F487308

General Info

Members Datasets Scaffolds Average Seq Length
978 402 1954 310

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0046706|Ga0495638_0046706_1519_2592
Length 357
Sequence LSIAKTYACSDAGLLSRSAWRLTSRGGAEHDHMTLNDPEIVMARRKLILDVDTGTDDAVAIMLAALHPGLELVACTTVNGNREIEHTTENTLRTLDHIGRGDIPVHAGLARPVGRLDFPTPRAARDPGVHFVEMPLAPSRSKASRTNAVEFLIETYRNATDEIVLVPVGPLSNIASALALFPKLVDCVPEVVIMGGGHAVSNVTASAEFNVWADPEAAALVFAAGFRKLTLVPLDATHKAVISSQQCKTLRASGGPAAEAAAIFVEKRIEGYRGYQLLADQDAAPVHDALCVASLIEPDMIETRDYHVDVETSGRLTVGRTVIDTNFRSGKEPNARVAMDADTERFGRFVLDTLINH

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
128 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
137 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
201 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
202 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
203 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
204 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
205 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
206 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
207 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
208 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
209 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
210 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
211 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
212 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
213 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
214 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
215 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
216 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
217 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
218 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
219 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
220 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
221 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
222 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
223 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
224 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
225 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
226 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
227 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
228 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
230 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
231 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
232 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
233 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
234 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
235 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
236 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
237 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
238 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
240 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
241 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
245 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
246 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
247 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
248 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
249 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
250 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
251 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
252 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
253 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
254 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
255 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
256 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
257 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
258 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
259 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
260 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
261 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
262 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
263 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
264 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
265 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
266 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
267 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
268 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
269 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
270 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
271 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
272 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
273 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
274 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
275 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
276 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
277 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
278 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
279 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
280 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
281 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
282 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
283 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
284 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
285 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
286 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
287 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
288 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
289 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
290 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
291 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
292 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
293 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
294 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
295 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
296 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
297 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
298 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
299 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
300 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
301 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
302 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
303 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
304 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
305 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
314 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
315 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
316 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
320 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
321 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
322 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
323 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
324 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
325 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
326 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
327 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
328 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
339 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
340 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
341 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
342 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
343 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
344 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
345 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
346 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
347 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
348 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
349 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
352 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
353 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
354 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
355 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
356 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
357 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
358 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
359 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
360 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
361 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
362 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
363 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
364 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
365 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
366 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
367 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
368 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
369 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
370 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
371 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
372 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
373 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
374 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
375 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
376 2582580736 Prauserella sp. Am3 Isolate Unclassified
377 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
378 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
379 2643221679 Angustibacter sp. Root456 Isolate Unclassified
380 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
381 2643221731 Bacillus sp. Root147 Isolate Unclassified
382 2643221732 Bacillus sp. Root239 Isolate Unclassified
383 2738543010 Bacillus sp. YR335 Isolate Unclassified
384 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
385 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
386 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
387 2842882022 Bacillus sp. R-71893 Isolate Unclassified
388 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
389 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
390 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
391 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
392 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
393 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
394 2919720352 Priestia megaterium 4340 Isolate Unclassified
395 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
