F487162

General Info

Members Datasets Scaffolds Average Seq Length
972 346 972 195

Family's Representative Sequence

Representative Sequence 3300046511|Ga0495608_0120798|Ga0495608_0120798_959_1621
Length 220
Sequence MEDRMSTPPDSTPLAASRPDGADAPRAASIERKTGETDVRLSLALDGAGEGARDTGVGFLDHMLDLLARHGKIDLDVAVAGDLQTGAHHTAEDTAIVLGQALDRALGDRRGIHRYGHFVVPMDEARASCAIDISGRPHTVFHADLPSGSTGGFDHELTEEFFRALATAAKLTLHLEVQAGTNAHHMIEAAFKAFARALRQAVAVDPGEKGVPSTKGTLTS

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
117 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
118 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
176 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
177 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
178 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
179 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
180 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
181 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
182 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
183 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
184 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
185 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
186 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
203 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
221 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
222 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
223 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
224 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
225 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
226 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
227 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
228 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
229 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
230 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
231 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
232 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
233 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
234 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
237 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
238 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
239 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
240 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
241 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
242 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
243 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
244 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
245 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
246 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
247 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
248 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
251 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
252 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
253 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
254 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
255 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
256 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
257 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
258 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
259 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
260 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
261 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
262 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
263 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
264 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
265 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
266 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
267 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
268 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
269 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
287 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
288 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
289 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
290 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
291 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
292 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
293 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
294 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
295 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
311 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
312 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
313 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
314 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
315 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
316 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
317 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
318 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
319 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
320 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
321 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
322 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
323 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
324 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
327 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
328 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
329 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
330 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
331 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
332 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
333 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
334 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
335 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
336 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
337 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
338 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
339 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
340 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
341 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
342 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
343 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
345 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
346 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.03
Nodule 0
Rhizoplane 9.88
Rhizosphere 87.04
Stem 0
Stem Tuber 0
Unclassified 2.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1007430 3300000549 Bacteria 1347
2 JGI25406J46586_10037679 3300003203 Unclassified 1740
3 JGI25407J50210_10007614 3300003373 Bacteria 2715
4 JGI25407J50210_10046016 3300003373 Bacteria 1111
5 Ga0070683_100017940 3300005329 Bacteria 6257
6 Ga0070683_100035511 3300005329 Bacteria 4556
7 Ga0070683_100051889 3300005329 Bacteria 3798
8 Ga0070683_100165130 3300005329 Bacteria 2100
9 Ga0070690_100243518 3300005330 Bacteria 1269
10 Ga0070670_100256191 3300005331 Bacteria 1525
11 Ga0070670_101056036 3300005331 Bacteria 740
12 Ga0068869_100019169 3300005334 Bacteria 4670
13 Ga0068869_100186159 3300005334 Bacteria 1630
14 Ga0070666_10549680 3300005335 Bacteria 840
15 Ga0070680_100810565 3300005336 Bacteria 807
16 Ga0070682_100023170 3300005337 Bacteria 3686
17 Ga0070682_100376757 3300005337 Bacteria 1066
