F487201

General Info

Members Datasets Scaffolds Average Seq Length
974 513 1948 53

Family's Representative Sequence

Representative Sequence 3300003659|JGI25404J52841_10003524|JGI25404J52841_100035243
Length 54
Sequence MKAILTVQNIASDLVTTFWTPVFVGIFIAIVIYALWPRNQAAFDEAARMPLREE

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
122 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
125 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
184 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
185 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
192 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
193 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
194 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
200 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
201 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
202 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
203 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
208 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
213 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
214 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
215 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
216 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
217 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
218 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
219 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
220 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
221 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
222 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
225 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
226 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
227 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
228 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
229 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
230 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
231 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
232 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
233 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
237 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
238 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
239 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
242 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
243 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
244 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
245 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
246 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
247 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
248 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
249 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
250 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
251 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
252 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
253 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
254 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
255 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
256 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
257 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
258 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
259 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
260 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
261 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
262 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
263 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
264 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
265 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
266 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
267 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
268 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
269 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
270 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
271 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
272 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
273 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
274 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
275 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
276 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
277 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
278 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
279 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
280 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
281 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
282 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
283 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
284 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
285 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
286 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
287 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
288 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
289 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
290 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
291 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
292 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
293 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
294 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
295 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
296 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
297 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
298 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
299 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
300 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
301 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
302 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
303 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
304 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
305 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
306 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
307 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
308 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
309 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
310 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
311 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
312 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
313 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
314 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
315 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
316 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
317 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
318 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
319 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
320 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
321 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
322 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
323 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
324 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
325 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
326 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
327 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
328 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
329 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
330 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
331 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
332 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
333 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
334 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
335 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
336 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
337 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
338 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
339 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
340 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
341 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
342 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
343 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
344 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
345 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
346 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
347 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
348 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
349 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
350 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
351 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
352 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
353 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
354 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
355 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
356 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
357 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
358 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
359 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
360 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
361 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
362 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
363 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
364 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
365 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
366 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
367 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
368 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
369 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
370 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
371 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
372 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
373 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
374 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
375 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
376 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
377 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
378 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
379 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
380 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
381 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
382 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
383 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
384 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
385 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
386 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
387 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