396 2929004312 Priestia megaterium 1104 Isolate Unclassified
397 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
398 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
399 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
400 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
401 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
402 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.6
Metatranscriptomes 1.53
Isolates 2.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.19
Nodule 0.1
Rhizoplane 9.2
Rhizosphere 81.8
Stem 0
Stem Tuber 0
Unclassified 2.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0046706 3300046460 Bacteria 2719
2 JGI25159J45721_1003617 3300002987 Bacteria 5394
3 JGI25159J45721_1009190 3300002987 Bacteria 2632
4 JGI25151J46595_10002956 3300003187 Bacteria 9710
5 JGI25151J46595_10005484 3300003187 Bacteria 6545
6 JGI25406J46586_10010790 3300003203 Bacteria 4032
7 rootH2_10101307 3300003320 Bacteria 3614
8 rootL2_10008518 3300003322 Bacteria 82305
9 rootL2_10104376 3300003322 Bacteria 14283
10 rootH1_10000320 3300003323 Bacteria 36827
11 JGI25160J50197_1000280 3300003354 Bacteria 37082
12 JGI25160J50197_1000599 3300003354 Bacteria 20168
13 JGI25161J50226_1000212 3300003374 Bacteria 37082
14 JGI25161J50226_1000424 3300003374 Bacteria 20168
15 Ga0006562J51391_1008419 3300003578 Bacteria 2266
16 Ga0055532_1004722 3300003758 Bacteria 2011
17 Ga0055536_1001185 3300003781 Bacteria 16236
18 Ga0055528_1012898 3300003790 Bacteria 3207
19 Ga0055540_1003516 3300003792 Bacteria 7529
20 Ga0055543_1000049 3300004625 Bacteria 108101
21 Ga0055543_1000576 3300004625 Bacteria 20206
22 Ga0058862_10066796 3300004803 Unclassified 3856
23 Ga0065165_1000338 3300005262 Bacteria 76912
24 Ga0065165_1002596 3300005262 Bacteria 14818
25 Ga0070658_10301505 3300005327 Unclassified 1366
26 Ga0070683_100014581 3300005329 Bacteria 6881
27 Ga0070683_100020230 3300005329 Bacteria 5921
28 Ga0070683_100029495 3300005329 Bacteria 4967
29 Ga0070683_100052523 3300005329 Bacteria 3776
30 Ga0070683_100067252 3300005329 Bacteria 3338
31 Ga0070683_100073168 3300005329 Bacteria 3200
32 Ga0070683_100186699 3300005329 Bacteria 1968
33 Ga0070683_100338718 3300005329 Bacteria 1432
34 Ga0070683_100592423 3300005329 Bacteria 1061
35 Ga0070690_100007365 3300005330 Bacteria 6301
36 Ga0070690_100042731 3300005330 Bacteria 2871
37 Ga0070670_100025034 3300005331 Bacteria 5134
38 Ga0070680_100006204 3300005336 Bacteria 9067
39 Ga0070680_100058175 3300005336 Bacteria 3161
40 Ga0070680_100058588 3300005336 Bacteria 3150
41 Ga0070680_100143875 3300005336 Bacteria 2000
42 Ga0070680_100205944 3300005336 Bacteria 1659
43 Ga0070682_100014132 3300005337 Bacteria 4611
44 Ga0070682_100038522 3300005337 Bacteria 2932
45 Ga0070682_100052612 3300005337 Bacteria 2549
46 Ga0068868_100022657 3300005338 Bacteria 4744
47 Ga0068868_100103727 3300005338 Unclassified 2304
48 Ga0070660_100032090 3300005339 Bacteria 3950
49 Ga0070660_100114021 3300005339 Bacteria 2152
50 Ga0070660_100145619 3300005339 Bacteria 1902
51 Ga0070660_100367410 3300005339 Bacteria 1186
52 Ga0070689_100004976 3300005340 Bacteria 9027
53 Ga0070689_100033094 3300005340 Bacteria 3936
54 Ga0070691_10000784 3300005341 Bacteria 12621
55 Ga0070691_10032921 3300005341 Bacteria 2437
56 Ga0070687_100027766 3300005343 Bacteria 2738
57 Ga0070661_100054617 3300005344 Bacteria 2925
58 Ga0070661_100055105 3300005344 Bacteria 2912
59 Ga0070661_100072623 3300005344 Bacteria 2532
60 Ga0070661_100107380 3300005344 Unclassified 2082
61 Ga0070661_100367604 3300005344 Bacteria 1131
62 Ga0070675_100103286 3300005354 Bacteria 2403
63 Ga0070675_100111035 3300005354 Unclassified 2320
64 Ga0070671_100005356 3300005355 Bacteria 10229
65 Ga0070671_100120784 3300005355 Bacteria 2205
66 Ga0070674_100003471 3300005356 Bacteria 8855
67 Ga0070674_100020601 3300005356 Bacteria 4218
68 Ga0070673_100266702 3300005364 Bacteria 1497
69 Ga0070688_100103242 3300005365 Bacteria 1883
70 Ga0070659_100013745 3300005366 Bacteria 6035
71 Ga0070659_100028119 3300005366 Bacteria 4339
72 Ga0070659_100035242 3300005366 Bacteria 3896
73 Ga0070714_100001916 3300005435 Bacteria 15178
74 Ga0070714_100007234 3300005435 Bacteria 8621
75 Ga0070714_100087163 3300005435 Bacteria 2730
76 Ga0070714_100226713 3300005435 Bacteria 1720
77 Ga0070714_100307645 3300005435 Bacteria 1479
78 Ga0070714_100430541 3300005435 Bacteria 1251
79 Ga0070713_100005171 3300005436 Bacteria 8882
80 Ga0070713_100228118 3300005436 Bacteria 1692
81 Ga0070713_100228375 3300005436 Bacteria 1691
82 Ga0070713_100666141 3300005436 Unclassified 992
83 Ga0070701_10023197 3300005438 Bacteria 2985
84 Ga0070711_100079151 3300005439 Bacteria 2337
85 Ga0070711_100089189 3300005439 Bacteria 2218
86 Ga0070705_100022853 3300005440 Bacteria 3348
87 Ga0070700_100017298 3300005441 Bacteria 4119
88 Ga0070700_100116860 3300005441 Bacteria 1781
89 Ga0070694_100046006 3300005444 Bacteria 2927
90 Ga0070708_100007522 3300005445 Bacteria 8720
91 Ga0070708_100020462 3300005445 Bacteria 5579
92 Ga0070663_100002699 3300005455 Bacteria 10042
93 Ga0070663_100010086 3300005455 Bacteria 5876
94 Ga0070678_100024394 3300005456 Bacteria 4048
95 Ga0070662_100045719 3300005457 Bacteria 3142
96 Ga0070681_10000761 3300005458 Bacteria 26755
97 Ga0070681_10010999 3300005458 Bacteria 8945
98 Ga0070681_10019104 3300005458 Bacteria 6859
99 Ga0070681_10042552 3300005458 Bacteria 4551
100 Ga0070681_10045056 3300005458 Bacteria 4414
101 Ga0070681_10067465 3300005458 Bacteria 3545
102 Ga0070681_10080728 3300005458 Bacteria 3208
103 Ga0070681_10097829 3300005458 Bacteria 2881
104 Ga0070681_10207392 3300005458 Bacteria 1876
105 Ga0070681_10239624 3300005458 Bacteria 1727
106 Ga0070681_10362512 3300005458 Bacteria 1360
107 Ga0068867_100035295 3300005459 Bacteria 3626
108 Ga0068867_100133976 3300005459 Bacteria 1929
109 Ga0070685_10025296 3300005466 Bacteria 3268
110 Ga0070685_10043520 3300005466 Bacteria 2567
111 Ga0070685_10111714 3300005466 Bacteria 1684
112 Ga0070706_100022567 3300005467 Bacteria 5794
113 Ga0070707_100092722 3300005468 Bacteria 2924
114 Ga0070707_100137944 3300005468 Bacteria 2373
115 Ga0070698_100021992 3300005471 Bacteria 6676
116 Ga0070679_100001341 3300005530 Bacteria 21723
117 Ga0070679_100026607 3300005530 Bacteria 5687
118 Ga0070679_100027691 3300005530 Bacteria 5580
119 Ga0070679_100055947 3300005530 Bacteria 3930
120 Ga0070679_100058793 3300005530 Bacteria 3831
121 Ga0070679_100091215 3300005530 Bacteria 3035
122 Ga0070679_100140953 3300005530 Bacteria 2390
123 Ga0070679_100171343 3300005530 Bacteria 2143
124 Ga0070679_100306389 3300005530 Bacteria 1539
125 Ga0070684_100029126 3300005535 Bacteria 4676
126 Ga0070684_100098398 3300005535 Bacteria 2610
127 Ga0070684_100139637 3300005535 Bacteria 2190
128 Ga0068853_100029727 3300005539 Bacteria 4609
129 Ga0068853_100086277 3300005539 Bacteria 2752
130 Ga0068853_100247621 3300005539 Bacteria 1635
131 Ga0070672_100146989 3300005543 Bacteria 1948
132 Ga0070672_100411861 3300005543 Bacteria 1160
133 Ga0070696_100060997 3300005546 Bacteria 2638
134 Ga0070693_100021572 3300005547 Bacteria 3413
135 Ga0070693_100118896 3300005547 Bacteria 1636
136 Ga0070693_100205031 3300005547 Bacteria 1283
137 Ga0070665_100010064 3300005548 Bacteria 9570
138 Ga0070665_100017578 3300005548 Bacteria 7183
139 Ga0070665_100032376 3300005548 Bacteria 5262
140 Ga0070665_100501606 3300005548 Unclassified 1225
141 Ga0068855_100046387 3300005563 Bacteria 5137
142 Ga0068855_100112305 3300005563 Bacteria 3127
143 Ga0068855_100173960 3300005563 Bacteria 2437
144 Ga0068855_100381527 3300005563 Bacteria 1547
145 Ga0070664_100029150 3300005564 Bacteria 4600
146 Ga0068857_100021524 3300005577 Bacteria 5673
147 Ga0068857_100033377 3300005577 Bacteria 4552
148 Ga0068857_100150161 3300005577 Bacteria 2110
149 Ga0068857_100179362 3300005577 Bacteria 1927
150 Ga0068857_100185726 3300005577 Bacteria 1892
151 Ga0068856_100016730 3300005614 Bacteria 7104
152 Ga0068856_100080702 3300005614 Bacteria 3227
153 Ga0068856_100116970 3300005614 Bacteria 2667
154 Ga0068856_100255073 3300005614 Bacteria 1769
155 Ga0070702_100000698 3300005615 Bacteria 12659
156 Ga0070702_100129647 3300005615 Bacteria 1591
157 Ga0070702_100137217 3300005615 Bacteria 1553
158 Ga0068852_100001790 3300005616 Bacteria 14582
159 Ga0068852_100007529 3300005616 Bacteria 7950
160 Ga0068852_100111971 3300005616 Bacteria 2483
161 Ga0068852_100327984 3300005616 Bacteria 1488
162 Ga0068859_100021489 3300005617 Bacteria 6478
163 Ga0068859_100025793 3300005617 Bacteria 5896
164 Ga0068859_100074145 3300005617 Bacteria 3442
165 Ga0068859_100237355 3300005617 Bacteria 1912
166 Ga0068864_100036613 3300005618 Bacteria 4183
167 Ga0068864_100082890 3300005618 Bacteria 2815
168 Ga0068864_100128949 3300005618 Bacteria 2270
169 Ga0068861_100162284 3300005719 Bacteria 1844
170 Ga0068851_10017123 3300005834 Bacteria 3477
171 Ga0068870_10006789 3300005840 Bacteria 5072
172 Ga0068870_10108064 3300005840 Bacteria 1583
173 Ga0068863_100054987 3300005841 Bacteria 3770
174 Ga0068863_100295684 3300005841 Unclassified 1570
175 Ga0068858_100052163 3300005842 Bacteria 3784
176 Ga0068858_100076631 3300005842 Bacteria 3106
177 Ga0068858_100109235 3300005842 Bacteria 2582
178 Ga0068858_100399581 3300005842 Bacteria 1320
179 Ga0068860_100011930 3300005843 Bacteria 8565
180 Ga0068860_100052360 3300005843 Bacteria 3883
181 Ga0068860_100086755 3300005843 Bacteria 2979
182 Ga0068860_100337424 3300005843 Unclassified 1481
183 Ga0068860_100448037 3300005843 Bacteria 1283
184 Ga0068862_100062041 3300005844 Bacteria 3214
185 Ga0081455_10000123 3300005937 Bacteria 89254
186 Ga0081539_10001472 3300005985 Bacteria 39944
187 Ga0081539_10004690 3300005985 Bacteria 14827
188 Ga0070717_10160657 3300006028 Bacteria 1949
189 Ga0070717_10179875 3300006028 Bacteria 1843
190 Ga0070717_10253477 3300006028 Bacteria 1555
191 Ga0075363_100096603 3300006048 Bacteria 1631
192 Ga0075364_10131652 3300006051 Bacteria 1679
193 Ga0070716_100207408 3300006173 Bacteria 1307
194 Ga0070712_100064819 3300006175 Bacteria 2592
195 Ga0070712_100115855 3300006175 Bacteria 2009
196 Ga0097621_100029767 3300006237 Bacteria 4316
197 Ga0097621_100287985 3300006237 Bacteria 1447
198 Ga0068871_100477432 3300006358 Bacteria 1121
199 Ga0075430_100431291 3300006846 Bacteria 1088
200 Ga0075431_100084901 3300006847 Bacteria 3268