18 Ga0070682_100399027 3300005337 Bacteria 1040
19 Ga0068868_100003173 3300005338 Bacteria 11441
20 Ga0068868_100027776 3300005338 Bacteria 4319
21 Ga0068868_100293943 3300005338 Bacteria 1378
22 Ga0068868_100340411 3300005338 Bacteria 1282
23 Ga0068868_100380266 3300005338 Bacteria 1215
24 Ga0068868_100887103 3300005338 Bacteria 810
25 Ga0070660_100003619 3300005339 Bacteria 10672
26 Ga0070660_100046597 3300005339 Bacteria 3323
27 Ga0070660_100068013 3300005339 Bacteria 2776
28 Ga0070660_100561430 3300005339 Bacteria 953
29 Ga0070689_100060626 3300005340 Bacteria 2942
30 Ga0070689_100158234 3300005340 Bacteria 1830
31 Ga0070689_100399760 3300005340 Bacteria 1161
32 Ga0070691_10158276 3300005341 Bacteria 1166
33 Ga0070687_100104910 3300005343 Bacteria 1589
34 Ga0070687_100478350 3300005343 Bacteria 834
35 Ga0070661_100019340 3300005344 Bacteria 4854
36 Ga0070661_100581806 3300005344 Bacteria 903
37 Ga0070692_10017574 3300005345 Bacteria 3423
38 Ga0070692_10090842 3300005345 Bacteria 1660
39 Ga0070692_10134710 3300005345 Bacteria 1392
40 Ga0070668_100042153 3300005347 Bacteria 3498
41 Ga0070668_100470612 3300005347 Bacteria 1084
42 Ga0070669_100020911 3300005353 Bacteria 4675
43 Ga0070669_100359311 3300005353 Bacteria 1184
44 Ga0070669_100385917 3300005353 Bacteria 1143
45 Ga0070675_100001160 3300005354 Bacteria 19040
46 Ga0070675_100413797 3300005354 Bacteria 1205
47 Ga0070671_100235319 3300005355 Bacteria 1554
48 Ga0070671_100488975 3300005355 Bacteria 1058
49 Ga0070674_100031861 3300005356 Bacteria 3498
50 Ga0070674_100481091 3300005356 Bacteria 1030
51 Ga0070674_101162445 3300005356 Bacteria 684
52 Ga0070673_100871895 3300005364 Bacteria 834
53 Ga0070688_100000027 3300005365 Bacteria 67477
54 Ga0070688_100004986 3300005365 Bacteria 6947
55 Ga0070688_100257611 3300005365 Bacteria 1244
56 Ga0070659_100000037 3300005366 Bacteria 113379
57 Ga0070659_100002687 3300005366 Bacteria 12638
58 Ga0070659_100476154 3300005366 Bacteria 1062
59 Ga0070659_100757011 3300005366 Bacteria 843
60 Ga0070667_100042334 3300005367 Bacteria 3822
61 Ga0070667_100811593 3300005367 Bacteria 869
62 Ga0070709_10053487 3300005434 Bacteria 2542
63 Ga0070714_100000860 3300005435 Bacteria 21534
64 Ga0070714_100010038 3300005435 Bacteria 7470
65 Ga0070714_100021490 3300005435 Bacteria 5280
66 Ga0070714_100069618 3300005435 Bacteria 3040
67 Ga0070714_100104971 3300005435 Bacteria 2494
68 Ga0070714_100113289 3300005435 Bacteria 2405
69 Ga0070714_100837573 3300005435 Bacteria 892
70 Ga0070713_100324287 3300005436 Bacteria 1423
71 Ga0070710_10000050 3300005437 Bacteria 56781
72 Ga0070710_10097718 3300005437 Bacteria 1743
73 Ga0070710_10201511 3300005437 Bacteria 1257
74 Ga0070710_10423514 3300005437 Bacteria 897
75 Ga0070701_10192589 3300005438 Bacteria 1200
76 Ga0070711_100001237 3300005439 Bacteria 13806
77 Ga0070711_100289029 3300005439 Bacteria 1300
78 Ga0070705_100005024 3300005440 Bacteria 6435
79 Ga0070705_100950972 3300005440 Bacteria 694
80 Ga0070705_100995940 3300005440 Bacteria 680
81 Ga0070700_100013649 3300005441 Bacteria 4567
82 Ga0070700_100029613 3300005441 Bacteria 3266
83 Ga0070700_100034667 3300005441 Bacteria 3049
84 Ga0070700_100188362 3300005441 Bacteria 1441
85 Ga0070700_100307524 3300005441 Bacteria 1159
86 Ga0070694_100314453 3300005444 Bacteria 1203
87 Ga0070708_100428217 3300005445 Bacteria 1248
88 Ga0070663_100009051 3300005455 Bacteria 6152
89 Ga0070678_100025608 3300005456 Bacteria 3973
90 Ga0070678_100284954 3300005456 Bacteria 1398
91 Ga0070662_100001035 3300005457 Bacteria 16981
92 Ga0070662_100294176 3300005457 Bacteria 1317
93 Ga0070662_100441662 3300005457 Bacteria 1079
94 Ga0070681_10003066 3300005458 Bacteria 15497
95 Ga0070681_10303916 3300005458 Bacteria 1505
96 Ga0070685_10000665 3300005466 Bacteria 18706
97 Ga0070685_10000791 3300005466 Bacteria 17160
98 Ga0070685_10031977 3300005466 Bacteria 2944
99 Ga0070685_10284096 3300005466 Bacteria 1109
100 Ga0070685_10663639 3300005466 Bacteria 757
101 Ga0070698_100623824 3300005471 Bacteria 1019
102 Ga0070679_100035983 3300005530 Bacteria 4913
103 Ga0070679_100043251 3300005530 Bacteria 4487
104 Ga0070679_100070872 3300005530 Bacteria 3476
105 Ga0070679_100151311 3300005530 Bacteria 2297
106 Ga0070679_100436883 3300005530 Bacteria 1254
107 Ga0070684_100035155 3300005535 Bacteria 4288
108 Ga0070684_100035948 3300005535 Bacteria 4242
109 Ga0070684_100106959 3300005535 Bacteria 2505
110 Ga0070684_100216967 3300005535 Bacteria 1745
111 Ga0070697_100407681 3300005536 Bacteria 1180
112 Ga0070697_100509609 3300005536 Bacteria 1053
113 Ga0068853_100390091 3300005539 Bacteria 1302
114 Ga0070686_100224047 3300005544 Bacteria 1360
115 Ga0070686_100229411 3300005544 Bacteria 1346
116 Ga0070695_100191180 3300005545 Bacteria 1457
117 Ga0070696_100021133 3300005546 Bacteria 4413
118 Ga0070696_100407601 3300005546 Bacteria 1065
119 Ga0070665_100036567 3300005548 Bacteria 4939
120 Ga0070665_100075544 3300005548 Bacteria 3376
121 Ga0070665_100113050 3300005548 Bacteria 2718
122 Ga0070665_100485083 3300005548 Bacteria 1247
123 Ga0070665_100515985 3300005548 Bacteria 1207
124 Ga0070665_100600571 3300005548 Bacteria 1113
125 Ga0070704_100223325 3300005549 Bacteria 1533
126 Ga0068855_100452939 3300005563 Bacteria 1400
127 Ga0068855_100960053 3300005563 Bacteria 900
128 Ga0070664_100012431 3300005564 Bacteria 6919
129 Ga0070664_100076082 3300005564 Bacteria 2883
130 Ga0070664_100153674 3300005564 Bacteria 2033
131 Ga0068857_100276104 3300005577 Bacteria 1545
132 Ga0068857_100317982 3300005577 Bacteria 1437
133 Ga0068854_100000116 3300005578 Bacteria 54986
134 Ga0068854_100075637 3300005578 Bacteria 2473
135 Ga0068854_100131953 3300005578 Bacteria 1908
136 Ga0068854_100882361 3300005578 Bacteria 785
137 Ga0068856_100000336 3300005614 Bacteria 51580
138 Ga0068856_100002016 3300005614 Bacteria 21154
139 Ga0068856_100032534 3300005614 Bacteria 5106
140 Ga0068856_100114684 3300005614 Bacteria 2694
141 Ga0070702_100050153 3300005615 Bacteria 2383
142 Ga0068852_100805384 3300005616 Bacteria 954
143 Ga0068859_100050092 3300005617 Bacteria 4195
144 Ga0068859_100119046 3300005617 Bacteria 2707
145 Ga0068861_100008771 3300005719 Bacteria 6963
146 Ga0068861_100049050 3300005719 Bacteria 3195
147 Ga0068851_10007756 3300005834 Bacteria 4938
148 Ga0068851_10057798 3300005834 Bacteria 1981
149 Ga0068870_10031616 3300005840 Bacteria 2683
150 Ga0068863_100111984 3300005841 Bacteria 2599
151 Ga0068863_100324115 3300005841 Bacteria 1497
152 Ga0068858_100081388 3300005842 Bacteria 3010
153 Ga0068858_100211186 3300005842 Bacteria 1837
154 Ga0068862_100042359 3300005844 Bacteria 3878
155 Ga0081455_10043405 3300005937 Bacteria 3933
156 Ga0081455_10097642 3300005937 Bacteria 2366
157 Ga0081455_10325138 3300005937 Bacteria 1094
158 Ga0081538_10000044 3300005981 Bacteria 115394
159 Ga0081538_10000766 3300005981 Bacteria 35083
160 Ga0081538_10001436 3300005981 Bacteria 24497
161 Ga0081538_10002073 3300005981 Bacteria 19976
162 Ga0081538_10002254 3300005981 Bacteria 19094
163 Ga0081538_10003695 3300005981 Bacteria 14357
164 Ga0081538_10004173 3300005981 Bacteria 13410
165 Ga0081538_10006143 3300005981 Bacteria 10654
166 Ga0081538_10025048 3300005981 Bacteria 4226
167 Ga0081538_10042073 3300005981 Bacteria 2889