388 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
389 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
390 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
391 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
392 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
393 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
394 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
395 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
396 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
397 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
398 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
399 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
400 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
401 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
402 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
403 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
404 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
405 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
406 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
407 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
408 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
409 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
410 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
411 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
412 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
413 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
414 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
415 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
416 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
417 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
418 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
419 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
420 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
421 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
422 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
423 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
424 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
425 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
426 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
427 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
428 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
429 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
430 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
431 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
432 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
433 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
434 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
435 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
436 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
437 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
438 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
439 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
440 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
441 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
442 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
443 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
444 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
445 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
446 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
447 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
448 2791355199
449 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
450 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
451 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
452 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
453 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
454 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
455 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
456 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
457 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
458 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
459 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
460 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
461 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
462 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
463 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
464 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
465 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
466 2922368715
467 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
468 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
469 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
470 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
471 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
472 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
473 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
474 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
475 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
476 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
477 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
478 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
479 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
480 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
481 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
482 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
483 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
484 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
485 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
486 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
487 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
488 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
489 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
490 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
491 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
492 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
493 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
494 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
495 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
496 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
497 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
498 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
499 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
500 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
501 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
502 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
503 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
504 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
505 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
506 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
507 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
508 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
509 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
510 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
511 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
512 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
513 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.56
Metatranscriptomes 0.1
Isolates 8.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.29
Nodule 7.39
Rhizoplane 7.39
Rhizosphere 64.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10003524 3300003659 Bacteria 3102
2 JGI25160J50197_1007453 3300003354 Bacteria 4278
3 JGI25404J52841_10033508 3300003659 Bacteria 1095
4 Ga0065165_1024361 3300005262 Bacteria 2034
5 Ga0065704_10057105 3300005289 Bacteria 645
6 Ga0065712_10444555 3300005290 Bacteria 691
7 Ga0065715_10304552 3300005293 Bacteria 1012
8 Ga0065707_10032968 3300005295 Bacteria 1310
9 Ga0070658_10236767 3300005327 Bacteria 1547
10 Ga0070658_11330970 3300005327 Bacteria 624
11 Ga0070676_10333695 3300005328 Bacteria 1038
12 Ga0070683_100073356 3300005329 Bacteria 3196
13 Ga0070683_100328126 3300005329 Bacteria 1457
14 Ga0070683_101370712 3300005329 Bacteria 680
15 Ga0070690_100141016 3300005330 Bacteria 1636
16 Ga0070670_100096384 3300005331 Bacteria 2545
17 Ga0070677_10384459 3300005333 Bacteria 736
18 Ga0068869_100172722 3300005334 Bacteria 1689
19 Ga0068869_100800581 3300005334 Bacteria 810
20 Ga0068869_101325413 3300005334 Bacteria 635
21 Ga0070666_10300185 3300005335 Bacteria 1143
22 Ga0070680_100018368 3300005336 Bacteria 5524
23 Ga0070680_101010223 3300005336 Bacteria 718
24 Ga0070682_100138468 3300005337 Bacteria 1656
25 Ga0070682_101008799 3300005337 Bacteria 691
26 Ga0068868_100007407 3300005338 Bacteria 7814
27 Ga0068868_100010220 3300005338 Bacteria 6785
28 Ga0068868_100614185 3300005338 Bacteria 965
29 Ga0068868_102146475 3300005338 Bacteria 532
30 Ga0070660_100302428 3300005339 Bacteria 1312
31 Ga0070660_100912824 3300005339 Bacteria 741
32 Ga0070689_100936494 3300005340 Bacteria 768
33 Ga0070689_101070768 3300005340 Bacteria 720
34 Ga0070691_10647691 3300005341 Bacteria 629
35 Ga0070687_100946727 3300005343 Bacteria 621
36 Ga0070661_100258418 3300005344 Bacteria 1346
37 Ga0070661_100553511 3300005344 Bacteria 926
38 Ga0070661_101081372 3300005344 Bacteria 668
39 Ga0070692_11111041 3300005345 Bacteria 558
40 Ga0070668_100673479 3300005347 Bacteria 910
41 Ga0070668_101522236 3300005347 Bacteria 612
42 Ga0070668_102166761 3300005347 Bacteria 513
43 Ga0070669_100716666 3300005353 Bacteria 846
44 Ga0070669_101419301 3300005353 Bacteria 602
45 Ga0070675_101046957 3300005354 Bacteria 750
46 Ga0070671_100550642 3300005355 Bacteria 995
47 Ga0070671_101584836 3300005355 Bacteria 580
48 Ga0070671_101850273 3300005355 Bacteria 537
49 Ga0070674_100102072 3300005356 Bacteria 2091
50 Ga0070674_100851818 3300005356 Bacteria 791
51 Ga0070673_101558819 3300005364 Bacteria 624
52 Ga0070688_100368730 3300005365 Bacteria 1056
53 Ga0070688_101624028 3300005365 Bacteria 528
54 Ga0070667_100195827 3300005367 Bacteria 1791
55 Ga0070667_101313979 3300005367 Bacteria 678
56 Ga0070703_10528903 3300005406 Bacteria 535
57 Ga0070709_10611730 3300005434 Bacteria 840
58 Ga0070714_100402021 3300005435 Bacteria 1295
59 Ga0070713_100313537 3300005436 Bacteria 1447
60 Ga0070701_10478226 3300005438 Bacteria 804
61 Ga0070711_100118939 3300005439 Bacteria 1951
62 Ga0070711_101858853 3300005439 Bacteria 529
63 Ga0070700_101950220 3300005441 Bacteria 509
64 Ga0070694_100605673 3300005444 Bacteria 883
65 Ga0070708_100302596 3300005445 Bacteria 1506
66 Ga0070708_100847246 3300005445 Bacteria 859
67 Ga0070663_100162060 3300005455 Bacteria 1722
68 Ga0070663_100279995 3300005455 Bacteria 1329
69 Ga0070663_100582452 3300005455 Bacteria 939
70 Ga0070678_100084545 3300005456 Bacteria 2416
71 Ga0070678_100385961 3300005456 Bacteria 1213
72 Ga0070678_100978995 3300005456 Bacteria 777