201 Ga0075431_100230598 3300006847 Bacteria 1887
202 Ga0075433_10000538 3300006852 Bacteria 24874
203 Ga0075433_10021633 3300006852 Bacteria 5396
204 Ga0075433_10106508 3300006852 Bacteria 2485
205 Ga0075434_100001508 3300006871 Bacteria 19661
206 Ga0075434_100018763 3300006871 Bacteria 6686
207 Ga0075434_100056740 3300006871 Bacteria 3892
208 Ga0075434_100067183 3300006871 Bacteria 3572
209 Ga0075429_100032038 3300006880 Bacteria 4570
210 Ga0075429_100189514 3300006880 Bacteria 1802
211 Ga0068865_100038132 3300006881 Bacteria 3250
212 Ga0068865_100184854 3300006881 Unclassified 1607
213 Ga0075436_100010800 3300006914 Bacteria 6265
214 Ga0097620_100021489 3300006931 Bacteria 6478
215 Ga0097620_100025795 3300006931 Bacteria 5896
216 Ga0097620_100074143 3300006931 Bacteria 3442
217 Ga0097620_100237353 3300006931 Bacteria 1912
218 Ga0075435_100001805 3300007076 Bacteria 13929
219 Ga0075435_100090512 3300007076 Bacteria 2524
220 Ga0075435_100101421 3300007076 Bacteria 2385
221 Ga0105240_10024111 3300009093 Bacteria 8031
222 Ga0105240_10082840 3300009093 Bacteria 3939
223 Ga0105240_10334349 3300009093 Bacteria 1723
224 Ga0111539_10009362 3300009094 Bacteria 12366
225 Ga0111539_10053130 3300009094 Bacteria 4823
226 Ga0111539_10103919 3300009094 Bacteria 3333
227 Ga0111539_10175423 3300009094 Bacteria 2504
228 Ga0111539_10973259 3300009094 Bacteria 987
229 Ga0105245_10011452 3300009098 Bacteria 7725
230 Ga0105245_10053696 3300009098 Bacteria 3617
231 Ga0105245_10093907 3300009098 Bacteria 2764
232 Ga0105245_10546467 3300009098 Bacteria 1180
233 Ga0105247_10023897 3300009101 Bacteria 3683
234 Ga0114129_10081287 3300009147 Bacteria 4504
235 Ga0114129_10145419 3300009147 Bacteria 3248
236 Ga0114129_10174582 3300009147 Bacteria 2927
237 Ga0105243_10022315 3300009148 Bacteria 4810
238 Ga0105243_10178662 3300009148 Bacteria 1844
239 Ga0105243_10311228 3300009148 Bacteria 1431
240 Ga0105241_10008405 3300009174 Bacteria 7594
241 Ga0105241_10282225 3300009174 Bacteria 1419
242 Ga0105242_10024312 3300009176 Bacteria 4784
243 Ga0105242_10046823 3300009176 Bacteria 3510
244 Ga0105242_10400815 3300009176 Bacteria 1280
245 Ga0105248_10023670 3300009177 Bacteria 6825
246 Ga0105248_10327382 3300009177 Bacteria 1726
247 Ga0105248_10379955 3300009177 Bacteria 1590
248 Ga0105248_10393667 3300009177 Bacteria 1560
249 Ga0105248_10546121 3300009177 Bacteria 1307
250 Ga0105248_10582673 3300009177 Unclassified 1262
251 Ga0105237_10018665 3300009545 Bacteria 7171
252 Ga0105237_10034049 3300009545 Bacteria 5159
253 Ga0105237_10415477 3300009545 Bacteria 1350
254 Ga0105237_10750544 3300009545 Bacteria 982
255 Ga0105238_10056322 3300009551 Bacteria 3945
256 Ga0105238_10069609 3300009551 Bacteria 3519
257 Ga0105238_10136607 3300009551 Bacteria 2429
258 Ga0105238_10489326 3300009551 Unclassified 1230
259 Ga0105028_103079 3300009993 Bacteria 1748
260 Ga0105239_10033997 3300010375 Bacteria 5597
261 Ga0105239_10197286 3300010375 Bacteria 2254
262 Ga0105246_10001509 3300011119 Bacteria 13795
263 Ga0157373_10015391 3300013100 Bacteria 5591
264 Ga0157371_10023977 3300013102 Bacteria 4457
265 Ga0157370_10011046 3300013104 Bacteria 9469
266 Ga0157370_10023696 3300013104 Bacteria 6091
267 Ga0157370_10072198 3300013104 Bacteria 3257
268 Ga0157370_10075672 3300013104 Bacteria 3173
269 Ga0157370_10152266 3300013104 Bacteria 2152
270 Ga0157369_10008734 3300013105 Bacteria 11608
271 Ga0157369_10043319 3300013105 Bacteria 4906
272 Ga0157369_10118105 3300013105 Bacteria 2815
273 Ga0157369_10156214 3300013105 Bacteria 2409
274 Ga0157369_10169761 3300013105 Bacteria 2299
275 Ga0157369_10195137 3300013105 Bacteria 2127
276 Ga0157369_10212974 3300013105 Bacteria 2025
277 Ga0157369_10230976 3300013105 Bacteria 1934
278 Ga0157369_10389145 3300013105 Bacteria 1447
279 Ga0157374_10006393 3300013296 Bacteria 10001
280 Ga0157378_10001154 3300013297 Bacteria 24017
281 Ga0163162_10392093 3300013306 Bacteria 1521
282 Ga0157372_10006138 3300013307 Bacteria 12766
283 Ga0157372_10021689 3300013307 Bacteria 6943
284 Ga0157372_10030994 3300013307 Bacteria 5853
285 Ga0157372_10148778 3300013307 Bacteria 2701
286 Ga0157372_10158991 3300013307 Bacteria 2610
287 Ga0157372_10868889 3300013307 Bacteria 1047
288 Ga0157375_10009209 3300013308 Bacteria 8658
289 Ga0157375_10039459 3300013308 Bacteria 4545
290 Ga0157375_10127461 3300013308 Bacteria 2662
291 Ga0157375_10192500 3300013308 Bacteria 2194
292 Ga0157375_10233432 3300013308 Bacteria 1999
293 Ga0157375_10325291 3300013308 Bacteria 1702
294 Ga0163163_10128112 3300014325 Bacteria 2577
295 Ga0163163_10159800 3300014325 Bacteria 2298
296 Ga0157380_10251101 3300014326 Bacteria 1601
297 Ga0182008_10068004 3300014497 Bacteria 1753
298 Ga0182008_10108107 3300014497 Bacteria 1377
299 Ga0157377_10016745 3300014745 Bacteria 3776
300 Ga0157377_10023167 3300014745 Bacteria 3288
301 Ga0157379_10024965 3300014968 Bacteria 5305
302 Ga0157379_10028625 3300014968 Bacteria 4955
303 Ga0157379_10053339 3300014968 Bacteria 3611
304 Ga0157376_10366024 3300014969 Bacteria 1384
305 Ga0163161_10172512 3300017792 Bacteria 1654
306 Ga0206356_10045217 3300020070 Bacteria 1363
307 Ga0206356_11606851 3300020070 Bacteria 1708
308 Ga0206350_10021615 3300020080 Bacteria 1765
309 Ga0206354_10651088 3300020081 Bacteria 2186
310 Ga0206354_10779778 3300020081 Bacteria 2043
311 Ga0206353_10034911 3300020082 Bacteria 1212
312 Ga0206353_10328578 3300020082 Bacteria 1539
313 Ga0206353_10517529 3300020082 Bacteria 3879
314 Ga0206353_11431182 3300020082 Bacteria 1973
315 Ga0206353_11527722 3300020082 Bacteria 3617
316 Ga0206353_11682003 3300020082 Bacteria 1869
317 Ga0206353_11772650 3300020082 Bacteria 1135
318 Ga0213875_10000373 3300021388 Bacteria 41081
319 Ga0213875_10020078 3300021388 Bacteria 3207
320 Ga0224712_10029022 3300022467 Bacteria 1983
321 Ga0209147_101402 3300025229 Bacteria 8839
322 Ga0209565_1006092 3300025263 Bacteria 3424
323 Ga0209673_1004649 3300025273 Bacteria 7261
324 Ga0209130_1000559 3300025284 Bacteria 36915
325 Ga0209130_1001091 3300025284 Bacteria 20220
326 Ga0209676_1000213 3300025292 Bacteria 128039
327 Ga0209025_1000863 3300025294 Bacteria 47880
328 Ga0209025_1004514 3300025294 Bacteria 12022
329 Ga0209050_1011809 3300025298 Bacteria 4089
330 Ga0207426_1000200 3300025302 Bacteria 144028
331 Ga0207426_1008366 3300025302 Bacteria 4190
332 Ga0209051_1000945 3300025303 Bacteria 28676
333 Ga0209257_1000757 3300025304 Bacteria 48772
334 Ga0207656_10028673 3300025321 Bacteria 2286
335 Ga0207655_1005685 3300025728 Bacteria 8431
336 Ga0207692_10154346 3300025898 Bacteria 1317
337 Ga0207642_10073416 3300025899 Bacteria 1636
338 Ga0207688_10025836 3300025901 Bacteria 3228
339 Ga0207699_10250936 3300025906 Bacteria 1219
340 Ga0207643_10000509 3300025908 Bacteria 24852
341 Ga0207705_10037046 3300025909 Bacteria 3490
342 Ga0207705_10325761 3300025909 Bacteria 1181
343 Ga0207654_10028289 3300025911 Bacteria 3055
344 Ga0207707_10002441 3300025912 Bacteria 16724
345 Ga0207707_10003694 3300025912 Bacteria 13568
346 Ga0207707_10018831 3300025912 Bacteria 6021
347 Ga0207707_10046889 3300025912 Bacteria 3764
348 Ga0207707_10059113 3300025912 Bacteria 3335
349 Ga0207707_10102228 3300025912 Bacteria 2505
350 Ga0207707_10102804 3300025912 Bacteria 2498
351 Ga0207707_10119140 3300025912 Bacteria 2307
352 Ga0207707_10119995 3300025912 Bacteria 2298
353 Ga0207707_10188342 3300025912 Bacteria 1800
354 Ga0207707_10291479 3300025912 Bacteria 1412
355 Ga0207695_10289813 3300025913 Bacteria 1529
356 Ga0207695_10517545 3300025913 Bacteria 1075
357 Ga0207671_10133057 3300025914 Bacteria 1910
358 Ga0207671_10325237 3300025914 Bacteria 1217
359 Ga0207693_10115797 3300025915 Bacteria 2105
360 Ga0207693_10119180 3300025915 Bacteria 2073
361 Ga0207663_10034475 3300025916 Bacteria 3027
362 Ga0207663_10079171 3300025916 Bacteria 2145
363 Ga0207660_10025317 3300025917 Bacteria 4026
364 Ga0207660_10030907 3300025917 Unclassified 3683
365 Ga0207660_10086294 3300025917 Bacteria 2317
366 Ga0207660_10265270 3300025917 Bacteria 1359
367 Ga0207662_10022210 3300025918 Bacteria 3635
368 Ga0207657_10005449 3300025919 Bacteria 13283
369 Ga0207657_10009888 3300025919 Bacteria 9549
370 Ga0207657_10017028 3300025919 Bacteria 6991
371 Ga0207657_10018623 3300025919 Bacteria 6619
372 Ga0207657_10034581 3300025919 Bacteria 4542
373 Ga0207657_10081850 3300025919 Bacteria 2711
374 Ga0207649_10015939 3300025920 Bacteria 4229
375 Ga0207649_10019505 3300025920 Bacteria 3875
376 Ga0207649_10037479 3300025920 Unclassified 2929
377 Ga0207649_10191455 3300025920 Bacteria 1439
378 Ga0207649_10235144 3300025920 Unclassified 1312
379 Ga0207652_10003277 3300025921 Bacteria 13414
380 Ga0207652_10004500 3300025921 Bacteria 11323
381 Ga0207652_10005110 3300025921 Bacteria 10650
382 Ga0207652_10026829 3300025921 Bacteria 4800
383 Ga0207652_10059785 3300025921 Bacteria 3286
384 Ga0207652_10184043 3300025921 Bacteria 1878
385 Ga0207646_10039331 3300025922 Bacteria 4257
386 Ga0207646_10206412 3300025922 Bacteria 1774
387 Ga0207694_10082941 3300025924 Bacteria 2520
388 Ga0207650_10008792 3300025925 Bacteria 6901
389 Ga0207659_10014892 3300025926 Bacteria 5027
390 Ga0207659_10093949 3300025926 Bacteria 2246
391 Ga0207659_10337022 3300025926 Bacteria 1248
392 Ga0207687_10007807 3300025927 Bacteria 7015
393 Ga0207700_10018003 3300025928 Bacteria 4733
394 Ga0207700_10159309 3300025928 Bacteria 1873
395 Ga0207700_10510769 3300025928 Bacteria 1064
396 Ga0207664_10000121 3300025929 Bacteria 68207
397 Ga0207664_10000908 3300025929 Bacteria 19993
398 Ga0207664_10113663 3300025929 Bacteria 2255
399 Ga0207664_10330799 3300025929 Bacteria 1346
400 Ga0207644_10021503 3300025931 Bacteria 4395
401 Ga0207644_10073215 3300025931 Bacteria 2512
402 Ga0207644_10281060 3300025931 Bacteria 1336
403 Ga0207690_10015371 3300025932 Bacteria 4637
404 Ga0207690_10021246 3300025932 Bacteria 4023
405 Ga0207706_10158497 3300025933 Bacteria 1990
406 Ga0207686_10227806 3300025934 Bacteria 1349
407 Ga0207686_10277571 3300025934 Bacteria 1235
408 Ga0207709_10295861 3300025935 Bacteria 1202
409 Ga0207670_10044013 3300025936 Bacteria 2952
410 Ga0207670_10048410 3300025936 Bacteria 2837
411 Ga0207670_10069384 3300025936 Bacteria 2431
412 Ga0207670_10086534 3300025936 Bacteria 2205
413 Ga0207669_10045217 3300025937 Bacteria 2593
414 Ga0207665_10025540 3300025939 Bacteria 3898
415 Ga0207665_10212308 3300025939 Bacteria 1414