168 Ga0081538_10050518 3300005981 Bacteria 2510
169 Ga0081538_10066379 3300005981 Bacteria 2023
170 Ga0081538_10096064 3300005981 Bacteria 1511
171 Ga0081540_1002481 3300005983 Bacteria 15029
172 Ga0081540_1084827 3300005983 Bacteria 1412
173 Ga0081539_10011326 3300005985 Bacteria 7075
174 Ga0081539_10012198 3300005985 Bacteria 6669
175 Ga0070717_10000019 3300006028 Bacteria 178051
176 Ga0070717_10036330 3300006028 Bacteria 3995
177 Ga0075365_10320280 3300006038 Bacteria 1092
178 Ga0075363_100047743 3300006048 Bacteria 2275
179 Ga0075363_100210420 3300006048 Bacteria 1113
180 Ga0075432_10008412 3300006058 Bacteria 3519
181 Ga0070716_100333012 3300006173 Bacteria 1068
182 Ga0070712_100000004 3300006175 Bacteria 215464
183 Ga0070712_100024256 3300006175 Bacteria 4017
184 Ga0070712_100073145 3300006175 Bacteria 2458
185 Ga0070712_100167367 3300006175 Bacteria 1703
186 Ga0070712_100545950 3300006175 Bacteria 976
187 Ga0068871_100396671 3300006358 Bacteria 1228
188 Ga0075428_100172045 3300006844 Bacteria 2347
189 Ga0075428_100281113 3300006844 Bacteria 1791
190 Ga0075428_100407972 3300006844 Bacteria 1456
191 Ga0075428_100417523 3300006844 Bacteria 1437
192 Ga0075430_100001606 3300006846 Bacteria 18450
193 Ga0075430_100125867 3300006846 Bacteria 2136
194 Ga0075430_100159561 3300006846 Bacteria 1877
195 Ga0075430_100174316 3300006846 Bacteria 1789
196 Ga0075431_100014397 3300006847 Bacteria 7999
197 Ga0075431_100102356 3300006847 Bacteria 2956
198 Ga0075431_100244726 3300006847 Bacteria 1823
199 Ga0075433_10069242 3300006852 Bacteria 3099
200 Ga0075433_10224928 3300006852 Bacteria 1667
201 Ga0075433_10389984 3300006852 Bacteria 1229
202 Ga0075434_100074065 3300006871 Bacteria 3398
203 Ga0075434_100434120 3300006871 Bacteria 1334
204 Ga0075429_100031400 3300006880 Bacteria 4616
205 Ga0075429_100090493 3300006880 Bacteria 2669
206 Ga0075429_100260198 3300006880 Bacteria 1519
207 Ga0068865_100081249 3300006881 Bacteria 2327
208 Ga0068865_100490241 3300006881 Bacteria 1023
209 Ga0075436_100069538 3300006914 Bacteria 2433
210 Ga0097620_100050092 3300006931 Bacteria 4195
211 Ga0097620_100119045 3300006931 Bacteria 2707
212 Ga0075435_100012265 3300007076 Bacteria 6338
213 Ga0075435_100220646 3300007076 Bacteria 1610
214 Ga0105240_10206274 3300009093 Bacteria 2300
215 Ga0105240_10370303 3300009093 Bacteria 1620
216 Ga0105240_10596443 3300009093 Bacteria 1217
217 Ga0111539_10004783 3300009094 Bacteria 17670
218 Ga0111539_10012635 3300009094 Bacteria 10578
219 Ga0111539_10039470 3300009094 Bacteria 5689
220 Ga0111539_10050074 3300009094 Bacteria 4977
221 Ga0111539_10129885 3300009094 Bacteria 2951
222 Ga0111539_10641360 3300009094 Bacteria 1237
223 Ga0111539_10954648 3300009094 Bacteria 997
224 Ga0111539_11452804 3300009094 Bacteria 795
225 Ga0105245_10000141 3300009098 Bacteria 68413
226 Ga0105245_10002406 3300009098 Bacteria 16922
227 Ga0105245_10003314 3300009098 Bacteria 14460
228 Ga0105245_10014806 3300009098 Bacteria 6793
229 Ga0105245_10015314 3300009098 Bacteria 6683
230 Ga0105245_10066571 3300009098 Bacteria 3261
231 Ga0105245_10358819 3300009098 Bacteria 1446
232 Ga0105245_10588679 3300009098 Bacteria 1138
233 Ga0105245_10688910 3300009098 Bacteria 1054
234 Ga0105245_10971783 3300009098 Bacteria 893
235 Ga0105247_10047392 3300009101 Bacteria 2638
236 Ga0105247_10625075 3300009101 Bacteria 801
237 Ga0114129_10019151 3300009147 Bacteria 9749
238 Ga0114129_10059944 3300009147 Bacteria 5322
239 Ga0114129_10183598 3300009147 Bacteria 2845
240 Ga0114129_10195494 3300009147 Bacteria 2743
241 Ga0114129_10315827 3300009147 Bacteria 2078
242 Ga0114129_11136682 3300009147 Bacteria 976
243 Ga0114129_12314265 3300009147 Bacteria 645
244 Ga0105243_10011687 3300009148 Bacteria 6640
245 Ga0105243_10012300 3300009148 Bacteria 6473
246 Ga0105243_10079736 3300009148 Bacteria 2669
247 Ga0105243_10576404 3300009148 Bacteria 1079
248 Ga0105243_10795080 3300009148 Bacteria 932
249 Ga0105243_11187265 3300009148 Bacteria 776
250 Ga0105242_10103250 3300009176 Bacteria 2418
251 Ga0105242_10358859 3300009176 Bacteria 1348
252 Ga0105242_10409502 3300009176 Bacteria 1268
253 Ga0105242_11390958 3300009176 Bacteria 729
254 Ga0105248_10000020 3300009177 Bacteria 284637
255 Ga0105248_10141614 3300009177 Bacteria 2713
256 Ga0105248_10312768 3300009177 Bacteria 1769
257 Ga0105237_10009091 3300009545 Bacteria 10677
258 Ga0105237_10207990 3300009545 Bacteria 1957
259 Ga0105237_10338998 3300009545 Bacteria 1508
260 Ga0105237_10486205 3300009545 Bacteria 1241
261 Ga0105238_10032231 3300009551 Bacteria 5333
262 Ga0105249_10018376 3300009553 Bacteria 6217
263 Ga0105249_10332398 3300009553 Bacteria 1534
264 Ga0105239_10019100 3300010375 Bacteria 7575
265 Ga0105239_10164107 3300010375 Bacteria 2483
266 Ga0105239_10217741 3300010375 Bacteria 2141
267 Ga0105239_10315601 3300010375 Bacteria 1762
268 Ga0105239_10685949 3300010375 Bacteria 1171
269 Ga0105239_11017158 3300010375 Bacteria 953
270 Ga0105246_10236010 3300011119 Bacteria 1443
271 Ga0157371_10011110 3300013102 Bacteria 6970
272 Ga0157371_10230312 3300013102 Bacteria 1331
273 Ga0157370_10013982 3300013104 Bacteria 8242
274 Ga0157370_10327615 3300013104 Bacteria 1412
275 Ga0157369_10004884 3300013105 Bacteria 15723
276 Ga0157369_10203624 3300013105 Bacteria 2077
277 Ga0157369_10390815 3300013105 Bacteria 1443
278 Ga0157369_10677369 3300013105 Bacteria 1063
279 Ga0157369_11298606 3300013105 Bacteria 742
280 Ga0157374_10470627 3300013296 Bacteria 1259
281 Ga0157374_10585624 3300013296 Bacteria 1125
282 Ga0163162_10027306 3300013306 Bacteria 5644
283 Ga0163162_10137792 3300013306 Bacteria 2552
284 Ga0163162_10603452 3300013306 Bacteria 1224
285 Ga0157372_10006642 3300013307 Bacteria 12311
286 Ga0157372_10023168 3300013307 Bacteria 6729
287 Ga0157372_10183403 3300013307 Bacteria 2423
288 Ga0157372_10411817 3300013307 Bacteria 1575
289 Ga0157375_10085478 3300013308 Bacteria 3204
290 Ga0157375_10673008 3300013308 Bacteria 1190
291 Ga0157375_11016385 3300013308 Bacteria 968
292 Ga0157375_11683226 3300013308 Bacteria 751
293 Ga0163163_10314158 3300014325 Bacteria 1620
294 Ga0163163_10484790 3300014325 Bacteria 1298
295 Ga0163163_11856857 3300014325 Bacteria 663
296 Ga0157380_10006499 3300014326 Bacteria 8241
297 Ga0157380_11273185 3300014326 Bacteria 782
298 Ga0182008_10245237 3300014497 Bacteria 923
299 Ga0157377_10011697 3300014745 Bacteria 4388
300 Ga0157377_10086770 3300014745 Bacteria 1840
301 Ga0157379_10148164 3300014968 Bacteria 2117
302 Ga0157379_10497759 3300014968 Bacteria 1129
303 Ga0157376_10028909 3300014969 Bacteria 4412
304 Ga0157376_10928289 3300014969 Bacteria 890
305 Ga0163161_10085718 3300017792 Bacteria 2323
306 Ga0206354_10513831 3300020081 Bacteria 1601
307 Ga0206353_10159166 3300020082 Bacteria 1368
308 Ga0206353_10352119 3300020082 Bacteria 950
309 Ga0206353_11218525 3300020082 Bacteria 1211
310 Ga0213873_10054893 3300021358 Bacteria 1064
311 Ga0213875_10032735 3300021388 Bacteria 2456
312 Ga0224712_10103572 3300022467 Bacteria 1211
313 Ga0207426_1013197 3300025302 Bacteria 3070
314 Ga0207656_10039832 3300025321 Bacteria 1990
315 Ga0207656_10193740 3300025321 Bacteria 979
316 Ga0207692_10000022 3300025898 Bacteria 56680
317 Ga0207692_10041897 3300025898 Bacteria 2270
318 Ga0207692_10152908 3300025898 Bacteria 1323
