_100021572 | 3300005547 | Bacteria | 3413 |
| 135 | Ga0070693_100118896 | 3300005547 | Bacteria | 1636 |
| 136 | Ga0070693_100205031 | 3300005547 | Bacteria | 1283 |
| 137 | Ga0070665_100010064 | 3300005548 | Bacteria | 9570 |
| 138 | Ga0070665_100017578 | 3300005548 | Bacteria | 7183 |
| 139 | Ga0070665_100032376 | 3300005548 | Bacteria | 5262 |
| 140 | Ga0070665_100501606 | 3300005548 | Unclassified | 1225 |
| 141 | Ga0068855_100046387 | 3300005563 | Bacteria | 5137 |
| 142 | Ga0068855_100112305 | 3300005563 | Bacteria | 3127 |
| 143 | Ga0068855_100173960 | 3300005563 | Bacteria | 2437 |
| 144 | Ga0068855_100381527 | 3300005563 | Bacteria | 1547 |
| 145 | Ga0070664_100029150 | 3300005564 | Bacteria | 4600 |
| 146 | Ga0068857_100021524 | 3300005577 | Bacteria | 5673 |
| 147 | Ga0068857_100033377 | 3300005577 | Bacteria | 4552 |
| 148 | Ga0068857_100150161 | 3300005577 | Bacteria | 2110 |
| 149 | Ga0068857_100179362 | 3300005577 | Bacteria | 1927 |
| 150 | Ga0068857_100185726 | 3300005577 | Bacteria | 1892 |
| 151 | Ga0068856_100016730 | 3300005614 | Bacteria | 7104 |
| 152 | Ga0068856_100080702 | 3300005614 | Bacteria | 3227 |
| 153 | Ga0068856_100116970 | 3300005614 | Bacteria | 2667 |
| 154 | Ga0068856_100255073 | 3300005614 | Bacteria | 1769 |
| 155 | Ga0070702_100000698 | 3300005615 | Bacteria | 12659 |
| 156 | Ga0070702_100129647 | 3300005615 | Bacteria | 1591 |
| 157 | Ga0070702_100137217 | 3300005615 | Bacteria | 1553 |
| 158 | Ga0068852_100001790 | 3300005616 | Bacteria | 14582 |
| 159 | Ga0068852_100007529 | 3300005616 | Bacteria | 7950 |
| 160 | Ga0068852_100111971 | 3300005616 | Bacteria | 2483 |
| 161 | Ga0068852_100327984 | 3300005616 | Bacteria | 1488 |
| 162 | Ga0068859_100021489 | 3300005617 | Bacteria | 6478 |
| 163 | Ga0068859_100025793 | 3300005617 | Bacteria | 5896 |
| 164 | Ga0068859_100074145 | 3300005617 | Bacteria | 3442 |
| 165 | Ga0068859_100237355 | 3300005617 | Bacteria | 1912 |
| 166 | Ga0068864_100036613 | 3300005618 | Bacteria | 4183 |
| 167 | Ga0068864_100082890 | 3300005618 | Bacteria | 2815 |
| 168 | Ga0068864_100128949 | 3300005618 | Bacteria | 2270 |
| 169 | Ga0068861_100162284 | 3300005719 | Bacteria | 1844 |
| 170 | Ga0068851_10017123 | 3300005834 | Bacteria | 3477 |
| 171 | Ga0068870_10006789 | 3300005840 | Bacteria | 5072 |
| 172 | Ga0068870_10108064 | 3300005840 | Bacteria | 1583 |
| 173 | Ga0068863_100054987 | 3300005841 | Bacteria | 3770 |
| 174 | Ga0068863_100295684 | 3300005841 | Unclassified | 1570 |
| 175 | Ga0068858_100052163 | 3300005842 | Bacteria | 3784 |
| 176 | Ga0068858_100076631 | 3300005842 | Bacteria | 3106 |
| 177 | Ga0068858_100109235 | 3300005842 | Bacteria | 2582 |
| 178 | Ga0068858_100399581 | 3300005842 | Bacteria | 1320 |
| 179 | Ga0068860_100011930 | 3300005843 | Bacteria | 8565 |
| 180 | Ga0068860_100052360 | 3300005843 | Bacteria | 3883 |
| 181 | Ga0068860_100086755 | 3300005843 | Bacteria | 2979 |
| 182 | Ga0068860_100337424 | 3300005843 | Unclassified | 1481 |
| 183 | Ga0068860_100448037 | 3300005843 | Bacteria | 1283 |
| 184 | Ga0068862_100062041 | 3300005844 | Bacteria | 3214 |
| 185 | Ga0081455_10000123 | 3300005937 | Bacteria | 89254 |
| 186 | Ga0081539_10001472 | 3300005985 | Bacteria | 39944 |
| 187 | Ga0081539_10004690 | 3300005985 | Bacteria | 14827 |
| 188 | Ga0070717_10160657 | 3300006028 | Bacteria | 1949 |
| 189 | Ga0070717_10179875 | 3300006028 | Bacteria | 1843 |
| 190 | Ga0070717_10253477 | 3300006028 | Bacteria | 1555 |
| 191 | Ga0075363_100096603 | 3300006048 | Bacteria | 1631 |
| 192 | Ga0075364_10131652 | 3300006051 | Bacteria | 1679 |
| 193 | Ga0070716_100207408 | 3300006173 | Bacteria | 1307 |
| 194 | Ga0070712_100064819 | 3300006175 | Bacteria | 2592 |
| 195 | Ga0070712_100115855 | 3300006175 | Bacteria | 2009 |
| 196 | Ga0097621_100029767 | 3300006237 | Bacteria | 4316 |
| 197 | Ga0097621_100287985 | 3300006237 | Bacteria | 1447 |
| 198 | Ga0068871_100477432 | 3300006358 | Bacteria | 1121 |
| 199 | Ga0075430_100431291 | 3300006846 | Bacteria | 1088 |
| 200 | Ga0075431_100084901 | 3300006847 | Bacteria | 3268 |
| 201 | Ga0075431_100230598 | 3300006847 | Bacteria | 1887 |
| 202 | Ga0075433_10000538 | 3300006852 | Bacteria | 24874 |
| 203 | Ga0075433_10021633 | 3300006852 | Bacteria | 5396 |
| 204 | Ga0075433_10106508 | 3300006852 | Bacteria | 2485 |
| 205 | Ga0075434_100001508 | 3300006871 | Bacteria | 19661 |
| 206 | Ga0075434_100018763 | 3300006871 | Bacteria | 6686 |
| 207 | Ga0075434_100056740 | 3300006871 | Bacteria | 3892 |
| 208 | Ga0075434_100067183 | 3300006871 | Bacteria | 3572 |
| 209 | Ga0075429_100032038 | 3300006880 | Bacteria | 4570 |
| 210 | Ga0075429_100189514 | 3300006880 | Bacteria | 1802 |
| 211 | Ga0068865_100038132 | 3300006881 | Bacteria | 3250 |
| 212 | Ga0068865_100184854 | 3300006881 | Unclassified | 1607 |
| 213 | Ga0075436_100010800 | 3300006914 | Bacteria | 6265 |
| 214 | Ga0097620_100021489 | 3300006931 | Bacteria | 6478 |
| 215 | Ga0097620_100025795 | 3300006931 | Bacteria | 5896 |
| 216 | Ga0097620_100074143 | 3300006931 | Bacteria | 3442 |
| 217 | Ga0097620_100237353 | 3300006931 | Bacteria | 1912 |
| 218 | Ga0075435_100001805 | 3300007076 | Bacteria | 13929 |
| 219 | Ga0075435_100090512 | 3300007076 | Bacteria | 2524 |
| 220 | Ga0075435_100101421 | 3300007076 | Bacteria | 2385 |
| 221 | Ga0105240_10024111 | 3300009093 | Bacteria | 8031 |
| 222 | Ga0105240_10082840 | 3300009093 | Bacteria | 3939 |
| 223 | Ga0105240_10334349 | 3300009093 | Bacteria | 1723 |
| 224 | Ga0111539_10009362 | 3300009094 | Bacteria | 12366 |
| 225 | Ga0111539_10053130 | 3300009094 | Bacteria | 4823 |
| 226 | Ga0111539_10103919 | 3300009094 | Bacteria | 3333 |
| 227 | Ga0111539_10175423 | 3300009094 | Bacteria | 2504 |
| 228 | Ga0111539_10973259 | 3300009094 | Bacteria | 987 |
| 229 | Ga0105245_10011452 | 3300009098 | Bacteria | 7725 |
| 230 | Ga0105245_10053696 | 3300009098 | Bacteria | 3617 |
| 231 | Ga0105245_10093907 | 3300009098 | Bacteria | 2764 |
| 232 | Ga0105245_10546467 | 3300009098 | Bacteria | 1180 |
| 233 | Ga0105247_10023897 | 3300009101 | Bacteria | 3683 |
| 234 | Ga0114129_10081287 | 3300009147 | Bacteria | 4504 |
| 235 | Ga0114129_10145419 | 3300009147 | Bacteria | 3248 |
| 236 | Ga0114129_10174582 | 3300009147 | Bacteria | 2927 |
| 237 | Ga0105243_10022315 | 3300009148 | Bacteria | 4810 |
| 238 | Ga0105243_10178662 | 3300009148 | Bacteria | 1844 |
| 239 | Ga0105243_10311228 | 3300009148 | Bacteria | 1431 |
| 240 | Ga0105241_10008405 | 3300009174 | Bacteria | 7594 |
| 241 | Ga0105241_10282225 | 3300009174 | Bacteria | 1419 |
| 242 | Ga0105242_10024312 | 3300009176 | Bacteria | 4784 |
| 243 | Ga0105242_10046823 | 3300009176 | Bacteria | 3510 |
| 244 | Ga0105242_10400815 | 3300009176 | Bacteria | 1280 |
| 245 | Ga0105248_10023670 | 3300009177 | Bacteria | 6825 |
| 246 | Ga0105248_10327382 | 3300009177 | Bacteria | 1726 |
| 247 | Ga0105248_10379955 | 3300009177 | Bacteria | 1590 |
| 248 | Ga0105248_10393667 | 3300009177 | Bacteria | 1560 |
| 249 | Ga0105248_10546121 | 3300009177 | Bacteria | 1307 |
| 250 | Ga0105248_10582673 | 3300009177 | Unclassified | 1262 |
| 251 | Ga0105237_10018665 | 3300009545 | Bacteria | 7171 |
| 252 | Ga0105237_10034049 | 3300009545 | Bacteria | 5159 |
| 253 | Ga0105237_10415477 | 3300009545 | Bacteria | 1350 |
| 254 | Ga0105237_10750544 | 3300009545 | Bacteria | 982 |
| 255 | Ga0105238_10056322 | 3300009551 | Bacteria | 3945 |
| 256 | Ga0105238_10069609 | 3300009551 | Bacteria | 3519 |
| 257 | Ga0105238_10136607 | 3300009551 | Bacteria | 2429 |
| 258 | Ga0105238_10489326 | 3300009551 | Unclassified | 1230 |
| 259 | Ga0105028_103079 | 3300009993 | Bacteria | 1748 |
| 260 | Ga0105239_10033997 | 3300010375 | Bacteria | 5597 |
| 261 | Ga0105239_10197286 | 3300010375 | Bacteria | 2254 |
| 262 | Ga0105246_10001509 | 3300011119 | Bacteria | 13795 |
| 263 | Ga0157373_10015391 | 3300013100 | Bacteria | 5591 |
| 264 | Ga0157371_10023977 | 3300013102 | Bacteria | 4457 |
| 265 | Ga0157370_10011046 | 3300013104 | Bacteria | 9469 |
| 266 | Ga0157370_10023696 | 3300013104 | Bacteria | 6091 |
| 267 | Ga0157370_10072198 | 3300013104 | Bacteria | 3257 |
| 268 | Ga0157370_10075672 | 3300013104 | Bacteria | 3173 |
| 269 | Ga0157370_10152266 | 3300013104 | Bacteria | 2152 |
| 270 | Ga0157369_10008734 | 3300013105 | Bacteria | 11608 |
| 271 | Ga0157369_10043319 | 3300013105 | Bacteria | 4906 |
| 272 | Ga0157369_10118105 | 3300013105 | Bacteria | 2815 |
| 273 | Ga0157369_10156214 | 3300013105 | Bacteria | 2409 |
| 274 | Ga0157369_10169761 | 3300013105 | Bacteria | 2299 |
| 275 | Ga0157369_10195137 | 3300013105 | Bacteria | 2127 |
| 276 | Ga0157369_10212974 | 3300013105 | Bacteria | 2025 |
| 277 | Ga0157369_10230976 | 3300013105 | Bacteria | 1934 |
| 278 | Ga0157369_10389145 | 3300013105 | Bacteria | 1447 |
| 279 | Ga0157374_10006393 | 3300013296 | Bacteria | 10001 |
| 280 | Ga0157378_10001154 | 3300013297 | Bacteria | 24017 |
| 281 | Ga0163162_10392093 | 3300013306 | Bacteria | 1521 |
| 282 | Ga0157372_10006138 | 3300013307 | Bacteria | 12766 |
| 283 | Ga0157372_10021689 | 3300013307 | Bacteria | 6943 |
| 284 | Ga0157372_10030994 | 3300013307 | Bacteria | 5853 |
| 285 | Ga0157372_10148778 | 3300013307 | Bacteria | 2701 |
| 286 | Ga0157372_10158991 | 3300013307 | Bacteria | 2610 |
| 287 | Ga0157372_10868889 | 3300013307 | Bacteria | 1047 |
| 288 | Ga0157375_10009209 | 3300013308 | Bacteria | 8658 |
| 289 | Ga0157375_10039459 | 3300013308 | Bacteria | 4545 |
| 290 | Ga0157375_10127461 | 3300013308 | Bacteria | 2662 |
| 291 | Ga0157375_10192500 | 3300013308 | Bacteria | 2194 |
| 292 | Ga0157375_10233432 | 3300013308 | Bacteria | 1999 |
| 293 | Ga0157375_10325291 | 3300013308 | Bacteria | 1702 |
| 294 | Ga0163163_10128112 | 3300014325 | Bacteria | 2577 |
| 295 | Ga0163163_10159800 | 3300014325 | Bacteria | 2298 |
| 296 | Ga0157380_10251101 | 3300014326 | Bacteria | 1601 |
| 297 | Ga0182008_10068004 | 3300014497 | Bacteria | 1753 |
| 298 | Ga0182008_10108107 | 3300014497 | Bacteria | 1377 |
| 299 | Ga0157377_10016745 | 3300014745 | Bacteria | 3776 |
| 300 | Ga0157377_10023167 | 3300014745 | Bacteria | 3288 |
| 301 | Ga0157379_10024965 | 3300014968 | Bacteria | 5305 |
| 302 | Ga0157379_10028625 | 3300014968 | Bacteria | 4955 |
| 303 | Ga0157379_10053339 | 3300014968 | Bacteria | 3611 |
| 304 | Ga0157376_10366024 | 3300014969 | Bacteria | 1384 |
| 305 | Ga0163161_10172512 | 3300017792 | Bacteria | 1654 |
| 306 | Ga0206356_10045217 | 3300020070 | Bacteria | 1363 |
| 307 | Ga0206356_11606851 | 3300020070 | Bacteria | 1708 |
| 308 | Ga0206350_10021615 | 3300020080 | Bacteria | 1765 |
| 309 | Ga0206354_10651088 | 3300020081 | Bacteria | 2186 |
| 310 | Ga0206354_10779778 | 3300020081 | Bacteria | 2043 |