416 Ga0207691_10009738 3300025940 Bacteria 9223
417 Ga0207691_10208844 3300025940 Bacteria 1697
418 Ga0207711_10034448 3300025941 Bacteria 4289
419 Ga0207711_10182944 3300025941 Bacteria 1907
420 Ga0207711_10470606 3300025941 Bacteria 1170
421 Ga0207711_10479673 3300025941 Unclassified 1158
422 Ga0207689_10004151 3300025942 Bacteria 13169
423 Ga0207689_10086399 3300025942 Bacteria 2578
424 Ga0207661_10017412 3300025944 Bacteria 5317
425 Ga0207661_10021239 3300025944 Bacteria 4863
426 Ga0207661_10057525 3300025944 Bacteria 3127
427 Ga0207661_10065426 3300025944 Bacteria 2951
428 Ga0207661_10122767 3300025944 Bacteria 2214
429 Ga0207661_10218999 3300025944 Bacteria 1682
430 Ga0207661_10317868 3300025944 Bacteria 1399
431 Ga0207661_10368867 3300025944 Bacteria 1298
432 Ga0207679_10001724 3300025945 Bacteria 13613
433 Ga0207679_10070604 3300025945 Bacteria 2632
434 Ga0207679_10153076 3300025945 Bacteria 1879
435 Ga0207667_10046202 3300025949 Bacteria 4610
436 Ga0207667_10185725 3300025949 Bacteria 2134
437 Ga0207667_10368423 3300025949 Bacteria 1464
438 Ga0207651_10040089 3300025960 Bacteria 3095
439 Ga0207668_10068207 3300025972 Bacteria 2528
440 Ga0207668_10129687 3300025972 Unclassified 1924
441 Ga0207658_10251144 3300025986 Bacteria 1503
442 Ga0207677_10011454 3300026023 Bacteria 5060
443 Ga0207677_10109977 3300026023 Bacteria 2050
444 Ga0207703_10039059 3300026035 Bacteria 3792
445 Ga0207703_10057066 3300026035 Bacteria 3182
446 Ga0207703_10127250 3300026035 Bacteria 2195
447 Ga0207703_10221336 3300026035 Bacteria 1692
448 Ga0207639_10169575 3300026041 Bacteria 1847
449 Ga0207678_10003455 3300026067 Bacteria 14239
450 Ga0207678_10020275 3300026067 Bacteria 5834
451 Ga0207678_10038256 3300026067 Bacteria 4169
452 Ga0207708_10012398 3300026075 Bacteria 6354
453 Ga0207708_10016793 3300026075 Bacteria 5510
454 Ga0207708_10030879 3300026075 Bacteria 4065
455 Ga0207702_10003496 3300026078 Bacteria 14316
456 Ga0207702_10166019 3300026078 Bacteria 2020
457 Ga0207702_10234471 3300026078 Bacteria 1716
458 Ga0207641_10024973 3300026088 Bacteria 4927
459 Ga0207648_10015351 3300026089 Bacteria 7046
460 Ga0207648_10171408 3300026089 Bacteria 1918
461 Ga0207648_10186761 3300026089 Bacteria 1836
462 Ga0207676_10001025 3300026095 Bacteria 21364
463 Ga0207676_10137357 3300026095 Bacteria 2088
464 Ga0207674_10010726 3300026116 Bacteria 10342
465 Ga0207674_10028008 3300026116 Bacteria 5954
466 Ga0207674_10030859 3300026116 Bacteria 5633
467 Ga0207674_10031713 3300026116 Bacteria 5549
468 Ga0207674_10249408 3300026116 Bacteria 1722
469 Ga0207675_100534619 3300026118 Bacteria 1170
470 Ga0207683_10000792 3300026121 Bacteria 28821
471 Ga0207683_10102182 3300026121 Bacteria 2560
472 Ga0207698_10001508 3300026142 Bacteria 13550
473 Ga0209998_10034400 3300027717 Bacteria 1133
474 Ga0207428_10032737 3300027907 Bacteria 4275
475 Ga0207428_10137104 3300027907 Bacteria 1870
476 Ga0268266_10015764 3300028379 Bacteria 6473
477 Ga0268266_10036232 3300028379 Bacteria 4198
478 Ga0268266_10291146 3300028379 Bacteria 1521
479 Ga0268265_10224447 3300028380 Bacteria 1646
480 Ga0268264_10205704 3300028381 Bacteria 1804
481 Ga0265322_10005052 3300028654 Bacteria 3910
482 Ga0265322_10015144 3300028654 Bacteria 2230
483 Ga0265338_10004565 3300028800 Bacteria 18629
484 Ga0265338_10075824 3300028800 Bacteria 2852
485 Ga0307512_10006564 3300030522 Bacteria 11755
486 Ga0265328_10041600 3300031239 Bacteria 1692
487 Ga0265320_10014590 3300031240 Bacteria 4466
488 Ga0265329_10056499 3300031242 Bacteria 1244
489 Ga0265340_10014521 3300031247 Bacteria 4112
490 Ga0265340_10031664 3300031247 Bacteria 2644
491 Ga0265327_10006161 3300031251 Bacteria 9695
492 Ga0265327_10012094 3300031251 Bacteria 5858
493 Ga0265327_10047637 3300031251 Bacteria 2259
494 Ga0265327_10092789 3300031251 Bacteria 1469
495 Ga0265316_10002772 3300031344 Bacteria 17956
496 Ga0307513_10018297 3300031456 Bacteria 8376
497 Ga0307509_10203601 3300031507 Bacteria 1813
498 Ga0307408_100077042 3300031548 Bacteria 2482
499 Ga0265313_10005148 3300031595 Bacteria 9720
500 Ga0265314_10104712 3300031711 Bacteria 1811
501 Ga0265342_10005387 3300031712 Bacteria 9773
502 Ga0316576_10033708 3300031727 Bacteria 3647
503 Ga0307516_10002263 3300031730 Bacteria 25980
504 Ga0307516_10084950 3300031730 Bacteria 3003
505 Ga0307405_10007230 3300031731 Bacteria 5533
506 Ga0307405_10038317 3300031731 Bacteria 2888
507 Ga0307413_10012460 3300031824 Bacteria 4235
508 Ga0307406_10009395 3300031901 Bacteria 5482
509 Ga0307406_10032073 3300031901 Bacteria 3204
510 Ga0307412_10002452 3300031911 Bacteria 10313
511 Ga0307409_100311301 3300031995 Bacteria 1470
512 Ga0307411_10013450 3300032005 Bacteria 4516
513 Ga0307415_100013875 3300032126 Bacteria 4717
514 Ga0307415_100296598 3300032126 Bacteria 1337
515 Ga0316583_10010822 3300032133 Bacteria 3287
516 Ga0316214_1003450 3300033545 Bacteria 1995
517 Ga0373926_0022338 3300035083 Bacteria 2196
518 Ga0373944_0015764 3300035089 Bacteria 2124
519 Ga0373936_0007825 3300035113 Bacteria 4015
520 Ga0373936_0028633 3300035113 Bacteria 2190
521 Ga0373945_0047548 3300035116 Bacteria 1569
522 Ga0373953_0020991 3300035117 Bacteria 2446
523 Ga0373953_0029837 3300035117 Bacteria 2111
524 Ga0373954_0022064 3300035118 Bacteria 2887
525 Ga0373957_0037683 3300035120 Bacteria 1807
526 Ga0373943_0002734 3300035170 Bacteria 8021
527 Ga0373943_0004387 3300035170 Bacteria 6397
528 Ga0373946_0001078 3300035171 Bacteria 9404
529 Ga0373946_0050879 3300035171 Bacteria 1732
530 Ga0373942_0000034 3300035207 Bacteria 25653
531 Ga0316574_0169510 3300035398 Unclassified 1406
532 Ga0373931_0053536 3300035691 Bacteria 2154
533 Ga0373935_0007767 3300035692 Bacteria 6427
534 Ga0373927_0015160 3300035695 Bacteria 5096
535 Ga0373933_0186375 3300035724 Bacteria 1324
536 Ga0373947_0013733 3300035725 Bacteria 4640
537 Ga0373947_0017071 3300035725 Bacteria 4173
538 Ga0373947_0089785 3300035725 Bacteria 1914
539 Ga0373937_0434946 3300036401 Bacteria 1245
540 Ga0373925_0061651 3300037068 Bacteria 2817
541 Ga0395900_0023444 3300037418 Bacteria 6317
542 Ga0395900_0181312 3300037418 Bacteria 2140
543 Ga0395900_0193252 3300037418 Bacteria 2063
544 Ga0395900_0237740 3300037418 Bacteria 1829
545 Ga0395900_0284361 3300037418 Bacteria 1645
546 Ga0395898_0010338 3300037466 Bacteria 9763
547 Ga0395898_0155639 3300037466 Bacteria 2186
548 Ga0395898_0218632 3300037466 Bacteria 1817
549 Ga0395898_0314269 3300037466 Bacteria 1495
550 Ga0395905_0041967 3300037471 Bacteria 4292
551 Ga0436364_0465814 3300037853 Bacteria 1404
552 Ga0436364_0695796 3300037853 Bacteria 1953
553 Ga0436364_0894784 3300037853 Bacteria 39842
554 Ga0436364_1268460 3300037853 Bacteria 4369
555 Ga0395901_0014883 3300038443 Bacteria 7904
556 Ga0395901_0023843 3300038443 Bacteria 6275
557 Ga0395901_0029607 3300038443 Bacteria 5639
558 Ga0395901_0032500 3300038443 Bacteria 5383
559 Ga0395901_0172388 3300038443 Bacteria 2270
560 Ga0395901_0192377 3300038443 Bacteria 2139
561 Ga0436365_0225286 3300039437 Bacteria 6314
562 Ga0451853_0837686 3300041512 Bacteria 1656
563 Ga0439441_005941 3300042001 Bacteria 1917
564 Ga0466969_0008010 3300044656 Bacteria 5610
565 Ga0466969_0021926 3300044656 Bacteria 3302
566 Ga0466969_0087567 3300044656 Bacteria 1479
567 Ga0466965_0037302 3300044683 Bacteria 2386
568 Ga0466965_0073398 3300044683 Bacteria 1723
569 Ga0466966_0032902 3300044684 Bacteria 3356
570 Ga0466966_0037705 3300044684 Bacteria 3115
571 Ga0466966_0055725 3300044684 Bacteria 2502
572 Ga0466966_0075026 3300044684 Bacteria 2113
573 Ga0466966_0179317 3300044684 Bacteria 1286
574 Ga0466966_0186847 3300044684 Bacteria 1256
575 Ga0466961_0032074 3300044693 Bacteria 3376
576 Ga0466961_0090308 3300044693 Bacteria 1935
577 Ga0466961_0096204 3300044693 Bacteria 1867
578 Ga0466963_0000749 3300044694 Bacteria 16031
579 Ga0466963_0006029 3300044694 Bacteria 7143
580 Ga0466963_0006648 3300044694 Bacteria 6865
581 Ga0466963_0017102 3300044694 Bacteria 4517
582 Ga0466963_0017754 3300044694 Bacteria 4438
583 Ga0466963_0038462 3300044694 Bacteria 3128
584 Ga0466963_0045489 3300044694 Bacteria 2891
585 Ga0466963_0061660 3300044694 Bacteria 2507
586 Ga0466963_0083324 3300044694 Bacteria 2169
587 Ga0466963_0102307 3300044694 Bacteria 1962
588 Ga0466963_0157971 3300044694 Bacteria 1577
589 Ga0466963_0225345 3300044694 Bacteria 1313
590 Ga0466964_0012820 3300044706 Bacteria 3175
591 Ga0466964_0013154 3300044706 Bacteria 3137
592 Ga0466971_0000953 3300044719 Bacteria 11883
593 Ga0466971_0012982 3300044719 Bacteria 3655
594 Ga0466971_0027791 3300044719 Bacteria 2534
595 Ga0466971_0101484 3300044719 Bacteria 1323
596 Ga0466971_0175750 3300044719 Bacteria 1006
597 Ga0466970_0090667 3300044765 Bacteria 1659
598 Ga0466970_0151782 3300044765 Bacteria 1279
599 Ga0466957_0009367 3300044842 Bacteria 5590
600 Ga0466957_0089460 3300044842 Bacteria 1927
601 Ga0466957_0106225 3300044842 Bacteria 1775
602 Ga0466957_0131880 3300044842 Bacteria 1602
603 Ga0466957_0249448 3300044842 Bacteria 1180
604 Ga0466957_0289089 3300044842 Bacteria 1099
605 Ga0466960_0018295 3300044901 Bacteria 3068
606 Ga0466960_0033894 3300044901 Bacteria 2376
607 Ga0466959_0026254 3300045049 Bacteria 4317
608 Ga0466959_0039680 3300045049 Bacteria 3480
609 Ga0466959_0057085 3300045049 Bacteria 2847
610 Ga0466959_0134719 3300045049 Bacteria 1749
611 Ga0466958_0005719 3300045836 Bacteria 6716
612 Ga0466958_0046699 3300045836 Bacteria 2613
613 Ga0466958_0072693 3300045836 Bacteria 2106
614 Ga0466958_0087803 3300045836 Bacteria 1920
615 Ga0466958_0235829 3300045836 Bacteria 1169
616 Ga0466967_0004426 3300045976 Bacteria 9469
617 Ga0466967_0004744 3300045976 Bacteria 9249
618 Ga0466967_0005187 3300045976 Bacteria 8972
619 Ga0466967_0012170 3300045976 Bacteria 6565
620 Ga0466967_0012876 3300045976 Bacteria 6429
621 Ga0466967_0017662 3300045976 Bacteria 5674
622 Ga0466967_0017986 3300045976 Bacteria 5634
623 Ga0466967_0023454 3300045976 Bacteria 5056
624 Ga0466967_0040124 3300045976 Bacteria 4028
625 Ga0466967_0056432 3300045976 Bacteria 3463
626 Ga0466967_0120303 3300045976 Bacteria 2425
627 Ga0466967_0124430 3300045976 Bacteria 2387
628 Ga0466967_0157467 3300045976 Bacteria 2129
629 Ga0466967_0188567 3300045976 Bacteria 1948
630 Ga0466967_0195024 3300045976 Bacteria 1916
631 Ga0466967_0199666 3300045976 Bacteria 1893
632 Ga0466967_0251830 3300045976 Bacteria 1687
633 Ga0466967_0429823 3300045976 Bacteria 1288