73 Ga0070678_101446096 3300005456 Bacteria 643
74 Ga0070662_101799466 3300005457 Bacteria 529
75 Ga0070681_10086734 3300005458 Bacteria 3083
76 Ga0070681_10856013 3300005458 Bacteria 827
77 Ga0068867_100385722 3300005459 Bacteria 1178
78 Ga0068867_100418933 3300005459 Bacteria 1134
79 Ga0068867_100733429 3300005459 Bacteria 875
80 Ga0068867_102040007 3300005459 Bacteria 543
81 Ga0070706_100742131 3300005467 Bacteria 910
82 Ga0070698_100111170 3300005471 Bacteria 2705
83 Ga0070698_100486283 3300005471 Bacteria 1172
84 Ga0070698_100756713 3300005471 Bacteria 915
85 Ga0070699_101059871 3300005518 Bacteria 744
86 Ga0070699_101086932 3300005518 Bacteria 734
87 Ga0070679_100014484 3300005530 Bacteria 7574
88 Ga0070684_100495844 3300005535 Bacteria 1131
89 Ga0070697_100105006 3300005536 Bacteria 2350
90 Ga0068853_100849027 3300005539 Bacteria 876
91 Ga0068853_101162873 3300005539 Bacteria 745
92 Ga0070672_100534370 3300005543 Bacteria 1017
93 Ga0070686_101016674 3300005544 Bacteria 681
94 Ga0070695_100218226 3300005545 Bacteria 1373
95 Ga0070693_100068382 3300005547 Bacteria 2084
96 Ga0070693_101208791 3300005547 Bacteria 581
97 Ga0070665_100020627 3300005548 Bacteria 6621
98 Ga0070665_100078578 3300005548 Bacteria 3306
99 Ga0070665_100111139 3300005548 Bacteria 2743
100 Ga0070665_100113175 3300005548 Bacteria 2716
101 Ga0070665_100805315 3300005548 Bacteria 952
102 Ga0070665_101086692 3300005548 Bacteria 811
103 Ga0070665_101119582 3300005548 Bacteria 799
104 Ga0070665_102182876 3300005548 Bacteria 558
105 Ga0070704_101283491 3300005549 Bacteria 669
106 Ga0068855_100536123 3300005563 Bacteria 1268
107 Ga0070664_100130878 3300005564 Bacteria 2204
108 Ga0070664_100185710 3300005564 Bacteria 1850
109 Ga0070664_100706493 3300005564 Bacteria 939
110 Ga0068854_100418865 3300005578 Bacteria 1112
111 Ga0068854_101485886 3300005578 Bacteria 615
112 Ga0068856_100854458 3300005614 Bacteria 929
113 Ga0070702_101162903 3300005615 Bacteria 620
114 Ga0068852_101917389 3300005616 Bacteria 615
115 Ga0068852_102628556 3300005616 Bacteria 523
116 Ga0068859_100044971 3300005617 Bacteria 4436
117 Ga0068859_100566907 3300005617 Bacteria 1229
118 Ga0068859_100708118 3300005617 Bacteria 1097
119 Ga0068859_102866521 3300005617 Bacteria 528
120 Ga0068864_102481515 3300005618 Bacteria 525
121 Ga0068866_10118105 3300005718 Bacteria 1490
122 Ga0068861_100545785 3300005719 Bacteria 1055
123 Ga0068861_101380508 3300005719 Bacteria 687
124 Ga0068861_101410493 3300005719 Bacteria 681
125 Ga0068861_101698612 3300005719 Bacteria 624
126 Ga0068851_10274594 3300005834 Bacteria 962
127 Ga0068851_10501925 3300005834 Bacteria 728
128 Ga0068870_10897422 3300005840 Bacteria 626
129 Ga0068863_100124361 3300005841 Bacteria 2461
130 Ga0068863_100335866 3300005841 Bacteria 1469
131 Ga0068863_101084744 3300005841 Bacteria 805
132 Ga0068863_101695447 3300005841 Bacteria 641
133 Ga0068858_100102383 3300005842 Bacteria 2671
134 Ga0068858_100264482 3300005842 Bacteria 1636
135 Ga0068858_101011591 3300005842 Bacteria 815
136 Ga0068858_101095963 3300005842 Bacteria 782
137 Ga0068858_101216605 3300005842 Bacteria 741
138 Ga0068860_100000360 3300005843 Bacteria 60297
139 Ga0068860_100126218 3300005843 Bacteria 2452
140 Ga0068860_100533311 3300005843 Bacteria 1174
141 Ga0068860_101317927 3300005843 Bacteria 743
142 Ga0068860_101463597 3300005843 Bacteria 704
143 Ga0068862_100634994 3300005844 Bacteria 1028
144 Ga0068862_100664259 3300005844 Bacteria 1006
145 Ga0068862_101041839 3300005844 Bacteria 811
146 Ga0068862_101565684 3300005844 Bacteria 665
147 Ga0068862_101668974 3300005844 Bacteria 645
148 Ga0081455_10161627 3300005937 Bacteria 1716
149 Ga0081455_10311305 3300005937 Bacteria 1125
150 Ga0081540_1000585 3300005983 Bacteria 35126
151 Ga0081540_1002910 3300005983 Bacteria 13803
152 Ga0081540_1027714 3300005983 Bacteria 3202
153 Ga0081540_1049081 3300005983 Bacteria 2109
154 Ga0081540_1049472 3300005983 Bacteria 2096
155 Ga0081540_1063531 3300005983 Bacteria 1747
156 Ga0081540_1325469 3300005983 Bacteria 527
157 Ga0070717_10030457 3300006028 Bacteria 4336
158 Ga0070717_10400438 3300006028 Bacteria 1233
159 Ga0070717_11058751 3300006028 Bacteria 739
160 Ga0070717_11385441 3300006028 Bacteria 639
161 Ga0075365_10043420 3300006038 Bacteria 2943
162 Ga0075365_10233887 3300006038 Bacteria 1290
163 Ga0075365_10268430 3300006038 Bacteria 1200
164 Ga0075363_101040387 3300006048 Bacteria 506
165 Ga0075432_10312120 3300006058 Bacteria 656
166 Ga0070715_10160329 3300006163 Bacteria 1111
167 Ga0070715_11042241 3300006163 Bacteria 512
168 Ga0075362_10414399 3300006177 Bacteria 681
169 Ga0075362_10621095 3300006177 Bacteria 560
170 Ga0075367_10710194 3300006178 Bacteria 639
171 Ga0075367_11127710 3300006178 Bacteria 502
172 Ga0075369_10221625 3300006186 Bacteria 875
173 Ga0075369_10377582 3300006186 Bacteria 667
174 Ga0075369_10377592 3300006186 Bacteria 667
175 Ga0075366_10293849 3300006195 Bacteria 994
176 Ga0075366_10682722 3300006195 Bacteria 638
177 Ga0075366_10981610 3300006195 Bacteria 527
178 Ga0075366_10987357 3300006195 Bacteria 525
179 Ga0097621_100102239 3300006237 Bacteria 2412
180 Ga0097621_100179278 3300006237 Bacteria 1830
181 Ga0097621_100717274 3300006237 Bacteria 922
182 Ga0097621_100896854 3300006237 Bacteria 826
183 Ga0097621_101356463 3300006237 Bacteria 673
184 Ga0075370_10389725 3300006353 Bacteria 835
185 Ga0075370_10773923 3300006353 Bacteria 585
186 Ga0068871_100216828 3300006358 Bacteria 1657
187 Ga0068871_100315109 3300006358 Bacteria 1376
188 Ga0068871_100593490 3300006358 Bacteria 1007
189 Ga0068871_100711691 3300006358 Bacteria 921
190 Ga0068871_100907893 3300006358 Bacteria 817
191 Ga0068871_102382741 3300006358 Bacteria 505
192 Ga0068865_100118278 3300006881 Bacteria 1966
193 Ga0068865_100376706 3300006881 Bacteria 1156
194 Ga0068865_101940994 3300006881 Bacteria 533
195 Ga0097620_100044970 3300006931 Bacteria 4436
196 Ga0097620_100566871 3300006931 Bacteria 1229
197 Ga0097620_100708098 3300006931 Bacteria 1097
198 Ga0097620_102866526 3300006931 Bacteria 528
199 Ga0105244_10112006 3300009036 Bacteria 1327
200 Ga0105250_10148397 3300009092 Bacteria 975
201 Ga0105240_10284876 3300009093 Bacteria 1897
202 Ga0105240_10439665 3300009093 Bacteria 1462
203 Ga0105240_11527212 3300009093 Bacteria 700
204 Ga0105240_12177172 3300009093 Bacteria 575
205 Ga0105240_12308697 3300009093 Bacteria 557
206 Ga0105240_12496186 3300009093 Bacteria 534
207 Ga0105245_10176206 3300009098 Bacteria 2040
208 Ga0105245_11608907 3300009098 Bacteria 701
209 Ga0105245_11838642 3300009098 Bacteria 659
210 Ga0105247_10049672 3300009101 Bacteria 2579
211 Ga0105247_10137036 3300009101 Bacteria 1600
212 Ga0105247_10219177 3300009101 Bacteria 1287
213 Ga0105247_10478548 3300009101 Bacteria 903
214 Ga0105247_10624068 3300009101 Bacteria 802
215 Ga0105243_11624757 3300009148 Bacteria 673
216 Ga0105243_11822357 3300009148 Bacteria 640
217 Ga0105243_11880176 3300009148 Bacteria 631
218 Ga0105241_10332843 3300009174 Bacteria 1313
219 Ga0105241_10795456 3300009174 Bacteria 871
220 Ga0105241_10798334 3300009174 Bacteria 869
221 Ga0105241_12374861 3300009174 Bacteria 529
222 Ga0105242_10262355 3300009176 Bacteria 1561
223 Ga0105242_11353239 3300009176 Bacteria 738
224 Ga0105248_10054220 3300009177 Bacteria 4496
225 Ga0105248_10585099 3300009177 Bacteria 1259
226 Ga0105248_11609338 3300009177 Bacteria 736
227 Ga0105248_11946294 3300009177 Bacteria 667
228 Ga0105237_10006317 3300009545 Bacteria 13172
229 Ga0105237_10183044 3300009545 Bacteria 2095
230 Ga0105237_12182870 3300009545 Bacteria 563
231 Ga0105238_10133557 3300009551 Bacteria 2460
232 Ga0105238_10148326 3300009551 Bacteria 2322
233 Ga0105238_10494007 3300009551 Bacteria 1224
234 Ga0105238_10619196 3300009551 Bacteria 1091
235 Ga0105238_10816981 3300009551 Bacteria 948
236 Ga0105238_11069847 3300009551 Bacteria 829
237 Ga0105238_12967259 3300009551 Bacteria 510
238 Ga0105249_10706020 3300009553 Bacteria 1069
239 Ga0105249_10861139 3300009553 Bacteria 972
240 Ga0105249_10878279 3300009553 Bacteria 963
241 Ga0105239_10071117 3300010375 Bacteria 3822
242 Ga0105239_10175903 3300010375 Bacteria 2394
243 Ga0105239_10336907 3300010375 Bacteria 1702
244 Ga0105239_10740243 3300010375 Bacteria 1125
245 Ga0105239_11363497 3300010375 Bacteria 818
246 Ga0105239_12632064 3300010375 Bacteria 587
247 Ga0105239_13558582 3300010375 Bacteria 506
248 Ga0105246_10106574 3300011119 Bacteria 2051
249 Ga0105246_10443107 3300011119 Bacteria 1089
250 Ga0105246_10458449 3300011119 Bacteria 1073
251 Ga0105246_10736872 3300011119 Bacteria 868
252 Ga0105246_11630940 3300011119 Bacteria 610
253 Ga0157319_1024370 3300012497 Bacteria 612
254 Ga0157370_10203594 3300013104 Bacteria 1836
255 Ga0157370_11449576 3300013104 Bacteria 617
256 Ga0157369_10288898 3300013105 Bacteria 1707
257 Ga0157374_10020966 3300013296 Bacteria 5807
258 Ga0157374_11514209 3300013296 Bacteria 694
259 Ga0157374_11844726 3300013296 Bacteria 630
260 Ga0157374_12633826 3300013296 Bacteria 531
261 Ga0157378_10791581 3300013297 Bacteria 973
262 Ga0157378_10798106 3300013297 Bacteria 970
263 Ga0157378_10879330 3300013297 Bacteria 926
264 Ga0157378_10921624 3300013297 Bacteria 905
265 Ga0157378_11166942 3300013297 Bacteria 809
266 Ga0157378_12800334 3300013297 Bacteria 540
267 Ga0163162_10165796 3300013306 Bacteria 2333
268 Ga0163162_10270304 3300013306 Bacteria 1832
269 Ga0163162_11918916 3300013306 Bacteria 678
270 Ga0157372_12375167 3300013307 Bacteria 609
271 Ga0157375_10008608 3300013308 Bacteria 8934
272 Ga0157375_11133342 3300013308 Bacteria 916
273 Ga0157375_11435120 3300013308 Bacteria 814
274 Ga0157375_12529985 3300013308 Bacteria 613
275 Ga0157375_12630447 3300013308 Bacteria 601
276 Ga0163163_10629727 3300014325 Bacteria 1136
277 Ga0163163_11897498 3300014325 Bacteria 656
278 Ga0163163_12118355 3300014325 Bacteria 622
279 Ga0163163_12226601 3300014325 Bacteria 607
280 Ga0163163_12873636 3300014325 Bacteria 537
281 Ga0157380_11259209 3300014326 Bacteria 785
282 Ga0157380_11324390 3300014326 Bacteria 768
283 Ga0157377_10155272 3300014745 Bacteria 1418
284 Ga0157377_10395133 3300014745 Bacteria 940
285 Ga0157379_10179398 3300014968 Bacteria 1913
286 Ga0157379_10731315 3300014968 Bacteria 930
287 Ga0157379_10806591 3300014968 Bacteria 886
288 Ga0157379_10931954 3300014968 Bacteria 825
289 Ga0157379_12045653 3300014968 Bacteria 567
290 Ga0157376_10003124 3300014969 Bacteria 11381
291 Ga0157376_11457887 3300014969 Bacteria 717
292 Ga0157376_11722269 3300014969 Bacteria 662
293 Ga0182007_10351307 3300015262 Bacteria 554
294 Ga0163161_10903547 3300017792 Bacteria 748
295 Ga0213872_10181325 3300021361 Bacteria 909
296 Ga0213874_10314804 3300021377 Bacteria 592
297 Ga0213876_10000677 3300021384 Bacteria 24226
298 Ga0213871_10092699 3300021441 Bacteria 876
299 Ga0209677_121472 3300025253 Bacteria 740