| 311 | Ga0206353_10034911 | 3300020082 | Bacteria | 1212 |
| 312 | Ga0206353_10328578 | 3300020082 | Bacteria | 1539 |
| 313 | Ga0206353_10517529 | 3300020082 | Bacteria | 3879 |
| 314 | Ga0206353_11431182 | 3300020082 | Bacteria | 1973 |
| 315 | Ga0206353_11527722 | 3300020082 | Bacteria | 3617 |
| 316 | Ga0206353_11682003 | 3300020082 | Bacteria | 1869 |
| 317 | Ga0206353_11772650 | 3300020082 | Bacteria | 1135 |
| 318 | Ga0213875_10000373 | 3300021388 | Bacteria | 41081 |
| 319 | Ga0213875_10020078 | 3300021388 | Bacteria | 3207 |
| 320 | Ga0224712_10029022 | 3300022467 | Bacteria | 1983 |
| 321 | Ga0209147_101402 | 3300025229 | Bacteria | 8839 |
| 322 | Ga0209565_1006092 | 3300025263 | Bacteria | 3424 |
| 323 | Ga0209673_1004649 | 3300025273 | Bacteria | 7261 |
| 324 | Ga0209130_1000559 | 3300025284 | Bacteria | 36915 |
| 325 | Ga0209130_1001091 | 3300025284 | Bacteria | 20220 |
| 326 | Ga0209676_1000213 | 3300025292 | Bacteria | 128039 |
| 327 | Ga0209025_1000863 | 3300025294 | Bacteria | 47880 |
| 328 | Ga0209025_1004514 | 3300025294 | Bacteria | 12022 |
| 329 | Ga0209050_1011809 | 3300025298 | Bacteria | 4089 |
| 330 | Ga0207426_1000200 | 3300025302 | Bacteria | 144028 |
| 331 | Ga0207426_1008366 | 3300025302 | Bacteria | 4190 |
| 332 | Ga0209051_1000945 | 3300025303 | Bacteria | 28676 |
| 333 | Ga0209257_1000757 | 3300025304 | Bacteria | 48772 |
| 334 | Ga0207656_10028673 | 3300025321 | Bacteria | 2286 |
| 335 | Ga0207655_1005685 | 3300025728 | Bacteria | 8431 |
| 336 | Ga0207692_10154346 | 3300025898 | Bacteria | 1317 |
| 337 | Ga0207642_10073416 | 3300025899 | Bacteria | 1636 |
| 338 | Ga0207688_10025836 | 3300025901 | Bacteria | 3228 |
| 339 | Ga0207699_10250936 | 3300025906 | Bacteria | 1219 |
| 340 | Ga0207643_10000509 | 3300025908 | Bacteria | 24852 |
| 341 | Ga0207705_10037046 | 3300025909 | Bacteria | 3490 |
| 342 | Ga0207705_10325761 | 3300025909 | Bacteria | 1181 |
| 343 | Ga0207654_10028289 | 3300025911 | Bacteria | 3055 |
| 344 | Ga0207707_10002441 | 3300025912 | Bacteria | 16724 |
| 345 | Ga0207707_10003694 | 3300025912 | Bacteria | 13568 |
| 346 | Ga0207707_10018831 | 3300025912 | Bacteria | 6021 |
| 347 | Ga0207707_10046889 | 3300025912 | Bacteria | 3764 |
| 348 | Ga0207707_10059113 | 3300025912 | Bacteria | 3335 |
| 349 | Ga0207707_10102228 | 3300025912 | Bacteria | 2505 |
| 350 | Ga0207707_10102804 | 3300025912 | Bacteria | 2498 |
| 351 | Ga0207707_10119140 | 3300025912 | Bacteria | 2307 |
| 352 | Ga0207707_10119995 | 3300025912 | Bacteria | 2298 |
| 353 | Ga0207707_10188342 | 3300025912 | Bacteria | 1800 |
| 354 | Ga0207707_10291479 | 3300025912 | Bacteria | 1412 |
| 355 | Ga0207695_10289813 | 3300025913 | Bacteria | 1529 |
| 356 | Ga0207695_10517545 | 3300025913 | Bacteria | 1075 |
| 357 | Ga0207671_10133057 | 3300025914 | Bacteria | 1910 |
| 358 | Ga0207671_10325237 | 3300025914 | Bacteria | 1217 |
| 359 | Ga0207693_10115797 | 3300025915 | Bacteria | 2105 |
| 360 | Ga0207693_10119180 | 3300025915 | Bacteria | 2073 |
| 361 | Ga0207663_10034475 | 3300025916 | Bacteria | 3027 |
| 362 | Ga0207663_10079171 | 3300025916 | Bacteria | 2145 |
| 363 | Ga0207660_10025317 | 3300025917 | Bacteria | 4026 |
| 364 | Ga0207660_10030907 | 3300025917 | Unclassified | 3683 |
| 365 | Ga0207660_10086294 | 3300025917 | Bacteria | 2317 |
| 366 | Ga0207660_10265270 | 3300025917 | Bacteria | 1359 |
| 367 | Ga0207662_10022210 | 3300025918 | Bacteria | 3635 |
| 368 | Ga0207657_10005449 | 3300025919 | Bacteria | 13283 |
| 369 | Ga0207657_10009888 | 3300025919 | Bacteria | 9549 |
| 370 | Ga0207657_10017028 | 3300025919 | Bacteria | 6991 |
| 371 | Ga0207657_10018623 | 3300025919 | Bacteria | 6619 |
| 372 | Ga0207657_10034581 | 3300025919 | Bacteria | 4542 |
| 373 | Ga0207657_10081850 | 3300025919 | Bacteria | 2711 |
| 374 | Ga0207649_10015939 | 3300025920 | Bacteria | 4229 |
| 375 | Ga0207649_10019505 | 3300025920 | Bacteria | 3875 |
| 376 | Ga0207649_10037479 | 3300025920 | Unclassified | 2929 |
| 377 | Ga0207649_10191455 | 3300025920 | Bacteria | 1439 |
| 378 | Ga0207649_10235144 | 3300025920 | Unclassified | 1312 |
| 379 | Ga0207652_10003277 | 3300025921 | Bacteria | 13414 |
| 380 | Ga0207652_10004500 | 3300025921 | Bacteria | 11323 |
| 381 | Ga0207652_10005110 | 3300025921 | Bacteria | 10650 |
| 382 | Ga0207652_10026829 | 3300025921 | Bacteria | 4800 |
| 383 | Ga0207652_10059785 | 3300025921 | Bacteria | 3286 |
| 384 | Ga0207652_10184043 | 3300025921 | Bacteria | 1878 |
| 385 | Ga0207646_10039331 | 3300025922 | Bacteria | 4257 |
| 386 | Ga0207646_10206412 | 3300025922 | Bacteria | 1774 |
| 387 | Ga0207694_10082941 | 3300025924 | Bacteria | 2520 |
| 388 | Ga0207650_10008792 | 3300025925 | Bacteria | 6901 |
| 389 | Ga0207659_10014892 | 3300025926 | Bacteria | 5027 |
| 390 | Ga0207659_10093949 | 3300025926 | Bacteria | 2246 |
| 391 | Ga0207659_10337022 | 3300025926 | Bacteria | 1248 |
| 392 | Ga0207687_10007807 | 3300025927 | Bacteria | 7015 |
| 393 | Ga0207700_10018003 | 3300025928 | Bacteria | 4733 |
| 394 | Ga0207700_10159309 | 3300025928 | Bacteria | 1873 |
| 395 | Ga0207700_10510769 | 3300025928 | Bacteria | 1064 |
| 396 | Ga0207664_10000121 | 3300025929 | Bacteria | 68207 |
| 397 | Ga0207664_10000908 | 3300025929 | Bacteria | 19993 |
| 398 | Ga0207664_10113663 | 3300025929 | Bacteria | 2255 |
| 399 | Ga0207664_10330799 | 3300025929 | Bacteria | 1346 |
| 400 | Ga0207644_10021503 | 3300025931 | Bacteria | 4395 |
| 401 | Ga0207644_10073215 | 3300025931 | Bacteria | 2512 |
| 402 | Ga0207644_10281060 | 3300025931 | Bacteria | 1336 |
| 403 | Ga0207690_10015371 | 3300025932 | Bacteria | 4637 |
| 404 | Ga0207690_10021246 | 3300025932 | Bacteria | 4023 |
| 405 | Ga0207706_10158497 | 3300025933 | Bacteria | 1990 |
| 406 | Ga0207686_10227806 | 3300025934 | Bacteria | 1349 |
| 407 | Ga0207686_10277571 | 3300025934 | Bacteria | 1235 |
| 408 | Ga0207709_10295861 | 3300025935 | Bacteria | 1202 |
| 409 | Ga0207670_10044013 | 3300025936 | Bacteria | 2952 |
| 410 | Ga0207670_10048410 | 3300025936 | Bacteria | 2837 |
| 411 | Ga0207670_10069384 | 3300025936 | Bacteria | 2431 |
| 412 | Ga0207670_10086534 | 3300025936 | Bacteria | 2205 |
| 413 | Ga0207669_10045217 | 3300025937 | Bacteria | 2593 |
| 414 | Ga0207665_10025540 | 3300025939 | Bacteria | 3898 |
| 415 | Ga0207665_10212308 | 3300025939 | Bacteria | 1414 |
| 416 | Ga0207691_10009738 | 3300025940 | Bacteria | 9223 |
| 417 | Ga0207691_10208844 | 3300025940 | Bacteria | 1697 |
| 418 | Ga0207711_10034448 | 3300025941 | Bacteria | 4289 |
| 419 | Ga0207711_10182944 | 3300025941 | Bacteria | 1907 |
| 420 | Ga0207711_10470606 | 3300025941 | Bacteria | 1170 |
| 421 | Ga0207711_10479673 | 3300025941 | Unclassified | 1158 |
| 422 | Ga0207689_10004151 | 3300025942 | Bacteria | 13169 |
| 423 | Ga0207689_10086399 | 3300025942 | Bacteria | 2578 |
| 424 | Ga0207661_10017412 | 3300025944 | Bacteria | 5317 |
| 425 | Ga0207661_10021239 | 3300025944 | Bacteria | 4863 |
| 426 | Ga0207661_10057525 | 3300025944 | Bacteria | 3127 |
| 427 | Ga0207661_10065426 | 3300025944 | Bacteria | 2951 |
| 428 | Ga0207661_10122767 | 3300025944 | Bacteria | 2214 |
| 429 | Ga0207661_10218999 | 3300025944 | Bacteria | 1682 |
| 430 | Ga0207661_10317868 | 3300025944 | Bacteria | 1399 |
| 431 | Ga0207661_10368867 | 3300025944 | Bacteria | 1298 |
| 432 | Ga0207679_10001724 | 3300025945 | Bacteria | 13613 |
| 433 | Ga0207679_10070604 | 3300025945 | Bacteria | 2632 |
| 434 | Ga0207679_10153076 | 3300025945 | Bacteria | 1879 |
| 435 | Ga0207667_10046202 | 3300025949 | Bacteria | 4610 |
| 436 | Ga0207667_10185725 | 3300025949 | Bacteria | 2134 |
| 437 | Ga0207667_10368423 | 3300025949 | Bacteria | 1464 |
| 438 | Ga0207651_10040089 | 3300025960 | Bacteria | 3095 |
| 439 | Ga0207668_10068207 | 3300025972 | Bacteria | 2528 |
| 440 | Ga0207668_10129687 | 3300025972 | Unclassified | 1924 |
| 441 | Ga0207658_10251144 | 3300025986 | Bacteria | 1503 |
| 442 | Ga0207677_10011454 | 3300026023 | Bacteria | 5060 |
| 443 | Ga0207677_10109977 | 3300026023 | Bacteria | 2050 |
| 444 | Ga0207703_10039059 | 3300026035 | Bacteria | 3792 |
| 445 | Ga0207703_10057066 | 3300026035 | Bacteria | 3182 |
| 446 | Ga0207703_10127250 | 3300026035 | Bacteria | 2195 |
| 447 | Ga0207703_10221336 | 3300026035 | Bacteria | 1692 |
| 448 | Ga0207639_10169575 | 3300026041 | Bacteria | 1847 |
| 449 | Ga0207678_10003455 | 3300026067 | Bacteria | 14239 |
| 450 | Ga0207678_10020275 | 3300026067 | Bacteria | 5834 |
| 451 | Ga0207678_10038256 | 3300026067 | Bacteria | 4169 |
| 452 | Ga0207708_10012398 | 3300026075 | Bacteria | 6354 |
| 453 | Ga0207708_10016793 | 3300026075 | Bacteria | 5510 |
| 454 | Ga0207708_10030879 | 3300026075 | Bacteria | 4065 |
| 455 | Ga0207702_10003496 | 3300026078 | Bacteria | 14316 |
| 456 | Ga0207702_10166019 | 3300026078 | Bacteria | 2020 |
| 457 | Ga0207702_10234471 | 3300026078 | Bacteria | 1716 |
| 458 | Ga0207641_10024973 | 3300026088 | Bacteria | 4927 |
| 459 | Ga0207648_10015351 | 3300026089 | Bacteria | 7046 |
| 460 | Ga0207648_10171408 | 3300026089 | Bacteria | 1918 |
| 461 | Ga0207648_10186761 | 3300026089 | Bacteria | 1836 |
| 462 | Ga0207676_10001025 | 3300026095 | Bacteria | 21364 |
| 463 | Ga0207676_10137357 | 3300026095 | Bacteria | 2088 |
| 464 | Ga0207674_10010726 | 3300026116 | Bacteria | 10342 |
| 465 | Ga0207674_10028008 | 3300026116 | Bacteria | 5954 |
| 466 | Ga0207674_10030859 | 3300026116 | Bacteria | 5633 |
| 467 | Ga0207674_10031713 | 3300026116 | Bacteria | 5549 |
| 468 | Ga0207674_10249408 | 3300026116 | Bacteria | 1722 |
| 469 | Ga0207675_100534619 | 3300026118 | Bacteria | 1170 |
| 470 | Ga0207683_10000792 | 3300026121 | Bacteria | 28821 |
| 471 | Ga0207683_10102182 | 3300026121 | Bacteria | 2560 |
| 472 | Ga0207698_10001508 | 3300026142 | Bacteria | 13550 |
| 473 | Ga0209998_10034400 | 3300027717 | Bacteria | 1133 |
| 474 | Ga0207428_10032737 | 3300027907 | Bacteria | 4275 |
| 475 | Ga0207428_10137104 | 3300027907 | Bacteria | 1870 |
| 476 | Ga0268266_10015764 | 3300028379 | Bacteria | 6473 |
| 477 | Ga0268266_10036232 | 3300028379 | Bacteria | 4198 |
| 478 | Ga0268266_10291146 | 3300028379 | Bacteria | 1521 |
| 479 | Ga0268265_10224447 | 3300028380 | Bacteria | 1646 |
| 480 | Ga0268264_10205704 | 3300028381 | Bacteria | 1804 |
| 481 | Ga0265322_10005052 | 3300028654 | Bacteria | 3910 |
| 482 | Ga0265322_10015144 | 3300028654 | Bacteria | 2230 |
| 483 | Ga0265338_10004565 | 3300028800 | Bacteria | 18629 |
| 484 | Ga0265338_10075824 | 3300028800 | Bacteria | 2852 |
| 485 | Ga0307512_10006564 | 3300030522 | Bacteria | 11755 |
| 486 | Ga0265328_10041600 | 3300031239 | Bacteria | 1692 |
| 487 | Ga0265320_10014590 | 3300031240 | Bacteria | 4466 |