634 Ga0466967_0544034 3300045976 Bacteria 1143
635 Ga0495592_0048020 3300046454 Bacteria 3177
636 Ga0495592_0121055 3300046454 Bacteria 1841
637 Ga0495603_0019038 3300046455 Bacteria 4157
638 Ga0495603_0134315 3300046455 Bacteria 1440
639 Ga0495603_0196445 3300046455 Unclassified 1166
640 Ga0495629_0001941 3300046459 Bacteria 16113
641 Ga0495629_0251563 3300046459 Bacteria 1216
642 Ga0495641_0001041 3300046461 Bacteria 23833
643 Ga0495641_0019363 3300046461 Bacteria 3485
644 Ga0495641_0129742 3300046461 Bacteria 1125
645 Ga0495641_0131458 3300046461 Bacteria 1117
646 Ga0495651_0026735 3300046462 Bacteria 4494
647 Ga0495651_0104853 3300046462 Bacteria 2098
648 Ga0495651_0133590 3300046462 Bacteria 1809
649 Ga0495651_0150057 3300046462 Bacteria 1681
650 Ga0495653_0026115 3300046463 Bacteria 4687
651 Ga0495653_0088407 3300046463 Bacteria 2273
652 Ga0495653_0259179 3300046463 Bacteria 1150
653 Ga0495582_0000040 3300046473 Bacteria 66496
654 Ga0495582_0071111 3300046473 Bacteria 1925
655 Ga0495639_0001045 3300046475 Bacteria 12486
656 Ga0495639_0057645 3300046475 Bacteria 1775
657 Ga0495662_0002364 3300046476 Bacteria 9506
658 Ga0495664_0046071 3300046477 Bacteria 2587
659 Ga0495585_0082609 3300046492 Bacteria 1739
660 Ga0495594_0073010 3300046499 Bacteria 1909
661 Ga0495608_0018595 3300046511 Bacteria 4790
662 Ga0495608_0033126 3300046511 Bacteria 3494
663 Ga0495608_0034838 3300046511 Bacteria 3398
664 Ga0495608_0112341 3300046511 Bacteria 1751
665 Ga0495608_0124252 3300046511 Bacteria 1653
666 Ga0495618_0157043 3300046514 Bacteria 1451
667 Ga0495628_0012316 3300046516 Bacteria 7210
668 Ga0495628_0213064 3300046516 Bacteria 1452
669 Ga0495630_0010867 3300046517 Bacteria 6574
670 Ga0495630_0042743 3300046517 Bacteria 3384
671 Ga0495630_0081771 3300046517 Bacteria 2438
672 Ga0495630_0106320 3300046517 Bacteria 2125
673 Ga0495652_0026147 3300046529 Bacteria 5158
674 Ga0495652_0028913 3300046529 Bacteria 4871
675 Ga0495665_0020103 3300046531 Bacteria 3587
676 Ga0495640_0002735 3300046533 Bacteria 14190
677 Ga0495640_0009964 3300046533 Bacteria 7367
678 Ga0495640_0062132 3300046533 Bacteria 2534
679 Ga0495640_0086997 3300046533 Bacteria 2068
680 Ga0495640_0110831 3300046533 Bacteria 1794
681 Ga0495640_0156781 3300046533 Bacteria 1461
682 Ga0495645_0077262 3300046543 Bacteria 2394
683 Ga0495645_0140680 3300046543 Bacteria 1684
684 Ga0495667_0003849 3300046559 Bacteria 10076
685 Ga0495667_0019788 3300046559 Bacteria 4542
686 Ga0495667_0037152 3300046559 Bacteria 3247
687 Ga0495667_0049276 3300046559 Bacteria 2780
688 Ga0495634_0022497 3300046642 Bacteria 4441
689 Ga0495634_0041779 3300046642 Bacteria 3113
690 Ga0495634_0108254 3300046642 Bacteria 1789
691 Ga0495634_0134650 3300046642 Bacteria 1573
692 Ga0495635_0004513 3300046663 Bacteria 9645
693 Ga0495635_0034255 3300046663 Bacteria 3522
694 Ga0495657_0031238 3300046675 Bacteria 3723
695 Ga0495657_0082512 3300046675 Bacteria 2077
696 Ga0495599_0032694 3300046678 Bacteria 3266
697 Ga0495599_0037108 3300046678 Bacteria 3062
698 Ga0495623_0021908 3300046679 Bacteria 4127
699 Ga0495647_0005989 3300046681 Bacteria 4007
700 Ga0495658_0000450 3300046683 Bacteria 22926
701 Ga0495658_0013929 3300046683 Bacteria 4100
702 Ga0495658_0110840 3300046683 Bacteria 1650
703 Ga0495658_0146186 3300046683 Bacteria 1449
704 Ga0495613_0050958 3300046689 Bacteria 3052
705 Ga0495613_0083184 3300046689 Bacteria 2324
706 Ga0495613_0175180 3300046689 Bacteria 1521
707 Ga0495624_0004825 3300046690 Bacteria 9805
708 Ga0495624_0078969 3300046690 Bacteria 2041
709 Ga0495600_0012025 3300046809 Bacteria 5405
710 Ga0495600_0054154 3300046809 Bacteria 2620
711 Ga0495600_0175595 3300046809 Bacteria 1381
712 Ga0495581_0001232 3300047315 Bacteria 14105
713 Ga0495581_0045205 3300047315 Bacteria 2546
714 Ga0495604_0035277 3300047317 Bacteria 3951
715 Ga0495674_0062408 3300047319 Bacteria 3245
716 Ga0495674_0100284 3300047319 Bacteria 2464
717 Ga0495674_0245874 3300047319 Bacteria 1473
718 Ga0495676_0001870 3300047321 Bacteria 18467
719 Ga0495676_0078177 3300047321 Bacteria 2520
720 Ga0495676_0090917 3300047321 Bacteria 2283
721 Ga0495676_0093777 3300047321 Bacteria 2238
722 Ga0495680_0000491 3300047322 Bacteria 44586
723 Ga0495680_0006927 3300047322 Bacteria 10461
724 Ga0495680_0007167 3300047322 Bacteria 10270
725 Ga0495680_0008828 3300047322 Bacteria 9124
726 Ga0495680_0053787 3300047322 Bacteria 3130
727 Ga0495675_0021630 3300047444 Bacteria 4098
728 Ga0495684_0003165 3300047471 Bacteria 12900
729 Ga0495684_0010242 3300047471 Bacteria 7251
730 Ga0495684_0071192 3300047471 Bacteria 2642
731 Ga0495684_0172521 3300047471 Bacteria 1607
732 Ga0495684_0182607 3300047471 Bacteria 1554
733 Ga0495593_0003136 3300047673 Bacteria 9935
734 Ga0495602_0014799 3300048088 Bacteria 7900
735 Ga0495602_0106416 3300048088 Bacteria 2290
736 Ga0496100_0001260 3300048903 Bacteria 12348
737 Ga0496100_0019675 3300048903 Bacteria 4033
738 Ga0496100_0039598 3300048903 Bacteria 2993
739 Ga0496100_0051870 3300048903 Bacteria 2665
740 Ga0496100_0080475 3300048903 Bacteria 2199
741 Ga0496100_0142497 3300048903 Bacteria 1700
742 Ga0496100_0196196 3300048903 Bacteria 1469
743 Ga0496101_0007015 3300048904 Bacteria 7278
744 Ga0496101_0007164 3300048904 Bacteria 7211
745 Ga0496101_0010403 3300048904 Bacteria 6144
746 Ga0496101_0014000 3300048904 Bacteria 5387
747 Ga0496101_0180490 3300048904 Bacteria 1625
748 Ga0496102_0010875 3300048905 Bacteria 7834
749 Ga0496102_0033240 3300048905 Bacteria 4633
750 Ga0496102_0072878 3300048905 Bacteria 3157
751 Ga0496102_0076438 3300048905 Bacteria 3080
752 Ga0496102_0194872 3300048905 Bacteria 1909
753 Ga0496102_0234148 3300048905 Bacteria 1731
754 Ga0496102_0426609 3300048905 Bacteria 1245
755 Ga0496103_0067164 3300048906 Bacteria 2239
756 Ga0496103_0139549 3300048906 Bacteria 1549
757 Ga0496104_0033265 3300048907 Bacteria 4801
758 Ga0496104_0035968 3300048907 Bacteria 4626
759 Ga0496104_0044264 3300048907 Bacteria 4182
760 Ga0496104_0055304 3300048907 Bacteria 3753
761 Ga0496104_0098458 3300048907 Bacteria 2799
762 Ga0496104_0111985 3300048907 Bacteria 2617
763 Ga0496104_0131303 3300048907 Bacteria 2406
764 Ga0496104_0172146 3300048907 Bacteria 2076
765 Ga0496105_0000333 3300048908 Bacteria 30838
766 Ga0496105_0004652 3300048908 Bacteria 10345
767 Ga0496105_0008768 3300048908 Bacteria 7870
768 Ga0496105_0013556 3300048908 Bacteria 6476
769 Ga0496106_0000466 3300048909 Bacteria 29034
770 Ga0496106_0003605 3300048909 Bacteria 11546
771 Ga0496106_0008841 3300048909 Bacteria 7444
772 Ga0496106_0016160 3300048909 Bacteria 5520
773 Ga0496106_0053940 3300048909 Bacteria 3037
774 Ga0496106_0122841 3300048909 Bacteria 2031
775 Ga0496106_0210058 3300048909 Bacteria 1550
776 Ga0496107_0003792 3300048910 Bacteria 10153
777 Ga0496107_0004038 3300048910 Bacteria 9885
778 Ga0496107_0010862 3300048910 Bacteria 6335
779 Ga0496107_0019386 3300048910 Bacteria 4798
780 Ga0496107_0056250 3300048910 Bacteria 2842
781 Ga0496107_0240017 3300048910 Bacteria 1348
782 Ga0496107_0386874 3300048910 Bacteria 1040
783 Ga0496108_0014051 3300048911 Bacteria 6533
784 Ga0496108_0023295 3300048911 Bacteria 5093
785 Ga0496108_0039172 3300048911 Bacteria 3951
786 Ga0496108_0050415 3300048911 Bacteria 3484
787 Ga0496108_0140672 3300048911 Bacteria 2079
788 Ga0496108_0232829 3300048911 Bacteria 1602
789 Ga0496108_0232842 3300048911 Bacteria 1602
790 Ga0496108_0369924 3300048911 Bacteria 1251
791 Ga0496109_0005464 3300048912 Bacteria 10630
792 Ga0496109_0007198 3300048912 Bacteria 9402
793 Ga0496109_0024064 3300048912 Bacteria 5411
794 Ga0496109_0051651 3300048912 Bacteria 3744
795 Ga0496110_0022283 3300048913 Bacteria 5377
796 Ga0496110_0035660 3300048913 Bacteria 4316
797 Ga0496110_0040212 3300048913 Bacteria 4075
798 Ga0496110_0057306 3300048913 Bacteria 3430
799 Ga0496110_0136018 3300048913 Bacteria 2220
800 Ga0496110_0200311 3300048913 Bacteria 1814
801 Ga0496111_0006189 3300048914 Bacteria 7750
802 Ga0496111_0058989 3300048914 Bacteria 2780
803 Ga0496111_0087906 3300048914 Bacteria 2275
804 Ga0496111_0157963 3300048914 Unclassified 1683
805 Ga0496112_0000822 3300048915 Bacteria 22028
806 Ga0496112_0001908 3300048915 Bacteria 16451
807 Ga0496112_0011157 3300048915 Bacteria 8192
808 Ga0496112_0251446 3300048915 Bacteria 1718
809 Ga0496112_0285618 3300048915 Bacteria 1596
810 Ga0496112_0329657 3300048915 Bacteria 1470
811 Ga0496113_0029554 3300048916 Bacteria 3959
812 Ga0496113_0030307 3300048916 Bacteria 3916
813 Ga0496113_0037070 3300048916 Bacteria 3576
814 Ga0496114_0008203 3300048917 Bacteria 8279
815 Ga0496114_0016445 3300048917 Bacteria 5962
816 Ga0496114_0072237 3300048917 Bacteria 2902
817 Ga0496114_0109058 3300048917 Bacteria 2370
818 Ga0496114_0129824 3300048917 Bacteria 2175
819 Ga0496114_0195700 3300048917 Bacteria 1769
820 Ga0496114_0426608 3300048917 Bacteria 1175
821 Ga0496115_0001216 3300048918 Bacteria 18469
822 Ga0496115_0002395 3300048918 Bacteria 13445
823 Ga0496115_0083614 3300048918 Bacteria 2602
824 Ga0496115_0250656 3300048918 Bacteria 1458
825 Ga0496115_0433249 3300048918 Bacteria 1064
826 Ga0496116_0002446 3300048919 Bacteria 19533
827 Ga0496116_0030670 3300048919 Bacteria 3858
828 Ga0496118_0208645 3300048921 Bacteria 1149
829 Ga0496119_0001484 3300048922 Bacteria 28124
830 Ga0496119_0002986 3300048922 Bacteria 17955
831 Ga0496121_0201971 3300048924 Unclassified 1416
832 Ga0496122_0012960 3300048925 Bacteria 8227
833 Ga0496125_0031312 3300048928 Bacteria 4742
834 Ga0496126_0012588 3300048929 Bacteria 8659
835 Ga0501031_0023724 3300049568 Bacteria 3998
836 Ga0501034_0012298 3300049571 Bacteria 8841
837 Ga0501034_0470896 3300049571 Bacteria 1172
838 Ga0501036_0061384 3300049572 Bacteria 3184
839 Ga0501036_0068245 3300049572 Bacteria 3009
840 Ga0501038_0162493 3300049574 Bacteria 1814
841 Ga0501039_0066050 3300049575 Bacteria 2807
842 Ga0501040_0049430 3300049576 Bacteria 2875
843 Ga0501040_0101602 3300049576 Bacteria 2006
844 Ga0501040_0107670 3300049576 Bacteria 1948
845 Ga0501040_0141534 3300049576 Bacteria 1695
846 Ga0501041_0049374 3300049577 Bacteria 2563
847 Ga0501041_0092384 3300049577 Bacteria 1869
848 Ga0501046_0165464 3300049580 Bacteria 1662
849 Ga0501046_0457348 3300049580 Bacteria 917
850 Ga0501047_0047874 3300049581 Bacteria 4130
851 Ga0501048_0028553 3300049582 Bacteria 4050
852 Ga0501048_0036658 3300049582 Bacteria 3524
853 Ga0501048_0135423 3300049582 Bacteria 1741
854 Ga0501067_0021609 3300049583 Bacteria 3561