319 Ga0207688_10000813 3300025901 Bacteria 15626
320 Ga0207688_10034319 3300025901 Bacteria 2809
321 Ga0207688_10039540 3300025901 Bacteria 2619
322 Ga0207688_10063504 3300025901 Bacteria 2083
323 Ga0207688_10064925 3300025901 Bacteria 2062
324 Ga0207688_10198878 3300025901 Bacteria 1201
325 Ga0207680_10323462 3300025903 Bacteria 1079
326 Ga0207699_10056789 3300025906 Bacteria 2335
327 Ga0207645_10074921 3300025907 Bacteria 2167
328 Ga0207643_10575587 3300025908 Bacteria 724
329 Ga0207707_10148415 3300025912 Bacteria 2050
330 Ga0207695_10139811 3300025913 Bacteria 2371
331 Ga0207695_10180841 3300025913 Bacteria 2029
332 Ga0207695_10513266 3300025913 Bacteria 1080
333 Ga0207695_10551251 3300025913 Bacteria 1034
334 Ga0207695_10657218 3300025913 Bacteria 929
335 Ga0207671_10001526 3300025914 Bacteria 26567
336 Ga0207693_10000017 3300025915 Bacteria 139308
337 Ga0207693_10004599 3300025915 Bacteria 11642
338 Ga0207693_10008005 3300025915 Bacteria 8678
339 Ga0207693_10049193 3300025915 Bacteria 3311
340 Ga0207693_10710466 3300025915 Bacteria 778
341 Ga0207663_10002190 3300025916 Bacteria 9339
342 Ga0207663_10055324 3300025916 Bacteria 2489
343 Ga0207663_10058625 3300025916 Bacteria 2431
344 Ga0207663_10309526 3300025916 Bacteria 1183
345 Ga0207660_10006020 3300025917 Bacteria 7873
346 Ga0207662_10077621 3300025918 Bacteria 2020
347 Ga0207657_10006359 3300025919 Bacteria 12271
348 Ga0207657_10057000 3300025919 Bacteria 3369
349 Ga0207657_10417286 3300025919 Bacteria 1055
350 Ga0207649_10176847 3300025920 Bacteria 1491
351 Ga0207649_10327925 3300025920 Bacteria 1127
352 Ga0207652_10008802 3300025921 Bacteria 8129
353 Ga0207652_10094266 3300025921 Bacteria 2636
354 Ga0207652_10095849 3300025921 Bacteria 2614
355 Ga0207652_10127154 3300025921 Bacteria 2270
356 Ga0207652_10812437 3300025921 Bacteria 830
357 Ga0207681_10016814 3300025923 Bacteria 4585
358 Ga0207681_10152625 3300025923 Bacteria 1733
359 Ga0207694_10247360 3300025924 Bacteria 1458
360 Ga0207650_10698466 3300025925 Bacteria 857
361 Ga0207659_10000553 3300025926 Bacteria 22395
362 Ga0207659_10035380 3300025926 Bacteria 3452
363 Ga0207659_10372296 3300025926 Bacteria 1189
364 Ga0207687_10000036 3300025927 Bacteria 121934
365 Ga0207687_10002476 3300025927 Bacteria 12542
366 Ga0207687_10039782 3300025927 Bacteria 3220
367 Ga0207687_10324237 3300025927 Bacteria 1248
368 Ga0207687_10547004 3300025927 Bacteria 971
369 Ga0207700_10371009 3300025928 Bacteria 1250
370 Ga0207700_10462839 3300025928 Bacteria 1119
371 Ga0207664_10000004 3300025929 Bacteria 493014
372 Ga0207664_10002049 3300025929 Bacteria 13273
373 Ga0207664_10082008 3300025929 Bacteria 2626
374 Ga0207664_10382024 3300025929 Bacteria 1250
375 Ga0207644_10041237 3300025931 Bacteria 3265
376 Ga0207644_10359468 3300025931 Bacteria 1184
377 Ga0207690_10000268 3300025932 Bacteria 37289
378 Ga0207690_10098395 3300025932 Bacteria 2084
379 Ga0207690_10141496 3300025932 Bacteria 1773
380 Ga0207690_10151916 3300025932 Bacteria 1717
381 Ga0207706_10003294 3300025933 Bacteria 15460
382 Ga0207706_10401597 3300025933 Bacteria 1188
383 Ga0207686_10093501 3300025934 Bacteria 1991
384 Ga0207686_10237332 3300025934 Bacteria 1325
385 Ga0207669_10164059 3300025937 Bacteria 1573
386 Ga0207669_10204345 3300025937 Bacteria 1437
387 Ga0207669_10315406 3300025937 Bacteria 1194
388 Ga0207669_10317918 3300025937 Bacteria 1190
389 Ga0207669_10520656 3300025937 Bacteria 955
390 Ga0207704_10034396 3300025938 Bacteria 2891
391 Ga0207704_10242885 3300025938 Bacteria 1347
392 Ga0207691_10078503 3300025940 Bacteria 2972
393 Ga0207711_10000006 3300025941 Bacteria 792692
394 Ga0207711_10210392 3300025941 Bacteria 1776
395 Ga0207689_10041401 3300025942 Bacteria 3811
396 Ga0207689_10254294 3300025942 Bacteria 1453
397 Ga0207661_10000312 3300025944 Bacteria 30978
398 Ga0207661_10028815 3300025944 Bacteria 4257
399 Ga0207661_10131491 3300025944 Bacteria 2144
400 Ga0207661_10248948 3300025944 Bacteria 1579
401 Ga0207661_10915826 3300025944 Bacteria 807
402 Ga0207679_10023802 3300025945 Bacteria 4193
403 Ga0207679_10074750 3300025945 Bacteria 2568
404 Ga0207679_10120470 3300025945 Bacteria 2088
405 Ga0207651_10687143 3300025960 Bacteria 901
406 Ga0207712_10008255 3300025961 Bacteria 6582
407 Ga0207712_10157106 3300025961 Bacteria 1763
408 Ga0207668_10012672 3300025972 Bacteria 5169
409 Ga0207668_10089592 3300025972 Bacteria 2256
410 Ga0207668_10454504 3300025972 Bacteria 1094
411 Ga0207640_10000134 3300025981 Bacteria 54961
412 Ga0207640_10102975 3300025981 Bacteria 2006
413 Ga0207640_10460067 3300025981 Bacteria 1051
414 Ga0207658_10029416 3300025986 Bacteria 3880
415 Ga0207677_10000374 3300026023 Bacteria 31092
416 Ga0207677_10138916 3300026023 Bacteria 1857
417 Ga0207677_10180365 3300026023 Bacteria 1660
418 Ga0207677_10240977 3300026023 Bacteria 1463
419 Ga0207677_10369646 3300026023 Bacteria 1207
420 Ga0207677_10756946 3300026023 Bacteria 866
421 Ga0207639_10079844 3300026041 Bacteria 2586
422 Ga0207678_10009806 3300026067 Bacteria 8420
423 Ga0207678_10058133 3300026067 Bacteria 3327
424 Ga0207678_10219814 3300026067 Bacteria 1626
425 Ga0207708_10000937 3300026075 Bacteria 21842
426 Ga0207708_10005784 3300026075 Bacteria 9140
427 Ga0207708_10011942 3300026075 Bacteria 6469
428 Ga0207708_10018439 3300026075 Bacteria 5256
429 Ga0207708_10035246 3300026075 Bacteria 3808
430 Ga0207702_10000368 3300026078 Bacteria 51559
431 Ga0207702_10025200 3300026078 Bacteria 4936
432 Ga0207702_10144487 3300026078 Bacteria 2157
433 Ga0207702_11075611 3300026078 Bacteria 798
434 Ga0207641_10054928 3300026088 Bacteria 3382
435 Ga0207641_10505971 3300026088 Bacteria 1174
436 Ga0207648_10204819 3300026089 Bacteria 1751
437 Ga0207648_10302058 3300026089 Bacteria 1436
438 Ga0207648_10385306 3300026089 Bacteria 1268
439 Ga0207676_10062035 3300026095 Bacteria 2963
440 Ga0207676_10566343 3300026095 Bacteria 1087
441 Ga0207674_10141397 3300026116 Bacteria 2366
442 Ga0207674_10152988 3300026116 Bacteria 2263
443 Ga0207674_10349889 3300026116 Bacteria 1429
444 Ga0207675_100004816 3300026118 Bacteria 12997
445 Ga0207675_100033107 3300026118 Bacteria 4816
446 Ga0207675_100101877 3300026118 Bacteria 2705
447 Ga0207675_100657539 3300026118 Bacteria 1054
448 Ga0207675_100733035 3300026118 Bacteria 999
449 Ga0207683_10084011 3300026121 Bacteria 2830
450 Ga0207683_11173117 3300026121 Bacteria 712
451 Ga0207698_10086179 3300026142 Bacteria 2553
452 Ga0207698_10243788 3300026142 Bacteria 1640
453 Ga0207428_10055052 3300027907 Bacteria 3165
454 Ga0207428_10201634 3300027907 Bacteria 1497
455 Ga0207428_10273695 3300027907 Bacteria 1255
456 Ga0268266_10010879 3300028379 Bacteria 7925
457 Ga0268266_10063353 3300028379 Bacteria 3192
458 Ga0268266_10365342 3300028379 Bacteria 1359
459 Ga0268266_10366927 3300028379 Bacteria 1355
460 Ga0268264_10563193 3300028381 Bacteria 1119
461 Ga0265337_1012291 3300028556 Bacteria 2916
462 Ga0265337_1079678 3300028556 Bacteria 897
463 Ga0265326_10000630 3300028558 Bacteria 13168
464 Ga0265326_10000833 3300028558 Bacteria 11353
465 Ga0265319_1000353 3300028563 Bacteria 33333
466 Ga0265319_1001381 3300028563 Bacteria 14593
467 Ga0265319_1009072 3300028563 Bacteria 4285
468 Ga0265334_10000002 3300028573 Bacteria 325014
469 Ga0265318_10001586 3300028577 Bacteria 13166
470 Ga0265318_10005786 3300028577 Bacteria 5769