| 488 | Ga0265329_10056499 | 3300031242 | Bacteria | 1244 |
| 489 | Ga0265340_10014521 | 3300031247 | Bacteria | 4112 |
| 490 | Ga0265340_10031664 | 3300031247 | Bacteria | 2644 |
| 491 | Ga0265327_10006161 | 3300031251 | Bacteria | 9695 |
| 492 | Ga0265327_10012094 | 3300031251 | Bacteria | 5858 |
| 493 | Ga0265327_10047637 | 3300031251 | Bacteria | 2259 |
| 494 | Ga0265327_10092789 | 3300031251 | Bacteria | 1469 |
| 495 | Ga0265316_10002772 | 3300031344 | Bacteria | 17956 |
| 496 | Ga0307513_10018297 | 3300031456 | Bacteria | 8376 |
| 497 | Ga0307509_10203601 | 3300031507 | Bacteria | 1813 |
| 498 | Ga0307408_100077042 | 3300031548 | Bacteria | 2482 |
| 499 | Ga0265313_10005148 | 3300031595 | Bacteria | 9720 |
| 500 | Ga0265314_10104712 | 3300031711 | Bacteria | 1811 |
| 501 | Ga0265342_10005387 | 3300031712 | Bacteria | 9773 |
| 502 | Ga0316576_10033708 | 3300031727 | Bacteria | 3647 |
| 503 | Ga0307516_10002263 | 3300031730 | Bacteria | 25980 |
| 504 | Ga0307516_10084950 | 3300031730 | Bacteria | 3003 |
| 505 | Ga0307405_10007230 | 3300031731 | Bacteria | 5533 |
| 506 | Ga0307405_10038317 | 3300031731 | Bacteria | 2888 |
| 507 | Ga0307413_10012460 | 3300031824 | Bacteria | 4235 |
| 508 | Ga0307406_10009395 | 3300031901 | Bacteria | 5482 |
| 509 | Ga0307406_10032073 | 3300031901 | Bacteria | 3204 |
| 510 | Ga0307412_10002452 | 3300031911 | Bacteria | 10313 |
| 511 | Ga0307409_100311301 | 3300031995 | Bacteria | 1470 |
| 512 | Ga0307411_10013450 | 3300032005 | Bacteria | 4516 |
| 513 | Ga0307415_100013875 | 3300032126 | Bacteria | 4717 |
| 514 | Ga0307415_100296598 | 3300032126 | Bacteria | 1337 |
| 515 | Ga0316583_10010822 | 3300032133 | Bacteria | 3287 |
| 516 | Ga0316214_1003450 | 3300033545 | Bacteria | 1995 |
| 517 | Ga0373926_0022338 | 3300035083 | Bacteria | 2196 |
| 518 | Ga0373944_0015764 | 3300035089 | Bacteria | 2124 |
| 519 | Ga0373936_0007825 | 3300035113 | Bacteria | 4015 |
| 520 | Ga0373936_0028633 | 3300035113 | Bacteria | 2190 |
| 521 | Ga0373945_0047548 | 3300035116 | Bacteria | 1569 |
| 522 | Ga0373953_0020991 | 3300035117 | Bacteria | 2446 |
| 523 | Ga0373953_0029837 | 3300035117 | Bacteria | 2111 |
| 524 | Ga0373954_0022064 | 3300035118 | Bacteria | 2887 |
| 525 | Ga0373957_0037683 | 3300035120 | Bacteria | 1807 |
| 526 | Ga0373943_0002734 | 3300035170 | Bacteria | 8021 |
| 527 | Ga0373943_0004387 | 3300035170 | Bacteria | 6397 |
| 528 | Ga0373946_0001078 | 3300035171 | Bacteria | 9404 |
| 529 | Ga0373946_0050879 | 3300035171 | Bacteria | 1732 |
| 530 | Ga0373942_0000034 | 3300035207 | Bacteria | 25653 |
| 531 | Ga0316574_0169510 | 3300035398 | Unclassified | 1406 |
| 532 | Ga0373931_0053536 | 3300035691 | Bacteria | 2154 |
| 533 | Ga0373935_0007767 | 3300035692 | Bacteria | 6427 |
| 534 | Ga0373927_0015160 | 3300035695 | Bacteria | 5096 |
| 535 | Ga0373933_0186375 | 3300035724 | Bacteria | 1324 |
| 536 | Ga0373947_0013733 | 3300035725 | Bacteria | 4640 |
| 537 | Ga0373947_0017071 | 3300035725 | Bacteria | 4173 |
| 538 | Ga0373947_0089785 | 3300035725 | Bacteria | 1914 |
| 539 | Ga0373937_0434946 | 3300036401 | Bacteria | 1245 |
| 540 | Ga0373925_0061651 | 3300037068 | Bacteria | 2817 |
| 541 | Ga0395900_0023444 | 3300037418 | Bacteria | 6317 |
| 542 | Ga0395900_0181312 | 3300037418 | Bacteria | 2140 |
| 543 | Ga0395900_0193252 | 3300037418 | Bacteria | 2063 |
| 544 | Ga0395900_0237740 | 3300037418 | Bacteria | 1829 |
| 545 | Ga0395900_0284361 | 3300037418 | Bacteria | 1645 |
| 546 | Ga0395898_0010338 | 3300037466 | Bacteria | 9763 |
| 547 | Ga0395898_0155639 | 3300037466 | Bacteria | 2186 |
| 548 | Ga0395898_0218632 | 3300037466 | Bacteria | 1817 |
| 549 | Ga0395898_0314269 | 3300037466 | Bacteria | 1495 |
| 550 | Ga0395905_0041967 | 3300037471 | Bacteria | 4292 |
| 551 | Ga0436364_0465814 | 3300037853 | Bacteria | 1404 |
| 552 | Ga0436364_0695796 | 3300037853 | Bacteria | 1953 |
| 553 | Ga0436364_0894784 | 3300037853 | Bacteria | 39842 |
| 554 | Ga0436364_1268460 | 3300037853 | Bacteria | 4369 |
| 555 | Ga0395901_0014883 | 3300038443 | Bacteria | 7904 |
| 556 | Ga0395901_0023843 | 3300038443 | Bacteria | 6275 |
| 557 | Ga0395901_0029607 | 3300038443 | Bacteria | 5639 |
| 558 | Ga0395901_0032500 | 3300038443 | Bacteria | 5383 |
| 559 | Ga0395901_0172388 | 3300038443 | Bacteria | 2270 |
| 560 | Ga0395901_0192377 | 3300038443 | Bacteria | 2139 |
| 561 | Ga0436365_0225286 | 3300039437 | Bacteria | 6314 |
| 562 | Ga0451853_0837686 | 3300041512 | Bacteria | 1656 |
| 563 | Ga0439441_005941 | 3300042001 | Bacteria | 1917 |
| 564 | Ga0466969_0008010 | 3300044656 | Bacteria | 5610 |
| 565 | Ga0466969_0021926 | 3300044656 | Bacteria | 3302 |
| 566 | Ga0466969_0087567 | 3300044656 | Bacteria | 1479 |
| 567 | Ga0466965_0037302 | 3300044683 | Bacteria | 2386 |
| 568 | Ga0466965_0073398 | 3300044683 | Bacteria | 1723 |
| 569 | Ga0466966_0032902 | 3300044684 | Bacteria | 3356 |
| 570 | Ga0466966_0037705 | 3300044684 | Bacteria | 3115 |
| 571 | Ga0466966_0055725 | 3300044684 | Bacteria | 2502 |
| 572 | Ga0466966_0075026 | 3300044684 | Bacteria | 2113 |
| 573 | Ga0466966_0179317 | 3300044684 | Bacteria | 1286 |
| 574 | Ga0466966_0186847 | 3300044684 | Bacteria | 1256 |
| 575 | Ga0466961_0032074 | 3300044693 | Bacteria | 3376 |
| 576 | Ga0466961_0090308 | 3300044693 | Bacteria | 1935 |
| 577 | Ga0466961_0096204 | 3300044693 | Bacteria | 1867 |
| 578 | Ga0466963_0000749 | 3300044694 | Bacteria | 16031 |
| 579 | Ga0466963_0006029 | 3300044694 | Bacteria | 7143 |
| 580 | Ga0466963_0006648 | 3300044694 | Bacteria | 6865 |
| 581 | Ga0466963_0017102 | 3300044694 | Bacteria | 4517 |
| 582 | Ga0466963_0017754 | 3300044694 | Bacteria | 4438 |
| 583 | Ga0466963_0038462 | 3300044694 | Bacteria | 3128 |
| 584 | Ga0466963_0045489 | 3300044694 | Bacteria | 2891 |
| 585 | Ga0466963_0061660 | 3300044694 | Bacteria | 2507 |
| 586 | Ga0466963_0083324 | 3300044694 | Bacteria | 2169 |
| 587 | Ga0466963_0102307 | 3300044694 | Bacteria | 1962 |
| 588 | Ga0466963_0157971 | 3300044694 | Bacteria | 1577 |
| 589 | Ga0466963_0225345 | 3300044694 | Bacteria | 1313 |
| 590 | Ga0466964_0012820 | 3300044706 | Bacteria | 3175 |
| 591 | Ga0466964_0013154 | 3300044706 | Bacteria | 3137 |
| 592 | Ga0466971_0000953 | 3300044719 | Bacteria | 11883 |
| 593 | Ga0466971_0012982 | 3300044719 | Bacteria | 3655 |
| 594 | Ga0466971_0027791 | 3300044719 | Bacteria | 2534 |
| 595 | Ga0466971_0101484 | 3300044719 | Bacteria | 1323 |
| 596 | Ga0466971_0175750 | 3300044719 | Bacteria | 1006 |
| 597 | Ga0466970_0090667 | 3300044765 | Bacteria | 1659 |
| 598 | Ga0466970_0151782 | 3300044765 | Bacteria | 1279 |
| 599 | Ga0466957_0009367 | 3300044842 | Bacteria | 5590 |
| 600 | Ga0466957_0089460 | 3300044842 | Bacteria | 1927 |
| 601 | Ga0466957_0106225 | 3300044842 | Bacteria | 1775 |
| 602 | Ga0466957_0131880 | 3300044842 | Bacteria | 1602 |
| 603 | Ga0466957_0249448 | 3300044842 | Bacteria | 1180 |
| 604 | Ga0466957_0289089 | 3300044842 | Bacteria | 1099 |
| 605 | Ga0466960_0018295 | 3300044901 | Bacteria | 3068 |
| 606 | Ga0466960_0033894 | 3300044901 | Bacteria | 2376 |
| 607 | Ga0466959_0026254 | 3300045049 | Bacteria | 4317 |
| 608 | Ga0466959_0039680 | 3300045049 | Bacteria | 3480 |
| 609 | Ga0466959_0057085 | 3300045049 | Bacteria | 2847 |
| 610 | Ga0466959_0134719 | 3300045049 | Bacteria | 1749 |
| 611 | Ga0466958_0005719 | 3300045836 | Bacteria | 6716 |
| 612 | Ga0466958_0046699 | 3300045836 | Bacteria | 2613 |
| 613 | Ga0466958_0072693 | 3300045836 | Bacteria | 2106 |
| 614 | Ga0466958_0087803 | 3300045836 | Bacteria | 1920 |
| 615 | Ga0466958_0235829 | 3300045836 | Bacteria | 1169 |
| 616 | Ga0466967_0004426 | 3300045976 | Bacteria | 9469 |
| 617 | Ga0466967_0004744 | 3300045976 | Bacteria | 9249 |
| 618 | Ga0466967_0005187 | 3300045976 | Bacteria | 8972 |
| 619 | Ga0466967_0012170 | 3300045976 | Bacteria | 6565 |
| 620 | Ga0466967_0012876 | 3300045976 | Bacteria | 6429 |
| 621 | Ga0466967_0017662 | 3300045976 | Bacteria | 5674 |
| 622 | Ga0466967_0017986 | 3300045976 | Bacteria | 5634 |
| 623 | Ga0466967_0023454 | 3300045976 | Bacteria | 5056 |
| 624 | Ga0466967_0040124 | 3300045976 | Bacteria | 4028 |
| 625 | Ga0466967_0056432 | 3300045976 | Bacteria | 3463 |
| 626 | Ga0466967_0120303 | 3300045976 | Bacteria | 2425 |
| 627 | Ga0466967_0124430 | 3300045976 | Bacteria | 2387 |
| 628 | Ga0466967_0157467 | 3300045976 | Bacteria | 2129 |
| 629 | Ga0466967_0188567 | 3300045976 | Bacteria | 1948 |
| 630 | Ga0466967_0195024 | 3300045976 | Bacteria | 1916 |
| 631 | Ga0466967_0199666 | 3300045976 | Bacteria | 1893 |
| 632 | Ga0466967_0251830 | 3300045976 | Bacteria | 1687 |
| 633 | Ga0466967_0429823 | 3300045976 | Bacteria | 1288 |
| 634 | Ga0466967_0544034 | 3300045976 | Bacteria | 1143 |
| 635 | Ga0495592_0048020 | 3300046454 | Bacteria | 3177 |
| 636 | Ga0495592_0121055 | 3300046454 | Bacteria | 1841 |
| 637 | Ga0495603_0019038 | 3300046455 | Bacteria | 4157 |
| 638 | Ga0495603_0134315 | 3300046455 | Bacteria | 1440 |
| 639 | Ga0495603_0196445 | 3300046455 | Unclassified | 1166 |
| 640 | Ga0495629_0001941 | 3300046459 | Bacteria | 16113 |
| 641 | Ga0495629_0251563 | 3300046459 | Bacteria | 1216 |
| 642 | Ga0495641_0001041 | 3300046461 | Bacteria | 23833 |
| 643 | Ga0495641_0019363 | 3300046461 | Bacteria | 3485 |
| 644 | Ga0495641_0129742 | 3300046461 | Bacteria | 1125 |
| 645 | Ga0495641_0131458 | 3300046461 | Bacteria | 1117 |
| 646 | Ga0495651_0026735 | 3300046462 | Bacteria | 4494 |
| 647 | Ga0495651_0104853 | 3300046462 | Bacteria | 2098 |
| 648 | Ga0495651_0133590 | 3300046462 | Bacteria | 1809 |
| 649 | Ga0495651_0150057 | 3300046462 | Bacteria | 1681 |
| 650 | Ga0495653_0026115 | 3300046463 | Bacteria | 4687 |
| 651 | Ga0495653_0088407 | 3300046463 | Bacteria | 2273 |
| 652 | Ga0495653_0259179 | 3300046463 | Bacteria | 1150 |
| 653 | Ga0495582_0000040 | 3300046473 | Bacteria | 66496 |
| 654 | Ga0495582_0071111 | 3300046473 | Bacteria | 1925 |
| 655 | Ga0495639_0001045 | 3300046475 | Bacteria | 12486 |
| 656 | Ga0495639_0057645 | 3300046475 | Bacteria | 1775 |
| 657 | Ga0495662_0002364 | 3300046476 | Bacteria | 9506 |
| 658 | Ga0495664_0046071 | 3300046477 | Bacteria | 2587 |
| 659 | Ga0495585_0082609 | 3300046492 | Bacteria | 1739 |
| 660 | Ga0495594_0073010 | 3300046499 | Bacteria | 1909 |
| 661 | Ga0495608_0018595 | 3300046511 | Bacteria | 4790 |
| 662 | Ga0495608_0033126 | 3300046511 | Bacteria | 3494 |
| 663 | Ga0495608_0034838 | 3300046511 | Bacteria | 3398 |
| 664 | Ga0495608_0112341 | 3300046511 | Bacteria | 1751 |
| 665 | Ga0495608_0124252 | 3300046511 | Bacteria | 1653 |
| 666 | Ga0495618_0157043 | 3300046514 | Bacteria | 1451 |
| 667 | Ga0495628_0012316 | 3300046516 | Bacteria | 7210 |
| 668 | Ga0495628_0213064 | 3300046516 | Bacteria | 1452 |