855 Ga0501067_0028170 3300049583 Bacteria 3112
856 Ga0501067_0080332 3300049583 Bacteria 1807
857 Ga0501068_0065938 3300049584 Bacteria 2205
858 Ga0501069_0017404 3300049585 Bacteria 3867
859 Ga0501069_0038966 3300049585 Bacteria 2624
860 Ga0501069_0080811 3300049585 Bacteria 1831
861 Ga0501069_0174179 3300049585 Bacteria 1242
862 Ga0501070_0000917 3300049586 Bacteria 26697
863 Ga0501070_0072820 3300049586 Bacteria 2844
864 Ga0501070_0152691 3300049586 Bacteria 1905
865 Ga0501070_0198953 3300049586 Bacteria 1646
866 Ga0501070_0237962 3300049586 Bacteria 1490
867 Ga0501070_0254723 3300049586 Bacteria 1435
868 Ga0501071_0047925 3300049587 Bacteria 3071
869 Ga0501071_0086392 3300049587 Bacteria 2301
870 Ga0501071_0109960 3300049587 Bacteria 2036
871 Ga0501071_0129792 3300049587 Bacteria 1872
872 Ga0501072_0193172 3300049588 Bacteria 1623
873 Ga0501075_0082673 3300049591 Bacteria 2432
874 Ga0501075_0140915 3300049591 Bacteria 1837
875 Ga0501075_0184295 3300049591 Bacteria 1592
876 Ga0501076_0034855 3300049592 Bacteria 3937
877 Ga0501076_0106040 3300049592 Bacteria 2268
878 Ga0501076_0242391 3300049592 Bacteria 1475
879 Ga0501079_0157622 3300049741 Bacteria 1770
880 Ga0501079_0169065 3300049741 Bacteria 1705
881 Ga0501079_0249039 3300049741 Bacteria 1388
882 Ga0501080_0044527 3300049742 Bacteria 4131
883 Ga0501080_0046017 3300049742 Bacteria 4064
884 Ga0501080_0167212 3300049742 Bacteria 2029
885 Ga0501081_0061123 3300049743 Bacteria 2612
886 Ga0501081_0162945 3300049743 Bacteria 1607
887 Ga0501035_0321232 3300049822 Bacteria 1301
888 Ga0501035_0420292 3300049822 Bacteria 1110
889 Ga0501044_0281378 3300049823 Bacteria 1597
890 Ga0501044_0324664 3300049823 Bacteria 1463
891 Ga0501045_0041237 3300049824 Bacteria 3359
892 Ga0501045_0112161 3300049824 Bacteria 2022
893 Ga0501045_0121798 3300049824 Bacteria 1937
894 Ga0501045_0131208 3300049824 Bacteria 1862
895 Ga0501045_0152272 3300049824 Bacteria 1721
896 nmdc:mga0yw44_230992_c1 3300050492 Bacteria 1228
897 nmdc:mga05p37_136630_c1 3300050507 Unclassified 3005
898 nmdc:mga05p37_22881_c1 3300050507 Bacteria 7579
899 nmdc:mga05p37_239161_c1 3300050507 Bacteria 2184
900 nmdc:mga05p37_317532_c1 3300050507 Bacteria 1845
901 nmdc:mga09592_10530_c1 3300050508 Bacteria 7523
902 nmdc:mga09592_454562_c1 3300050508 Bacteria 1105
903 nmdc:mga06r32_11741_c1 3300050510 Bacteria 7887
904 nmdc:mga06r32_235502_c1 3300050510 Bacteria 1818
905 nmdc:mga08y16_253582_c1 3300050511 Bacteria 1818
906 nmdc:mga08y16_309180_c1 3300050511 Bacteria 1628
907 nmdc:mga08y16_46579_c1 3300050511 Bacteria 4540
908 nmdc:mga0n895_20042_c1 3300050512 Bacteria 6228
909 nmdc:mga0n895_34444_c1 3300050512 Bacteria 4874
910 nmdc:mga0n895_4716_c1 3300050512 Bacteria 11255
911 nmdc:mga0n895_6829_c1 3300050512 Bacteria 9744
912 nmdc:mga0n895_71514_c1 3300050512 Bacteria 3440
913 nmdc:mga0n895_73251_c1 3300050512 Bacteria 3400
914 nmdc:mga0rr50_115870_c1 3300050513 Bacteria 2127
915 nmdc:mga0rr50_21795_c1 3300050513 Bacteria 4383
916 nmdc:mga0rr50_52926_c1 3300050513 Bacteria 3018
917 nmdc:mga08x19_45146_c1 3300050514 Bacteria 2815
918 nmdc:mga08x19_61937_c1 3300050514 Bacteria 2425
919 nmdc:mga0a205_147831_c1 3300050515 Bacteria 2250
920 nmdc:mga0a205_1512_c1 3300050515 Bacteria 19858
921 nmdc:mga0a205_304465_c1 3300050515 Bacteria 1466
922 nmdc:mga0a205_7873_c1 3300050515 Bacteria 9678
923 Ga0495601_0044443 3300053077 Bacteria 2792
924 Ga0495601_0071635 3300053077 Bacteria 2213
925 Ga0495612_0095547 3300053078 Bacteria 1262
926 Ga0495595_0005502 3300053084 Bacteria 5130
927 Ga0495595_0007450 3300053084 Bacteria 4480
928 Ga0495595_0240009 3300053084 Bacteria 906
929 Ga0495619_0006148 3300053085 Bacteria 7605
930 Ga0495619_0009378 3300053085 Bacteria 6175
931 Ga0495619_0020953 3300053085 Bacteria 4169
932 Ga0495619_0090189 3300053085 Bacteria 2075
933 Ga0500644_0009006 3300053088 Bacteria 2655
934 Ga0500644_0036267 3300053088 Bacteria 1604
935 Ga0500651_0010935 3300053093 Bacteria 5458
936 Ga0500595_006391 3300053119 Bacteria 5002
937 Ga0500618_000318 3300053125 Bacteria 35515
938 Ga0500559_0031660 3300053136 Bacteria 2269
939 Ga0500559_0052511 3300053136 Bacteria 1802
940 Ga0500600_0037165 3300053149 Unclassified 2825
941 Ga0501084_0189729 3300054114 Bacteria 1734
942 Ga0501082_0052269 3300060353 Bacteria 3522
943 Ga0501082_0254387 3300060353 Unclassified 1528
944 Ga0466962_0070749 3300061719 Bacteria 1667
945 Ga0466962_0090766 3300061719 Bacteria 1463
946 Ga0530510_0031101 3300061734 Bacteria 3837
947 Ga0530510_0044327 3300061734 Bacteria 3214
948 Ga0530510_0062856 3300061734 Bacteria 2688
949 Ga0530510_0300148 3300061734 Unclassified 1202
950 2523470208 2523231067 Bacteria 5230452
951 2583149123 2582580736 Bacteria 5325865
952 2585846281 2585427594 Bacteria 6180594
953 2643882588 2643221574 Bacteria 2789653
954 2644444600 2643221679 Bacteria 3839507
955 2644549455 2643221699 Bacteria 5731501
956 2644719174 2643221731 Bacteria 5623886
957 2644722419 2643221732 Bacteria 5756404
958 2739235136 2738543010 Bacteria 5583595
959 2791910751 2791354901 Bacteria 8322202
960 2795783657 2795385470 Bacteria 8317180
961 2819707857 2818991465 Bacteria 5388835
962 2842885082 2842882022 Bacteria 6158489
963 2871458053 2871451962 Bacteria 7336357
964 2891326749 2891326441 Bacteria 6439512
965 2904167188 2904162308 Bacteria 7086713
966 2904527519 2904524088 Bacteria 5887454
967 2919143836 2919143609 Bacteria 6219228
968 2919520643 2919517244 Bacteria 5858162
969 2919724634 2919720352 Bacteria 5986006
970 2928097319 2928093941 Bacteria 5965005
971 2929004486 2929004312 Bacteria 5678476
972 2960319379 2960319331 Bacteria 5502575
973 2960378083 2960375949 Bacteria 5361395
974 3006988064 3006984091 Bacteria 4207523
975 8022893672 8022893055 Bacteria 5300455
976 8022915941 8022914991 Bacteria 5584517
977 8056214871 8056207758 Bacteria 8639239
978 Ga0495638_0046706
979 JGI25159J45721_1003617
980 JGI25159J45721_1009190
981 JGI25151J46595_10002956
982 JGI25151J46595_10005484
983 JGI25406J46586_10010790
984 rootH2_10101307
985 rootL2_10008518
986 rootL2_10104376
987 rootH1_10000320
988 JGI25160J50197_1000280
989 JGI25160J50197_1000599
990 JGI25161J50226_1000212
991 JGI25161J50226_1000424
992 Ga0006562J51391_1008419
993 Ga0055532_1004722
994 Ga0055536_1001185
995 Ga0055528_1012898
996 Ga0055540_1003516
997 Ga0055543_1000049
998 Ga0055543_1000576
999 Ga0058862_10066796
1000 Ga0065165_1000338
1001 Ga0065165_1002596
1002 Ga0070658_10301505
1003 Ga0070683_100014581
1004 Ga0070683_100020230
1005 Ga0070683_100029495
1006 Ga0070683_100052523
1007 Ga0070683_100067252
1008 Ga0070683_100073168
1009 Ga0070683_100186699
1010 Ga0070683_100338718
1011 Ga0070683_100592423
1012 Ga0070690_100007365
1013 Ga0070690_100042731
1014 Ga0070670_100025034
1015 Ga0070680_100006204
1016 Ga0070680_100058175
1017 Ga0070680_100058588
1018 Ga0070680_100143875
1019 Ga0070680_100205944
1020 Ga0070682_100014132
1021 Ga0070682_100038522
1022 Ga0070682_100052612
1023 Ga0068868_100022657
1024 Ga0068868_100103727
1025 Ga0070660_100032090
1026 Ga0070660_100114021
1027 Ga0070660_100145619
1028 Ga0070660_100367410
1029 Ga0070689_100004976
1030 Ga0070689_100033094
1031 Ga0070691_10000784
1032 Ga0070691_10032921
1033 Ga0070687_100027766
1034 Ga0070661_100054617
1035 Ga0070661_100055105
1036 Ga0070661_100072623
1037 Ga0070661_100107380
1038 Ga0070661_100367604
1039 Ga0070675_100103286
1040 Ga0070675_100111035
1041 Ga0070671_100005356
1042 Ga0070671_100120784
1043 Ga0070674_100003471
1044 Ga0070674_100020601
1045 Ga0070673_100266702
1046 Ga0070688_100103242
1047 Ga0070659_100013745
1048 Ga0070659_100028119
1049 Ga0070659_100035242
1050 Ga0070714_100001916
1051 Ga0070714_100007234
1052 Ga0070714_100087163
1053 Ga0070714_100226713
1054 Ga0070714_100307645
1055 Ga0070714_100430541
1056 Ga0070713_100005171
1057 Ga0070713_100228118
1058 Ga0070713_100228375
1059 Ga0070713_100666141
1060 Ga0070701_10023197
1061 Ga0070711_100079151
1062 Ga0070711_100089189
1063 Ga0070705_100022853
1064 Ga0070700_100017298
1065 Ga0070700_100116860
1066 Ga0070694_100046006
1067 Ga0070708_100007522
1068 Ga0070708_100020462
1069 Ga0070663_100002699
1070 Ga0070663_100010086
1071 Ga0070678_100024394
1072 Ga0070662_100045719
1073 Ga0070681_10000761
1074 Ga0070681_10010999
1075 Ga0070681_10019104
1076 Ga0070681_10042552
1077 Ga0070681_10045056
1078 Ga0070681_10067465
1079 Ga0070681_10080728
1080 Ga0070681_10097829
1081 Ga0070681_10207392
1082 Ga0070681_10239624
1083 Ga0070681_10362512
1084 Ga0068867_100035295
1085 Ga0068867_100133976
1086 Ga0070685_10025296
1087 Ga0070685_10043520
1088 Ga0070685_10111714
1089 Ga0070706_100022567
1090 Ga0070707_100092722
1091 Ga0070707_100137944
1092 Ga0070698_100021992
1093 Ga0070679_100001341
1094 Ga0070679_100026607
1095 Ga0070679_100027691
1096 Ga0070679_100055947
1097 Ga0070679_100058793
1098 Ga0070679_100091215
1099 Ga0070679_100140953
1100 Ga0070679_100171343
1101 Ga0070679_100306389
1102 Ga0070684_100029126
1103 Ga0070684_100098398
1104 Ga0070684_100139637
1105 Ga0068853_100029727
1106 Ga0068853_100086277
1107 Ga0068853_100247621
1108 Ga0070672_100146989
1109 Ga0070672_100411861
1110 Ga0070696_100060997
1111 Ga0070693_100021572
1112 Ga0070693_100118896
1113 Ga0070693_100205031
1114 Ga0070665_100010064
1115 Ga0070665_100017578
1116 Ga0070665_100032376
1117 Ga0070665_100501606
1118 Ga0068855_100046387
1119 Ga0068855_100112305
1120 Ga0068855_100173960
1121 Ga0068855_100381527
1122 Ga0070664_100029150
1123 Ga0068857_100021524
1124 Ga0068857_100033377
1125 Ga0068857_100150161
1126 Ga0068857_100179362
1127 Ga0068857_100185726
1128 Ga0068856_100016730
1129 Ga0068856_100080702
1130 Ga0068856_100116970
1131 Ga0068856_100255073
1132 Ga0070702_100000698
1133 Ga0070702_100129647
1134 Ga0070702_100137217
1135 Ga0068852_100001790
1136 Ga0068852_100007529
1137 Ga0068852_100111971
1138 Ga0068852_100327984
1139 Ga0068859_100021489
1140 Ga0068859_100025793
1141 Ga0068859_100074145
1142 Ga0068859_100237355
1143 Ga0068864_100036613
1144 Ga0068864_100082890
1145 Ga0068864_100128949
1146 Ga0068861_100162284
1147 Ga0068851_10017123
1148 Ga0068870_10006789
1149 Ga0068870_10108064
1150 Ga0068863_100054987
1151 Ga0068863_100295684
1152 Ga0068858_100052163
1153 Ga0068858_100076631
1154 Ga0068858_100109235
1155 Ga0068858_100399581
1156 Ga0068860_100011930
1157 Ga0068860_100052360
1158 Ga0068860_100086755
1159 Ga0068860_100337424
1160 Ga0068860_100448037