471 Ga0265318_10047329 3300028577 Bacteria 1622
472 Ga0265318_10075213 3300028577 Bacteria 1250
473 Ga0265323_10120796 3300028653 Bacteria 854
474 Ga0265336_10000005 3300028666 Bacteria 399349
475 Ga0265336_10002183 3300028666 Bacteria 8258
476 Ga0265338_10000001 3300028800 Bacteria 1177449
477 Ga0265338_10024856 3300028800 Bacteria 6104
478 Ga0265338_10147335 3300028800 Bacteria 1834
479 Ga0265338_10386672 3300028800 Bacteria 1000
480 Ga0265320_10008105 3300031240 Bacteria 6458
481 Ga0265320_10047466 3300031240 Bacteria 2100
482 Ga0265325_10085887 3300031241 Bacteria 1558
483 Ga0265340_10000001 3300031247 Bacteria 1647668
484 Ga0265327_10121611 3300031251 Bacteria 1236
485 Ga0265327_10211865 3300031251 Bacteria 874
486 Ga0265316_10129048 3300031344 Bacteria 1905
487 Ga0307408_100149363 3300031548 Bacteria 1843
488 Ga0307408_100270750 3300031548 Bacteria 1410
489 Ga0307408_100272361 3300031548 Bacteria 1406
490 Ga0307408_100614185 3300031548 Bacteria 968
491 Ga0265314_10273943 3300031711 Bacteria 958
492 Ga0307405_10047556 3300031731 Bacteria 2642
493 Ga0307405_10071547 3300031731 Bacteria 2232
494 Ga0307405_10158330 3300031731 Bacteria 1601
495 Ga0307413_10067704 3300031824 Bacteria 2234
496 Ga0307413_10084903 3300031824 Bacteria 2042
497 Ga0307413_10961614 3300031824 Bacteria 729
498 Ga0307410_10020116 3300031852 Bacteria 4076
499 Ga0307410_10035996 3300031852 Bacteria 3220
500 Ga0307410_10050510 3300031852 Bacteria 2797
501 Ga0307410_10853731 3300031852 Bacteria 777
502 Ga0307410_10983725 3300031852 Bacteria 727
503 Ga0326468_10011767 3300031889 Bacteria 909
504 Ga0307406_10027100 3300031901 Bacteria 3449
505 Ga0307406_10131462 3300031901 Bacteria 1758
506 Ga0307407_10098143 3300031903 Bacteria 1812
507 Ga0307407_10358508 3300031903 Bacteria 1035
508 Ga0307412_10131209 3300031911 Bacteria 1820
509 Ga0307412_11013148 3300031911 Bacteria 734
510 Ga0307409_100011229 3300031995 Bacteria 5631
511 Ga0307409_100017566 3300031995 Bacteria 4774
512 Ga0307409_100056097 3300031995 Bacteria 3045
513 Ga0307409_100066444 3300031995 Bacteria 2844
514 Ga0307409_100091978 3300031995 Bacteria 2488
515 Ga0307409_100182248 3300031995 Bacteria 1860
516 Ga0307409_100357287 3300031995 Bacteria 1381
517 Ga0307416_100028146 3300032002 Bacteria 4175
518 Ga0307416_100060399 3300032002 Bacteria 3087
519 Ga0307416_100240649 3300032002 Bacteria 1753
520 Ga0307416_100309296 3300032002 Bacteria 1576
521 Ga0307416_100348654 3300032002 Bacteria 1497
522 Ga0307416_100379049 3300032002 Bacteria 1444
523 Ga0307416_100401692 3300032002 Bacteria 1408
524 Ga0307416_100982852 3300032002 Bacteria 947
525 Ga0307416_101021688 3300032002 Bacteria 930
526 Ga0307416_101285132 3300032002 Bacteria 838
527 Ga0307416_101719263 3300032002 Bacteria 732
528 Ga0307414_10100122 3300032004 Bacteria 2179
529 Ga0307411_10114352 3300032005 Bacteria 1939
530 Ga0307411_10445148 3300032005 Bacteria 1082
531 Ga0307411_10977401 3300032005 Bacteria 757
532 Ga0307415_100003017 3300032126 Bacteria 8473
533 Ga0307415_100069572 3300032126 Bacteria 2469
534 Ga0307415_100132044 3300032126 Bacteria 1892
535 Ga0307415_100133214 3300032126 Bacteria 1885
536 Ga0307415_100218137 3300032126 Bacteria 1527
537 Ga0307415_100318338 3300032126 Bacteria 1296
538 Ga0307415_100363516 3300032126 Bacteria 1223
539 Ga0307415_100514303 3300032126 Bacteria 1049
540 Ga0307415_100794725 3300032126 Bacteria 863
541 Ga0373944_0113250 3300035089 Bacteria 928
542 Ga0373960_0042544 3300035121 Bacteria 1319
543 Ga0373943_0051887 3300035170 Bacteria 2021
544 Ga0373946_0274255 3300035171 Bacteria 828
545 Ga0373955_0624287 3300035172 Bacteria 660
546 Ga0373961_0085827 3300035241 Bacteria 998
547 Ga0373931_0030150 3300035691 Bacteria 2791
548 Ga0373931_0187096 3300035691 Bacteria 1230
549 Ga0373927_0173552 3300035695 Bacteria 1414
550 Ga0373947_0138010 3300035725 Bacteria 1562
551 Ga0373925_0517403 3300037068 Bacteria 980
552 Ga0395899_0204295 3300037312 Bacteria 1376
553 Ga0395900_0717592 3300037418 Bacteria 932
554 Ga0395900_0736322 3300037418 Bacteria 917
555 Ga0395900_1120423 3300037418 Bacteria 704
556 Ga0395898_0047298 3300037466 Bacteria 4223
557 Ga0395898_0181894 3300037466 Bacteria 2009
558 Ga0395898_0384537 3300037466 Bacteria 1338
559 Ga0395898_0421362 3300037466 Bacteria 1272
560 Ga0395898_0445794 3300037466 Bacteria 1233
561 Ga0395905_0441897 3300037471 Bacteria 1198
562 Ga0395905_0492484 3300037471 Bacteria 1126
563 Ga0436364_0069355 3300037853 Bacteria 825
564 Ga0436364_0637349 3300037853 Bacteria 2787
565 Ga0395901_0009771 3300038443 Bacteria 9729
566 Ga0395901_0026246 3300038443 Bacteria 5980
567 Ga0395901_0096926 3300038443 Bacteria 3091
568 Ga0395901_0172676 3300038443 Bacteria 2268
569 Ga0395901_0285448 3300038443 Bacteria 1714
570 Ga0395901_0946536 3300038443 Bacteria 840
571 Ga0395901_0988665 3300038443 Bacteria 818
572 Ga0436365_0367556 3300039437 Bacteria 5407
573 Ga0436365_0869569 3300039437 Bacteria 690
574 Ga0436365_1517862 3300039437 Bacteria 5102
575 Ga0436363_0311232 3300039450 Bacteria 675
576 Ga0436363_1637204 3300039450 Bacteria 1004
577 Ga0436362_0383083 3300039453 Bacteria 1374
578 Ga0436362_0577753 3300039453 Bacteria 820
579 Ga0451853_0704132 3300041512 Bacteria 1834
580 Ga0466969_0030135 3300044656 Bacteria 2766
581 Ga0466965_0101923 3300044683 Bacteria 1469
582 Ga0466965_0641259 3300044683 Bacteria 606
583 Ga0466966_0014445 3300044684 Bacteria 5228
584 Ga0466966_0040633 3300044684 Bacteria 2993
585 Ga0466966_0074139 3300044684 Bacteria 2128
586 Ga0466966_0378420 3300044684 Bacteria 851
587 Ga0466961_0004147 3300044693 Bacteria 9049
588 Ga0466961_0103773 3300044693 Bacteria 1790
589 Ga0466961_0342961 3300044693 Bacteria 910
590 Ga0466963_0016615 3300044694 Bacteria 4578
591 Ga0466963_0251045 3300044694 Bacteria 1241
592 Ga0466963_0565513 3300044694 Bacteria 803
593 Ga0466963_0627894 3300044694 Bacteria 758
594 Ga0466963_0854409 3300044694 Bacteria 642
595 Ga0466964_0091450 3300044706 Bacteria 1325
596 Ga0466964_0214286 3300044706 Bacteria 932
597 Ga0466971_0169199 3300044719 Bacteria 1025
598 Ga0466968_0023973 3300044735 Bacteria 2491
599 Ga0466968_0030132 3300044735 Bacteria 2247
600 Ga0466970_0186309 3300044765 Bacteria 1152
601 Ga0466970_0198559 3300044765 Bacteria 1116
602 Ga0466957_0005022 3300044842 Bacteria 7408
603 Ga0466957_0196176 3300044842 Bacteria 1324
604 Ga0466957_0198208 3300044842 Bacteria 1318
605 Ga0466957_0498444 3300044842 Bacteria 844
606 Ga0466957_0539345 3300044842 Bacteria 812
607 Ga0466957_0561600 3300044842 Bacteria 796
608 Ga0466960_0025275 3300044901 Bacteria 2686
609 Ga0466960_0079028 3300044901 Bacteria 1653
610 Ga0466960_0173092 3300044901 Bacteria 1166
611 Ga0466960_0245859 3300044901 Bacteria 992
612 Ga0466960_0278035 3300044901 Bacteria 937
613 Ga0466959_0025843 3300045049 Bacteria 4354
614 Ga0466959_0029413 3300045049 Bacteria 4070
615 Ga0466959_0189196 3300045049 Bacteria 1437
616 Ga0466958_0008664 3300045836 Bacteria 5648
617 Ga0466958_0036525 3300045836 Bacteria 2941
618 Ga0466958_0052338 3300045836 Bacteria 2475
619 Ga0466958_0137732 3300045836 Bacteria 1536
620 Ga0466967_0005031 3300045976 Bacteria 9059
621 Ga0466967_0023219 3300045976 Bacteria 5079
622 Ga0466967_0027316 3300045976 Bacteria 4746
623 Ga0466967_0132475 3300045976 Bacteria 2315