| 669 | Ga0495630_0010867 | 3300046517 | Bacteria | 6574 |
| 670 | Ga0495630_0042743 | 3300046517 | Bacteria | 3384 |
| 671 | Ga0495630_0081771 | 3300046517 | Bacteria | 2438 |
| 672 | Ga0495630_0106320 | 3300046517 | Bacteria | 2125 |
| 673 | Ga0495652_0026147 | 3300046529 | Bacteria | 5158 |
| 674 | Ga0495652_0028913 | 3300046529 | Bacteria | 4871 |
| 675 | Ga0495665_0020103 | 3300046531 | Bacteria | 3587 |
| 676 | Ga0495640_0002735 | 3300046533 | Bacteria | 14190 |
| 677 | Ga0495640_0009964 | 3300046533 | Bacteria | 7367 |
| 678 | Ga0495640_0062132 | 3300046533 | Bacteria | 2534 |
| 679 | Ga0495640_0086997 | 3300046533 | Bacteria | 2068 |
| 680 | Ga0495640_0110831 | 3300046533 | Bacteria | 1794 |
| 681 | Ga0495640_0156781 | 3300046533 | Bacteria | 1461 |
| 682 | Ga0495645_0077262 | 3300046543 | Bacteria | 2394 |
| 683 | Ga0495645_0140680 | 3300046543 | Bacteria | 1684 |
| 684 | Ga0495667_0003849 | 3300046559 | Bacteria | 10076 |
| 685 | Ga0495667_0019788 | 3300046559 | Bacteria | 4542 |
| 686 | Ga0495667_0037152 | 3300046559 | Bacteria | 3247 |
| 687 | Ga0495667_0049276 | 3300046559 | Bacteria | 2780 |
| 688 | Ga0495634_0022497 | 3300046642 | Bacteria | 4441 |
| 689 | Ga0495634_0041779 | 3300046642 | Bacteria | 3113 |
| 690 | Ga0495634_0108254 | 3300046642 | Bacteria | 1789 |
| 691 | Ga0495634_0134650 | 3300046642 | Bacteria | 1573 |
| 692 | Ga0495635_0004513 | 3300046663 | Bacteria | 9645 |
| 693 | Ga0495635_0034255 | 3300046663 | Bacteria | 3522 |
| 694 | Ga0495657_0031238 | 3300046675 | Bacteria | 3723 |
| 695 | Ga0495657_0082512 | 3300046675 | Bacteria | 2077 |
| 696 | Ga0495599_0032694 | 3300046678 | Bacteria | 3266 |
| 697 | Ga0495599_0037108 | 3300046678 | Bacteria | 3062 |
| 698 | Ga0495623_0021908 | 3300046679 | Bacteria | 4127 |
| 699 | Ga0495647_0005989 | 3300046681 | Bacteria | 4007 |
| 700 | Ga0495658_0000450 | 3300046683 | Bacteria | 22926 |
| 701 | Ga0495658_0013929 | 3300046683 | Bacteria | 4100 |
| 702 | Ga0495658_0110840 | 3300046683 | Bacteria | 1650 |
| 703 | Ga0495658_0146186 | 3300046683 | Bacteria | 1449 |
| 704 | Ga0495613_0050958 | 3300046689 | Bacteria | 3052 |
| 705 | Ga0495613_0083184 | 3300046689 | Bacteria | 2324 |
| 706 | Ga0495613_0175180 | 3300046689 | Bacteria | 1521 |
| 707 | Ga0495624_0004825 | 3300046690 | Bacteria | 9805 |
| 708 | Ga0495624_0078969 | 3300046690 | Bacteria | 2041 |
| 709 | Ga0495600_0012025 | 3300046809 | Bacteria | 5405 |
| 710 | Ga0495600_0054154 | 3300046809 | Bacteria | 2620 |
| 711 | Ga0495600_0175595 | 3300046809 | Bacteria | 1381 |
| 712 | Ga0495581_0001232 | 3300047315 | Bacteria | 14105 |
| 713 | Ga0495581_0045205 | 3300047315 | Bacteria | 2546 |
| 714 | Ga0495604_0035277 | 3300047317 | Bacteria | 3951 |
| 715 | Ga0495674_0062408 | 3300047319 | Bacteria | 3245 |
| 716 | Ga0495674_0100284 | 3300047319 | Bacteria | 2464 |
| 717 | Ga0495674_0245874 | 3300047319 | Bacteria | 1473 |
| 718 | Ga0495676_0001870 | 3300047321 | Bacteria | 18467 |
| 719 | Ga0495676_0078177 | 3300047321 | Bacteria | 2520 |
| 720 | Ga0495676_0090917 | 3300047321 | Bacteria | 2283 |
| 721 | Ga0495676_0093777 | 3300047321 | Bacteria | 2238 |
| 722 | Ga0495680_0000491 | 3300047322 | Bacteria | 44586 |
| 723 | Ga0495680_0006927 | 3300047322 | Bacteria | 10461 |
| 724 | Ga0495680_0007167 | 3300047322 | Bacteria | 10270 |
| 725 | Ga0495680_0008828 | 3300047322 | Bacteria | 9124 |
| 726 | Ga0495680_0053787 | 3300047322 | Bacteria | 3130 |
| 727 | Ga0495675_0021630 | 3300047444 | Bacteria | 4098 |
| 728 | Ga0495684_0003165 | 3300047471 | Bacteria | 12900 |
| 729 | Ga0495684_0010242 | 3300047471 | Bacteria | 7251 |
| 730 | Ga0495684_0071192 | 3300047471 | Bacteria | 2642 |
| 731 | Ga0495684_0172521 | 3300047471 | Bacteria | 1607 |
| 732 | Ga0495684_0182607 | 3300047471 | Bacteria | 1554 |
| 733 | Ga0495593_0003136 | 3300047673 | Bacteria | 9935 |
| 734 | Ga0495602_0014799 | 3300048088 | Bacteria | 7900 |
| 735 | Ga0495602_0106416 | 3300048088 | Bacteria | 2290 |
| 736 | Ga0496100_0001260 | 3300048903 | Bacteria | 12348 |
| 737 | Ga0496100_0019675 | 3300048903 | Bacteria | 4033 |
| 738 | Ga0496100_0039598 | 3300048903 | Bacteria | 2993 |
| 739 | Ga0496100_0051870 | 3300048903 | Bacteria | 2665 |
| 740 | Ga0496100_0080475 | 3300048903 | Bacteria | 2199 |
| 741 | Ga0496100_0142497 | 3300048903 | Bacteria | 1700 |
| 742 | Ga0496100_0196196 | 3300048903 | Bacteria | 1469 |
| 743 | Ga0496101_0007015 | 3300048904 | Bacteria | 7278 |
| 744 | Ga0496101_0007164 | 3300048904 | Bacteria | 7211 |
| 745 | Ga0496101_0010403 | 3300048904 | Bacteria | 6144 |
| 746 | Ga0496101_0014000 | 3300048904 | Bacteria | 5387 |
| 747 | Ga0496101_0180490 | 3300048904 | Bacteria | 1625 |
| 748 | Ga0496102_0010875 | 3300048905 | Bacteria | 7834 |
| 749 | Ga0496102_0033240 | 3300048905 | Bacteria | 4633 |
| 750 | Ga0496102_0072878 | 3300048905 | Bacteria | 3157 |
| 751 | Ga0496102_0076438 | 3300048905 | Bacteria | 3080 |
| 752 | Ga0496102_0194872 | 3300048905 | Bacteria | 1909 |
| 753 | Ga0496102_0234148 | 3300048905 | Bacteria | 1731 |
| 754 | Ga0496102_0426609 | 3300048905 | Bacteria | 1245 |
| 755 | Ga0496103_0067164 | 3300048906 | Bacteria | 2239 |
| 756 | Ga0496103_0139549 | 3300048906 | Bacteria | 1549 |
| 757 | Ga0496104_0033265 | 3300048907 | Bacteria | 4801 |
| 758 | Ga0496104_0035968 | 3300048907 | Bacteria | 4626 |
| 759 | Ga0496104_0044264 | 3300048907 | Bacteria | 4182 |
| 760 | Ga0496104_0055304 | 3300048907 | Bacteria | 3753 |
| 761 | Ga0496104_0098458 | 3300048907 | Bacteria | 2799 |
| 762 | Ga0496104_0111985 | 3300048907 | Bacteria | 2617 |
| 763 | Ga0496104_0131303 | 3300048907 | Bacteria | 2406 |
| 764 | Ga0496104_0172146 | 3300048907 | Bacteria | 2076 |
| 765 | Ga0496105_0000333 | 3300048908 | Bacteria | 30838 |
| 766 | Ga0496105_0004652 | 3300048908 | Bacteria | 10345 |
| 767 | Ga0496105_0008768 | 3300048908 | Bacteria | 7870 |
| 768 | Ga0496105_0013556 | 3300048908 | Bacteria | 6476 |
| 769 | Ga0496106_0000466 | 3300048909 | Bacteria | 29034 |
| 770 | Ga0496106_0003605 | 3300048909 | Bacteria | 11546 |
| 771 | Ga0496106_0008841 | 3300048909 | Bacteria | 7444 |
| 772 | Ga0496106_0016160 | 3300048909 | Bacteria | 5520 |
| 773 | Ga0496106_0053940 | 3300048909 | Bacteria | 3037 |
| 774 | Ga0496106_0122841 | 3300048909 | Bacteria | 2031 |
| 775 | Ga0496106_0210058 | 3300048909 | Bacteria | 1550 |
| 776 | Ga0496107_0003792 | 3300048910 | Bacteria | 10153 |
| 777 | Ga0496107_0004038 | 3300048910 | Bacteria | 9885 |
| 778 | Ga0496107_0010862 | 3300048910 | Bacteria | 6335 |
| 779 | Ga0496107_0019386 | 3300048910 | Bacteria | 4798 |
| 780 | Ga0496107_0056250 | 3300048910 | Bacteria | 2842 |
| 781 | Ga0496107_0240017 | 3300048910 | Bacteria | 1348 |
| 782 | Ga0496107_0386874 | 3300048910 | Bacteria | 1040 |
| 783 | Ga0496108_0014051 | 3300048911 | Bacteria | 6533 |
| 784 | Ga0496108_0023295 | 3300048911 | Bacteria | 5093 |
| 785 | Ga0496108_0039172 | 3300048911 | Bacteria | 3951 |
| 786 | Ga0496108_0050415 | 3300048911 | Bacteria | 3484 |
| 787 | Ga0496108_0140672 | 3300048911 | Bacteria | 2079 |
| 788 | Ga0496108_0232829 | 3300048911 | Bacteria | 1602 |
| 789 | Ga0496108_0232842 | 3300048911 | Bacteria | 1602 |
| 790 | Ga0496108_0369924 | 3300048911 | Bacteria | 1251 |
| 791 | Ga0496109_0005464 | 3300048912 | Bacteria | 10630 |
| 792 | Ga0496109_0007198 | 3300048912 | Bacteria | 9402 |
| 793 | Ga0496109_0024064 | 3300048912 | Bacteria | 5411 |
| 794 | Ga0496109_0051651 | 3300048912 | Bacteria | 3744 |
| 795 | Ga0496110_0022283 | 3300048913 | Bacteria | 5377 |
| 796 | Ga0496110_0035660 | 3300048913 | Bacteria | 4316 |
| 797 | Ga0496110_0040212 | 3300048913 | Bacteria | 4075 |
| 798 | Ga0496110_0057306 | 3300048913 | Bacteria | 3430 |
| 799 | Ga0496110_0136018 | 3300048913 | Bacteria | 2220 |
| 800 | Ga0496110_0200311 | 3300048913 | Bacteria | 1814 |
| 801 | Ga0496111_0006189 | 3300048914 | Bacteria | 7750 |
| 802 | Ga0496111_0058989 | 3300048914 | Bacteria | 2780 |
| 803 | Ga0496111_0087906 | 3300048914 | Bacteria | 2275 |
| 804 | Ga0496111_0157963 | 3300048914 | Unclassified | 1683 |
| 805 | Ga0496112_0000822 | 3300048915 | Bacteria | 22028 |
| 806 | Ga0496112_0001908 | 3300048915 | Bacteria | 16451 |
| 807 | Ga0496112_0011157 | 3300048915 | Bacteria | 8192 |
| 808 | Ga0496112_0251446 | 3300048915 | Bacteria | 1718 |
| 809 | Ga0496112_0285618 | 3300048915 | Bacteria | 1596 |
| 810 | Ga0496112_0329657 | 3300048915 | Bacteria | 1470 |
| 811 | Ga0496113_0029554 | 3300048916 | Bacteria | 3959 |
| 812 | Ga0496113_0030307 | 3300048916 | Bacteria | 3916 |
| 813 | Ga0496113_0037070 | 3300048916 | Bacteria | 3576 |
| 814 | Ga0496114_0008203 | 3300048917 | Bacteria | 8279 |
| 815 | Ga0496114_0016445 | 3300048917 | Bacteria | 5962 |
| 816 | Ga0496114_0072237 | 3300048917 | Bacteria | 2902 |
| 817 | Ga0496114_0109058 | 3300048917 | Bacteria | 2370 |
| 818 | Ga0496114_0129824 | 3300048917 | Bacteria | 2175 |
| 819 | Ga0496114_0195700 | 3300048917 | Bacteria | 1769 |
| 820 | Ga0496114_0426608 | 3300048917 | Bacteria | 1175 |
| 821 | Ga0496115_0001216 | 3300048918 | Bacteria | 18469 |
| 822 | Ga0496115_0002395 | 3300048918 | Bacteria | 13445 |
| 823 | Ga0496115_0083614 | 3300048918 | Bacteria | 2602 |
| 824 | Ga0496115_0250656 | 3300048918 | Bacteria | 1458 |
| 825 | Ga0496115_0433249 | 3300048918 | Bacteria | 1064 |
| 826 | Ga0496116_0002446 | 3300048919 | Bacteria | 19533 |
| 827 | Ga0496116_0030670 | 3300048919 | Bacteria | 3858 |
| 828 | Ga0496118_0208645 | 3300048921 | Bacteria | 1149 |
| 829 | Ga0496119_0001484 | 3300048922 | Bacteria | 28124 |
| 830 | Ga0496119_0002986 | 3300048922 | Bacteria | 17955 |
| 831 | Ga0496121_0201971 | 3300048924 | Unclassified | 1416 |
| 832 | Ga0496122_0012960 | 3300048925 | Bacteria | 8227 |
| 833 | Ga0496125_0031312 | 3300048928 | Bacteria | 4742 |
| 834 | Ga0496126_0012588 | 3300048929 | Bacteria | 8659 |
| 835 | Ga0501031_0023724 | 3300049568 | Bacteria | 3998 |
| 836 | Ga0501034_0012298 | 3300049571 | Bacteria | 8841 |
| 837 | Ga0501034_0470896 | 3300049571 | Bacteria | 1172 |
| 838 | Ga0501036_0061384 | 3300049572 | Bacteria | 3184 |
| 839 | Ga0501036_0068245 | 3300049572 | Bacteria | 3009 |
| 840 | Ga0501038_0162493 | 3300049574 | Bacteria | 1814 |
| 841 | Ga0501039_0066050 | 3300049575 | Bacteria | 2807 |
| 842 | Ga0501040_0049430 | 3300049576 | Bacteria | 2875 |
| 843 | Ga0501040_0101602 | 3300049576 | Bacteria | 2006 |
| 844 | Ga0501040_0107670 | 3300049576 | Bacteria | 1948 |
| 845 | Ga0501040_0141534 | 3300049576 | Bacteria | 1695 |
| 846 | Ga0501041_0049374 | 3300049577 | Bacteria | 2563 |
| 847 | Ga0501041_0092384 | 3300049577 | Bacteria | 1869 |
| 848 | Ga0501046_0165464 | 3300049580 | Bacteria | 1662 |