300 Ga0209233_1004122 3300025261 Bacteria 5007
301 Ga0209758_1004187 3300025297 Bacteria 12254
302 Ga0209758_1054319 3300025297 Bacteria 1369
303 Ga0207697_10156079 3300025315 Bacteria 994
304 Ga0207697_10239635 3300025315 Bacteria 802
305 Ga0207697_10379777 3300025315 Bacteria 627
306 Ga0207656_10229753 3300025321 Bacteria 904
307 Ga0207696_1107183 3300025711 Bacteria 759
308 Ga0207642_10172453 3300025899 Bacteria 1172
309 Ga0207642_10519137 3300025899 Bacteria 732
310 Ga0207710_10042863 3300025900 Bacteria 2011
311 Ga0207710_10157676 3300025900 Bacteria 1104
312 Ga0207710_10274242 3300025900 Bacteria 848
313 Ga0207688_10057535 3300025901 Bacteria 2186
314 Ga0207688_10073295 3300025901 Bacteria 1946
315 Ga0207680_10314877 3300025903 Bacteria 1093
316 Ga0207647_10305125 3300025904 Bacteria 906
317 Ga0207647_10373282 3300025904 Bacteria 806
318 Ga0207685_10306879 3300025905 Bacteria 787
319 Ga0207645_10166445 3300025907 Bacteria 1444
320 Ga0207645_10723460 3300025907 Bacteria 677
321 Ga0207705_10211380 3300025909 Bacteria 1471
322 Ga0207705_10350619 3300025909 Bacteria 1137
323 Ga0207684_10162463 3300025910 Bacteria 1924
324 Ga0207684_10381807 3300025910 Bacteria 1212
325 Ga0207684_10866987 3300025910 Bacteria 760
326 Ga0207654_10386351 3300025911 Bacteria 970
327 Ga0207654_10770437 3300025911 Bacteria 694
328 Ga0207654_11354714 3300025911 Bacteria 519
329 Ga0207707_10234158 3300025912 Bacteria 1598
330 Ga0207707_10714162 3300025912 Bacteria 841
331 Ga0207695_10075203 3300025913 Bacteria 3437
332 Ga0207695_10247662 3300025913 Bacteria 1682
333 Ga0207671_10007602 3300025914 Bacteria 9377
334 Ga0207671_10211671 3300025914 Bacteria 1517
335 Ga0207671_10277682 3300025914 Bacteria 1321
336 Ga0207671_10936176 3300025914 Bacteria 684
337 Ga0207671_11205702 3300025914 Bacteria 592
338 Ga0207663_10091180 3300025916 Bacteria 2023
339 Ga0207663_10842886 3300025916 Bacteria 731
340 Ga0207660_10717239 3300025917 Bacteria 816
341 Ga0207662_10318838 3300025918 Bacteria 1037
342 Ga0207657_10742500 3300025919 Bacteria 761
343 Ga0207649_10211284 3300025920 Bacteria 1377
344 Ga0207649_10436599 3300025920 Bacteria 986
345 Ga0207652_10021522 3300025921 Bacteria 5322
346 Ga0207694_10203457 3300025924 Bacteria 1611
347 Ga0207694_10313919 3300025924 Bacteria 1293
348 Ga0207650_10251662 3300025925 Bacteria 1430
349 Ga0207659_10159647 3300025926 Bacteria 1768
350 Ga0207659_11095883 3300025926 Bacteria 685
351 Ga0207687_10033315 3300025927 Bacteria 3494
352 Ga0207664_10179497 3300025929 Bacteria 1817
353 Ga0207644_10343568 3300025931 Bacteria 1211
354 Ga0207644_10479962 3300025931 Bacteria 1024
355 Ga0207644_10696064 3300025931 Bacteria 847
356 Ga0207644_11671161 3300025931 Bacteria 534
357 Ga0207644_11848626 3300025931 Bacteria 505
358 Ga0207706_10402543 3300025933 Bacteria 1186
359 Ga0207686_10114939 3300025934 Bacteria 1822
360 Ga0207686_10721939 3300025934 Bacteria 793
361 Ga0207670_10247007 3300025936 Bacteria 1377
362 Ga0207669_10360837 3300025937 Bacteria 1126
363 Ga0207704_10117482 3300025938 Bacteria 1812
364 Ga0207704_10237030 3300025938 Bacteria 1360
365 Ga0207704_11473644 3300025938 Bacteria 584
366 Ga0207704_11739716 3300025938 Bacteria 536
367 Ga0207691_10141692 3300025940 Bacteria 2118
368 Ga0207691_10262737 3300025940 Bacteria 1488
369 Ga0207711_10301302 3300025941 Bacteria 1478
370 Ga0207711_10578762 3300025941 Bacteria 1047
371 Ga0207711_10696421 3300025941 Bacteria 948
372 Ga0207689_10471142 3300025942 Bacteria 1051
373 Ga0207689_10749733 3300025942 Bacteria 824
374 Ga0207661_10247297 3300025944 Bacteria 1584
375 Ga0207679_10446407 3300025945 Bacteria 1146
376 Ga0207679_10676703 3300025945 Bacteria 935
377 Ga0207679_10800293 3300025945 Bacteria 859
378 Ga0207667_10199083 3300025949 Bacteria 2055
379 Ga0207651_11322584 3300025960 Bacteria 648
380 Ga0207712_10112764 3300025961 Bacteria 2043
381 Ga0207668_10467464 3300025972 Bacteria 1079
382 Ga0207640_10385573 3300025981 Bacteria 1137
383 Ga0207658_10145680 3300025986 Bacteria 1923
384 Ga0207658_10234241 3300025986 Bacteria 1552
385 Ga0207677_10228859 3300026023 Bacteria 1496
386 Ga0207677_10286151 3300026023 Bacteria 1355
387 Ga0207677_11771724 3300026023 Bacteria 573
388 Ga0207703_10260422 3300026035 Bacteria 1567
389 Ga0207703_10387091 3300026035 Bacteria 1295
390 Ga0207703_10841586 3300026035 Bacteria 877
391 Ga0207703_11761505 3300026035 Bacteria 595
392 Ga0207639_10324294 3300026041 Bacteria 1368
393 Ga0207639_10462653 3300026041 Bacteria 1153
394 Ga0207639_10590244 3300026041 Bacteria 1023
395 Ga0207639_10603828 3300026041 Bacteria 1012
396 Ga0207678_10040637 3300026067 Bacteria 4033
397 Ga0207678_10272055 3300026067 Bacteria 1453
398 Ga0207678_10318063 3300026067 Bacteria 1339
399 Ga0207678_10489223 3300026067 Bacteria 1072
400 Ga0207678_10958843 3300026067 Bacteria 757
401 Ga0207641_10113724 3300026088 Bacteria 2404
402 Ga0207641_12097424 3300026088 Bacteria 566
403 Ga0207641_12223141 3300026088 Bacteria 549
404 Ga0207641_12628686 3300026088 Bacteria 501
405 Ga0207648_10400700 3300026089 Bacteria 1243
406 Ga0207648_10577393 3300026089 Bacteria 1035
407 Ga0207648_10767777 3300026089 Bacteria 896
408 Ga0207676_10498432 3300026095 Bacteria 1156
409 Ga0207676_11805424 3300026095 Bacteria 610
410 Ga0207674_10645936 3300026116 Bacteria 1022
411 Ga0207675_102131600 3300026118 Bacteria 577
412 Ga0207683_10026290 3300026121 Bacteria 5023
413 Ga0207683_10543705 3300026121 Bacteria 1074
414 Ga0207683_11379199 3300026121 Bacteria 652
415 Ga0207683_11939960 3300026121 Bacteria 537
416 Ga0207698_10424106 3300026142 Bacteria 1277
417 Ga0209389_1000097 3300027296 Bacteria 80338
418 Ga0209589_1000132 3300027357 Bacteria 80338
419 Ga0209489_100368 3300027361 Bacteria 80342
420 Ga0268266_10030100 3300028379 Bacteria 4612
421 Ga0268266_10056051 3300028379 Bacteria 3390
422 Ga0268266_10062317 3300028379 Bacteria 3218
423 Ga0268266_10191723 3300028379 Bacteria 1866
424 Ga0268266_10616507 3300028379 Bacteria 1043
425 Ga0268266_10687273 3300028379 Bacteria 986
426 Ga0268266_12120028 3300028379 Bacteria 535
427 Ga0268265_10291746 3300028380 Bacteria 1464
428 Ga0268265_11098215 3300028380 Bacteria 789
429 Ga0268265_11183325 3300028380 Bacteria 761
430 Ga0268265_11956699 3300028380 Bacteria 593
431 Ga0268264_10000030 3300028381 Bacteria 418542
432 Ga0268264_10303728 3300028381 Bacteria 1503
433 Ga0268264_11063990 3300028381 Bacteria 817
434 Ga0307517_10345751 3300028786 Bacteria 810
435 Ga0307515_10845737 3300028794 Bacteria 541
436 Ga0307511_10095745 3300030521 Bacteria 1981
437 Ga0307511_10096779 3300030521 Bacteria 1964
438 Ga0307511_10154879 3300030521 Bacteria 1304
439 Ga0307512_10339012 3300030522 Bacteria 671
440 Ga0265332_10056338 3300031238 Bacteria 1684
441 Ga0265331_10383756 3300031250 Bacteria 630
442 Ga0265316_10327353 3300031344 Bacteria 1112
443 Ga0307513_10055674 3300031456 Bacteria 4230
444 Ga0307513_10578994 3300031456 Bacteria 833
445 Ga0307509_10016687 3300031507 Bacteria 8484
446 Ga0307509_10158415 3300031507 Bacteria 2166
447 Ga0307509_10189301 3300031507 Bacteria 1911
448 Ga0307509_10495919 3300031507 Bacteria 906
449 Ga0307408_100231779 3300031548 Bacteria 1513
450 Ga0307508_10034804 3300031616 Bacteria 4539
451 Ga0307508_10070393 3300031616 Bacteria 3071
452 Ga0307508_10080568 3300031616 Bacteria 2837
453 Ga0307508_10100032 3300031616 Bacteria 2494
454 Ga0307508_10141164 3300031616 Bacteria 2013
455 Ga0307508_10289963 3300031616 Bacteria 1230
456 Ga0307508_10326273 3300031616 Bacteria 1127
457 Ga0307514_10522377 3300031649 Bacteria 557
458 Ga0265314_10014954 3300031711 Bacteria 6181
459 Ga0307516_10032517 3300031730 Bacteria 5253
460 Ga0307516_10124558 3300031730 Bacteria 2363
461 Ga0307516_10805698 3300031730 Bacteria 601
462 Ga0307516_10875890 3300031730 Bacteria 563
463 Ga0307516_10954975 3300031730 Bacteria 527
464 Ga0307405_10321378 3300031731 Bacteria 1182
465 Ga0307405_11557664 3300031731 Bacteria 582
466 Ga0307413_10408195 3300031824 Bacteria 1066
467 Ga0307413_10518919 3300031824 Bacteria 960
468 Ga0307413_11216865 3300031824 Bacteria 656
469 Ga0307410_11944505 3300031852 Bacteria 524
470 Ga0307406_10258310 3300031901 Bacteria 1316
471 Ga0307406_10820587 3300031901 Bacteria 786
472 Ga0307407_10247203 3300031903 Bacteria 1220
473 Ga0307407_11245650 3300031903 Bacteria 582
474 Ga0307409_100435513 3300031995 Bacteria 1261
475 Ga0307409_101417596 3300031995 Bacteria 721
476 Ga0307416_100403543 3300032002 Bacteria 1405
477 Ga0307416_101537430 3300032002 Bacteria 771
478 Ga0307416_101823912 3300032002 Bacteria 712
479 Ga0307414_10165321 3300032004 Bacteria 1763
480 Ga0307414_10959116 3300032004 Bacteria 786
481 Ga0307411_10095499 3300032005 Bacteria 2087
482 Ga0307411_10183139 3300032005 Bacteria 1592
483 Ga0307411_12137555 3300032005 Bacteria 524
484 Ga0307415_100046068 3300032126 Bacteria 2928
485 Ga0307415_100047271 3300032126 Bacteria 2896
486 Ga0307415_101587400 3300032126 Bacteria 628
487 Ga0307415_102559646 3300032126 Bacteria 503
488 Ga0307507_10035305 3300033179 Bacteria 5139
489 Ga0307510_10035347 3300033180 Bacteria 5582
490 Ga0307510_10145193 3300033180 Bacteria 2007
491 Ga0307510_10255190 3300033180 Bacteria 1238
492 Ga0315911_1000030 3300033442 Bacteria 76458
493 Ga0373930_0058857 3300034816 Bacteria 854
494 Ga0373958_0060277 3300034819 Bacteria 821
495 Ga0373938_0168976 3300034957 Bacteria 591
496 Ga0373934_0002271 3300035086 Bacteria 7070
497 Ga0373934_0078745 3300035086 Bacteria 1323
498 Ga0373940_0346344 3300035088 Bacteria 521
499 Ga0373952_0135067 3300035092 Bacteria 681
500 Ga0373923_0041804 3300035111 Bacteria 1891
501 Ga0373923_0362064 3300035111 Bacteria 694
502 Ga0373936_0611738 3300035113 Bacteria 512
503 Ga0373941_0457410 3300035115 Bacteria 537
504 Ga0373953_0054973 3300035117 Bacteria 1615
505 Ga0373954_0000600 3300035118 Bacteria 13674
506 Ga0373956_0158992 3300035119 Bacteria 1064
507 Ga0373957_0024711 3300035120 Bacteria 2159
508 Ga0373960_0105458 3300035121 Bacteria 919
509 Ga0373955_0003136 3300035172 Bacteria 7232
510 Ga0373942_0377092 3300035207 Bacteria 506
511 Ga0373961_0113888 3300035241 Bacteria 889
512 Ga0373924_0027017 3300035410 Bacteria 2280
513 Ga0373931_0089399 3300035691 Bacteria 1713
514 Ga0373931_0423338 3300035691 Bacteria 847
515 Ga0373931_0437791 3300035691 Bacteria 834
516 Ga0373935_0014909 3300035692 Bacteria 4694
517 Ga0373935_0141978 3300035692 Bacteria 1623
518 Ga0373935_0833454 3300035692 Bacteria 682
519 Ga0373927_0006383 3300035695 Bacteria 8032
520 Ga0373927_0046209 3300035695 Bacteria 2818
521 Ga0373927_0321887 3300035695 Bacteria 1018
522 Ga0373927_0707548 3300035695 Bacteria 665
523 Ga0373933_0002820 3300035724 Bacteria 9707
524 Ga0373933_0232392 3300035724 Bacteria 1185
525 Ga0373933_0310686 3300035724 Bacteria 1021
526 Ga0373947_0065177 3300035725 Bacteria 2222