624 Ga0466967_0215269 3300045976 Bacteria 1823
625 Ga0466967_0225689 3300045976 Bacteria 1782
626 Ga0466967_0251445 3300045976 Bacteria 1688
627 Ga0466967_0297834 3300045976 Bacteria 1551
628 Ga0466967_0494918 3300045976 Bacteria 1199
629 Ga0466967_0523551 3300045976 Bacteria 1165
630 Ga0466967_0572986 3300045976 Bacteria 1112
631 Ga0495603_0144193 3300046455 Bacteria 1385
632 Ga0495603_0406041 3300046455 Bacteria 781
633 Ga0495629_0007258 3300046459 Bacteria 8163
634 Ga0495629_0105003 3300046459 Bacteria 1970
635 Ga0495629_0411793 3300046459 Bacteria 918
636 Ga0495641_0010982 3300046461 Bacteria 5199
637 Ga0495653_0000179 3300046463 Bacteria 52301
638 Ga0495580_0336198 3300046472 Bacteria 1025
639 Ga0495582_0257222 3300046473 Bacteria 1002
640 Ga0495605_0142622 3300046474 Bacteria 1074
641 Ga0495664_0000012 3300046477 Bacteria 226118
642 Ga0495664_0288244 3300046477 Bacteria 992
643 Ga0495594_0000011 3300046499 Bacteria 118444
644 Ga0495606_0000586 3300046507 Bacteria 57795
645 Ga0495608_0120798 3300046511 Bacteria 1680
646 Ga0495618_0000352 3300046514 Bacteria 32977
647 Ga0495628_0370922 3300046516 Bacteria 1050
648 Ga0495630_0000075 3300046517 Bacteria 77378
649 Ga0495630_0011902 3300046517 Bacteria 6307
650 Ga0495644_0123461 3300046523 Bacteria 986
651 Ga0495644_0150753 3300046523 Bacteria 890
652 Ga0495652_0053133 3300046529 Bacteria 3454
653 Ga0495586_0261191 3300046535 Bacteria 989
654 Ga0495586_0307438 3300046535 Bacteria 909
655 Ga0495597_0126169 3300046542 Bacteria 1064
656 Ga0495645_0000012 3300046543 Bacteria 209044
657 Ga0495667_0348810 3300046559 Bacteria 935
658 Ga0495656_0194779 3300046615 Bacteria 1003
659 Ga0495657_0000007 3300046675 Bacteria 222471
660 Ga0495599_0465602 3300046678 Bacteria 747
661 Ga0495647_0000419 3300046681 Bacteria 12163
662 Ga0495624_0000027 3300046690 Bacteria 93611
663 Ga0495600_0028472 3300046809 Bacteria 3615
664 Ga0495660_0055941 3300046810 Bacteria 2134
665 Ga0495674_0207925 3300047319 Bacteria 1622
666 Ga0495672_0054488 3300047320 Bacteria 2337
667 Ga0495676_0019702 3300047321 Bacteria 5930
668 Ga0495676_0227660 3300047321 Bacteria 1282
669 Ga0495680_0055337 3300047322 Bacteria 3078
670 Ga0495677_0134406 3300047445 Bacteria 948
671 Ga0495684_0002969 3300047471 Bacteria 13357
672 Ga0495684_0036602 3300047471 Bacteria 3762
673 Ga0495593_0018850 3300047673 Bacteria 3873
674 Ga0495593_0118145 3300047673 Bacteria 1351
675 Ga0496100_0000001 3300048903 Bacteria 530179
676 Ga0496100_0005518 3300048903 Bacteria 6825
677 Ga0496100_0005686 3300048903 Bacteria 6744
678 Ga0496100_0011761 3300048903 Bacteria 4992
679 Ga0496100_0061411 3300048903 Bacteria 2477
680 Ga0496100_0375744 3300048903 Bacteria 1078
681 Ga0496100_0669049 3300048903 Bacteria 809
682 Ga0496100_0695007 3300048903 Bacteria 794
683 Ga0496101_0000004 3300048904 Bacteria 331599
684 Ga0496101_0005308 3300048904 Bacteria 8206
685 Ga0496101_0011694 3300048904 Bacteria 5832
686 Ga0496101_0243794 3300048904 Bacteria 1399
687 Ga0496102_0000027 3300048905 Bacteria 225466
688 Ga0496102_0001758 3300048905 Bacteria 18871
689 Ga0496102_0012087 3300048905 Bacteria 7460
690 Ga0496102_0076150 3300048905 Bacteria 3085
691 Ga0496102_0081859 3300048905 Bacteria 2977
692 Ga0496102_0138760 3300048905 Bacteria 2279
693 Ga0496103_0001348 3300048906 Bacteria 16570
694 Ga0496103_0007177 3300048906 Bacteria 6644
695 Ga0496103_0009119 3300048906 Bacteria 5875
696 Ga0496103_0086878 3300048906 Bacteria 1971
697 Ga0496104_0000026 3300048907 Bacteria 210098
698 Ga0496104_0003438 3300048907 Bacteria 13654
699 Ga0496104_0015713 3300048907 Bacteria 6866
700 Ga0496104_0065216 3300048907 Bacteria 3455
701 Ga0496104_0194632 3300048907 Bacteria 1940
702 Ga0496104_0450871 3300048907 Bacteria 1198
703 Ga0496104_0877699 3300048907 Bacteria 802
704 Ga0496105_0023481 3300048908 Bacteria 5002
705 Ga0496105_0092970 3300048908 Bacteria 2490
706 Ga0496105_0170169 3300048908 Bacteria 1786
707 Ga0496105_0348997 3300048908 Bacteria 1182
708 Ga0496105_0463918 3300048908 Bacteria 998
709 Ga0496106_0000414 3300048909 Bacteria 30298
710 Ga0496106_0029323 3300048909 Bacteria 4101
711 Ga0496106_0029356 3300048909 Bacteria 4097
712 Ga0496106_0044920 3300048909 Bacteria 3317
713 Ga0496106_0062139 3300048909 Bacteria 2835
714 Ga0496106_0065354 3300048909 Bacteria 2770
715 Ga0496107_0000005 3300048910 Bacteria 281747
716 Ga0496107_0008283 3300048910 Bacteria 7191
717 Ga0496107_0009275 3300048910 Bacteria 6822
718 Ga0496107_0239060 3300048910 Bacteria 1351
719 Ga0496107_0569221 3300048910 Unclassified 838
720 Ga0496107_0608924 3300048910 Bacteria 807
721 Ga0496108_0006662 3300048911 Bacteria 9355
722 Ga0496108_0042757 3300048911 Bacteria 3783
723 Ga0496108_0161303 3300048911 Bacteria 1938
724 Ga0496108_0429061 3300048911 Bacteria 1154
725 Ga0496108_1187811 3300048911 Unclassified 645
726 Ga0496109_0023996 3300048912 Bacteria 5417
727 Ga0496109_0111247 3300048912 Bacteria 2547
728 Ga0496109_0122434 3300048912 Bacteria 2424
729 Ga0496109_0187399 3300048912 Bacteria 1944
730 Ga0496109_0373958 3300048912 Bacteria 1346
731 Ga0496109_0451959 3300048912 Bacteria 1213
732 Ga0496109_0594754 3300048912 Bacteria 1042
733 Ga0496110_0000242 3300048913 Bacteria 35454
734 Ga0496110_0000716 3300048913 Bacteria 22903
735 Ga0496110_0003019 3300048913 Bacteria 12771
736 Ga0496110_0062723 3300048913 Bacteria 3283
737 Ga0496110_0113433 3300048913 Bacteria 2438
738 Ga0496110_0502409 3300048913 Bacteria 1104
739 Ga0496110_0808958 3300048913 Bacteria 842
740 Ga0496110_0954202 3300048913 Bacteria 764
741 Ga0496111_0000366 3300048914 Bacteria 22446
742 Ga0496111_0001332 3300048914 Bacteria 13911
743 Ga0496111_0004875 3300048914 Bacteria 8519
744 Ga0496111_0011253 3300048914 Bacteria 6023
745 Ga0496111_0032700 3300048914 Bacteria 3709
746 Ga0496111_0066011 3300048914 Bacteria 2627
747 Ga0496111_0284439 3300048914 Unclassified 1227
748 Ga0496111_0310200 3300048914 Bacteria 1169
749 Ga0496112_0000200 3300048915 Bacteria 39289
750 Ga0496112_0007945 3300048915 Bacteria 9459
751 Ga0496112_0025245 3300048915 Bacteria 5704
752 Ga0496112_0045162 3300048915 Bacteria 4318
753 Ga0496112_0124638 3300048915 Bacteria 2547
754 Ga0496112_0180021 3300048915 Bacteria 2078
755 Ga0496112_0511496 3300048915 Bacteria 1136
756 Ga0496112_0554970 3300048915 Bacteria 1082
757 Ga0496112_0617699 3300048915 Bacteria 1015
758 Ga0496112_0821146 3300048915 Bacteria 854
759 Ga0496113_0000027 3300048916 Bacteria 63463
760 Ga0496113_0009548 3300048916 Bacteria 6363
761 Ga0496113_0090241 3300048916 Bacteria 2360
762 Ga0496113_0118977 3300048916 Bacteria 2063
763 Ga0496114_0181378 3300048917 Bacteria 1839
764 Ga0496114_0467708 3300048917 Bacteria 1116
765 Ga0496114_0640806 3300048917 Bacteria 935
766 Ga0496114_0733901 3300048917 Bacteria 864
767 Ga0496115_0000143 3300048918 Bacteria 65909
768 Ga0496115_0055013 3300048918 Bacteria 3196
769 Ga0496115_0411658 3300048918 Bacteria 1096
770 Ga0496115_0468815 3300048918 Bacteria 1015
771 Ga0496116_0000176 3300048919 Bacteria 128426
772 Ga0496117_0012250 3300048920 Bacteria 7582
773 Ga0496118_0005822 3300048921 Bacteria 13815
774 Ga0496118_0189826 3300048921 Bacteria 1230
775 Ga0496119_0022041 3300048922 Bacteria 4578
776 Ga0496119_0045653 3300048922 Bacteria 2744
777 Ga0496120_0008785 3300048923 Bacteria 7261