| 849 | Ga0501046_0457348 | 3300049580 | Bacteria | 917 |
| 850 | Ga0501047_0047874 | 3300049581 | Bacteria | 4130 |
| 851 | Ga0501048_0028553 | 3300049582 | Bacteria | 4050 |
| 852 | Ga0501048_0036658 | 3300049582 | Bacteria | 3524 |
| 853 | Ga0501048_0135423 | 3300049582 | Bacteria | 1741 |
| 854 | Ga0501067_0021609 | 3300049583 | Bacteria | 3561 |
| 855 | Ga0501067_0028170 | 3300049583 | Bacteria | 3112 |
| 856 | Ga0501067_0080332 | 3300049583 | Bacteria | 1807 |
| 857 | Ga0501068_0065938 | 3300049584 | Bacteria | 2205 |
| 858 | Ga0501069_0017404 | 3300049585 | Bacteria | 3867 |
| 859 | Ga0501069_0038966 | 3300049585 | Bacteria | 2624 |
| 860 | Ga0501069_0080811 | 3300049585 | Bacteria | 1831 |
| 861 | Ga0501069_0174179 | 3300049585 | Bacteria | 1242 |
| 862 | Ga0501070_0000917 | 3300049586 | Bacteria | 26697 |
| 863 | Ga0501070_0072820 | 3300049586 | Bacteria | 2844 |
| 864 | Ga0501070_0152691 | 3300049586 | Bacteria | 1905 |
| 865 | Ga0501070_0198953 | 3300049586 | Bacteria | 1646 |
| 866 | Ga0501070_0237962 | 3300049586 | Bacteria | 1490 |
| 867 | Ga0501070_0254723 | 3300049586 | Bacteria | 1435 |
| 868 | Ga0501071_0047925 | 3300049587 | Bacteria | 3071 |
| 869 | Ga0501071_0086392 | 3300049587 | Bacteria | 2301 |
| 870 | Ga0501071_0109960 | 3300049587 | Bacteria | 2036 |
| 871 | Ga0501071_0129792 | 3300049587 | Bacteria | 1872 |
| 872 | Ga0501072_0193172 | 3300049588 | Bacteria | 1623 |
| 873 | Ga0501075_0082673 | 3300049591 | Bacteria | 2432 |
| 874 | Ga0501075_0140915 | 3300049591 | Bacteria | 1837 |
| 875 | Ga0501075_0184295 | 3300049591 | Bacteria | 1592 |
| 876 | Ga0501076_0034855 | 3300049592 | Bacteria | 3937 |
| 877 | Ga0501076_0106040 | 3300049592 | Bacteria | 2268 |
| 878 | Ga0501076_0242391 | 3300049592 | Bacteria | 1475 |
| 879 | Ga0501079_0157622 | 3300049741 | Bacteria | 1770 |
| 880 | Ga0501079_0169065 | 3300049741 | Bacteria | 1705 |
| 881 | Ga0501079_0249039 | 3300049741 | Bacteria | 1388 |
| 882 | Ga0501080_0044527 | 3300049742 | Bacteria | 4131 |
| 883 | Ga0501080_0046017 | 3300049742 | Bacteria | 4064 |
| 884 | Ga0501080_0167212 | 3300049742 | Bacteria | 2029 |
| 885 | Ga0501081_0061123 | 3300049743 | Bacteria | 2612 |
| 886 | Ga0501081_0162945 | 3300049743 | Bacteria | 1607 |
| 887 | Ga0501035_0321232 | 3300049822 | Bacteria | 1301 |
| 888 | Ga0501035_0420292 | 3300049822 | Bacteria | 1110 |
| 889 | Ga0501044_0281378 | 3300049823 | Bacteria | 1597 |
| 890 | Ga0501044_0324664 | 3300049823 | Bacteria | 1463 |
| 891 | Ga0501045_0041237 | 3300049824 | Bacteria | 3359 |
| 892 | Ga0501045_0112161 | 3300049824 | Bacteria | 2022 |
| 893 | Ga0501045_0121798 | 3300049824 | Bacteria | 1937 |
| 894 | Ga0501045_0131208 | 3300049824 | Bacteria | 1862 |
| 895 | Ga0501045_0152272 | 3300049824 | Bacteria | 1721 |
| 896 | nmdc:mga0yw44_230992_c1 | 3300050492 | Bacteria | 1228 |
| 897 | nmdc:mga05p37_136630_c1 | 3300050507 | Unclassified | 3005 |
| 898 | nmdc:mga05p37_22881_c1 | 3300050507 | Bacteria | 7579 |
| 899 | nmdc:mga05p37_239161_c1 | 3300050507 | Bacteria | 2184 |
| 900 | nmdc:mga05p37_317532_c1 | 3300050507 | Bacteria | 1845 |
| 901 | nmdc:mga09592_10530_c1 | 3300050508 | Bacteria | 7523 |
| 902 | nmdc:mga09592_454562_c1 | 3300050508 | Bacteria | 1105 |
| 903 | nmdc:mga06r32_11741_c1 | 3300050510 | Bacteria | 7887 |
| 904 | nmdc:mga06r32_235502_c1 | 3300050510 | Bacteria | 1818 |
| 905 | nmdc:mga08y16_253582_c1 | 3300050511 | Bacteria | 1818 |
| 906 | nmdc:mga08y16_309180_c1 | 3300050511 | Bacteria | 1628 |
| 907 | nmdc:mga08y16_46579_c1 | 3300050511 | Bacteria | 4540 |
| 908 | nmdc:mga0n895_20042_c1 | 3300050512 | Bacteria | 6228 |
| 909 | nmdc:mga0n895_34444_c1 | 3300050512 | Bacteria | 4874 |
| 910 | nmdc:mga0n895_4716_c1 | 3300050512 | Bacteria | 11255 |
| 911 | nmdc:mga0n895_6829_c1 | 3300050512 | Bacteria | 9744 |
| 912 | nmdc:mga0n895_71514_c1 | 3300050512 | Bacteria | 3440 |
| 913 | nmdc:mga0n895_73251_c1 | 3300050512 | Bacteria | 3400 |
| 914 | nmdc:mga0rr50_115870_c1 | 3300050513 | Bacteria | 2127 |
| 915 | nmdc:mga0rr50_21795_c1 | 3300050513 | Bacteria | 4383 |
| 916 | nmdc:mga0rr50_52926_c1 | 3300050513 | Bacteria | 3018 |
| 917 | nmdc:mga08x19_45146_c1 | 3300050514 | Bacteria | 2815 |
| 918 | nmdc:mga08x19_61937_c1 | 3300050514 | Bacteria | 2425 |
| 919 | nmdc:mga0a205_147831_c1 | 3300050515 | Bacteria | 2250 |
| 920 | nmdc:mga0a205_1512_c1 | 3300050515 | Bacteria | 19858 |
| 921 | nmdc:mga0a205_304465_c1 | 3300050515 | Bacteria | 1466 |
| 922 | nmdc:mga0a205_7873_c1 | 3300050515 | Bacteria | 9678 |
| 923 | Ga0495601_0044443 | 3300053077 | Bacteria | 2792 |
| 924 | Ga0495601_0071635 | 3300053077 | Bacteria | 2213 |
| 925 | Ga0495612_0095547 | 3300053078 | Bacteria | 1262 |
| 926 | Ga0495595_0005502 | 3300053084 | Bacteria | 5130 |
| 927 | Ga0495595_0007450 | 3300053084 | Bacteria | 4480 |
| 928 | Ga0495595_0240009 | 3300053084 | Bacteria | 906 |
| 929 | Ga0495619_0006148 | 3300053085 | Bacteria | 7605 |
| 930 | Ga0495619_0009378 | 3300053085 | Bacteria | 6175 |
| 931 | Ga0495619_0020953 | 3300053085 | Bacteria | 4169 |
| 932 | Ga0495619_0090189 | 3300053085 | Bacteria | 2075 |
| 933 | Ga0500644_0009006 | 3300053088 | Bacteria | 2655 |
| 934 | Ga0500644_0036267 | 3300053088 | Bacteria | 1604 |
| 935 | Ga0500651_0010935 | 3300053093 | Bacteria | 5458 |
| 936 | Ga0500595_006391 | 3300053119 | Bacteria | 5002 |
| 937 | Ga0500618_000318 | 3300053125 | Bacteria | 35515 |
| 938 | Ga0500559_0031660 | 3300053136 | Bacteria | 2269 |
| 939 | Ga0500559_0052511 | 3300053136 | Bacteria | 1802 |
| 940 | Ga0500600_0037165 | 3300053149 | Unclassified | 2825 |
| 941 | Ga0501084_0189729 | 3300054114 | Bacteria | 1734 |
| 942 | Ga0501082_0052269 | 3300060353 | Bacteria | 3522 |
| 943 | Ga0501082_0254387 | 3300060353 | Unclassified | 1528 |
| 944 | Ga0466962_0070749 | 3300061719 | Bacteria | 1667 |
| 945 | Ga0466962_0090766 | 3300061719 | Bacteria | 1463 |
| 946 | Ga0530510_0031101 | 3300061734 | Bacteria | 3837 |
| 947 | Ga0530510_0044327 | 3300061734 | Bacteria | 3214 |
| 948 | Ga0530510_0062856 | 3300061734 | Bacteria | 2688 |
| 949 | Ga0530510_0300148 | 3300061734 | Unclassified | 1202 |
| 950 | 2523470208 | 2523231067 | Bacteria | 5230452 |
| 951 | 2583149123 | 2582580736 | Bacteria | 5325865 |
| 952 | 2585846281 | 2585427594 | Bacteria | 6180594 |
| 953 | 2643882588 | 2643221574 | Bacteria | 2789653 |
| 954 | 2644444600 | 2643221679 | Bacteria | 3839507 |
| 955 | 2644549455 | 2643221699 | Bacteria | 5731501 |
| 956 | 2644719174 | 2643221731 | Bacteria | 5623886 |
| 957 | 2644722419 | 2643221732 | Bacteria | 5756404 |
| 958 | 2739235136 | 2738543010 | Bacteria | 5583595 |
| 959 | 2791910751 | 2791354901 | Bacteria | 8322202 |
| 960 | 2795783657 | 2795385470 | Bacteria | 8317180 |
| 961 | 2819707857 | 2818991465 | Bacteria | 5388835 |
| 962 | 2842885082 | 2842882022 | Bacteria | 6158489 |
| 963 | 2871458053 | 2871451962 | Bacteria | 7336357 |
| 964 | 2891326749 | 2891326441 | Bacteria | 6439512 |
| 965 | 2904167188 | 2904162308 | Bacteria | 7086713 |
| 966 | 2904527519 | 2904524088 | Bacteria | 5887454 |
| 967 | 2919143836 | 2919143609 | Bacteria | 6219228 |
| 968 | 2919520643 | 2919517244 | Bacteria | 5858162 |
| 969 | 2919724634 | 2919720352 | Bacteria | 5986006 |
| 970 | 2928097319 | 2928093941 | Bacteria | 5965005 |
| 971 | 2929004486 | 2929004312 | Bacteria | 5678476 |
| 972 | 2960319379 | 2960319331 | Bacteria | 5502575 |
| 973 | 2960378083 | 2960375949 | Bacteria | 5361395 |
| 974 | 3006988064 | 3006984091 | Bacteria | 4207523 |
| 975 | 8022893672 | 8022893055 | Bacteria | 5300455 |
| 976 | 8022915941 | 8022914991 | Bacteria | 5584517 |
| 977 | 8056214871 | 8056207758 | Bacteria | 8639239 |
| 978 | Ga0495638_0046706 | |||
| 979 | JGI25159J45721_1003617 | |||
| 980 | JGI25159J45721_1009190 | |||
| 981 | JGI25151J46595_10002956 | |||
| 982 | JGI25151J46595_10005484 | |||
| 983 | JGI25406J46586_10010790 | |||
| 984 | rootH2_10101307 | |||
| 985 | rootL2_10008518 | |||
| 986 | rootL2_10104376 | |||
| 987 | rootH1_10000320 | |||
| 988 | JGI25160J50197_1000280 | |||
| 989 | JGI25160J50197_1000599 | |||
| 990 | JGI25161J50226_1000212 | |||
| 991 | JGI25161J50226_1000424 | |||
| 992 | Ga0006562J51391_1008419 | |||
| 993 | Ga0055532_1004722 | |||
| 994 | Ga0055536_1001185 | |||
| 995 | Ga0055528_1012898 | |||
| 996 | Ga0055540_1003516 | |||
| 997 | Ga0055543_1000049 | |||
| 998 | Ga0055543_1000576 | |||
| 999 | Ga0058862_10066796 | |||
| 1000 | Ga0065165_1000338 | |||
| 1001 | Ga0065165_1002596 | |||
| 1002 | Ga0070658_10301505 | |||
| 1003 | Ga0070683_100014581 | |||
| 1004 | Ga0070683_100020230 | |||
| 1005 | Ga0070683_100029495 | |||
| 1006 | Ga0070683_100052523 | |||
| 1007 | Ga0070683_100067252 | |||
| 1008 | Ga0070683_100073168 | |||
| 1009 | Ga0070683_100186699 | |||
| 1010 | Ga0070683_100338718 | |||
| 1011 | Ga0070683_100592423 | |||
| 1012 | Ga0070690_100007365 | |||
| 1013 | Ga0070690_100042731 | |||
| 1014 | Ga0070670_100025034 | |||
| 1015 | Ga0070680_100006204 | |||
| 1016 | Ga0070680_100058175 | |||
| 1017 | Ga0070680_100058588 | |||
| 1018 | Ga0070680_100143875 | |||
| 1019 | Ga0070680_100205944 | |||
| 1020 | Ga0070682_100014132 | |||
| 1021 | Ga0070682_100038522 | |||
| 1022 | Ga0070682_100052612 | |||
| 1023 | Ga0068868_100022657 | |||
| 1024 | Ga0068868_100103727 | |||
| 1025 | Ga0070660_100032090 | |||
| 1026 | Ga0070660_100114021 | |||
| 1027 | Ga0070660_100145619 | |||
| 1028 | Ga0070660_100367410 | |||
| 1029 | Ga0070689_100004976 | |||
| 1030 | Ga0070689_100033094 | |||
| 1031 | Ga0070691_10000784 | |||
| 1032 | Ga0070691_10032921 | |||
| 1033 | Ga0070687_100027766 | |||
| 1034 | Ga0070661_100054617 | |||
| 1035 | Ga0070661_100055105 | |||
| 1036 | Ga0070661_100072623 | |||
| 1037 | Ga0070661_100107380 | |||
| 1038 | Ga0070661_100367604 | |||
| 1039 | Ga0070675_100103286 | |||
| 1040 | Ga0070675_100111035 | |||
| 1041 | Ga0070671_100005356 | |||
| 1042 | Ga0070671_100120784 | |||
| 1043 | Ga0070674_100003471 | |||
| 1044 | Ga0070674_100020601 | |||
| 1045 | Ga0070673_100266702 | |||
| 1046 | Ga0070688_100103242 | |||
| 1047 | Ga0070659_100013745 | |||
| 1048 | Ga0070659_100028119 | |||
| 1049 | Ga0070659_100035242 | |||
| 1050 | Ga0070714_100001916 | |||
| 1051 | Ga0070714_100007234 | |||
| 1052 | Ga0070714_100087163 | |||
| 1053 | Ga0070714_100226713 | |||
| 1054 | Ga0070714_100307645 | |||
| 1055 | Ga0070714_100430541 | |||
| 1056 | Ga0070713_100005171 | |||
| 1057 | Ga0070713_100228118 | |||
| 1058 | Ga0070713_100228375 | |||
| 1059 | Ga0070713_100666141 | |||
| 1060 | Ga0070701_10023197 | |||
| 1061 | Ga0070711_100079151 | |||
| 1062 | Ga0070711_100089189 | |||
| 1063 | Ga0070705_100022853 | |||
| 1064 | Ga0070700_100017298 | |||
| 1065 | Ga0070700_100116860 | |||