527 Ga0373947_0226055 3300035725 Bacteria 1231
528 Ga0373937_0913444 3300036401 Bacteria 827
529 Ga0373925_0061460 3300037068 Bacteria 2822
530 Ga0373925_0076870 3300037068 Bacteria 2533
531 Ga0373925_0328833 3300037068 Bacteria 1238
532 Ga0395900_0547359 3300037418 Bacteria 1102
533 Ga0395905_0343872 3300037471 Bacteria 1383
534 Ga0395901_0185952 3300038443 Bacteria 2179
535 Ga0436365_1626523 3300039437 Bacteria 6727
536 Ga0436360_0231544 3300039438 Bacteria 1966
537 Ga0436360_0681330 3300039438 Bacteria 635
538 Ga0436360_0700541 3300039438 Bacteria 1170
539 Ga0436360_1172970 3300039438 Bacteria 1776
540 Ga0436361_0613153 3300039447 Bacteria 1654
541 Ga0436361_0844056 3300039447 Bacteria 2307
542 Ga0436363_0166821 3300039450 Bacteria 541
543 Ga0436363_1719074 3300039450 Bacteria 1328
544 Ga0436362_0461135 3300039453 Bacteria 2062
545 Ga0436362_1096408 3300039453 Bacteria 823
546 Ga0451791_0909212 3300041451 Bacteria 1180
547 Ga0451793_0449397 3300041452 Bacteria 707
548 Ga0451797_0563377 3300041453 Bacteria 788
549 Ga0451797_1244989 3300041453 Bacteria 588
550 Ga0451795_0254481 3300041456 Bacteria 511
551 Ga0451795_1141107 3300041456 Bacteria 600
552 Ga0451800_0756944 3300041459 Bacteria 578
553 Ga0451800_1152186 3300041459 Bacteria 581
554 Ga0451802_0487379 3300041460 Bacteria 1179
555 Ga0451805_096700 3300041461 Bacteria 577
556 Ga0451804_0165328 3300041463 Bacteria 520
557 Ga0451804_0369479 3300041463 Bacteria 909
558 Ga0451807_2731352 3300041486 Bacteria 1042
559 Ga0451833_0837549 3300041491 Bacteria 504
560 Ga0451841_0708513 3300041498 Bacteria 635
561 Ga0451841_1307024 3300041498 Bacteria 532
562 Ga0451843_1372376 3300041509 Bacteria 751
563 Ga0451853_0168564 3300041512 Bacteria 690
564 Ga0439432_144022 3300042006 Bacteria 700
565 Ga0439459_0196647 3300042438 Bacteria 549
566 Ga0466969_0563085 3300044656 Bacteria 522
567 Ga0466966_0175158 3300044684 Bacteria 1303
568 Ga0466970_0037685 3300044765 Bacteria 2564
569 Ga0495592_0017775 3300046454 Bacteria 5405
570 Ga0495592_0691603 3300046454 Bacteria 614
571 Ga0495603_0016916 3300046455 Bacteria 4413
572 Ga0495590_0165871 3300046457 Bacteria 804
573 Ga0495591_066660 3300046458 Bacteria 944
574 Ga0495629_0006344 3300046459 Bacteria 8773
575 Ga0495629_0108779 3300046459 Bacteria 1933
576 Ga0495629_0387206 3300046459 Bacteria 951
577 Ga0495629_0717926 3300046459 Bacteria 663
578 Ga0495629_0719503 3300046459 Bacteria 662
579 Ga0495638_0163651 3300046460 Bacteria 1281
580 Ga0495638_0376596 3300046460 Bacteria 742
581 Ga0495638_0649962 3300046460 Bacteria 513
582 Ga0495641_0139802 3300046461 Bacteria 1081
583 Ga0495651_0353036 3300046462 Bacteria 971
584 Ga0495651_0859680 3300046462 Bacteria 557
585 Ga0495653_0000404 3300046463 Bacteria 34649
586 Ga0495580_0072888 3300046472 Bacteria 2398
587 Ga0495582_0601077 3300046473 Bacteria 636
588 Ga0495605_0072848 3300046474 Bacteria 1619
589 Ga0495605_0132778 3300046474 Bacteria 1122
590 Ga0495605_0401636 3300046474 Bacteria 570
591 Ga0495639_0128744 3300046475 Bacteria 1211
592 Ga0495639_0210770 3300046475 Bacteria 953
593 Ga0495639_0233208 3300046475 Bacteria 907
594 Ga0495662_0143711 3300046476 Bacteria 1175
595 Ga0495664_0211064 3300046477 Bacteria 1176
596 Ga0495664_0312431 3300046477 Bacteria 948
597 Ga0495664_0371389 3300046477 Bacteria 860
598 Ga0495584_0130393 3300046491 Bacteria 1275
599 Ga0495584_0191524 3300046491 Bacteria 1039
600 Ga0495584_0396821 3300046491 Bacteria 701
601 Ga0495585_0060809 3300046492 Bacteria 2078
602 Ga0495585_0085252 3300046492 Bacteria 1707
603 Ga0495607_0163277 3300046501 Bacteria 1130
604 Ga0495583_0198264 3300046506 Bacteria 816
605 Ga0495606_0151236 3300046507 Bacteria 1362
606 Ga0495606_0206574 3300046507 Bacteria 1116
607 Ga0495606_0416121 3300046507 Bacteria 696
608 Ga0495608_0018177 3300046511 Bacteria 4853
609 Ga0495610_0147095 3300046512 Bacteria 1009
610 Ga0495610_0173764 3300046512 Bacteria 901
611 Ga0495616_0076114 3300046513 Bacteria 1613
612 Ga0495618_0070693 3300046514 Bacteria 2220
613 Ga0495620_0222320 3300046515 Bacteria 722
614 Ga0495628_0047865 3300046516 Bacteria 3390
615 Ga0495631_0074871 3300046518 Bacteria 1461
616 Ga0495631_0094036 3300046518 Bacteria 1290
617 Ga0495632_0131074 3300046519 Bacteria 1166
618 Ga0495637_0059690 3300046520 Bacteria 1569
619 Ga0495643_0140031 3300046522 Bacteria 1207
620 Ga0495643_0506961 3300046522 Bacteria 518
621 Ga0495644_0237513 3300046523 Bacteria 706
622 Ga0495648_0446052 3300046524 Bacteria 567
623 Ga0495663_0307230 3300046525 Bacteria 572
624 Ga0495666_0198830 3300046526 Bacteria 922
625 Ga0495652_0010990 3300046529 Bacteria 8204
626 Ga0495654_0360613 3300046530 Bacteria 583
627 Ga0495665_0379532 3300046531 Bacteria 718
628 Ga0495640_0643140 3300046533 Bacteria 638
629 Ga0495587_0017284 3300046536 Bacteria 4483
630 Ga0495598_0002389 3300046537 Bacteria 3873
631 Ga0495609_0116259 3300046538 Bacteria 1152
632 Ga0495609_0189982 3300046538 Bacteria 862
633 Ga0495609_0406966 3300046538 Bacteria 544
634 Ga0495597_0208683 3300046542 Bacteria 780
635 Ga0495645_0059754 3300046543 Bacteria 2763
636 Ga0495622_0098715 3300046557 Bacteria 1339
637 Ga0495622_0113303 3300046557 Bacteria 1241
638 Ga0495633_0208755 3300046558 Bacteria 895
639 Ga0495667_0045653 3300046559 Bacteria 2899
640 Ga0495656_0002292 3300046615 Bacteria 6320
641 Ga0495668_0113686 3300046616 Bacteria 1480
642 Ga0495668_0153564 3300046616 Bacteria 1261
643 Ga0495668_0440953 3300046616 Bacteria 716
644 Ga0495634_0020752 3300046642 Bacteria 4655
645 Ga0495611_0099045 3300046648 Bacteria 1352
646 Ga0495611_0181831 3300046648 Bacteria 982
647 Ga0495625_0102223 3300046660 Bacteria 1967
648 Ga0495625_0552498 3300046660 Bacteria 697
649 Ga0495635_0005996 3300046663 Bacteria 8479
650 Ga0495635_0400531 3300046663 Bacteria 912
651 Ga0495659_0321886 3300046664 Bacteria 656
652 Ga0495661_0247256 3300046665 Bacteria 912
653 Ga0495588_0144167 3300046674 Bacteria 1258
654 Ga0495657_0332868 3300046675 Bacteria 901
655 Ga0495599_0006842 3300046678 Bacteria 6894
656 Ga0495623_0256635 3300046679 Bacteria 981
657 Ga0495623_0328115 3300046679 Bacteria 838
658 Ga0495623_0570390 3300046679 Bacteria 591
659 Ga0495646_0009855 3300046680 Bacteria 6071
660 Ga0495647_0377397 3300046681 Bacteria 649
661 Ga0495613_0403263 3300046689 Bacteria 932
662 Ga0495613_0728726 3300046689 Bacteria 651
663 Ga0495624_0330722 3300046690 Bacteria 917
664 Ga0495670_0103798 3300046691 Bacteria 1466
665 Ga0495671_0055245 3300046692 Bacteria 1967
666 Ga0495649_0249434 3300046694 Bacteria 912
667 Ga0495589_0128399 3300046794 Bacteria 1218
668 Ga0495589_0158610 3300046794 Bacteria 1078
669 Ga0495600_0005299 3300046809 Bacteria 7768
670 Ga0495660_0344122 3300046810 Bacteria 664
671 Ga0495581_0142985 3300047315 Bacteria 1396
672 Ga0495581_0439801 3300047315 Bacteria 760
673 Ga0495604_0128301 3300047317 Bacteria 1825
674 Ga0495604_0209701 3300047317 Bacteria 1347
675 Ga0495604_0277744 3300047317 Bacteria 1133
676 Ga0495636_0053072 3300047318 Bacteria 1701
677 Ga0495636_0444521 3300047318 Bacteria 622
678 Ga0495674_0066083 3300047319 Bacteria 3139
679 Ga0495674_0099633 3300047319 Bacteria 2474
680 Ga0495674_0851941 3300047319 Bacteria 706
681 Ga0495676_0276028 3300047321 Bacteria 1139
682 Ga0495680_0075801 3300047322 Bacteria 2551
683 Ga0495680_0289549 3300047322 Bacteria 1152
684 Ga0495683_0129357 3300047323 Bacteria 1192
685 Ga0495675_0009161 3300047444 Bacteria 6155
686 Ga0495675_0359688 3300047444 Bacteria 855
687 Ga0495677_0099989 3300047445 Bacteria 1097
688 Ga0495685_040984 3300047447 Bacteria 1583
689 Ga0495673_0028557 3300047469 Bacteria 2641
690 Ga0495684_0000470 3300047471 Bacteria 32869
691 Ga0495593_0036919 3300047673 Bacteria 2646
692 Ga0495593_0699221 3300047673 Bacteria 509
693 Ga0495615_0053023 3300048090 Bacteria 1049
694 Ga0495626_0367917 3300048091 Bacteria 559
695 Ga0495626_0423447 3300048091 Bacteria 513
696 Ga0496100_0041442 3300048903 Bacteria 2935
697 Ga0496100_0755303 3300048903 Bacteria 761
698 Ga0496100_1076994 3300048903 Bacteria 633
699 Ga0496100_1414420 3300048903 Bacteria 549
700 Ga0496101_0000888 3300048904 Bacteria 17608
701 Ga0496101_0148681 3300048904 Bacteria 1790
702 Ga0496101_0348992 3300048904 Bacteria 1163
703 Ga0496102_0011329 3300048905 Bacteria 7685
704 Ga0496102_0019609 3300048905 Bacteria 5957
705 Ga0496102_0773262 3300048905 Bacteria 883
706 Ga0496102_0984976 3300048905 Bacteria 764
707 Ga0496103_0025948 3300048906 Bacteria 3545
708 Ga0496103_0057831 3300048906 Bacteria 2408
709 Ga0496103_0810559 3300048906 Bacteria 590
710 Ga0496104_0111788 3300048907 Bacteria 2619
711 Ga0496104_0115352 3300048907 Bacteria 2577
712 Ga0496105_0048261 3300048908 Bacteria 3514
713 Ga0496105_0124901 3300048908 Bacteria 2121
714 Ga0496105_0687374 3300048908 Bacteria 787
715 Ga0496106_0000823 3300048909 Bacteria 22502
716 Ga0496106_0028016 3300048909 Bacteria 4194
717 Ga0496106_0050949 3300048909 Bacteria 3121
718 Ga0496107_0080566 3300048910 Bacteria 2374
719 Ga0496107_0244829 3300048910 Bacteria 1334
720 Ga0496108_0009465 3300048911 Bacteria 7890
721 Ga0496108_0168359 3300048911 Bacteria 1895
722 Ga0496108_0601214 3300048911 Bacteria 958
723 Ga0496109_0026993 3300048912 Bacteria 5122
724 Ga0496109_0148902 3300048912 Bacteria 2191
725 Ga0496109_0731549 3300048912 Bacteria 927
726 Ga0496109_1052552 3300048912 Bacteria 751
727 Ga0496109_1399546 3300048912 Bacteria 635
728 Ga0496109_1583881 3300048912 Bacteria 589
729 Ga0496110_0100786 3300048913 Bacteria 2588
730 Ga0496110_0357108 3300048913 Bacteria 1331
731 Ga0496110_0678231 3300048913 Bacteria 931
732 Ga0496110_0795438 3300048913 Bacteria 850
733 Ga0496110_1046484 3300048913 Bacteria 724
734 Ga0496110_1500757 3300048913 Bacteria 584
735 Ga0496110_1882938 3300048913 Bacteria 508
736 Ga0496111_0006306 3300048914 Bacteria 7692
737 Ga0496111_0806755 3300048914 Bacteria 679
738 Ga0496111_0841780 3300048914 Bacteria 662
739 Ga0496112_0076154 3300048915 Bacteria 3318
740 Ga0496112_0133178 3300048915 Bacteria 2456
741 Ga0496112_0219063 3300048915 Bacteria 1859
742 Ga0496113_0005645 3300048916 Bacteria 7830
743 Ga0496113_0009716 3300048916 Bacteria 6321
744 Ga0496113_1470139 3300048916 Bacteria 526
745 Ga0496114_0019856 3300048917 Bacteria 5449
746 Ga0496114_0239473 3300048917 Bacteria 1595
747 Ga0496114_0270740 3300048917 Bacteria 1496
748 Ga0496114_0299090 3300048917 Bacteria 1421
749 Ga0496114_0809620 3300048917 Bacteria 816
750 Ga0496115_0012648 3300048918 Bacteria 6360
751 Ga0496115_0012999 3300048918 Bacteria 6282
752 Ga0496115_0032180 3300048918 Bacteria 4137
753 Ga0496115_0346048 3300048918 Bacteria 1213
754 Ga0496115_1089571 3300048918 Bacteria 606
755 Ga0496116_0236311 3300048919 Bacteria 922
756 Ga0496116_0489179 3300048919 Bacteria 515
757 Ga0496116_0500805 3300048919 Bacteria 505