1161 Ga0068862_100062041
1162 Ga0081455_10000123
1163 Ga0081539_10001472
1164 Ga0081539_10004690
1165 Ga0070717_10160657
1166 Ga0070717_10179875
1167 Ga0070717_10253477
1168 Ga0075363_100096603
1169 Ga0075364_10131652
1170 Ga0070716_100207408
1171 Ga0070712_100064819
1172 Ga0070712_100115855
1173 Ga0097621_100029767
1174 Ga0097621_100287985
1175 Ga0068871_100477432
1176 Ga0075430_100431291
1177 Ga0075431_100084901
1178 Ga0075431_100230598
1179 Ga0075433_10000538
1180 Ga0075433_10021633
1181 Ga0075433_10106508
1182 Ga0075434_100001508
1183 Ga0075434_100018763
1184 Ga0075434_100056740
1185 Ga0075434_100067183
1186 Ga0075429_100032038
1187 Ga0075429_100189514
1188 Ga0068865_100038132
1189 Ga0068865_100184854
1190 Ga0075436_100010800
1191 Ga0097620_100021489
1192 Ga0097620_100025795
1193 Ga0097620_100074143
1194 Ga0097620_100237353
1195 Ga0075435_100001805
1196 Ga0075435_100090512
1197 Ga0075435_100101421
1198 Ga0105240_10024111
1199 Ga0105240_10082840
1200 Ga0105240_10334349
1201 Ga0111539_10009362
1202 Ga0111539_10053130
1203 Ga0111539_10103919
1204 Ga0111539_10175423
1205 Ga0111539_10973259
1206 Ga0105245_10011452
1207 Ga0105245_10053696
1208 Ga0105245_10093907
1209 Ga0105245_10546467
1210 Ga0105247_10023897
1211 Ga0114129_10081287
1212 Ga0114129_10145419
1213 Ga0114129_10174582
1214 Ga0105243_10022315
1215 Ga0105243_10178662
1216 Ga0105243_10311228
1217 Ga0105241_10008405
1218 Ga0105241_10282225
1219 Ga0105242_10024312
1220 Ga0105242_10046823
1221 Ga0105242_10400815
1222 Ga0105248_10023670
1223 Ga0105248_10327382
1224 Ga0105248_10379955
1225 Ga0105248_10393667
1226 Ga0105248_10546121
1227 Ga0105248_10582673
1228 Ga0105237_10018665
1229 Ga0105237_10034049
1230 Ga0105237_10415477
1231 Ga0105237_10750544
1232 Ga0105238_10056322
1233 Ga0105238_10069609
1234 Ga0105238_10136607
1235 Ga0105238_10489326
1236 Ga0105028_103079
1237 Ga0105239_10033997
1238 Ga0105239_10197286
1239 Ga0105246_10001509
1240 Ga0157373_10015391
1241 Ga0157371_10023977
1242 Ga0157370_10011046
1243 Ga0157370_10023696
1244 Ga0157370_10072198
1245 Ga0157370_10075672
1246 Ga0157370_10152266
1247 Ga0157369_10008734
1248 Ga0157369_10043319
1249 Ga0157369_10118105
1250 Ga0157369_10156214
1251 Ga0157369_10169761
1252 Ga0157369_10195137
1253 Ga0157369_10212974
1254 Ga0157369_10230976
1255 Ga0157369_10389145
1256 Ga0157374_10006393
1257 Ga0157378_10001154
1258 Ga0163162_10392093
1259 Ga0157372_10006138
1260 Ga0157372_10021689
1261 Ga0157372_10030994
1262 Ga0157372_10148778
1263 Ga0157372_10158991
1264 Ga0157372_10868889
1265 Ga0157375_10009209
1266 Ga0157375_10039459
1267 Ga0157375_10127461
1268 Ga0157375_10192500
1269 Ga0157375_10233432
1270 Ga0157375_10325291
1271 Ga0163163_10128112
1272 Ga0163163_10159800
1273 Ga0157380_10251101
1274 Ga0182008_10068004
1275 Ga0182008_10108107
1276 Ga0157377_10016745
1277 Ga0157377_10023167
1278 Ga0157379_10024965
1279 Ga0157379_10028625
1280 Ga0157379_10053339
1281 Ga0157376_10366024
1282 Ga0163161_10172512
1283 Ga0206356_10045217
1284 Ga0206356_11606851
1285 Ga0206350_10021615
1286 Ga0206354_10651088
1287 Ga0206354_10779778
1288 Ga0206353_10034911
1289 Ga0206353_10328578
1290 Ga0206353_10517529
1291 Ga0206353_11431182
1292 Ga0206353_11527722
1293 Ga0206353_11682003
1294 Ga0206353_11772650
1295 Ga0213875_10000373
1296 Ga0213875_10020078
1297 Ga0224712_10029022
1298 Ga0209147_101402
1299 Ga0209565_1006092
1300 Ga0209673_1004649
1301 Ga0209130_1000559
1302 Ga0209130_1001091
1303 Ga0209676_1000213
1304 Ga0209025_1000863
1305 Ga0209025_1004514
1306 Ga0209050_1011809
1307 Ga0207426_1000200
1308 Ga0207426_1008366
1309 Ga0209051_1000945
1310 Ga0209257_1000757
1311 Ga0207656_10028673
1312 Ga0207655_1005685
1313 Ga0207692_10154346
1314 Ga0207642_10073416
1315 Ga0207688_10025836
1316 Ga0207699_10250936
1317 Ga0207643_10000509
1318 Ga0207705_10037046
1319 Ga0207705_10325761
1320 Ga0207654_10028289
1321 Ga0207707_10002441
1322 Ga0207707_10003694
1323 Ga0207707_10018831
1324 Ga0207707_10046889
1325 Ga0207707_10059113
1326 Ga0207707_10102228
1327 Ga0207707_10102804
1328 Ga0207707_10119140
1329 Ga0207707_10119995
1330 Ga0207707_10188342
1331 Ga0207707_10291479
1332 Ga0207695_10289813
1333 Ga0207695_10517545
1334 Ga0207671_10133057
1335 Ga0207671_10325237
1336 Ga0207693_10115797
1337 Ga0207693_10119180
1338 Ga0207663_10034475
1339 Ga0207663_10079171
1340 Ga0207660_10025317
1341 Ga0207660_10030907
1342 Ga0207660_10086294
1343 Ga0207660_10265270
1344 Ga0207662_10022210
1345 Ga0207657_10005449
1346 Ga0207657_10009888
1347 Ga0207657_10017028
1348 Ga0207657_10018623
1349 Ga0207657_10034581
1350 Ga0207657_10081850
1351 Ga0207649_10015939
1352 Ga0207649_10019505
1353 Ga0207649_10037479
1354 Ga0207649_10191455
1355 Ga0207649_10235144
1356 Ga0207652_10003277
1357 Ga0207652_10004500
1358 Ga0207652_10005110
1359 Ga0207652_10026829
1360 Ga0207652_10059785
1361 Ga0207652_10184043
1362 Ga0207646_10039331
1363 Ga0207646_10206412
1364 Ga0207694_10082941
1365 Ga0207650_10008792
1366 Ga0207659_10014892
1367 Ga0207659_10093949
1368 Ga0207659_10337022
1369 Ga0207687_10007807
1370 Ga0207700_10018003
1371 Ga0207700_10159309
1372 Ga0207700_10510769
1373 Ga0207664_10000121
1374 Ga0207664_10000908
1375 Ga0207664_10113663
1376 Ga0207664_10330799
1377 Ga0207644_10021503
1378 Ga0207644_10073215
1379 Ga0207644_10281060
1380 Ga0207690_10015371
1381 Ga0207690_10021246
1382 Ga0207706_10158497
1383 Ga0207686_10227806
1384 Ga0207686_10277571
1385 Ga0207709_10295861
1386 Ga0207670_10044013
1387 Ga0207670_10048410
1388 Ga0207670_10069384
1389 Ga0207670_10086534
1390 Ga0207669_10045217
1391 Ga0207665_10025540
1392 Ga0207665_10212308
1393 Ga0207691_10009738
1394 Ga0207691_10208844
1395 Ga0207711_10034448
1396 Ga0207711_10182944
1397 Ga0207711_10470606
1398 Ga0207711_10479673
1399 Ga0207689_10004151
1400 Ga0207689_10086399
1401 Ga0207661_10017412
1402 Ga0207661_10021239
1403 Ga0207661_10057525
1404 Ga0207661_10065426
1405 Ga0207661_10122767
1406 Ga0207661_10218999
1407 Ga0207661_10317868
1408 Ga0207661_10368867
1409 Ga0207679_10001724
1410 Ga0207679_10070604
1411 Ga0207679_10153076
1412 Ga0207667_10046202
1413 Ga0207667_10185725
1414 Ga0207667_10368423
1415 Ga0207651_10040089
1416 Ga0207668_10068207
1417 Ga0207668_10129687
1418 Ga0207658_10251144
1419 Ga0207677_10011454
1420 Ga0207677_10109977
1421 Ga0207703_10039059
1422 Ga0207703_10057066
1423 Ga0207703_10127250
1424 Ga0207703_10221336
1425 Ga0207639_10169575
1426 Ga0207678_10003455
1427 Ga0207678_10020275
1428 Ga0207678_10038256
1429 Ga0207708_10012398
1430 Ga0207708_10016793
1431 Ga0207708_10030879
1432 Ga0207702_10003496
1433 Ga0207702_10166019
1434 Ga0207702_10234471
1435 Ga0207641_10024973
1436 Ga0207648_10015351
1437 Ga0207648_10171408
1438 Ga0207648_10186761
1439 Ga0207676_10001025
1440 Ga0207676_10137357
1441 Ga0207674_10010726
1442 Ga0207674_10028008
1443 Ga0207674_10030859
1444 Ga0207674_10031713
1445 Ga0207674_10249408
1446 Ga0207675_100534619
1447 Ga0207683_10000792
1448 Ga0207683_10102182
1449 Ga0207698_10001508
1450 Ga0209998_10034400
1451 Ga0207428_10032737
1452 Ga0207428_10137104
1453 Ga0268266_10015764
1454 Ga0268266_10036232
1455 Ga0268266_10291146
1456 Ga0268265_10224447
1457 Ga0268264_10205704
1458 Ga0265322_10005052
1459 Ga0265322_10015144
1460 Ga0265338_10004565
1461 Ga0265338_10075824
1462 Ga0307512_10006564
1463 Ga0265328_10041600
1464 Ga0265320_10014590
1465 Ga0265329_10056499
1466 Ga0265340_10014521
1467 Ga0265340_10031664
1468 Ga0265327_10006161
1469 Ga0265327_10012094
1470 Ga0265327_10047637
1471 Ga0265327_10092789
1472 Ga0265316_10002772
1473 Ga0307513_10018297
1474 Ga0307509_10203601
1475 Ga0307408_100077042
1476 Ga0265313_10005148
1477 Ga0265314_10104712
1478 Ga0265342_10005387
1479 Ga0316576_10033708
1480 Ga0307516_10002263
1481 Ga0307516_10084950
1482 Ga0307405_10007230
1483 Ga0307405_10038317
1484 Ga0307413_10012460
1485 Ga0307406_10009395
1486 Ga0307406_10032073
1487 Ga0307412_10002452
1488 Ga0307409_100311301
1489 Ga0307411_10013450
1490 Ga0307415_100013875
1491 Ga0307415_100296598
1492 Ga0316583_10010822
1493 Ga0316214_1003450
1494 Ga0373926_0022338
1495 Ga0373944_0015764
1496 Ga0373936_0007825
1497 Ga0373936_0028633
1498 Ga0373945_0047548
1499 Ga0373953_0020991
1500 Ga0373953_0029837
1501 Ga0373954_0022064
1502 Ga0373957_0037683
1503 Ga0373943_0002734
1504 Ga0373943_0004387
1505 Ga0373946_0001078
1506 Ga0373946_0050879
1507 Ga0373942_0000034
1508 Ga0316574_0169510
1509 Ga0373931_0053536
1510 Ga0373935_0007767
1511 Ga0373927_0015160
1512 Ga0373933_0186375
1513 Ga0373947_0013733
1514 Ga0373947_0017071
1515 Ga0373947_0089785
1516 Ga0373937_0434946
1517 Ga0373925_0061651
1518 Ga0395900_0023444
1519 Ga0395900_0181312
1520 Ga0395900_0193252
1521 Ga0395900_0237740
1522 Ga0395900_0284361
1523 Ga0395898_0010338
1524 Ga0395898_0155639
1525 Ga0395898_0218632
1526 Ga0395898_0314269
1527 Ga0395905_0041967
1528 Ga0436364_0465814
1529 Ga0436364_0695796
1530 Ga0436364_0894784
1531 Ga0436364_1268460
1532 Ga0395901_0014883
1533 Ga0395901_0023843
1534 Ga0395901_0029607
1535 Ga0395901_0032500
1536 Ga0395901_0172388
1537 Ga0395901_0192377
1538 Ga0436365_0225286
1539 Ga0451853_0837686
1540 Ga0439441_005941
1541 Ga0466969_0008010
1542 Ga0466969_0021926
1543 Ga0466969_0087567
1544 Ga0466965_0037302
1545 Ga0466965_0073398
1546 Ga0466966_0032902
1547 Ga0466966_0037705
1548 Ga0466966_0055725
1549 Ga0466966_0075026
1550 Ga0466966_0179317
1551 Ga0466966_0186847
1552 Ga0466961_0032074
1553 Ga0466961_0090308
1554 Ga0466961_0096204
1555 Ga0466963_0000749
1556 Ga0466963_0006029
1557 Ga0466963_0006648
1558 Ga0466963_0017102
1559 Ga0466963_0017754
1560 Ga0466963_0038462
1561 Ga0466963_0045489
1562 Ga0466963_0061660
1563 Ga0466963_0083324
1564 Ga0466963_0102307
1565 Ga0466963_0157971
1566 Ga0466963_0225345
1567 Ga0466964_0012820
1568 Ga0466964_0013154
1569 Ga0466971_0000953
1570 Ga0466971_0012982
1571 Ga0466971_0027791
1572 Ga0466971_0101484
1573 Ga0466971_0175750
1574 Ga0466970_0090667
1575 Ga0466970_0151782
1576 Ga0466957_0009367
1577 Ga0466957_0089460
1578 Ga0466957_0106225
1579 Ga0466957_0131880
1580 Ga0466957_0249448
1581 Ga0466957_0289089
1582 Ga0466960_0018295
1583 Ga0466960_0033894
1584 Ga0466959_0026254
1585 Ga0466959_0039680
1586 Ga0466959_0057085
1587 Ga0466959_0134719
1588 Ga0466958_0005719
1589 Ga0466958_0046699
1590 Ga0466958_0072693
1591 Ga0466958_0087803
1592 Ga0466958_0235829
1593 Ga0466967_0004426
1594 Ga0466967_0004744
1595 Ga0466967_0005187
1596 Ga0466967_0012170