| 1066 | Ga0070694_100046006 | |||
| 1067 | Ga0070708_100007522 | |||
| 1068 | Ga0070708_100020462 | |||
| 1069 | Ga0070663_100002699 | |||
| 1070 | Ga0070663_100010086 | |||
| 1071 | Ga0070678_100024394 | |||
| 1072 | Ga0070662_100045719 | |||
| 1073 | Ga0070681_10000761 | |||
| 1074 | Ga0070681_10010999 | |||
| 1075 | Ga0070681_10019104 | |||
| 1076 | Ga0070681_10042552 | |||
| 1077 | Ga0070681_10045056 | |||
| 1078 | Ga0070681_10067465 | |||
| 1079 | Ga0070681_10080728 | |||
| 1080 | Ga0070681_10097829 | |||
| 1081 | Ga0070681_10207392 | |||
| 1082 | Ga0070681_10239624 | |||
| 1083 | Ga0070681_10362512 | |||
| 1084 | Ga0068867_100035295 | |||
| 1085 | Ga0068867_100133976 | |||
| 1086 | Ga0070685_10025296 | |||
| 1087 | Ga0070685_10043520 | |||
| 1088 | Ga0070685_10111714 | |||
| 1089 | Ga0070706_100022567 | |||
| 1090 | Ga0070707_100092722 | |||
| 1091 | Ga0070707_100137944 | |||
| 1092 | Ga0070698_100021992 | |||
| 1093 | Ga0070679_100001341 | |||
| 1094 | Ga0070679_100026607 | |||
| 1095 | Ga0070679_100027691 | |||
| 1096 | Ga0070679_100055947 | |||
| 1097 | Ga0070679_100058793 | |||
| 1098 | Ga0070679_100091215 | |||
| 1099 | Ga0070679_100140953 | |||
| 1100 | Ga0070679_100171343 | |||
| 1101 | Ga0070679_100306389 | |||
| 1102 | Ga0070684_100029126 | |||
| 1103 | Ga0070684_100098398 | |||
| 1104 | Ga0070684_100139637 | |||
| 1105 | Ga0068853_100029727 | |||
| 1106 | Ga0068853_100086277 | |||
| 1107 | Ga0068853_100247621 | |||
| 1108 | Ga0070672_100146989 | |||
| 1109 | Ga0070672_100411861 | |||
| 1110 | Ga0070696_100060997 | |||
| 1111 | Ga0070693_100021572 | |||
| 1112 | Ga0070693_100118896 | |||
| 1113 | Ga0070693_100205031 | |||
| 1114 | Ga0070665_100010064 | |||
| 1115 | Ga0070665_100017578 | |||
| 1116 | Ga0070665_100032376 | |||
| 1117 | Ga0070665_100501606 | |||
| 1118 | Ga0068855_100046387 | |||
| 1119 | Ga0068855_100112305 | |||
| 1120 | Ga0068855_100173960 | |||
| 1121 | Ga0068855_100381527 | |||
| 1122 | Ga0070664_100029150 | |||
| 1123 | Ga0068857_100021524 | |||
| 1124 | Ga0068857_100033377 | |||
| 1125 | Ga0068857_100150161 | |||
| 1126 | Ga0068857_100179362 | |||
| 1127 | Ga0068857_100185726 | |||
| 1128 | Ga0068856_100016730 | |||
| 1129 | Ga0068856_100080702 | |||
| 1130 | Ga0068856_100116970 | |||
| 1131 | Ga0068856_100255073 | |||
| 1132 | Ga0070702_100000698 | |||
| 1133 | Ga0070702_100129647 | |||
| 1134 | Ga0070702_100137217 | |||
| 1135 | Ga0068852_100001790 | |||
| 1136 | Ga0068852_100007529 | |||
| 1137 | Ga0068852_100111971 | |||
| 1138 | Ga0068852_100327984 | |||
| 1139 | Ga0068859_100021489 | |||
| 1140 | Ga0068859_100025793 | |||
| 1141 | Ga0068859_100074145 | |||
| 1142 | Ga0068859_100237355 | |||
| 1143 | Ga0068864_100036613 | |||
| 1144 | Ga0068864_100082890 | |||
| 1145 | Ga0068864_100128949 | |||
| 1146 | Ga0068861_100162284 | |||
| 1147 | Ga0068851_10017123 | |||
| 1148 | Ga0068870_10006789 | |||
| 1149 | Ga0068870_10108064 | |||
| 1150 | Ga0068863_100054987 | |||
| 1151 | Ga0068863_100295684 | |||
| 1152 | Ga0068858_100052163 | |||
| 1153 | Ga0068858_100076631 | |||
| 1154 | Ga0068858_100109235 | |||
| 1155 | Ga0068858_100399581 | |||
| 1156 | Ga0068860_100011930 | |||
| 1157 | Ga0068860_100052360 | |||
| 1158 | Ga0068860_100086755 | |||
| 1159 | Ga0068860_100337424 | |||
| 1160 | Ga0068860_100448037 | |||
| 1161 | Ga0068862_100062041 | |||
| 1162 | Ga0081455_10000123 | |||
| 1163 | Ga0081539_10001472 | |||
| 1164 | Ga0081539_10004690 | |||
| 1165 | Ga0070717_10160657 | |||
| 1166 | Ga0070717_10179875 | |||
| 1167 | Ga0070717_10253477 | |||
| 1168 | Ga0075363_100096603 | |||
| 1169 | Ga0075364_10131652 | |||
| 1170 | Ga0070716_100207408 | |||
| 1171 | Ga0070712_100064819 | |||
| 1172 | Ga0070712_100115855 | |||
| 1173 | Ga0097621_100029767 | |||
| 1174 | Ga0097621_100287985 | |||
| 1175 | Ga0068871_100477432 | |||
| 1176 | Ga0075430_100431291 | |||
| 1177 | Ga0075431_100084901 | |||
| 1178 | Ga0075431_100230598 | |||
| 1179 | Ga0075433_10000538 | |||
| 1180 | Ga0075433_10021633 | |||
| 1181 | Ga0075433_10106508 | |||
| 1182 | Ga0075434_100001508 | |||
| 1183 | Ga0075434_100018763 | |||
| 1184 | Ga0075434_100056740 | |||
| 1185 | Ga0075434_100067183 | |||
| 1186 | Ga0075429_100032038 | |||
| 1187 | Ga0075429_100189514 | |||
| 1188 | Ga0068865_100038132 | |||
| 1189 | Ga0068865_100184854 | |||
| 1190 | Ga0075436_100010800 | |||
| 1191 | Ga0097620_100021489 | |||
| 1192 | Ga0097620_100025795 | |||
| 1193 | Ga0097620_100074143 | |||
| 1194 | Ga0097620_100237353 | |||
| 1195 | Ga0075435_100001805 | |||
| 1196 | Ga0075435_100090512 | |||
| 1197 | Ga0075435_100101421 | |||
| 1198 | Ga0105240_10024111 | |||
| 1199 | Ga0105240_10082840 | |||
| 1200 | Ga0105240_10334349 | |||
| 1201 | Ga0111539_10009362 | |||
| 1202 | Ga0111539_10053130 | |||
| 1203 | Ga0111539_10103919 | |||
| 1204 | Ga0111539_10175423 | |||
| 1205 | Ga0111539_10973259 | |||
| 1206 | Ga0105245_10011452 | |||
| 1207 | Ga0105245_10053696 | |||
| 1208 | Ga0105245_10093907 | |||
| 1209 | Ga0105245_10546467 | |||
| 1210 | Ga0105247_10023897 | |||
| 1211 | Ga0114129_10081287 | |||
| 1212 | Ga0114129_10145419 | |||
| 1213 | Ga0114129_10174582 | |||
| 1214 | Ga0105243_10022315 | |||
| 1215 | Ga0105243_10178662 | |||
| 1216 | Ga0105243_10311228 | |||
| 1217 | Ga0105241_10008405 | |||
| 1218 | Ga0105241_10282225 | |||
| 1219 | Ga0105242_10024312 | |||
| 1220 | Ga0105242_10046823 | |||
| 1221 | Ga0105242_10400815 | |||
| 1222 | Ga0105248_10023670 | |||
| 1223 | Ga0105248_10327382 | |||
| 1224 | Ga0105248_10379955 | |||
| 1225 | Ga0105248_10393667 | |||
| 1226 | Ga0105248_10546121 | |||
| 1227 | Ga0105248_10582673 | |||
| 1228 | Ga0105237_10018665 | |||
| 1229 | Ga0105237_10034049 | |||
| 1230 | Ga0105237_10415477 | |||
| 1231 | Ga0105237_10750544 | |||
| 1232 | Ga0105238_10056322 | |||
| 1233 | Ga0105238_10069609 | |||
| 1234 | Ga0105238_10136607 | |||
| 1235 | Ga0105238_10489326 | |||
| 1236 | Ga0105028_103079 | |||
| 1237 | Ga0105239_10033997 | |||
| 1238 | Ga0105239_10197286 | |||
| 1239 | Ga0105246_10001509 | |||
| 1240 | Ga0157373_10015391 | |||
| 1241 | Ga0157371_10023977 | |||
| 1242 | Ga0157370_10011046 | |||
| 1243 | Ga0157370_10023696 | |||
| 1244 | Ga0157370_10072198 | |||
| 1245 | Ga0157370_10075672 | |||
| 1246 | Ga0157370_10152266 | |||
| 1247 | Ga0157369_10008734 | |||
| 1248 | Ga0157369_10043319 | |||
| 1249 | Ga0157369_10118105 | |||
| 1250 | Ga0157369_10156214 | |||
| 1251 | Ga0157369_10169761 | |||
| 1252 | Ga0157369_10195137 | |||
| 1253 | Ga0157369_10212974 | |||
| 1254 | Ga0157369_10230976 | |||
| 1255 | Ga0157369_10389145 | |||
| 1256 | Ga0157374_10006393 | |||
| 1257 | Ga0157378_10001154 | |||
| 1258 | Ga0163162_10392093 | |||
| 1259 | Ga0157372_10006138 | |||
| 1260 | Ga0157372_10021689 | |||
| 1261 | Ga0157372_10030994 | |||
| 1262 | Ga0157372_10148778 | |||
| 1263 | Ga0157372_10158991 | |||
| 1264 | Ga0157372_10868889 | |||
| 1265 | Ga0157375_10009209 | |||
| 1266 | Ga0157375_10039459 | |||
| 1267 | Ga0157375_10127461 | |||
| 1268 | Ga0157375_10192500 | |||
| 1269 | Ga0157375_10233432 | |||
| 1270 | Ga0157375_10325291 | |||
| 1271 | Ga0163163_10128112 | |||
| 1272 | Ga0163163_10159800 | |||
| 1273 | Ga0157380_10251101 | |||
| 1274 | Ga0182008_10068004 | |||
| 1275 | Ga0182008_10108107 | |||
| 1276 | Ga0157377_10016745 | |||
| 1277 | Ga0157377_10023167 | |||
| 1278 | Ga0157379_10024965 | |||
| 1279 | Ga0157379_10028625 | |||
| 1280 | Ga0157379_10053339 | |||
| 1281 | Ga0157376_10366024 | |||
| 1282 | Ga0163161_10172512 | |||
| 1283 | Ga0206356_10045217 | |||
| 1284 | Ga0206356_11606851 | |||
| 1285 | Ga0206350_10021615 | |||
| 1286 | Ga0206354_10651088 | |||
| 1287 | Ga0206354_10779778 | |||
| 1288 | Ga0206353_10034911 | |||
| 1289 | Ga0206353_10328578 | |||
| 1290 | Ga0206353_10517529 | |||
| 1291 | Ga0206353_11431182 | |||
| 1292 | Ga0206353_11527722 | |||
| 1293 | Ga0206353_11682003 | |||
| 1294 | Ga0206353_11772650 | |||
| 1295 | Ga0213875_10000373 | |||
| 1296 | Ga0213875_10020078 | |||
| 1297 | Ga0224712_10029022 | |||
| 1298 | Ga0209147_101402 | |||
| 1299 | Ga0209565_1006092 | |||
| 1300 | Ga0209673_1004649 | |||
| 1301 | Ga0209130_1000559 | |||
| 1302 | Ga0209130_1001091 | |||
| 1303 | Ga0209676_1000213 | |||
| 1304 | Ga0209025_1000863 | |||
| 1305 | Ga0209025_1004514 | |||
| 1306 | Ga0209050_1011809 | |||
| 1307 | Ga0207426_1000200 | |||
| 1308 | Ga0207426_1008366 | |||
| 1309 | Ga0209051_1000945 | |||
| 1310 | Ga0209257_1000757 | |||
| 1311 | Ga0207656_10028673 | |||
| 1312 | Ga0207655_1005685 | |||
| 1313 | Ga0207692_10154346 | |||
| 1314 | Ga0207642_10073416 | |||
| 1315 | Ga0207688_10025836 | |||
| 1316 | Ga0207699_10250936 | |||
| 1317 | Ga0207643_10000509 | |||
| 1318 | Ga0207705_10037046 | |||
| 1319 | Ga0207705_10325761 | |||
| 1320 | Ga0207654_10028289 | |||
| 1321 | Ga0207707_10002441 | |||
| 1322 | Ga0207707_10003694 | |||
| 1323 | Ga0207707_10018831 | |||
| 1324 | Ga0207707_10046889 | |||
| 1325 | Ga0207707_10059113 | |||
| 1326 | Ga0207707_10102228 | |||
| 1327 | Ga0207707_10102804 | |||
| 1328 | Ga0207707_10119140 | |||
| 1329 | Ga0207707_10119995 | |||
| 1330 | Ga0207707_10188342 | |||
| 1331 | Ga0207707_10291479 | |||
| 1332 | Ga0207695_10289813 | |||
| 1333 | Ga0207695_10517545 | |||
| 1334 | Ga0207671_10133057 | |||
| 1335 | Ga0207671_10325237 | |||
| 1336 | Ga0207693_10115797 | |||
| 1337 | Ga0207693_10119180 | |||
| 1338 | Ga0207663_10034475 | |||
| 1339 | Ga0207663_10079171 | |||
| 1340 | Ga0207660_10025317 | |||
| 1341 | Ga0207660_10030907 | |||
| 1342 | Ga0207660_10086294 | |||
| 1343 | Ga0207660_10265270 | |||
| 1344 | Ga0207662_10022210 | |||
| 1345 | Ga0207657_10005449 | |||
| 1346 | Ga0207657_10009888 | |||
| 1347 | Ga0207657_10017028 | |||
| 1348 | Ga0207657_10018623 | |||
| 1349 | Ga0207657_10034581 | |||
| 1350 | Ga0207657_10081850 | |||
| 1351 | Ga0207649_10015939 | |||
| 1352 | Ga0207649_10019505 | |||
| 1353 | Ga0207649_10037479 | |||
| 1354 | Ga0207649_10191455 | |||
| 1355 | Ga0207649_10235144 | |||
| 1356 | Ga0207652_10003277 | |||
| 1357 | Ga0207652_10004500 | |||
| 1358 | Ga0207652_10005110 | |||
| 1359 | Ga0207652_10026829 | |||
| 1360 | Ga0207652_10059785 | |||
| 1361 | Ga0207652_10184043 | |||
| 1362 | Ga0207646_10039331 | |||
| 1363 | Ga0207646_10206412 | |||
| 1364 | Ga0207694_10082941 | |||
| 1365 | Ga0207650_10008792 | |||
| 1366 | Ga0207659_10014892 | |||
| 1367 | Ga0207659_10093949 | |||
| 1368 | Ga0207659_10337022 | |||
| 1369 | Ga0207687_10007807 | |||
| 1370 | Ga0207700_10018003 | |||
| 1371 | Ga0207700_10159309 | |||
| 1372 | Ga0207700_10510769 | |||
| 1373 | Ga0207664_10000121 | |||
| 1374 | Ga0207664_10000908 | |||
| 1375 | Ga0207664_10113663 | |||
| 1376 | Ga0207664_10330799 | |||
| 1377 | Ga0207644_10021503 | |||