758 Ga0496117_0159091 3300048920 Bacteria 1326
759 Ga0496117_0232469 3300048920 Bacteria 1018
760 Ga0496117_0258542 3300048920 Bacteria 945
761 Ga0496117_0614689 3300048920 Bacteria 506
762 Ga0496118_0003610 3300048921 Bacteria 19225
763 Ga0496118_0198593 3300048921 Bacteria 1191
764 Ga0496118_0256615 3300048921 Bacteria 990
765 Ga0496118_0512785 3300048921 Bacteria 593
766 Ga0496118_0592583 3300048921 Bacteria 532
767 Ga0496119_0064702 3300048922 Bacteria 2170
768 Ga0496119_0082194 3300048922 Bacteria 1853
769 Ga0496119_0108057 3300048922 Bacteria 1550
770 Ga0496120_0286130 3300048923 Bacteria 760
771 Ga0496121_0000041 3300048924 Bacteria 346686
772 Ga0496121_0045050 3300048924 Bacteria 3795
773 Ga0496121_0218228 3300048924 Bacteria 1345
774 Ga0496121_0233216 3300048924 Bacteria 1287
775 Ga0496121_0236352 3300048924 Bacteria 1276
776 Ga0496121_0640649 3300048924 Bacteria 649
777 Ga0496121_0871224 3300048924 Bacteria 521
778 Ga0496124_0011558 3300048927 Bacteria 8810
779 Ga0496124_0106790 3300048927 Bacteria 2260
780 Ga0496124_0442022 3300048927 Bacteria 889
781 Ga0496125_0088160 3300048928 Bacteria 2340
782 Ga0496125_0422830 3300048928 Bacteria 772
783 Ga0496126_0005282 3300048929 Bacteria 14826
784 Ga0496126_0035098 3300048929 Bacteria 4703
785 Ga0496126_0047048 3300048929 Bacteria 3951
786 Ga0496126_0076032 3300048929 Bacteria 2980
787 Ga0496126_0096233 3300048929 Bacteria 2596
788 Ga0496126_0156181 3300048929 Bacteria 1952
789 Ga0496126_0179341 3300048929 Bacteria 1800
790 Ga0496126_0257090 3300048929 Bacteria 1453
791 Ga0496126_0277705 3300048929 Bacteria 1388
792 Ga0496126_0381626 3300048929 Bacteria 1147
793 Ga0496126_1059094 3300048929 Bacteria 605
794 Ga0496126_1200756 3300048929 Bacteria 558
795 Ga0495682_0124821 3300049460 Bacteria 921
796 Ga0501216_080572 3300049660 Bacteria 688
797 nmdc:mga03683_675516_c1 3300050489 Bacteria 510
798 nmdc:mga0yw44_195314_c1 3300050492 Bacteria 1335
799 nmdc:mga0yw44_710633_c1 3300050492 Bacteria 683
800 nmdc:mga0yw44_808490_c1 3300050492 Bacteria 637
801 nmdc:mga0k408_318353_c1 3300050493 Bacteria 928
802 nmdc:mga06z11_416598_c1 3300050494 Bacteria 809
803 nmdc:mga07m45_214196_c1 3300050496 Bacteria 1120
804 nmdc:mga07m45_270275_c1 3300050496 Bacteria 989
805 nmdc:mga07m45_280106_c1 3300050496 Bacteria 970
806 nmdc:mga0sz30_191494_c1 3300050516 Bacteria 908
807 nmdc:mga0sz30_420759_c1 3300050516 Bacteria 599
808 Ga0495601_0019002 3300053077 Bacteria 4187
809 Ga0495601_0056308 3300053077 Bacteria 2490
810 Ga0495612_0285211 3300053078 Bacteria 739
811 Ga0495612_0526032 3300053078 Bacteria 544
812 Ga0500635_0046998 3300053080 Bacteria 1465
813 Ga0500635_0156197 3300053080 Bacteria 873
814 Ga0495655_0022166 3300053083 Bacteria 1448
815 Ga0495595_0039793 3300053084 Bacteria 2146
816 Ga0495619_0002707 3300053085 Bacteria 11586
817 Ga0495619_0218956 3300053085 Bacteria 1319
818 Ga0500643_023567 3300053087 Bacteria 1965
819 Ga0500646_0088378 3300053090 Bacteria 956
820 Ga0500646_0097972 3300053090 Bacteria 917
821 Ga0500647_0199573 3300053091 Bacteria 908
822 Ga0500583_0076852 3300053092 Bacteria 1606
823 Ga0500651_0355709 3300053093 Bacteria 830
824 Ga0500651_0493105 3300053093 Bacteria 676
825 Ga0500566_0064299 3300053094 Bacteria 2071
826 Ga0500566_0085436 3300053094 Bacteria 1750
827 Ga0500566_0312056 3300053094 Bacteria 736
828 Ga0500641_0017363 3300053096 Bacteria 2690
829 Ga0500641_0056093 3300053096 Bacteria 1632
830 Ga0500648_348180 3300053097 Bacteria 607
831 Ga0500650_0194561 3300053098 Bacteria 925
832 Ga0500554_146452 3300053102 Bacteria 798
833 Ga0500555_056421 3300053103 Bacteria 1065
834 Ga0500562_060854 3300053108 Bacteria 1014
835 Ga0500569_173000 3300053109 Bacteria 733
836 Ga0500582_294351 3300053114 Bacteria 505
837 Ga0500592_016338 3300053116 Bacteria 1191
838 Ga0500594_0035920 3300053118 Bacteria 1331
839 Ga0500594_0227910 3300053118 Bacteria 617
840 Ga0500595_000181 3300053119 Bacteria 42687
841 Ga0500595_002904 3300053119 Bacteria 8202
842 Ga0500595_007285 3300053119 Bacteria 4594
843 Ga0500595_014285 3300053119 Bacteria 3018
844 Ga0500607_267271 3300053121 Bacteria 664
845 Ga0500608_218662 3300053122 Bacteria 771
846 Ga0500617_180406 3300053124 Bacteria 799
847 Ga0500642_0509666 3300053130 Bacteria 506
848 Ga0500655_028191 3300053133 Bacteria 1074
849 Ga0500658_0153373 3300053134 Bacteria 1039
850 Ga0500658_0543642 3300053134 Bacteria 523
851 Ga0500559_0044823 3300053136 Bacteria 1935
852 Ga0500559_0162209 3300053136 Bacteria 1050
853 Ga0500561_0215663 3300053137 Bacteria 608
854 Ga0500564_354486 3300053138 Bacteria 545
855 Ga0500568_0071506 3300053139 Bacteria 1328
856 Ga0500573_0096320 3300053140 Bacteria 1667
857 Ga0500573_0248203 3300053140 Bacteria 919
858 Ga0500577_0163306 3300053142 Bacteria 949
859 Ga0500577_0166340 3300053142 Bacteria 941
860 Ga0500589_134548 3300053147 Bacteria 1027
861 Ga0500589_203109 3300053147 Bacteria 759
862 Ga0500590_085299 3300053148 Bacteria 1543
863 Ga0500603_014422 3300053150 Bacteria 1846
864 Ga0500603_021719 3300053150 Bacteria 1581
865 Ga0500603_083980 3300053150 Bacteria 926
866 Ga0500604_0065903 3300053151 Bacteria 1146
867 Ga0500604_0276446 3300053151 Bacteria 582
868 Ga0500616_0345109 3300053153 Bacteria 607
869 Ga0500619_240292 3300053154 Bacteria 599
870 Ga0500622_0198088 3300053156 Bacteria 916
871 Ga0500627_0048284 3300053158 Bacteria 1849
872 Ga0500627_0273633 3300053158 Bacteria 743
873 Ga0500633_0224648 3300053160 Bacteria 701
874 Ga0500634_0149133 3300053161 Bacteria 1096
875 Ga0500638_031409 3300053162 Bacteria 2562
876 Ga0500638_265626 3300053162 Bacteria 682
877 Ga0500638_294969 3300053162 Bacteria 628
878 Ga0500639_109023 3300053163 Bacteria 1350
879 Ga0500636_0151494 3300053177 Bacteria 1273
880 Ga0500636_0167517 3300053177 Bacteria 1191
881 Ga0500636_0273666 3300053177 Bacteria 847
882 Ga0500636_0311049 3300053177 Bacteria 770
883 Ga0500636_0321806 3300053177 Bacteria 751
884 Ga0500636_0432883 3300053177 Bacteria 600
885 Ga0500637_0000116 3300053178 Bacteria 29193
886 Ga0500637_0070744 3300053178 Bacteria 2006
887 Ga0500611_214085 3300053727 Bacteria 549
888 Ga0500657_225738 3300053728 Bacteria 588
889 Ga0500645_017719 3300053730 Bacteria 2229
890 Ga0500601_043631 3300053737 Bacteria 549
891 Ga0500661_004085 3300055283 Bacteria 2728
892 2509152262 2508501128 Bacteria 8613869
893 2511398115 2511231028 Bacteria 8046582
894 2513659698 2513237096 Bacteria 8722461
895 2513679234 2513237098 Bacteria 9902361
896 2513691572 2513237101 Bacteria 7952346
897 2513695546 2513237101 Bacteria 7952346
898 2513921782 2513237145 Bacteria 8979722
899 2517890782 2517572143 Bacteria 9484767
900 2524463617 2524023210 Bacteria 9029266
901 2528855259 2528768022 Bacteria 10457665
902 2723843941 2721755755 Bacteria 8322773
903 2723845446 2721755755 Bacteria 8322773
904 2793066126 2791355197 Bacteria 8420563
905 2793083366
906 2824707868 2824704595 Bacteria 9667483
907 2824757943 2824753945 Bacteria 9787441
908 2824766522 2824763712 Bacteria 9792355
909 2874612068 2874604998 Bacteria 7834745
910 2876811952 2876808645 Bacteria 8824342
911 2879101915 2879099564 Bacteria 10442239
912 2879107887 2879099564 Bacteria 10442239
913 2879113991 2879110137 Bacteria 8907982
914 2881666992 2881665667 Bacteria 8175609
915 2885389467 2885383462 Bacteria 9473874
916 2885414333 2885409591 Bacteria 9235467
917 2889040229 2889033259 Bacteria 9099371
918 2903774717 2903768456 Bacteria 9749579
919 2904693610 2904690495 Bacteria 9412302
920 2904711780 2904711408 Bacteria 9771557
921 2906642822 2906635258 Bacteria 8601019
922 2908758574 2908756301 Bacteria 8864324
923 2922366288 2922361189 Bacteria 7436256
924 2922375894
925 2922386647 2922386360 Bacteria 7017218
926 2929621218 2929615660 Bacteria 9193770
927 2929625951 2929624759 Bacteria 9339455
928 2932785159 2932784394 Bacteria 9704911
929 2932789332 2932784394 Bacteria 9704911
930 2932801347 2932794094 Bacteria 7915132
931 2932810186 2932809354 Bacteria 9135765
932 2932821759 2932818245 Bacteria 9955613
933 2932828995 2932828146 Bacteria 9745859
934 2933582913 2933577622 Bacteria 9116884
935 2935619585 2935616580 Bacteria 9032984
936 2935638565 2935638405 Bacteria 10015038
937 2935666583 2935665750 Bacteria 9571747
938 2935676372 2935675223 Bacteria 9928132
939 2935691111 2935684952 Bacteria 9590419
940 2935694458 2935694250 Bacteria 9291695
941 2935703571 2935703347 Bacteria 10242284
942 2935718492 2935713505 Bacteria 9608509
943 2935727528 2935722832 Bacteria 9608746
944 2935736231 2935732158 Bacteria 9706831
945 2935745611 2935741537 Bacteria 9707219
946 2935755992 2935750917 Bacteria 9590372
947 2935760746 2935760218 Bacteria 9817913
948 2935801708 2935801545 Bacteria 9301974
949 2935814876 2935810662 Bacteria 9401221
950 2935828059 2935827899 Bacteria 10038562
951 2935842265 2935837841 Bacteria 9454360
952 2935858099 2935855204 Bacteria 9035059
953 2935868004 2935864058 Bacteria 9784707
954 2935873973 2935873716 Bacteria 9632195
955 2935965204 2935959822 Bacteria 7869783
956 2935993103 2935992306 Bacteria 9802711
957 2936003015 2936002035 Bacteria 9362176
958 2936040481 2936037263 Bacteria 9446081
959 2940562033 2940556831 Bacteria 9590747
960 2941542313 2941538514 Bacteria 9402094
961 2941546540 2941538514 Bacteria 9402094
962 8006968065 8006964411 Bacteria 8966052
963 8006992249 8006984368 Bacteria 9651211
964 8006999359 8006994254 Bacteria 8309700
965 8016520466 8016511872 Bacteria 9921665
966 8017065109 8017057580 Bacteria 10023680
967 8019584497 8019576017 Bacteria 10049540
968 8019592269 8019586578 Bacteria 10212056
969 8019599019 8019597564 Bacteria 10041141
970 8019609355 8019608314 Bacteria 10042931
971 8055744920 8055742211 Bacteria 9226248
972 8056680018 8056673599 Bacteria 7871253
973 8056687711 8056681323 Bacteria 8472857
974 8056689471 8056681323 Bacteria 8472857
975 JGI25404J52841_10003524
976 JGI25160J50197_1007453
977 JGI25404J52841_10033508
978 Ga0065165_1024361
979 Ga0065704_10057105
980 Ga0065712_10444555
981 Ga0065715_10304552
982 Ga0065707_10032968
983 Ga0070658_10236767
984 Ga0070658_11330970
985 Ga0070676_10333695
986 Ga0070683_100073356
987 Ga0070683_100328126
988 Ga0070683_101370712
989 Ga0070690_100141016
990 Ga0070670_100096384
991 Ga0070677_10384459
992 Ga0068869_100172722
993 Ga0068869_100800581
994 Ga0068869_101325413
995 Ga0070666_10300185
996 Ga0070680_100018368
997 Ga0070680_101010223
998 Ga0070682_100138468
999 Ga0070682_101008799
1000 Ga0068868_100007407
1001 Ga0068868_100010220
1002 Ga0068868_100614185
1003 Ga0068868_102146475
1004 Ga0070660_100302428
1005 Ga0070660_100912824
1006 Ga0070689_100936494
1007 Ga0070689_101070768
1008 Ga0070691_10647691
1009 Ga0070687_100946727
1010 Ga0070661_100258418
1011 Ga0070661_100553511
1012 Ga0070661_101081372
1013 Ga0070692_11111041
1014 Ga0070668_100673479
1015 Ga0070668_101522236
1016 Ga0070668_102166761