1597 Ga0466967_0012876
1598 Ga0466967_0017662
1599 Ga0466967_0017986
1600 Ga0466967_0023454
1601 Ga0466967_0040124
1602 Ga0466967_0056432
1603 Ga0466967_0120303
1604 Ga0466967_0124430
1605 Ga0466967_0157467
1606 Ga0466967_0188567
1607 Ga0466967_0195024
1608 Ga0466967_0199666
1609 Ga0466967_0251830
1610 Ga0466967_0429823
1611 Ga0466967_0544034
1612 Ga0495592_0048020
1613 Ga0495592_0121055
1614 Ga0495603_0019038
1615 Ga0495603_0134315
1616 Ga0495603_0196445
1617 Ga0495629_0001941
1618 Ga0495629_0251563
1619 Ga0495641_0001041
1620 Ga0495641_0019363
1621 Ga0495641_0129742
1622 Ga0495641_0131458
1623 Ga0495651_0026735
1624 Ga0495651_0104853
1625 Ga0495651_0133590
1626 Ga0495651_0150057
1627 Ga0495653_0026115
1628 Ga0495653_0088407
1629 Ga0495653_0259179
1630 Ga0495582_0000040
1631 Ga0495582_0071111
1632 Ga0495639_0001045
1633 Ga0495639_0057645
1634 Ga0495662_0002364
1635 Ga0495664_0046071
1636 Ga0495585_0082609
1637 Ga0495594_0073010
1638 Ga0495608_0018595
1639 Ga0495608_0033126
1640 Ga0495608_0034838
1641 Ga0495608_0112341
1642 Ga0495608_0124252
1643 Ga0495618_0157043
1644 Ga0495628_0012316
1645 Ga0495628_0213064
1646 Ga0495630_0010867
1647 Ga0495630_0042743
1648 Ga0495630_0081771
1649 Ga0495630_0106320
1650 Ga0495652_0026147
1651 Ga0495652_0028913
1652 Ga0495665_0020103
1653 Ga0495640_0002735
1654 Ga0495640_0009964
1655 Ga0495640_0062132
1656 Ga0495640_0086997
1657 Ga0495640_0110831
1658 Ga0495640_0156781
1659 Ga0495645_0077262
1660 Ga0495645_0140680
1661 Ga0495667_0003849
1662 Ga0495667_0019788
1663 Ga0495667_0037152
1664 Ga0495667_0049276
1665 Ga0495634_0022497
1666 Ga0495634_0041779
1667 Ga0495634_0108254
1668 Ga0495634_0134650
1669 Ga0495635_0004513
1670 Ga0495635_0034255
1671 Ga0495657_0031238
1672 Ga0495657_0082512
1673 Ga0495599_0032694
1674 Ga0495599_0037108
1675 Ga0495623_0021908
1676 Ga0495647_0005989
1677 Ga0495658_0000450
1678 Ga0495658_0013929
1679 Ga0495658_0110840
1680 Ga0495658_0146186
1681 Ga0495613_0050958
1682 Ga0495613_0083184
1683 Ga0495613_0175180
1684 Ga0495624_0004825
1685 Ga0495624_0078969
1686 Ga0495600_0012025
1687 Ga0495600_0054154
1688 Ga0495600_0175595
1689 Ga0495581_0001232
1690 Ga0495581_0045205
1691 Ga0495604_0035277
1692 Ga0495674_0062408
1693 Ga0495674_0100284
1694 Ga0495674_0245874
1695 Ga0495676_0001870
1696 Ga0495676_0078177
1697 Ga0495676_0090917
1698 Ga0495676_0093777
1699 Ga0495680_0000491
1700 Ga0495680_0006927
1701 Ga0495680_0007167
1702 Ga0495680_0008828
1703 Ga0495680_0053787
1704 Ga0495675_0021630
1705 Ga0495684_0003165
1706 Ga0495684_0010242
1707 Ga0495684_0071192
1708 Ga0495684_0172521
1709 Ga0495684_0182607
1710 Ga0495593_0003136
1711 Ga0495602_0014799
1712 Ga0495602_0106416
1713 Ga0496100_0001260
1714 Ga0496100_0019675
1715 Ga0496100_0039598
1716 Ga0496100_0051870
1717 Ga0496100_0080475
1718 Ga0496100_0142497
1719 Ga0496100_0196196
1720 Ga0496101_0007015
1721 Ga0496101_0007164
1722 Ga0496101_0010403
1723 Ga0496101_0014000
1724 Ga0496101_0180490
1725 Ga0496102_0010875
1726 Ga0496102_0033240
1727 Ga0496102_0072878
1728 Ga0496102_0076438
1729 Ga0496102_0194872
1730 Ga0496102_0234148
1731 Ga0496102_0426609
1732 Ga0496103_0067164
1733 Ga0496103_0139549
1734 Ga0496104_0033265
1735 Ga0496104_0035968
1736 Ga0496104_0044264
1737 Ga0496104_0055304
1738 Ga0496104_0098458
1739 Ga0496104_0111985
1740 Ga0496104_0131303
1741 Ga0496104_0172146
1742 Ga0496105_0000333
1743 Ga0496105_0004652
1744 Ga0496105_0008768
1745 Ga0496105_0013556
1746 Ga0496106_0000466
1747 Ga0496106_0003605
1748 Ga0496106_0008841
1749 Ga0496106_0016160
1750 Ga0496106_0053940
1751 Ga0496106_0122841
1752 Ga0496106_0210058
1753 Ga0496107_0003792
1754 Ga0496107_0004038
1755 Ga0496107_0010862
1756 Ga0496107_0019386
1757 Ga0496107_0056250
1758 Ga0496107_0240017
1759 Ga0496107_0386874
1760 Ga0496108_0014051
1761 Ga0496108_0023295
1762 Ga0496108_0039172
1763 Ga0496108_0050415
1764 Ga0496108_0140672
1765 Ga0496108_0232829
1766 Ga0496108_0232842
1767 Ga0496108_0369924
1768 Ga0496109_0005464
1769 Ga0496109_0007198
1770 Ga0496109_0024064
1771 Ga0496109_0051651
1772 Ga0496110_0022283
1773 Ga0496110_0035660
1774 Ga0496110_0040212
1775 Ga0496110_0057306
1776 Ga0496110_0136018
1777 Ga0496110_0200311
1778 Ga0496111_0006189
1779 Ga0496111_0058989
1780 Ga0496111_0087906
1781 Ga0496111_0157963
1782 Ga0496112_0000822
1783 Ga0496112_0001908
1784 Ga0496112_0011157
1785 Ga0496112_0251446
1786 Ga0496112_0285618
1787 Ga0496112_0329657
1788 Ga0496113_0029554
1789 Ga0496113_0030307
1790 Ga0496113_0037070
1791 Ga0496114_0008203
1792 Ga0496114_0016445
1793 Ga0496114_0072237
1794 Ga0496114_0109058
1795 Ga0496114_0129824
1796 Ga0496114_0195700
1797 Ga0496114_0426608
1798 Ga0496115_0001216
1799 Ga0496115_0002395
1800 Ga0496115_0083614
1801 Ga0496115_0250656
1802 Ga0496115_0433249
1803 Ga0496116_0002446
1804 Ga0496116_0030670
1805 Ga0496118_0208645
1806 Ga0496119_0001484
1807 Ga0496119_0002986
1808 Ga0496121_0201971
1809 Ga0496122_0012960
1810 Ga0496125_0031312
1811 Ga0496126_0012588
1812 Ga0501031_0023724
1813 Ga0501034_0012298
1814 Ga0501034_0470896
1815 Ga0501036_0061384
1816 Ga0501036_0068245
1817 Ga0501038_0162493
1818 Ga0501039_0066050
1819 Ga0501040_0049430
1820 Ga0501040_0101602
1821 Ga0501040_0107670
1822 Ga0501040_0141534
1823 Ga0501041_0049374
1824 Ga0501041_0092384
1825 Ga0501046_0165464
1826 Ga0501046_0457348
1827 Ga0501047_0047874
1828 Ga0501048_0028553
1829 Ga0501048_0036658
1830 Ga0501048_0135423
1831 Ga0501067_0021609
1832 Ga0501067_0028170
1833 Ga0501067_0080332
1834 Ga0501068_0065938
1835 Ga0501069_0017404
1836 Ga0501069_0038966
1837 Ga0501069_0080811
1838 Ga0501069_0174179
1839 Ga0501070_0000917
1840 Ga0501070_0072820
1841 Ga0501070_0152691
1842 Ga0501070_0198953
1843 Ga0501070_0237962
1844 Ga0501070_0254723
1845 Ga0501071_0047925
1846 Ga0501071_0086392
1847 Ga0501071_0109960
1848 Ga0501071_0129792
1849 Ga0501072_0193172
1850 Ga0501075_0082673
1851 Ga0501075_0140915
1852 Ga0501075_0184295
1853 Ga0501076_0034855
1854 Ga0501076_0106040
1855 Ga0501076_0242391
1856 Ga0501079_0157622
1857 Ga0501079_0169065
1858 Ga0501079_0249039
1859 Ga0501080_0044527
1860 Ga0501080_0046017
1861 Ga0501080_0167212
1862 Ga0501081_0061123
1863 Ga0501081_0162945
1864 Ga0501035_0321232
1865 Ga0501035_0420292
1866 Ga0501044_0281378
1867 Ga0501044_0324664
1868 Ga0501045_0041237
1869 Ga0501045_0112161
1870 Ga0501045_0121798
1871 Ga0501045_0131208
1872 Ga0501045_0152272
1873 nmdc:mga0yw44_230992_c1
1874 nmdc:mga05p37_136630_c1
1875 nmdc:mga05p37_22881_c1
1876 nmdc:mga05p37_239161_c1
1877 nmdc:mga05p37_317532_c1
1878 nmdc:mga09592_10530_c1
1879 nmdc:mga09592_454562_c1
1880 nmdc:mga06r32_11741_c1
1881 nmdc:mga06r32_235502_c1
1882 nmdc:mga08y16_253582_c1
1883 nmdc:mga08y16_309180_c1
1884 nmdc:mga08y16_46579_c1
1885 nmdc:mga0n895_20042_c1
1886 nmdc:mga0n895_34444_c1
1887 nmdc:mga0n895_4716_c1
1888 nmdc:mga0n895_6829_c1
1889 nmdc:mga0n895_71514_c1
1890 nmdc:mga0n895_73251_c1
1891 nmdc:mga0rr50_115870_c1
1892 nmdc:mga0rr50_21795_c1
1893 nmdc:mga0rr50_52926_c1
1894 nmdc:mga08x19_45146_c1
1895 nmdc:mga08x19_61937_c1
1896 nmdc:mga0a205_147831_c1
1897 nmdc:mga0a205_1512_c1
1898 nmdc:mga0a205_304465_c1
1899 nmdc:mga0a205_7873_c1
1900 Ga0495601_0044443
1901 Ga0495601_0071635
1902 Ga0495612_0095547
1903 Ga0495595_0005502
1904 Ga0495595_0007450
1905 Ga0495595_0240009
1906 Ga0495619_0006148
1907 Ga0495619_0009378
1908 Ga0495619_0020953
1909 Ga0495619_0090189
1910 Ga0500644_0009006
1911 Ga0500644_0036267
1912 Ga0500651_0010935
1913 Ga0500595_006391
1914 Ga0500618_000318
1915 Ga0500559_0031660
1916 Ga0500559_0052511
1917 Ga0500600_0037165
1918 Ga0501084_0189729
1919 Ga0501082_0052269
1920 Ga0501082_0254387
1921 Ga0466962_0070749
1922 Ga0466962_0090766
1923 Ga0530510_0031101
1924 Ga0530510_0044327
1925 Ga0530510_0062856
1926 Ga0530510_0300148
1927 2523470208
1928 2583149123
1929 2585846281
1930 2643882588
1931 2644444600
1932 2644549455
1933 2644719174
1934 2644722419
1935 2739235136
1936 2791910751
1937 2795783657
1938 2819707857
1939 2842885082
1940 2871458053
1941 2891326749
1942 2904167188
1943 2904527519
1944 2919143836
1945 2919520643
1946 2919724634
1947 2928097319
1948 2929004486
1949 2960319379
1950 2960378083
1951 3006988064
1952 8022893672
1953 8022915941
1954 8056214871

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01156

IU_nuc_hydro

Inosine-uridine preferring nucleoside hydrolase

47

348

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mkn-assembly1.cif.gz_D crystal structure of the e. coli pyrimidine nucleosidase yeik bound to a competitive inhibitor 0.9587 2 314
3mkn-assembly1.cif.gz_A crystal structure of the e. coli pyrimidine nucleosidase yeik bound to a competitive inhibitor 0.9578 2 314
3mkm-assembly1.cif.gz_C crystal structure of the e. coli pyrimidine nucleoside hydrolase yeik (apo-form) 0.956 2 314
3b9x-assembly1.cif.gz_C crystal structure of the e. coli pyrimidine nucleoside hydrolase yeik in complex with inosine 0.9514 2 314
1q8f-assembly1.cif.gz_C crystal structure of the e.coli pyrimidine nucleoside hydrolase yeik 0.9513 2 314
ID Description Score Start End Superfamily
3mkmC00 Alpha Beta;Alpha-Beta Complex;Inosine-uridine Nucleoside N-ribohydrolase; Chain A;Ribonucleoside hydrolase-like 0.956 2 314 3.90.245.10
af_Q9P6J4_1_308_3.90.245.10 Alpha Beta;Alpha-Beta Complex;Inosine-uridine Nucleoside N-ribohydrolase; Chain A;Ribonucleoside hydrolase-like 0.9462 4 315 3.90.245.10
af_Q2G217_1_311_3.90.245.10 Alpha Beta;Alpha-Beta Complex;Inosine-uridine Nucleoside N-ribohydrolase; Chain A;Ribonucleoside hydrolase-like 0.9434 1 314 3.90.245.10
af_Q9P6J4_1_308_3.90.245.10 Alpha Beta;Alpha-Beta Complex;Inosine-uridine Nucleoside N-ribohydrolase; Chain A;Ribonucleoside hydrolase-like 0.9402 4 315 3.90.245.10
3mkmC00 Alpha Beta;Alpha-Beta Complex;Inosine-uridine Nucleoside N-ribohydrolase; Chain A;Ribonucleoside hydrolase-like 0.9401 2 314 3.90.245.10
ID Description Score Start End GO Terms
AF-A0A3L7Y1A7-F1-model_v4 Nucleoside hydrolase 0.9931 124 315 GO:0005829
GO:0006152
GO:0008477
AF-A0A3D5JDL4-F1-model_v4 Nucleoside hydrolase 0.9884 1 74 GO:0005829
GO:0006152
GO:0008477
GO:0045437
AF-A0A3L7Y1A7-F1-model_v4 Nucleoside hydrolase 0.9829 124 315 GO:0005829
GO:0006152
GO:0008477
AF-A0A3L7YTA0-F1-model_v4 Nucleoside hydrolase 0.9802 46 314 GO:0005829
GO:0006152
GO:0008477
AF-A0A3D5MPC6-F1-model_v4 Inosine/uridine-preferring nucleoside hydrolase domain-containing protein 0.9688 123 314 GO:0005829
GO:0006152
GO:0008477

Map