| 1378 | Ga0207644_10073215 | |||
| 1379 | Ga0207644_10281060 | |||
| 1380 | Ga0207690_10015371 | |||
| 1381 | Ga0207690_10021246 | |||
| 1382 | Ga0207706_10158497 | |||
| 1383 | Ga0207686_10227806 | |||
| 1384 | Ga0207686_10277571 | |||
| 1385 | Ga0207709_10295861 | |||
| 1386 | Ga0207670_10044013 | |||
| 1387 | Ga0207670_10048410 | |||
| 1388 | Ga0207670_10069384 | |||
| 1389 | Ga0207670_10086534 | |||
| 1390 | Ga0207669_10045217 | |||
| 1391 | Ga0207665_10025540 | |||
| 1392 | Ga0207665_10212308 | |||
| 1393 | Ga0207691_10009738 | |||
| 1394 | Ga0207691_10208844 | |||
| 1395 | Ga0207711_10034448 | |||
| 1396 | Ga0207711_10182944 | |||
| 1397 | Ga0207711_10470606 | |||
| 1398 | Ga0207711_10479673 | |||
| 1399 | Ga0207689_10004151 | |||
| 1400 | Ga0207689_10086399 | |||
| 1401 | Ga0207661_10017412 | |||
| 1402 | Ga0207661_10021239 | |||
| 1403 | Ga0207661_10057525 | |||
| 1404 | Ga0207661_10065426 | |||
| 1405 | Ga0207661_10122767 | |||
| 1406 | Ga0207661_10218999 | |||
| 1407 | Ga0207661_10317868 | |||
| 1408 | Ga0207661_10368867 | |||
| 1409 | Ga0207679_10001724 | |||
| 1410 | Ga0207679_10070604 | |||
| 1411 | Ga0207679_10153076 | |||
| 1412 | Ga0207667_10046202 | |||
| 1413 | Ga0207667_10185725 | |||
| 1414 | Ga0207667_10368423 | |||
| 1415 | Ga0207651_10040089 | |||
| 1416 | Ga0207668_10068207 | |||
| 1417 | Ga0207668_10129687 | |||
| 1418 | Ga0207658_10251144 | |||
| 1419 | Ga0207677_10011454 | |||
| 1420 | Ga0207677_10109977 | |||
| 1421 | Ga0207703_10039059 | |||
| 1422 | Ga0207703_10057066 | |||
| 1423 | Ga0207703_10127250 | |||
| 1424 | Ga0207703_10221336 | |||
| 1425 | Ga0207639_10169575 | |||
| 1426 | Ga0207678_10003455 | |||
| 1427 | Ga0207678_10020275 | |||
| 1428 | Ga0207678_10038256 | |||
| 1429 | Ga0207708_10012398 | |||
| 1430 | Ga0207708_10016793 | |||
| 1431 | Ga0207708_10030879 | |||
| 1432 | Ga0207702_10003496 | |||
| 1433 | Ga0207702_10166019 | |||
| 1434 | Ga0207702_10234471 | |||
| 1435 | Ga0207641_10024973 | |||
| 1436 | Ga0207648_10015351 | |||
| 1437 | Ga0207648_10171408 | |||
| 1438 | Ga0207648_10186761 | |||
| 1439 | Ga0207676_10001025 | |||
| 1440 | Ga0207676_10137357 | |||
| 1441 | Ga0207674_10010726 | |||
| 1442 | Ga0207674_10028008 | |||
| 1443 | Ga0207674_10030859 | |||
| 1444 | Ga0207674_10031713 | |||
| 1445 | Ga0207674_10249408 | |||
| 1446 | Ga0207675_100534619 | |||
| 1447 | Ga0207683_10000792 | |||
| 1448 | Ga0207683_10102182 | |||
| 1449 | Ga0207698_10001508 | |||
| 1450 | Ga0209998_10034400 | |||
| 1451 | Ga0207428_10032737 | |||
| 1452 | Ga0207428_10137104 | |||
| 1453 | Ga0268266_10015764 | |||
| 1454 | Ga0268266_10036232 | |||
| 1455 | Ga0268266_10291146 | |||
| 1456 | Ga0268265_10224447 | |||
| 1457 | Ga0268264_10205704 | |||
| 1458 | Ga0265322_10005052 | |||
| 1459 | Ga0265322_10015144 | |||
| 1460 | Ga0265338_10004565 | |||
| 1461 | Ga0265338_10075824 | |||
| 1462 | Ga0307512_10006564 | |||
| 1463 | Ga0265328_10041600 | |||
| 1464 | Ga0265320_10014590 | |||
| 1465 | Ga0265329_10056499 | |||
| 1466 | Ga0265340_10014521 | |||
| 1467 | Ga0265340_10031664 | |||
| 1468 | Ga0265327_10006161 | |||
| 1469 | Ga0265327_10012094 | |||
| 1470 | Ga0265327_10047637 | |||
| 1471 | Ga0265327_10092789 | |||
| 1472 | Ga0265316_10002772 | |||
| 1473 | Ga0307513_10018297 | |||
| 1474 | Ga0307509_10203601 | |||
| 1475 | Ga0307408_100077042 | |||
| 1476 | Ga0265313_10005148 | |||
| 1477 | Ga0265314_10104712 | |||
| 1478 | Ga0265342_10005387 | |||
| 1479 | Ga0316576_10033708 | |||
| 1480 | Ga0307516_10002263 | |||
| 1481 | Ga0307516_10084950 | |||
| 1482 | Ga0307405_10007230 | |||
| 1483 | Ga0307405_10038317 | |||
| 1484 | Ga0307413_10012460 | |||
| 1485 | Ga0307406_10009395 | |||
| 1486 | Ga0307406_10032073 | |||
| 1487 | Ga0307412_10002452 | |||
| 1488 | Ga0307409_100311301 | |||
| 1489 | Ga0307411_10013450 | |||
| 1490 | Ga0307415_100013875 | |||
| 1491 | Ga0307415_100296598 | |||
| 1492 | Ga0316583_10010822 | |||
| 1493 | Ga0316214_1003450 | |||
| 1494 | Ga0373926_0022338 | |||
| 1495 | Ga0373944_0015764 | |||
| 1496 | Ga0373936_0007825 | |||
| 1497 | Ga0373936_0028633 | |||
| 1498 | Ga0373945_0047548 | |||
| 1499 | Ga0373953_0020991 | |||
| 1500 | Ga0373953_0029837 | |||
| 1501 | Ga0373954_0022064 | |||
| 1502 | Ga0373957_0037683 | |||
| 1503 | Ga0373943_0002734 | |||
| 1504 | Ga0373943_0004387 | |||
| 1505 | Ga0373946_0001078 | |||
| 1506 | Ga0373946_0050879 | |||
| 1507 | Ga0373942_0000034 | |||
| 1508 | Ga0316574_0169510 | |||
| 1509 | Ga0373931_0053536 | |||
| 1510 | Ga0373935_0007767 | |||
| 1511 | Ga0373927_0015160 | |||
| 1512 | Ga0373933_0186375 | |||
| 1513 | Ga0373947_0013733 | |||
| 1514 | Ga0373947_0017071 | |||
| 1515 | Ga0373947_0089785 | |||
| 1516 | Ga0373937_0434946 | |||
| 1517 | Ga0373925_0061651 | |||
| 1518 | Ga0395900_0023444 | |||
| 1519 | Ga0395900_0181312 | |||
| 1520 | Ga0395900_0193252 | |||
| 1521 | Ga0395900_0237740 | |||
| 1522 | Ga0395900_0284361 | |||
| 1523 | Ga0395898_0010338 | |||
| 1524 | Ga0395898_0155639 | |||
| 1525 | Ga0395898_0218632 | |||
| 1526 | Ga0395898_0314269 | |||
| 1527 | Ga0395905_0041967 | |||
| 1528 | Ga0436364_0465814 | |||
| 1529 | Ga0436364_0695796 | |||
| 1530 | Ga0436364_0894784 | |||
| 1531 | Ga0436364_1268460 | |||
| 1532 | Ga0395901_0014883 | |||
| 1533 | Ga0395901_0023843 | |||
| 1534 | Ga0395901_0029607 | |||
| 1535 | Ga0395901_0032500 | |||
| 1536 | Ga0395901_0172388 | |||
| 1537 | Ga0395901_0192377 | |||
| 1538 | Ga0436365_0225286 | |||
| 1539 | Ga0451853_0837686 | |||
| 1540 | Ga0439441_005941 | |||
| 1541 | Ga0466969_0008010 | |||
| 1542 | Ga0466969_0021926 | |||
| 1543 | Ga0466969_0087567 | |||
| 1544 | Ga0466965_0037302 | |||
| 1545 | Ga0466965_0073398 | |||
| 1546 | Ga0466966_0032902 | |||
| 1547 | Ga0466966_0037705 | |||
| 1548 | Ga0466966_0055725 | |||
| 1549 | Ga0466966_0075026 | |||
| 1550 | Ga0466966_0179317 | |||
| 1551 | Ga0466966_0186847 | |||
| 1552 | Ga0466961_0032074 | |||
| 1553 | Ga0466961_0090308 | |||
| 1554 | Ga0466961_0096204 | |||
| 1555 | Ga0466963_0000749 | |||
| 1556 | Ga0466963_0006029 | |||
| 1557 | Ga0466963_0006648 | |||
| 1558 | Ga0466963_0017102 | |||
| 1559 | Ga0466963_0017754 | |||
| 1560 | Ga0466963_0038462 | |||
| 1561 | Ga0466963_0045489 | |||
| 1562 | Ga0466963_0061660 | |||
| 1563 | Ga0466963_0083324 | |||
| 1564 | Ga0466963_0102307 | |||
| 1565 | Ga0466963_0157971 | |||
| 1566 | Ga0466963_0225345 | |||
| 1567 | Ga0466964_0012820 | |||
| 1568 | Ga0466964_0013154 | |||
| 1569 | Ga0466971_0000953 | |||
| 1570 | Ga0466971_0012982 | |||
| 1571 | Ga0466971_0027791 | |||
| 1572 | Ga0466971_0101484 | |||
| 1573 | Ga0466971_0175750 | |||
| 1574 | Ga0466970_0090667 | |||
| 1575 | Ga0466970_0151782 | |||
| 1576 | Ga0466957_0009367 | |||
| 1577 | Ga0466957_0089460 | |||
| 1578 | Ga0466957_0106225 | |||
| 1579 | Ga0466957_0131880 | |||
| 1580 | Ga0466957_0249448 | |||
| 1581 | Ga0466957_0289089 | |||
| 1582 | Ga0466960_0018295 | |||
| 1583 | Ga0466960_0033894 | |||
| 1584 | Ga0466959_0026254 | |||
| 1585 | Ga0466959_0039680 | |||
| 1586 | Ga0466959_0057085 | |||
| 1587 | Ga0466959_0134719 | |||
| 1588 | Ga0466958_0005719 | |||
| 1589 | Ga0466958_0046699 | |||
| 1590 | Ga0466958_0072693 | |||
| 1591 | Ga0466958_0087803 | |||
| 1592 | Ga0466958_0235829 | |||
| 1593 | Ga0466967_0004426 | |||
| 1594 | Ga0466967_0004744 | |||
| 1595 | Ga0466967_0005187 | |||
| 1596 | Ga0466967_0012170 | |||
| 1597 | Ga0466967_0012876 | |||
| 1598 | Ga0466967_0017662 | |||
| 1599 | Ga0466967_0017986 | |||
| 1600 | Ga0466967_0023454 | |||
| 1601 | Ga0466967_0040124 | |||
| 1602 | Ga0466967_0056432 | |||
| 1603 | Ga0466967_0120303 | |||
| 1604 | Ga0466967_0124430 | |||
| 1605 | Ga0466967_0157467 | |||
| 1606 | Ga0466967_0188567 | |||
| 1607 | Ga0466967_0195024 | |||
| 1608 | Ga0466967_0199666 | |||
| 1609 | Ga0466967_0251830 | |||
| 1610 | Ga0466967_0429823 | |||
| 1611 | Ga0466967_0544034 | |||
| 1612 | Ga0495592_0048020 | |||
| 1613 | Ga0495592_0121055 | |||
| 1614 | Ga0495603_0019038 | |||
| 1615 | Ga0495603_0134315 | |||
| 1616 | Ga0495603_0196445 | |||
| 1617 | Ga0495629_0001941 | |||
| 1618 | Ga0495629_0251563 | |||
| 1619 | Ga0495641_0001041 | |||
| 1620 | Ga0495641_0019363 | |||
| 1621 | Ga0495641_0129742 | |||
| 1622 | Ga0495641_0131458 | |||
| 1623 | Ga0495651_0026735 | |||
| 1624 | Ga0495651_0104853 | |||
| 1625 | Ga0495651_0133590 | |||
| 1626 | Ga0495651_0150057 | |||
| 1627 | Ga0495653_0026115 | |||
| 1628 | Ga0495653_0088407 | |||
| 1629 | Ga0495653_0259179 | |||
| 1630 | Ga0495582_0000040 | |||
| 1631 | Ga0495582_0071111 | |||
| 1632 | Ga0495639_0001045 | |||
| 1633 | Ga0495639_0057645 | |||
| 1634 | Ga0495662_0002364 | |||
| 1635 | Ga0495664_0046071 | |||
| 1636 | Ga0495585_0082609 | |||
| 1637 | Ga0495594_0073010 | |||
| 1638 | Ga0495608_0018595 | |||
| 1639 | Ga0495608_0033126 | |||
| 1640 | Ga0495608_0034838 | |||
| 1641 | Ga0495608_0112341 | |||
| 1642 | Ga0495608_0124252 | |||
| 1643 | Ga0495618_0157043 | |||
| 1644 | Ga0495628_0012316 | |||
| 1645 | Ga0495628_0213064 | |||
| 1646 | Ga0495630_0010867 | |||
| 1647 | Ga0495630_0042743 | |||
| 1648 | Ga0495630_0081771 | |||
| 1649 | Ga0495630_0106320 | |||
| 1650 | Ga0495652_0026147 | |||
| 1651 | Ga0495652_0028913 | |||
| 1652 | Ga0495665_0020103 | |||
| 1653 | Ga0495640_0002735 | |||
| 1654 | Ga0495640_0009964 | |||
| 1655 | Ga0495640_0062132 | |||
| 1656 | Ga0495640_0086997 | |||
| 1657 | Ga0495640_0110831 | |||
| 1658 | Ga0495640_0156781 | |||
| 1659 | Ga0495645_0077262 | |||
| 1660 | Ga0495645_0140680 | |||
| 1661 | Ga0495667_0003849 | |||
| 1662 | Ga0495667_0019788 | |||
| 1663 | Ga0495667_0037152 | |||
| 1664 | Ga0495667_0049276 | |||
| 1665 | Ga0495634_0022497 | |||
| 1666 | Ga0495634_0041779 | |||
| 1667 | Ga0495634_0108254 | |||
| 1668 | Ga0495634_0134650 | |||
| 1669 | Ga0495635_0004513 | |||
| 1670 | Ga0495635_0034255 | |||
| 1671 | Ga0495657_0031238 | |||
| 1672 | Ga0495657_0082512 | |||
| 1673 | Ga0495599_0032694 | |||
| 1674 | Ga0495599_0037108 | |||
| 1675 | Ga0495623_0021908 | |||
| 1676 | Ga0495647_0005989 | |||
| 1677 | Ga0495658_0000450 | |||
| 1678 | Ga0495658_0013929 | |||
| 1679 | Ga0495658_0110840 | |||
| 1680 | Ga0495658_0146186 | |||
| 1681 | Ga0495613_0050958 | |||
| 1682 | Ga0495613_0083184 | |||
| 1683 | Ga0495613_0175180 | |||
| 1684 | Ga0495624_0004825 | |||
| 1685 | Ga0495624_0078969 | |||
| 1686 | Ga0495600_0012025 | |||
| 1687 | Ga0495600_0054154 | |||
| 1688 | Ga0495600_0175595 | |||
| 1689 | Ga0495581_0001232 | |||
| 1690 | Ga0495581_0045205 | |||
| 1691 | Ga0495604_0035277 | |||
| 1692 | Ga0495674_0062408 | |||
| 1693 | Ga0495674_0100284 | |||
| 1694 | Ga0495674_0245874 | |||
| 1695 | Ga0495676_0001870 | |||
| 1696 | Ga0495676_0078177 | |||
| 1697 | Ga0495676_0090917 | |||