1017 Ga0070669_100716666
1018 Ga0070669_101419301
1019 Ga0070675_101046957
1020 Ga0070671_100550642
1021 Ga0070671_101584836
1022 Ga0070671_101850273
1023 Ga0070674_100102072
1024 Ga0070674_100851818
1025 Ga0070673_101558819
1026 Ga0070688_100368730
1027 Ga0070688_101624028
1028 Ga0070667_100195827
1029 Ga0070667_101313979
1030 Ga0070703_10528903
1031 Ga0070709_10611730
1032 Ga0070714_100402021
1033 Ga0070713_100313537
1034 Ga0070701_10478226
1035 Ga0070711_100118939
1036 Ga0070711_101858853
1037 Ga0070700_101950220
1038 Ga0070694_100605673
1039 Ga0070708_100302596
1040 Ga0070708_100847246
1041 Ga0070663_100162060
1042 Ga0070663_100279995
1043 Ga0070663_100582452
1044 Ga0070678_100084545
1045 Ga0070678_100385961
1046 Ga0070678_100978995
1047 Ga0070678_101446096
1048 Ga0070662_101799466
1049 Ga0070681_10086734
1050 Ga0070681_10856013
1051 Ga0068867_100385722
1052 Ga0068867_100418933
1053 Ga0068867_100733429
1054 Ga0068867_102040007
1055 Ga0070706_100742131
1056 Ga0070698_100111170
1057 Ga0070698_100486283
1058 Ga0070698_100756713
1059 Ga0070699_101059871
1060 Ga0070699_101086932
1061 Ga0070679_100014484
1062 Ga0070684_100495844
1063 Ga0070697_100105006
1064 Ga0068853_100849027
1065 Ga0068853_101162873
1066 Ga0070672_100534370
1067 Ga0070686_101016674
1068 Ga0070695_100218226
1069 Ga0070693_100068382
1070 Ga0070693_101208791
1071 Ga0070665_100020627
1072 Ga0070665_100078578
1073 Ga0070665_100111139
1074 Ga0070665_100113175
1075 Ga0070665_100805315
1076 Ga0070665_101086692
1077 Ga0070665_101119582
1078 Ga0070665_102182876
1079 Ga0070704_101283491
1080 Ga0068855_100536123
1081 Ga0070664_100130878
1082 Ga0070664_100185710
1083 Ga0070664_100706493
1084 Ga0068854_100418865
1085 Ga0068854_101485886
1086 Ga0068856_100854458
1087 Ga0070702_101162903
1088 Ga0068852_101917389
1089 Ga0068852_102628556
1090 Ga0068859_100044971
1091 Ga0068859_100566907
1092 Ga0068859_100708118
1093 Ga0068859_102866521
1094 Ga0068864_102481515
1095 Ga0068866_10118105
1096 Ga0068861_100545785
1097 Ga0068861_101380508
1098 Ga0068861_101410493
1099 Ga0068861_101698612
1100 Ga0068851_10274594
1101 Ga0068851_10501925
1102 Ga0068870_10897422
1103 Ga0068863_100124361
1104 Ga0068863_100335866
1105 Ga0068863_101084744
1106 Ga0068863_101695447
1107 Ga0068858_100102383
1108 Ga0068858_100264482
1109 Ga0068858_101011591
1110 Ga0068858_101095963
1111 Ga0068858_101216605
1112 Ga0068860_100000360
1113 Ga0068860_100126218
1114 Ga0068860_100533311
1115 Ga0068860_101317927
1116 Ga0068860_101463597
1117 Ga0068862_100634994
1118 Ga0068862_100664259
1119 Ga0068862_101041839
1120 Ga0068862_101565684
1121 Ga0068862_101668974
1122 Ga0081455_10161627
1123 Ga0081455_10311305
1124 Ga0081540_1000585
1125 Ga0081540_1002910
1126 Ga0081540_1027714
1127 Ga0081540_1049081
1128 Ga0081540_1049472
1129 Ga0081540_1063531
1130 Ga0081540_1325469
1131 Ga0070717_10030457
1132 Ga0070717_10400438
1133 Ga0070717_11058751
1134 Ga0070717_11385441
1135 Ga0075365_10043420
1136 Ga0075365_10233887
1137 Ga0075365_10268430
1138 Ga0075363_101040387
1139 Ga0075432_10312120
1140 Ga0070715_10160329
1141 Ga0070715_11042241
1142 Ga0075362_10414399
1143 Ga0075362_10621095
1144 Ga0075367_10710194
1145 Ga0075367_11127710
1146 Ga0075369_10221625
1147 Ga0075369_10377582
1148 Ga0075369_10377592
1149 Ga0075366_10293849
1150 Ga0075366_10682722
1151 Ga0075366_10981610
1152 Ga0075366_10987357
1153 Ga0097621_100102239
1154 Ga0097621_100179278
1155 Ga0097621_100717274
1156 Ga0097621_100896854
1157 Ga0097621_101356463
1158 Ga0075370_10389725
1159 Ga0075370_10773923
1160 Ga0068871_100216828
1161 Ga0068871_100315109
1162 Ga0068871_100593490
1163 Ga0068871_100711691
1164 Ga0068871_100907893
1165 Ga0068871_102382741
1166 Ga0068865_100118278
1167 Ga0068865_100376706
1168 Ga0068865_101940994
1169 Ga0097620_100044970
1170 Ga0097620_100566871
1171 Ga0097620_100708098
1172 Ga0097620_102866526
1173 Ga0105244_10112006
1174 Ga0105250_10148397
1175 Ga0105240_10284876
1176 Ga0105240_10439665
1177 Ga0105240_11527212
1178 Ga0105240_12177172
1179 Ga0105240_12308697
1180 Ga0105240_12496186
1181 Ga0105245_10176206
1182 Ga0105245_11608907
1183 Ga0105245_11838642
1184 Ga0105247_10049672
1185 Ga0105247_10137036
1186 Ga0105247_10219177
1187 Ga0105247_10478548
1188 Ga0105247_10624068
1189 Ga0105243_11624757
1190 Ga0105243_11822357
1191 Ga0105243_11880176
1192 Ga0105241_10332843
1193 Ga0105241_10795456
1194 Ga0105241_10798334
1195 Ga0105241_12374861
1196 Ga0105242_10262355
1197 Ga0105242_11353239
1198 Ga0105248_10054220
1199 Ga0105248_10585099
1200 Ga0105248_11609338
1201 Ga0105248_11946294
1202 Ga0105237_10006317
1203 Ga0105237_10183044
1204 Ga0105237_12182870
1205 Ga0105238_10133557
1206 Ga0105238_10148326
1207 Ga0105238_10494007
1208 Ga0105238_10619196
1209 Ga0105238_10816981
1210 Ga0105238_11069847
1211 Ga0105238_12967259
1212 Ga0105249_10706020
1213 Ga0105249_10861139
1214 Ga0105249_10878279
1215 Ga0105239_10071117
1216 Ga0105239_10175903
1217 Ga0105239_10336907
1218 Ga0105239_10740243
1219 Ga0105239_11363497
1220 Ga0105239_12632064
1221 Ga0105239_13558582
1222 Ga0105246_10106574
1223 Ga0105246_10443107
1224 Ga0105246_10458449
1225 Ga0105246_10736872
1226 Ga0105246_11630940
1227 Ga0157319_1024370
1228 Ga0157370_10203594
1229 Ga0157370_11449576
1230 Ga0157369_10288898
1231 Ga0157374_10020966
1232 Ga0157374_11514209
1233 Ga0157374_11844726
1234 Ga0157374_12633826
1235 Ga0157378_10791581
1236 Ga0157378_10798106
1237 Ga0157378_10879330
1238 Ga0157378_10921624
1239 Ga0157378_11166942
1240 Ga0157378_12800334
1241 Ga0163162_10165796
1242 Ga0163162_10270304
1243 Ga0163162_11918916
1244 Ga0157372_12375167
1245 Ga0157375_10008608
1246 Ga0157375_11133342
1247 Ga0157375_11435120
1248 Ga0157375_12529985
1249 Ga0157375_12630447
1250 Ga0163163_10629727
1251 Ga0163163_11897498
1252 Ga0163163_12118355
1253 Ga0163163_12226601
1254 Ga0163163_12873636
1255 Ga0157380_11259209
1256 Ga0157380_11324390
1257 Ga0157377_10155272
1258 Ga0157377_10395133
1259 Ga0157379_10179398
1260 Ga0157379_10731315
1261 Ga0157379_10806591
1262 Ga0157379_10931954
1263 Ga0157379_12045653
1264 Ga0157376_10003124
1265 Ga0157376_11457887
1266 Ga0157376_11722269
1267 Ga0182007_10351307
1268 Ga0163161_10903547
1269 Ga0213872_10181325
1270 Ga0213874_10314804
1271 Ga0213876_10000677
1272 Ga0213871_10092699
1273 Ga0209677_121472
1274 Ga0209233_1004122
1275 Ga0209758_1004187
1276 Ga0209758_1054319
1277 Ga0207697_10156079
1278 Ga0207697_10239635
1279 Ga0207697_10379777
1280 Ga0207656_10229753
1281 Ga0207696_1107183
1282 Ga0207642_10172453
1283 Ga0207642_10519137
1284 Ga0207710_10042863
1285 Ga0207710_10157676
1286 Ga0207710_10274242
1287 Ga0207688_10057535
1288 Ga0207688_10073295
1289 Ga0207680_10314877
1290 Ga0207647_10305125
1291 Ga0207647_10373282
1292 Ga0207685_10306879
1293 Ga0207645_10166445
1294 Ga0207645_10723460
1295 Ga0207705_10211380
1296 Ga0207705_10350619
1297 Ga0207684_10162463
1298 Ga0207684_10381807
1299 Ga0207684_10866987
1300 Ga0207654_10386351
1301 Ga0207654_10770437
1302 Ga0207654_11354714
1303 Ga0207707_10234158
1304 Ga0207707_10714162
1305 Ga0207695_10075203
1306 Ga0207695_10247662
1307 Ga0207671_10007602
1308 Ga0207671_10211671
1309 Ga0207671_10277682
1310 Ga0207671_10936176
1311 Ga0207671_11205702
1312 Ga0207663_10091180
1313 Ga0207663_10842886
1314 Ga0207660_10717239
1315 Ga0207662_10318838
1316 Ga0207657_10742500
1317 Ga0207649_10211284
1318 Ga0207649_10436599
1319 Ga0207652_10021522
1320 Ga0207694_10203457
1321 Ga0207694_10313919
1322 Ga0207650_10251662
1323 Ga0207659_10159647
1324 Ga0207659_11095883
1325 Ga0207687_10033315
1326 Ga0207664_10179497
1327 Ga0207644_10343568
1328 Ga0207644_10479962
1329 Ga0207644_10696064
1330 Ga0207644_11671161
1331 Ga0207644_11848626
1332 Ga0207706_10402543
1333 Ga0207686_10114939
1334 Ga0207686_10721939
1335 Ga0207670_10247007
1336 Ga0207669_10360837
1337 Ga0207704_10117482
1338 Ga0207704_10237030
1339 Ga0207704_11473644
1340 Ga0207704_11739716
1341 Ga0207691_10141692
1342 Ga0207691_10262737
1343 Ga0207711_10301302
1344 Ga0207711_10578762
1345 Ga0207711_10696421
1346 Ga0207689_10471142
1347 Ga0207689_10749733
1348 Ga0207661_10247297
1349 Ga0207679_10446407
1350 Ga0207679_10676703
1351 Ga0207679_10800293
1352 Ga0207667_10199083
1353 Ga0207651_11322584
1354 Ga0207712_10112764
1355 Ga0207668_10467464
1356 Ga0207640_10385573
1357 Ga0207658_10145680
1358 Ga0207658_10234241
1359 Ga0207677_10228859
1360 Ga0207677_10286151
1361 Ga0207677_11771724
1362 Ga0207703_10260422
1363 Ga0207703_10387091
1364 Ga0207703_10841586
1365 Ga0207703_11761505
1366 Ga0207639_10324294
1367 Ga0207639_10462653
1368 Ga0207639_10590244
1369 Ga0207639_10603828
1370 Ga0207678_10040637
1371 Ga0207678_10272055
1372 Ga0207678_10318063
1373 Ga0207678_10489223
1374 Ga0207678_10958843
1375 Ga0207641_10113724
1376 Ga0207641_12097424
1377 Ga0207641_12223141
1378 Ga0207641_12628686
1379 Ga0207648_10400700
1380 Ga0207648_10577393
1381 Ga0207648_10767777
1382 Ga0207676_10498432
1383 Ga0207676_11805424
1384 Ga0207674_10645936
1385 Ga0207675_102131600
1386 Ga0207683_10026290
1387 Ga0207683_10543705
1388 Ga0207683_11379199
1389 Ga0207683_11939960
1390 Ga0207698_10424106
1391 Ga0209389_1000097
1392 Ga0209589_1000132
1393 Ga0209489_100368
1394 Ga0268266_10030100
1395 Ga0268266_10056051
1396 Ga0268266_10062317
1397 Ga0268266_10191723
1398 Ga0268266_10616507
1399 Ga0268266_10687273
1400 Ga0268266_12120028
1401 Ga0268265_10291746
1402 Ga0268265_11098215
1403 Ga0268265_11183325
1404 Ga0268265_11956699
1405 Ga0268264_10000030
1406 Ga0268264_10303728
1407 Ga0268264_11063990
1408 Ga0307517_10345751
1409 Ga0307515_10845737
1410 Ga0307511_10095745
1411 Ga0307511_10096779
1412 Ga0307511_10154879
1413 Ga0307512_10339012
1414 Ga0265332_10056338
1415 Ga0265331_10383756
1416 Ga0265316_10327353
1417 Ga0307513_10055674
1418 Ga0307513_10578994
1419 Ga0307509_10016687
1420 Ga0307509_10158415
1421 Ga0307509_10189301
1422 Ga0307509_10495919
1423 Ga0307408_100231779
1424 Ga0307508_10034804
1425 Ga0307508_10070393
1426 Ga0307508_10080568
1427 Ga0307508_10100032
1428 Ga0307508_10141164
1429 Ga0307508_10289963
1430 Ga0307508_10326273
1431 Ga0307514_10522377
1432 Ga0265314_10014954
1433 Ga0307516_10032517
1434 Ga0307516_10124558
1435 Ga0307516_10805698
1436 Ga0307516_10875890
1437 Ga0307516_10954975
1438 Ga0307405_10321378
1439 Ga0307405_11557664
1440 Ga0307413_10408195
1441 Ga0307413_10518919
1442 Ga0307413_11216865
1443 Ga0307410_11944505
1444 Ga0307406_10258310
1445 Ga0307406_10820587
1446 Ga0307407_10247203
1447 Ga0307407_11245650
1448 Ga0307409_100435513
1449 Ga0307409_101417596
1450 Ga0307416_100403543
1451 Ga0307416_101537430
1452 Ga0307416_101823912
1453 Ga0307414_10165321
1454 Ga0307414_10959116
1455 Ga0307411_10095499
1456 Ga0307411_10183139
1457 Ga0307411_12137555
1458 Ga0307415_100046068
1459 Ga0307415_100047271
1460 Ga0307415_101587400
1461 Ga0307415_102559646