778 Ga0496121_0128403 3300048924 Bacteria 1902
779 Ga0496121_0193951 3300048924 Bacteria 1454
780 Ga0496124_0017107 3300048927 Bacteria 6855
781 Ga0496126_0373062 3300048929 Bacteria 1163
782 Ga0501291_059373 3300049514 Bacteria 716
783 Ga0501031_0004602 3300049568 Bacteria 8945
784 Ga0501031_0012782 3300049568 Bacteria 5486
785 Ga0501031_0019873 3300049568 Bacteria 4378
786 Ga0501031_0087685 3300049568 Bacteria 2029
787 Ga0501032_0002323 3300049569 Bacteria 14908
788 Ga0501032_0005183 3300049569 Bacteria 9712
789 Ga0501033_0001255 3300049570 Bacteria 22735
790 Ga0501033_0028212 3300049570 Bacteria 4219
791 Ga0501033_0051742 3300049570 Bacteria 3045
792 Ga0501033_0626742 3300049570 Bacteria 736
793 Ga0501034_0016423 3300049571 Bacteria 7598
794 Ga0501034_0174514 3300049571 Bacteria 2116
795 Ga0501034_0367342 3300049571 Bacteria 1365
796 Ga0501034_0710376 3300049571 Bacteria 903
797 Ga0501034_0939652 3300049571 Bacteria 751
798 Ga0501036_0004619 3300049572 Bacteria 11128
799 Ga0501036_0100530 3300049572 Bacteria 2446
800 Ga0501036_0161191 3300049572 Bacteria 1891
801 Ga0501036_0178674 3300049572 Bacteria 1787
802 Ga0501036_0507748 3300049572 Bacteria 1003
803 Ga0501036_0621470 3300049572 Bacteria 895
804 Ga0501037_0002105 3300049573 Bacteria 14423
805 Ga0501037_0084212 3300049573 Bacteria 2303
806 Ga0501038_0003549 3300049574 Bacteria 14517
807 Ga0501038_0028808 3300049574 Bacteria 4929
808 Ga0501038_0339781 3300049574 Bacteria 1171
809 Ga0501039_0015041 3300049575 Bacteria 5920
810 Ga0501039_0016303 3300049575 Bacteria 5693
811 Ga0501039_0051757 3300049575 Bacteria 3177
812 Ga0501039_0551106 3300049575 Bacteria 905
813 Ga0501039_0777105 3300049575 Bacteria 747
814 Ga0501040_0014377 3300049576 Bacteria 5215
815 Ga0501040_0046498 3300049576 Bacteria 2963
816 Ga0501041_0024970 3300049577 Bacteria 3590
817 Ga0501041_0073997 3300049577 Bacteria 2093
818 Ga0501041_0108610 3300049577 Bacteria 1721
819 Ga0501041_0196994 3300049577 Bacteria 1262
820 Ga0501041_0208496 3300049577 Bacteria 1226
821 Ga0501042_0039746 3300049578 Bacteria 3344
822 Ga0501042_0065224 3300049578 Bacteria 2602
823 Ga0501042_0081645 3300049578 Bacteria 2317
824 Ga0501042_0092955 3300049578 Bacteria 2166
825 Ga0501042_0103883 3300049578 Bacteria 2044
826 Ga0501042_0250936 3300049578 Bacteria 1277
827 Ga0501043_0002925 3300049579 Bacteria 14258
828 Ga0501043_0081375 3300049579 Bacteria 2544
829 Ga0501043_0428448 3300049579 Bacteria 997
830 Ga0501046_0003552 3300049580 Bacteria 14279
831 Ga0501046_0009834 3300049580 Bacteria 8247
832 Ga0501046_0100685 3300049580 Bacteria 2217
833 Ga0501046_0291423 3300049580 Bacteria 1194
834 Ga0501046_0483342 3300049580 Bacteria 888
835 Ga0501047_0002361 3300049581 Bacteria 18047
836 Ga0501047_0057684 3300049581 Bacteria 3754
837 Ga0501047_0061159 3300049581 Bacteria 3634
838 Ga0501047_0085868 3300049581 Bacteria 3023
839 Ga0501047_0119545 3300049581 Bacteria 2517
840 Ga0501047_0125226 3300049581 Bacteria 2450
841 Ga0501047_0134553 3300049581 Bacteria 2352
842 Ga0501047_0274239 3300049581 Bacteria 1532
843 Ga0501048_0002577 3300049582 Bacteria 13867
844 Ga0501048_0198898 3300049582 Bacteria 1420
845 Ga0501048_0290307 3300049582 Bacteria 1163
846 Ga0501048_0456802 3300049582 Bacteria 915
847 Ga0501067_0003591 3300049583 Bacteria 8545
848 Ga0501068_0009293 3300049584 Bacteria 5496
849 Ga0501068_0031540 3300049584 Bacteria 3148
850 Ga0501068_0353264 3300049584 Bacteria 945
851 Ga0501069_0003034 3300049585 Bacteria 8625
852 Ga0501069_0047028 3300049585 Bacteria 2394
853 Ga0501069_0079700 3300049585 Bacteria 1843
854 Ga0501069_0218953 3300049585 Bacteria 1106
855 Ga0501070_0000832 3300049586 Bacteria 28030
856 Ga0501070_0009212 3300049586 Bacteria 8349
857 Ga0501070_0338896 3300049586 Bacteria 1221
858 Ga0501071_0041672 3300049587 Bacteria 3288
859 Ga0501071_0053674 3300049587 Bacteria 2907
860 Ga0501071_0076231 3300049587 Bacteria 2449
861 Ga0501072_0007453 3300049588 Bacteria 8299
862 Ga0501072_0016434 3300049588 Bacteria 5682
863 Ga0501072_0121775 3300049588 Bacteria 2079
864 Ga0501072_0247865 3300049588 Bacteria 1418
865 Ga0501072_0561092 3300049588 Bacteria 901
866 Ga0501073_0007834 3300049589 Bacteria 7930
867 Ga0501073_0009603 3300049589 Bacteria 7134
868 Ga0501074_0007166 3300049590 Bacteria 8051
869 Ga0501074_0035154 3300049590 Bacteria 3630
870 Ga0501074_0040709 3300049590 Bacteria 3364
871 Ga0501074_0083958 3300049590 Bacteria 2283
872 Ga0501074_0295117 3300049590 Bacteria 1152
873 Ga0501074_0376689 3300049590 Bacteria 1007
874 Ga0501075_0013118 3300049591 Bacteria 5909
875 Ga0501075_0148563 3300049591 Bacteria 1786
876 Ga0501076_0023338 3300049592 Bacteria 4767
877 Ga0501076_0056905 3300049592 Bacteria 3104
878 Ga0501076_0100517 3300049592 Bacteria 2330
879 Ga0501076_0309229 3300049592 Bacteria 1296
880 Ga0501076_0341570 3300049592 Bacteria 1229
881 Ga0501079_0009011 3300049741 Bacteria 7557
882 Ga0501079_0039174 3300049741 Bacteria 3655
883 Ga0501079_0041381 3300049741 Bacteria 3556
884 Ga0501079_0176701 3300049741 Bacteria 1665
885 Ga0501080_0007024 3300049742 Bacteria 10165
886 Ga0501080_0042368 3300049742 Bacteria 4239
887 Ga0501080_0267252 3300049742 Bacteria 1557
888 Ga0501080_0299224 3300049742 Bacteria 1459
889 Ga0501080_1049355 3300049742 Bacteria 705
890 Ga0501081_0058683 3300049743 Bacteria 2663
891 Ga0501083_0002406 3300049744 Bacteria 12801
892 Ga0501083_0027131 3300049744 Bacteria 3953
893 Ga0501083_0038323 3300049744 Bacteria 3259
894 Ga0501083_0114676 3300049744 Bacteria 1769
895 Ga0501035_0004128 3300049822 Bacteria 13802
896 Ga0501035_0022019 3300049822 Bacteria 5855
897 Ga0501035_0259373 3300049822 Bacteria 1474
898 Ga0501044_0000684 3300049823 Bacteria 40967
899 Ga0501044_0022596 3300049823 Bacteria 6702
900 Ga0501044_0064508 3300049823 Bacteria 3739
901 Ga0501045_0053737 3300049824 Bacteria 2943
902 Ga0501045_0094821 3300049824 Bacteria 2207
903 Ga0501045_0140998 3300049824 Bacteria 1792
904 Ga0501045_0365148 3300049824 Bacteria 1074
905 Ga0501045_0540533 3300049824 Bacteria 864
906 nmdc:mga00v17_165783_c1 3300050491 Bacteria 1423
907 nmdc:mga00v17_387567_c1 3300050491 Bacteria 908
908 nmdc:mga00v17_495179_c1 3300050491 Bacteria 792
909 nmdc:mga05p37_1164634_c1 3300050507 Bacteria 800
910 nmdc:mga05p37_140993_c1 3300050507 Bacteria 2953
911 nmdc:mga05p37_1604883_c1 3300050507 Bacteria 640
912 nmdc:mga05p37_262700_c1 3300050507 Bacteria 2065
913 nmdc:mga05p37_45564_c1 3300050507 Bacteria 5393
914 nmdc:mga05p37_478418_c1 3300050507 Bacteria 1435
915 nmdc:mga05p37_704595_c1 3300050507 Bacteria 1121
916 nmdc:mga09592_163983_c1 3300050508 Bacteria 1920
917 nmdc:mga09592_19237_c1 3300050508 Bacteria 5605
918 nmdc:mga09592_385900_c1 3300050508 Bacteria 1211
919 nmdc:mga09592_390814_c1 3300050508 Bacteria 1202
920 nmdc:mga09592_6990_c1 3300050508 Bacteria 9174
921 nmdc:mga0qj67_334433_c1 3300050509 Bacteria 1225
922 nmdc:mga0qj67_50370_c1 3300050509 Bacteria 3293
923 nmdc:mga0qj67_5408_c1 3300050509 Bacteria 9321
924 nmdc:mga0qj67_70656_c1 3300050509 Bacteria 2785
925 nmdc:mga06r32_13488_c1 3300050510 Bacteria 7405
926 nmdc:mga06r32_190968_c1 3300050510 Bacteria 2036
927 nmdc:mga06r32_32616_c1 3300050510 Bacteria 4902
928 nmdc:mga08y16_118758_c1 3300050511 Bacteria 2752
929 nmdc:mga08y16_190763_c1 3300050511 Bacteria 2126