| 1698 | Ga0495676_0093777 | |||
| 1699 | Ga0495680_0000491 | |||
| 1700 | Ga0495680_0006927 | |||
| 1701 | Ga0495680_0007167 | |||
| 1702 | Ga0495680_0008828 | |||
| 1703 | Ga0495680_0053787 | |||
| 1704 | Ga0495675_0021630 | |||
| 1705 | Ga0495684_0003165 | |||
| 1706 | Ga0495684_0010242 | |||
| 1707 | Ga0495684_0071192 | |||
| 1708 | Ga0495684_0172521 | |||
| 1709 | Ga0495684_0182607 | |||
| 1710 | Ga0495593_0003136 | |||
| 1711 | Ga0495602_0014799 | |||
| 1712 | Ga0495602_0106416 | |||
| 1713 | Ga0496100_0001260 | |||
| 1714 | Ga0496100_0019675 | |||
| 1715 | Ga0496100_0039598 | |||
| 1716 | Ga0496100_0051870 | |||
| 1717 | Ga0496100_0080475 | |||
| 1718 | Ga0496100_0142497 | |||
| 1719 | Ga0496100_0196196 | |||
| 1720 | Ga0496101_0007015 | |||
| 1721 | Ga0496101_0007164 | |||
| 1722 | Ga0496101_0010403 | |||
| 1723 | Ga0496101_0014000 | |||
| 1724 | Ga0496101_0180490 | |||
| 1725 | Ga0496102_0010875 | |||
| 1726 | Ga0496102_0033240 | |||
| 1727 | Ga0496102_0072878 | |||
| 1728 | Ga0496102_0076438 | |||
| 1729 | Ga0496102_0194872 | |||
| 1730 | Ga0496102_0234148 | |||
| 1731 | Ga0496102_0426609 | |||
| 1732 | Ga0496103_0067164 | |||
| 1733 | Ga0496103_0139549 | |||
| 1734 | Ga0496104_0033265 | |||
| 1735 | Ga0496104_0035968 | |||
| 1736 | Ga0496104_0044264 | |||
| 1737 | Ga0496104_0055304 | |||
| 1738 | Ga0496104_0098458 | |||
| 1739 | Ga0496104_0111985 | |||
| 1740 | Ga0496104_0131303 | |||
| 1741 | Ga0496104_0172146 | |||
| 1742 | Ga0496105_0000333 | |||
| 1743 | Ga0496105_0004652 | |||
| 1744 | Ga0496105_0008768 | |||
| 1745 | Ga0496105_0013556 | |||
| 1746 | Ga0496106_0000466 | |||
| 1747 | Ga0496106_0003605 | |||
| 1748 | Ga0496106_0008841 | |||
| 1749 | Ga0496106_0016160 | |||
| 1750 | Ga0496106_0053940 | |||
| 1751 | Ga0496106_0122841 | |||
| 1752 | Ga0496106_0210058 | |||
| 1753 | Ga0496107_0003792 | |||
| 1754 | Ga0496107_0004038 | |||
| 1755 | Ga0496107_0010862 | |||
| 1756 | Ga0496107_0019386 | |||
| 1757 | Ga0496107_0056250 | |||
| 1758 | Ga0496107_0240017 | |||
| 1759 | Ga0496107_0386874 | |||
| 1760 | Ga0496108_0014051 | |||
| 1761 | Ga0496108_0023295 | |||
| 1762 | Ga0496108_0039172 | |||
| 1763 | Ga0496108_0050415 | |||
| 1764 | Ga0496108_0140672 | |||
| 1765 | Ga0496108_0232829 | |||
| 1766 | Ga0496108_0232842 | |||
| 1767 | Ga0496108_0369924 | |||
| 1768 | Ga0496109_0005464 | |||
| 1769 | Ga0496109_0007198 | |||
| 1770 | Ga0496109_0024064 | |||
| 1771 | Ga0496109_0051651 | |||
| 1772 | Ga0496110_0022283 | |||
| 1773 | Ga0496110_0035660 | |||
| 1774 | Ga0496110_0040212 | |||
| 1775 | Ga0496110_0057306 | |||
| 1776 | Ga0496110_0136018 | |||
| 1777 | Ga0496110_0200311 | |||
| 1778 | Ga0496111_0006189 | |||
| 1779 | Ga0496111_0058989 | |||
| 1780 | Ga0496111_0087906 | |||
| 1781 | Ga0496111_0157963 | |||
| 1782 | Ga0496112_0000822 | |||
| 1783 | Ga0496112_0001908 | |||
| 1784 | Ga0496112_0011157 | |||
| 1785 | Ga0496112_0251446 | |||
| 1786 | Ga0496112_0285618 | |||
| 1787 | Ga0496112_0329657 | |||
| 1788 | Ga0496113_0029554 | |||
| 1789 | Ga0496113_0030307 | |||
| 1790 | Ga0496113_0037070 | |||
| 1791 | Ga0496114_0008203 | |||
| 1792 | Ga0496114_0016445 | |||
| 1793 | Ga0496114_0072237 | |||
| 1794 | Ga0496114_0109058 | |||
| 1795 | Ga0496114_0129824 | |||
| 1796 | Ga0496114_0195700 | |||
| 1797 | Ga0496114_0426608 | |||
| 1798 | Ga0496115_0001216 | |||
| 1799 | Ga0496115_0002395 | |||
| 1800 | Ga0496115_0083614 | |||
| 1801 | Ga0496115_0250656 | |||
| 1802 | Ga0496115_0433249 | |||
| 1803 | Ga0496116_0002446 | |||
| 1804 | Ga0496116_0030670 | |||
| 1805 | Ga0496118_0208645 | |||
| 1806 | Ga0496119_0001484 | |||
| 1807 | Ga0496119_0002986 | |||
| 1808 | Ga0496121_0201971 | |||
| 1809 | Ga0496122_0012960 | |||
| 1810 | Ga0496125_0031312 | |||
| 1811 | Ga0496126_0012588 | |||
| 1812 | Ga0501031_0023724 | |||
| 1813 | Ga0501034_0012298 | |||
| 1814 | Ga0501034_0470896 | |||
| 1815 | Ga0501036_0061384 | |||
| 1816 | Ga0501036_0068245 | |||
| 1817 | Ga0501038_0162493 | |||
| 1818 | Ga0501039_0066050 | |||
| 1819 | Ga0501040_0049430 | |||
| 1820 | Ga0501040_0101602 | |||
| 1821 | Ga0501040_0107670 | |||
| 1822 | Ga0501040_0141534 | |||
| 1823 | Ga0501041_0049374 | |||
| 1824 | Ga0501041_0092384 | |||
| 1825 | Ga0501046_0165464 | |||
| 1826 | Ga0501046_0457348 | |||
| 1827 | Ga0501047_0047874 | |||
| 1828 | Ga0501048_0028553 | |||
| 1829 | Ga0501048_0036658 | |||
| 1830 | Ga0501048_0135423 | |||
| 1831 | Ga0501067_0021609 | |||
| 1832 | Ga0501067_0028170 | |||
| 1833 | Ga0501067_0080332 | |||
| 1834 | Ga0501068_0065938 | |||
| 1835 | Ga0501069_0017404 | |||
| 1836 | Ga0501069_0038966 | |||
| 1837 | Ga0501069_0080811 | |||
| 1838 | Ga0501069_0174179 | |||
| 1839 | Ga0501070_0000917 | |||
| 1840 | Ga0501070_0072820 | |||
| 1841 | Ga0501070_0152691 | |||
| 1842 | Ga0501070_0198953 | |||
| 1843 | Ga0501070_0237962 | |||
| 1844 | Ga0501070_0254723 | |||
| 1845 | Ga0501071_0047925 | |||
| 1846 | Ga0501071_0086392 | |||
| 1847 | Ga0501071_0109960 | |||
| 1848 | Ga0501071_0129792 | |||
| 1849 | Ga0501072_0193172 | |||
| 1850 | Ga0501075_0082673 | |||
| 1851 | Ga0501075_0140915 | |||
| 1852 | Ga0501075_0184295 | |||
| 1853 | Ga0501076_0034855 | |||
| 1854 | Ga0501076_0106040 | |||
| 1855 | Ga0501076_0242391 | |||
| 1856 | Ga0501079_0157622 | |||
| 1857 | Ga0501079_0169065 | |||
| 1858 | Ga0501079_0249039 | |||
| 1859 | Ga0501080_0044527 | |||
| 1860 | Ga0501080_0046017 | |||
| 1861 | Ga0501080_0167212 | |||
| 1862 | Ga0501081_0061123 | |||
| 1863 | Ga0501081_0162945 | |||
| 1864 | Ga0501035_0321232 | |||
| 1865 | Ga0501035_0420292 | |||
| 1866 | Ga0501044_0281378 | |||
| 1867 | Ga0501044_0324664 | |||
| 1868 | Ga0501045_0041237 | |||
| 1869 | Ga0501045_0112161 | |||
| 1870 | Ga0501045_0121798 | |||
| 1871 | Ga0501045_0131208 | |||
| 1872 | Ga0501045_0152272 | |||
| 1873 | nmdc:mga0yw44_230992_c1 | |||
| 1874 | nmdc:mga05p37_136630_c1 | |||
| 1875 | nmdc:mga05p37_22881_c1 | |||
| 1876 | nmdc:mga05p37_239161_c1 | |||
| 1877 | nmdc:mga05p37_317532_c1 | |||
| 1878 | nmdc:mga09592_10530_c1 | |||
| 1879 | nmdc:mga09592_454562_c1 | |||
| 1880 | nmdc:mga06r32_11741_c1 | |||
| 1881 | nmdc:mga06r32_235502_c1 | |||
| 1882 | nmdc:mga08y16_253582_c1 | |||
| 1883 | nmdc:mga08y16_309180_c1 | |||
| 1884 | nmdc:mga08y16_46579_c1 | |||
| 1885 | nmdc:mga0n895_20042_c1 | |||
| 1886 | nmdc:mga0n895_34444_c1 | |||
| 1887 | nmdc:mga0n895_4716_c1 | |||
| 1888 | nmdc:mga0n895_6829_c1 | |||
| 1889 | nmdc:mga0n895_71514_c1 | |||
| 1890 | nmdc:mga0n895_73251_c1 | |||
| 1891 | nmdc:mga0rr50_115870_c1 | |||
| 1892 | nmdc:mga0rr50_21795_c1 | |||
| 1893 | nmdc:mga0rr50_52926_c1 | |||
| 1894 | nmdc:mga08x19_45146_c1 | |||
| 1895 | nmdc:mga08x19_61937_c1 | |||
| 1896 | nmdc:mga0a205_147831_c1 | |||
| 1897 | nmdc:mga0a205_1512_c1 | |||
| 1898 | nmdc:mga0a205_304465_c1 | |||
| 1899 | nmdc:mga0a205_7873_c1 | |||
| 1900 | Ga0495601_0044443 | |||
| 1901 | Ga0495601_0071635 | |||
| 1902 | Ga0495612_0095547 | |||
| 1903 | Ga0495595_0005502 | |||
| 1904 | Ga0495595_0007450 | |||
| 1905 | Ga0495595_0240009 | |||
| 1906 | Ga0495619_0006148 | |||
| 1907 | Ga0495619_0009378 | |||
| 1908 | Ga0495619_0020953 | |||
| 1909 | Ga0495619_0090189 | |||
| 1910 | Ga0500644_0009006 | |||
| 1911 | Ga0500644_0036267 | |||
| 1912 | Ga0500651_0010935 | |||
| 1913 | Ga0500595_006391 | |||
| 1914 | Ga0500618_000318 | |||
| 1915 | Ga0500559_0031660 | |||
| 1916 | Ga0500559_0052511 | |||
| 1917 | Ga0500600_0037165 | |||
| 1918 | Ga0501084_0189729 | |||
| 1919 | Ga0501082_0052269 | |||
| 1920 | Ga0501082_0254387 | |||
| 1921 | Ga0466962_0070749 | |||
| 1922 | Ga0466962_0090766 | |||
| 1923 | Ga0530510_0031101 | |||
| 1924 | Ga0530510_0044327 | |||
| 1925 | Ga0530510_0062856 | |||
| 1926 | Ga0530510_0300148 | |||
| 1927 | 2523470208 | |||
| 1928 | 2583149123 | |||
| 1929 | 2585846281 | |||
| 1930 | 2643882588 | |||
| 1931 | 2644444600 | |||
| 1932 | 2644549455 | |||
| 1933 | 2644719174 | |||
| 1934 | 2644722419 | |||
| 1935 | 2739235136 | |||
| 1936 | 2791910751 | |||
| 1937 | 2795783657 | |||
| 1938 | 2819707857 | |||
| 1939 | 2842885082 | |||
| 1940 | 2871458053 | |||
| 1941 | 2891326749 | |||
| 1942 | 2904167188 | |||
| 1943 | 2904527519 | |||
| 1944 | 2919143836 | |||
| 1945 | 2919520643 | |||
| 1946 | 2919724634 | |||
| 1947 | 2928097319 | |||
| 1948 | 2929004486 | |||
| 1949 | 2960319379 | |||
| 1950 | 2960378083 | |||
| 1951 | 3006988064 | |||
| 1952 | 8022893672 | |||
| 1953 | 8022915941 | |||
| 1954 | 8056214871 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3mkn-assembly1.cif.gz_D | crystal structure of the e. coli pyrimidine nucleosidase yeik bound to a competitive inhibitor | 0.9587 | 2 | 314 |
| 3mkn-assembly1.cif.gz_A | crystal structure of the e. coli pyrimidine nucleosidase yeik bound to a competitive inhibitor | 0.9578 | 2 | 314 |
| 3mkm-assembly1.cif.gz_C | crystal structure of the e. coli pyrimidine nucleoside hydrolase yeik (apo-form) | 0.956 | 2 | 314 |
| 3b9x-assembly1.cif.gz_C | crystal structure of the e. coli pyrimidine nucleoside hydrolase yeik in complex with inosine | 0.9514 | 2 | 314 |
| 1q8f-assembly1.cif.gz_C | crystal structure of the e.coli pyrimidine nucleoside hydrolase yeik | 0.9513 | 2 | 314 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3mkmC00 | Alpha Beta;Alpha-Beta Complex;Inosine-uridine Nucleoside N-ribohydrolase; Chain A;Ribonucleoside hydrolase-like | 0.956 | 2 | 314 | 3.90.245.10 |
| af_Q9P6J4_1_308_3.90.245.10 | Alpha Beta;Alpha-Beta Complex;Inosine-uridine Nucleoside N-ribohydrolase; Chain A;Ribonucleoside hydrolase-like | 0.9462 | 4 | 315 | 3.90.245.10 |
| af_Q2G217_1_311_3.90.245.10 | Alpha Beta;Alpha-Beta Complex;Inosine-uridine Nucleoside N-ribohydrolase; Chain A;Ribonucleoside hydrolase-like | 0.9434 | 1 | 314 | 3.90.245.10 |
| af_Q9P6J4_1_308_3.90.245.10 | Alpha Beta;Alpha-Beta Complex;Inosine-uridine Nucleoside N-ribohydrolase; Chain A;Ribonucleoside hydrolase-like | 0.9402 | 4 | 315 | 3.90.245.10 |
| 3mkmC00 | Alpha Beta;Alpha-Beta Complex;Inosine-uridine Nucleoside N-ribohydrolase; Chain A;Ribonucleoside hydrolase-like | 0.9401 | 2 | 314 | 3.90.245.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3L7Y1A7-F1-model_v4 | Nucleoside hydrolase | 0.9931 | 124 | 315 |
GO:0005829
GO:0006152 GO:0008477 |
| AF-A0A3D5JDL4-F1-model_v4 | Nucleoside hydrolase | 0.9884 | 1 | 74 |
GO:0005829
GO:0006152 GO:0008477 GO:0045437 |
| AF-A0A3L7Y1A7-F1-model_v4 | Nucleoside hydrolase | 0.9829 | 124 | 315 |
GO:0005829
GO:0006152 GO:0008477 |
| AF-A0A3L7YTA0-F1-model_v4 | Nucleoside hydrolase | 0.9802 | 46 | 314 |
GO:0005829
GO:0006152 GO:0008477 |
| AF-A0A3D5MPC6-F1-model_v4 | Inosine/uridine-preferring nucleoside hydrolase domain-containing protein | 0.9688 | 123 | 314 |
GO:0005829
GO:0006152 GO:0008477 |