1462 Ga0307507_10035305
1463 Ga0307510_10035347
1464 Ga0307510_10145193
1465 Ga0307510_10255190
1466 Ga0315911_1000030
1467 Ga0373930_0058857
1468 Ga0373958_0060277
1469 Ga0373938_0168976
1470 Ga0373934_0002271
1471 Ga0373934_0078745
1472 Ga0373940_0346344
1473 Ga0373952_0135067
1474 Ga0373923_0041804
1475 Ga0373923_0362064
1476 Ga0373936_0611738
1477 Ga0373941_0457410
1478 Ga0373953_0054973
1479 Ga0373954_0000600
1480 Ga0373956_0158992
1481 Ga0373957_0024711
1482 Ga0373960_0105458
1483 Ga0373955_0003136
1484 Ga0373942_0377092
1485 Ga0373961_0113888
1486 Ga0373924_0027017
1487 Ga0373931_0089399
1488 Ga0373931_0423338
1489 Ga0373931_0437791
1490 Ga0373935_0014909
1491 Ga0373935_0141978
1492 Ga0373935_0833454
1493 Ga0373927_0006383
1494 Ga0373927_0046209
1495 Ga0373927_0321887
1496 Ga0373927_0707548
1497 Ga0373933_0002820
1498 Ga0373933_0232392
1499 Ga0373933_0310686
1500 Ga0373947_0065177
1501 Ga0373947_0226055
1502 Ga0373937_0913444
1503 Ga0373925_0061460
1504 Ga0373925_0076870
1505 Ga0373925_0328833
1506 Ga0395900_0547359
1507 Ga0395905_0343872
1508 Ga0395901_0185952
1509 Ga0436365_1626523
1510 Ga0436360_0231544
1511 Ga0436360_0681330
1512 Ga0436360_0700541
1513 Ga0436360_1172970
1514 Ga0436361_0613153
1515 Ga0436361_0844056
1516 Ga0436363_0166821
1517 Ga0436363_1719074
1518 Ga0436362_0461135
1519 Ga0436362_1096408
1520 Ga0451791_0909212
1521 Ga0451793_0449397
1522 Ga0451797_0563377
1523 Ga0451797_1244989
1524 Ga0451795_0254481
1525 Ga0451795_1141107
1526 Ga0451800_0756944
1527 Ga0451800_1152186
1528 Ga0451802_0487379
1529 Ga0451805_096700
1530 Ga0451804_0165328
1531 Ga0451804_0369479
1532 Ga0451807_2731352
1533 Ga0451833_0837549
1534 Ga0451841_0708513
1535 Ga0451841_1307024
1536 Ga0451843_1372376
1537 Ga0451853_0168564
1538 Ga0439432_144022
1539 Ga0439459_0196647
1540 Ga0466969_0563085
1541 Ga0466966_0175158
1542 Ga0466970_0037685
1543 Ga0495592_0017775
1544 Ga0495592_0691603
1545 Ga0495603_0016916
1546 Ga0495590_0165871
1547 Ga0495591_066660
1548 Ga0495629_0006344
1549 Ga0495629_0108779
1550 Ga0495629_0387206
1551 Ga0495629_0717926
1552 Ga0495629_0719503
1553 Ga0495638_0163651
1554 Ga0495638_0376596
1555 Ga0495638_0649962
1556 Ga0495641_0139802
1557 Ga0495651_0353036
1558 Ga0495651_0859680
1559 Ga0495653_0000404
1560 Ga0495580_0072888
1561 Ga0495582_0601077
1562 Ga0495605_0072848
1563 Ga0495605_0132778
1564 Ga0495605_0401636
1565 Ga0495639_0128744
1566 Ga0495639_0210770
1567 Ga0495639_0233208
1568 Ga0495662_0143711
1569 Ga0495664_0211064
1570 Ga0495664_0312431
1571 Ga0495664_0371389
1572 Ga0495584_0130393
1573 Ga0495584_0191524
1574 Ga0495584_0396821
1575 Ga0495585_0060809
1576 Ga0495585_0085252
1577 Ga0495607_0163277
1578 Ga0495583_0198264
1579 Ga0495606_0151236
1580 Ga0495606_0206574
1581 Ga0495606_0416121
1582 Ga0495608_0018177
1583 Ga0495610_0147095
1584 Ga0495610_0173764
1585 Ga0495616_0076114
1586 Ga0495618_0070693
1587 Ga0495620_0222320
1588 Ga0495628_0047865
1589 Ga0495631_0074871
1590 Ga0495631_0094036
1591 Ga0495632_0131074
1592 Ga0495637_0059690
1593 Ga0495643_0140031
1594 Ga0495643_0506961
1595 Ga0495644_0237513
1596 Ga0495648_0446052
1597 Ga0495663_0307230
1598 Ga0495666_0198830
1599 Ga0495652_0010990
1600 Ga0495654_0360613
1601 Ga0495665_0379532
1602 Ga0495640_0643140
1603 Ga0495587_0017284
1604 Ga0495598_0002389
1605 Ga0495609_0116259
1606 Ga0495609_0189982
1607 Ga0495609_0406966
1608 Ga0495597_0208683
1609 Ga0495645_0059754
1610 Ga0495622_0098715
1611 Ga0495622_0113303
1612 Ga0495633_0208755
1613 Ga0495667_0045653
1614 Ga0495656_0002292
1615 Ga0495668_0113686
1616 Ga0495668_0153564
1617 Ga0495668_0440953
1618 Ga0495634_0020752
1619 Ga0495611_0099045
1620 Ga0495611_0181831
1621 Ga0495625_0102223
1622 Ga0495625_0552498
1623 Ga0495635_0005996
1624 Ga0495635_0400531
1625 Ga0495659_0321886
1626 Ga0495661_0247256
1627 Ga0495588_0144167
1628 Ga0495657_0332868
1629 Ga0495599_0006842
1630 Ga0495623_0256635
1631 Ga0495623_0328115
1632 Ga0495623_0570390
1633 Ga0495646_0009855
1634 Ga0495647_0377397
1635 Ga0495613_0403263
1636 Ga0495613_0728726
1637 Ga0495624_0330722
1638 Ga0495670_0103798
1639 Ga0495671_0055245
1640 Ga0495649_0249434
1641 Ga0495589_0128399
1642 Ga0495589_0158610
1643 Ga0495600_0005299
1644 Ga0495660_0344122
1645 Ga0495581_0142985
1646 Ga0495581_0439801
1647 Ga0495604_0128301
1648 Ga0495604_0209701
1649 Ga0495604_0277744
1650 Ga0495636_0053072
1651 Ga0495636_0444521
1652 Ga0495674_0066083
1653 Ga0495674_0099633
1654 Ga0495674_0851941
1655 Ga0495676_0276028
1656 Ga0495680_0075801
1657 Ga0495680_0289549
1658 Ga0495683_0129357
1659 Ga0495675_0009161
1660 Ga0495675_0359688
1661 Ga0495677_0099989
1662 Ga0495685_040984
1663 Ga0495673_0028557
1664 Ga0495684_0000470
1665 Ga0495593_0036919
1666 Ga0495593_0699221
1667 Ga0495615_0053023
1668 Ga0495626_0367917
1669 Ga0495626_0423447
1670 Ga0496100_0041442
1671 Ga0496100_0755303
1672 Ga0496100_1076994
1673 Ga0496100_1414420
1674 Ga0496101_0000888
1675 Ga0496101_0148681
1676 Ga0496101_0348992
1677 Ga0496102_0011329
1678 Ga0496102_0019609
1679 Ga0496102_0773262
1680 Ga0496102_0984976
1681 Ga0496103_0025948
1682 Ga0496103_0057831
1683 Ga0496103_0810559
1684 Ga0496104_0111788
1685 Ga0496104_0115352
1686 Ga0496105_0048261
1687 Ga0496105_0124901
1688 Ga0496105_0687374
1689 Ga0496106_0000823
1690 Ga0496106_0028016
1691 Ga0496106_0050949
1692 Ga0496107_0080566
1693 Ga0496107_0244829
1694 Ga0496108_0009465
1695 Ga0496108_0168359
1696 Ga0496108_0601214
1697 Ga0496109_0026993
1698 Ga0496109_0148902
1699 Ga0496109_0731549
1700 Ga0496109_1052552
1701 Ga0496109_1399546
1702 Ga0496109_1583881
1703 Ga0496110_0100786
1704 Ga0496110_0357108
1705 Ga0496110_0678231
1706 Ga0496110_0795438
1707 Ga0496110_1046484
1708 Ga0496110_1500757
1709 Ga0496110_1882938
1710 Ga0496111_0006306
1711 Ga0496111_0806755
1712 Ga0496111_0841780
1713 Ga0496112_0076154
1714 Ga0496112_0133178
1715 Ga0496112_0219063
1716 Ga0496113_0005645
1717 Ga0496113_0009716
1718 Ga0496113_1470139
1719 Ga0496114_0019856
1720 Ga0496114_0239473
1721 Ga0496114_0270740
1722 Ga0496114_0299090
1723 Ga0496114_0809620
1724 Ga0496115_0012648
1725 Ga0496115_0012999
1726 Ga0496115_0032180
1727 Ga0496115_0346048
1728 Ga0496115_1089571
1729 Ga0496116_0236311
1730 Ga0496116_0489179
1731 Ga0496116_0500805
1732 Ga0496117_0159091
1733 Ga0496117_0232469
1734 Ga0496117_0258542
1735 Ga0496117_0614689
1736 Ga0496118_0003610
1737 Ga0496118_0198593
1738 Ga0496118_0256615
1739 Ga0496118_0512785
1740 Ga0496118_0592583
1741 Ga0496119_0064702
1742 Ga0496119_0082194
1743 Ga0496119_0108057
1744 Ga0496120_0286130
1745 Ga0496121_0000041
1746 Ga0496121_0045050
1747 Ga0496121_0218228
1748 Ga0496121_0233216
1749 Ga0496121_0236352
1750 Ga0496121_0640649
1751 Ga0496121_0871224
1752 Ga0496124_0011558
1753 Ga0496124_0106790
1754 Ga0496124_0442022
1755 Ga0496125_0088160
1756 Ga0496125_0422830
1757 Ga0496126_0005282
1758 Ga0496126_0035098
1759 Ga0496126_0047048
1760 Ga0496126_0076032
1761 Ga0496126_0096233
1762 Ga0496126_0156181
1763 Ga0496126_0179341
1764 Ga0496126_0257090
1765 Ga0496126_0277705
1766 Ga0496126_0381626
1767 Ga0496126_1059094
1768 Ga0496126_1200756
1769 Ga0495682_0124821
1770 Ga0501216_080572
1771 nmdc:mga03683_675516_c1
1772 nmdc:mga0yw44_195314_c1
1773 nmdc:mga0yw44_710633_c1
1774 nmdc:mga0yw44_808490_c1
1775 nmdc:mga0k408_318353_c1
1776 nmdc:mga06z11_416598_c1
1777 nmdc:mga07m45_214196_c1
1778 nmdc:mga07m45_270275_c1
1779 nmdc:mga07m45_280106_c1
1780 nmdc:mga0sz30_191494_c1
1781 nmdc:mga0sz30_420759_c1
1782 Ga0495601_0019002
1783 Ga0495601_0056308
1784 Ga0495612_0285211
1785 Ga0495612_0526032
1786 Ga0500635_0046998
1787 Ga0500635_0156197
1788 Ga0495655_0022166
1789 Ga0495595_0039793
1790 Ga0495619_0002707
1791 Ga0495619_0218956
1792 Ga0500643_023567
1793 Ga0500646_0088378
1794 Ga0500646_0097972
1795 Ga0500647_0199573
1796 Ga0500583_0076852
1797 Ga0500651_0355709
1798 Ga0500651_0493105
1799 Ga0500566_0064299
1800 Ga0500566_0085436
1801 Ga0500566_0312056
1802 Ga0500641_0017363
1803 Ga0500641_0056093
1804 Ga0500648_348180
1805 Ga0500650_0194561
1806 Ga0500554_146452
1807 Ga0500555_056421
1808 Ga0500562_060854
1809 Ga0500569_173000
1810 Ga0500582_294351
1811 Ga0500592_016338
1812 Ga0500594_0035920
1813 Ga0500594_0227910
1814 Ga0500595_000181
1815 Ga0500595_002904
1816 Ga0500595_007285
1817 Ga0500595_014285
1818 Ga0500607_267271
1819 Ga0500608_218662
1820 Ga0500617_180406
1821 Ga0500642_0509666
1822 Ga0500655_028191
1823 Ga0500658_0153373
1824 Ga0500658_0543642
1825 Ga0500559_0044823
1826 Ga0500559_0162209
1827 Ga0500561_0215663
1828 Ga0500564_354486
1829 Ga0500568_0071506
1830 Ga0500573_0096320
1831 Ga0500573_0248203
1832 Ga0500577_0163306
1833 Ga0500577_0166340
1834 Ga0500589_134548
1835 Ga0500589_203109
1836 Ga0500590_085299
1837 Ga0500603_014422
1838 Ga0500603_021719
1839 Ga0500603_083980
1840 Ga0500604_0065903
1841 Ga0500604_0276446
1842 Ga0500616_0345109
1843 Ga0500619_240292
1844 Ga0500622_0198088
1845 Ga0500627_0048284
1846 Ga0500627_0273633
1847 Ga0500633_0224648
1848 Ga0500634_0149133
1849 Ga0500638_031409
1850 Ga0500638_265626
1851 Ga0500638_294969
1852 Ga0500639_109023
1853 Ga0500636_0151494
1854 Ga0500636_0167517
1855 Ga0500636_0273666
1856 Ga0500636_0311049
1857 Ga0500636_0321806
1858 Ga0500636_0432883
1859 Ga0500637_0000116
1860 Ga0500637_0070744
1861 Ga0500611_214085
1862 Ga0500657_225738
1863 Ga0500645_017719
1864 Ga0500601_043631
1865 Ga0500661_004085
1866 2509152262
1867 2511398115
1868 2513659698
1869 2513679234
1870 2513691572
1871 2513695546
1872 2513921782
1873 2517890782
1874 2524463617
1875 2528855259
1876 2723843941
1877 2723845446
1878 2793066126
1879 2793083366
1880 2824707868
1881 2824757943
1882 2824766522
1883 2874612068
1884 2876811952
1885 2879101915
1886 2879107887
1887 2879113991
1888 2881666992
1889 2885389467
1890 2885414333
1891 2889040229
1892 2903774717
1893 2904693610
1894 2904711780
1895 2906642822
1896 2908758574
1897 2922366288
1898 2922375894
1899 2922386647
1900 2929621218
1901 2929625951
1902 2932785159
1903 2932789332
1904 2932801347
1905 2932810186
1906 2932821759
1907 2932828995
1908 2933582913
1909 2935619585
1910 2935638565
1911 2935666583
1912 2935676372
1913 2935691111
1914 2935694458
1915 2935703571
1916 2935718492
1917 2935727528
1918 2935736231
1919 2935745611
1920 2935755992
1921 2935760746
1922 2935801708
1923 2935814876
1924 2935828059
1925 2935842265
1926 2935858099
1927 2935868004
1928 2935873973
1929 2935965204
1930 2935993103
1931 2936003015
1932 2936040481
1933 2940562033
1934 2941542313
1935 2941546540
1936 8006968065
1937 8006992249
1938 8006999359
1939 8016520466
1940 8017065109
1941 8019584497
1942 8019592269
1943 8019599019
1944 8019609355
1945 8055744920
1946 8056680018
1947 8056687711
1948 8056689471

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05545

FixQ

Cbb3-type cytochrome oxidase component FixQ

9

54

0.92

Map