930 nmdc:mga08y16_276486_c1 3300050511 Bacteria 1733
931 nmdc:mga08y16_35631_c1 3300050511 Bacteria 5226
932 nmdc:mga08y16_37510_c1 3300050511 Bacteria 5089
933 nmdc:mga08y16_652245_c1 3300050511 Bacteria 1057
934 nmdc:mga0n895_121418_c1 3300050512 Bacteria 2634
935 nmdc:mga0n895_326177_c1 3300050512 Bacteria 1555
936 nmdc:mga0n895_601864_c1 3300050512 Bacteria 1101
937 nmdc:mga0n895_64787_c1 3300050512 Bacteria 3615
938 nmdc:mga0rr50_193863_c1 3300050513 Bacteria 1666
939 nmdc:mga0a205_220706_c1 3300050515 Bacteria 1781
940 nmdc:mga0a205_51769_c1 3300050515 Bacteria 3964
941 nmdc:mga0a205_828417_c1 3300050515 Bacteria 773
942 Ga0495601_0000595 3300053077 Bacteria 19251
943 Ga0495601_0005015 3300053077 Bacteria 7684
944 Ga0495601_0006880 3300053077 Bacteria 6662
945 Ga0495612_0000023 3300053078 Bacteria 118413
946 Ga0495612_0002167 3300053078 Bacteria 8080
947 Ga0495655_0073885 3300053083 Bacteria 959
948 Ga0495655_0080651 3300053083 Bacteria 930
949 Ga0495619_0000047 3300053085 Bacteria 102152
950 Ga0495619_0123674 3300053085 Bacteria 1775
951 Ga0500568_0175941 3300053139 Bacteria 787
952 Ga0500616_0025481 3300053153 Bacteria 3280
953 Ga0500616_0142130 3300053153 Bacteria 1120
954 Ga0501084_0021707 3300054114 Bacteria 5353
955 Ga0501084_0042468 3300054114 Bacteria 3804
956 Ga0501084_0044658 3300054114 Bacteria 3710
957 Ga0501084_0506402 3300054114 Bacteria 1020
958 Ga0587071_045024 3300060344 Bacteria 896
959 Ga0501082_0008369 3300060353 Bacteria 8922
960 Ga0501082_0046329 3300060353 Bacteria 3748
961 Ga0501082_0068822 3300060353 Bacteria 3048
962 Ga0501082_0090176 3300060353 Bacteria 2647
963 Ga0501082_0698602 3300060353 Bacteria 888
964 Ga0501082_0754966 3300060353 Bacteria 851
965 Ga0466962_0054943 3300061719 Bacteria 1903
966 Ga0466962_0086446 3300061719 Bacteria 1501
967 Ga0530510_0009957 3300061734 Bacteria 6668
968 Ga0530510_0093190 3300061734 Bacteria 2199
969 Ga0530510_0213005 3300061734 Bacteria 1435
970 Ga0530510_0434603 3300061734 Bacteria 991
971 Ga0530510_0555932 3300061734 Bacteria 872
972 Ga0530510_0997689 3300061734 Bacteria 641

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_10688910 Ga0105245_106889101 160
2 3300005330 Ga0070690_100243518 Ga0070690_1002435182 171
3 3300035695 Ga0373927_0173552 Ga0373927_0173552_122_715 171
4 3300048903 Ga0496100_0005518 Ga0496100_0005518_1371_1961 171
5 3300048904 Ga0496101_0005308 Ga0496101_0005308_2185_2775 171
6 3300048909 Ga0496106_0029356 Ga0496106_0029356_3242_3832 171
7 3300048910 Ga0496107_0008283 Ga0496107_0008283_4999_5589 171
8 3300048917 Ga0496114_0181378 Ga0496114_0181378_357_947 171
9 3300005334 Ga0068869_100186159 Ga0068869_1001861592 172
10 3300035089 Ga0373944_0113250 Ga0373944_0113250_48_641 173
11 3300035171 Ga0373946_0274255 Ga0373946_0274255_224_817 173
12 3300035725 Ga0373947_0138010 Ga0373947_0138010_587_1180 173
13 3300005331 Ga0070670_100256191 Ga0070670_1002561912 174
14 3300005337 Ga0070682_100376757 Ga0070682_1003767572 174
15 3300005339 Ga0070660_100561430 Ga0070660_1005614302 175
16 3300009093 Ga0105240_10206274 Ga0105240_102062743 175
17 3300009094 Ga0111539_10954648 Ga0111539_109546482 175
18 3300025901 Ga0207688_10198878 Ga0207688_101988782 175
19 3300025913 Ga0207695_10180841 Ga0207695_101808412 175
20 3300028556 Ga0265337_1012291 Ga0265337_10122912 175
21 3300028558 Ga0265326_10000833 Ga0265326_100008332 175
22 3300028563 Ga0265319_1000353 Ga0265319_100035333 175
23 3300028577 Ga0265318_10001586 Ga0265318_1000158612 175
24 3300028666 Ga0265336_10000005 Ga0265336_10000005345 175
25 3300028800 Ga0265338_10000001 Ga0265338_100000011162 175
26 3300031241 Ga0265325_10085887 Ga0265325_100858872 175
27 3300031247 Ga0265340_10000001 Ga0265340_100000011160 175
28 3300031344 Ga0265316_10129048 Ga0265316_101290482 175
29 3300035172 Ga0373955_0624287 Ga0373955_0624287_15_548 175
30 3300053085 Ga0495619_0123674 Ga0495619_0123674_248_895 175
31 3300046542 Ga0495597_0126169 Ga0495597_0126169_176_766 176
32 3300047471 Ga0495684_0002969 Ga0495684_0002969_12300_12878 176
33 3300048918 Ga0496115_0000143 Ga0496115_0000143_60914_61519 176
34 3300005548 Ga0070665_100113050 Ga0070665_1001130503 177
35 3300028379 Ga0268266_10063353 Ga0268266_100633535 177
36 3300046514 Ga0495618_0000352 Ga0495618_0000352_5858_6466 177
37 3300047320 Ga0495672_0054488 Ga0495672_0054488_672_1259 177
38 3300048907 Ga0496104_0000026 Ga0496104_0000026_203900_204514 177
39 3300048913 Ga0496110_0000716 Ga0496110_0000716_16705_17319 177
40 3300048914 Ga0496111_0000366 Ga0496111_0000366_7632_8246 177
41 3300050491 nmdc:mga00v17_495179_c1 nmdc:mga00v17_495179_c1_232_768 177
42 3300005437 Ga0070710_10423514 Ga0070710_104235142 178
43 3300020082 Ga0206353_11218525 Ga0206353_112185252 178
44 3300032126 Ga0307415_100318338 Ga0307415_1003183382 178
45 3300049571 Ga0501034_0939652 Ga0501034_0939652_48_653 178
46 3300006038 Ga0075365_10320280 Ga0075365_103202802 179
47 3300006844 Ga0075428_100417523 Ga0075428_1004175232 180
48 3300006846 Ga0075430_100174316 Ga0075430_1001743162 180
49 3300006847 Ga0075431_100014397 Ga0075431_10001439710 180
50 3300020082 Ga0206353_10352119 Ga0206353_103521192 180
51 3300039450 Ga0436363_1637204 Ga0436363_1637204_153_743 180
52 3300044683 Ga0466965_0641259 Ga0466965_0641259_14_565 180
53 3300044693 Ga0466961_0342961 Ga0466961_0342961_70_675 180
54 3300046463 Ga0495653_0000179 Ga0495653_0000179_43250_43843 180
55 3300046474 Ga0495605_0142622 Ga0495605_0142622_434_1021 180
56 3300046523 Ga0495644_0150753 Ga0495644_0150753_106_693 180
57 3300046535 Ga0495586_0261191 Ga0495586_0261191_318_866 180
58 3300050507 nmdc:mga05p37_262700_c1 nmdc:mga05p37_262700_c1_98_685 180
59 3300050508 nmdc:mga09592_163983_c1 nmdc:mga09592_163983_c1_300_887 180
60 3300050509 nmdc:mga0qj67_50370_c1 nmdc:mga0qj67_50370_c1_466_1053 180
61 3300050510 nmdc:mga06r32_13488_c1 nmdc:mga06r32_13488_c1_6468_7055 180
62 3300053077 Ga0495601_0000595 Ga0495601_0000595_12027_12617 180
63 3300005981 Ga0081538_10096064 Ga0081538_100960643 181
64 3300014497 Ga0182008_10245237 Ga0182008_102452372 181
65 3300044901 Ga0466960_0278035 Ga0466960_0278035_298_903 181
66 3300005338 Ga0068868_100027776 Ga0068868_1000277762 182
67 3300005340 Ga0070689_100399760 Ga0070689_1003997602 182
68 3300005345 Ga0070692_10090842 Ga0070692_100908422 182
69 3300005435 Ga0070714_100104971 Ga0070714_1001049712 182
70 3300005441 Ga0070700_100013649 Ga0070700_1000136493 182
71 3300005466 Ga0070685_10284096 Ga0070685_102840962 182
72 3300005615 Ga0070702_100050153 Ga0070702_1000501533 182
73 3300005617 Ga0068859_100119046 Ga0068859_1001190463 182
74 3300005842 Ga0068858_100081388 Ga0068858_1000813882 182
75 3300005937 Ga0081455_10097642 Ga0081455_100976424 182
76 3300005981 Ga0081538_10004173 Ga0081538_100041736 182
77 3300005981 Ga0081538_10025048 Ga0081538_100250486 182
78 3300006931 Ga0097620_100119045 Ga0097620_1001190453 182
79 3300009098 Ga0105245_10015314 Ga0105245_100153145 182
80 3300009148 Ga0105243_10012300 Ga0105243_100123005 182
81 3300009176 Ga0105242_10103250 Ga0105242_101032502 182
82 3300010375 Ga0105239_10685949 Ga0105239_106859492 182
83 3300011119 Ga0105246_10236010 Ga0105246_102360102 182
84 3300014968 Ga0157379_10497759 Ga0157379_104977591 182
85 3300025901 Ga0207688_10063504 Ga0207688_100635043 182
86 3300025907 Ga0207645_10074921 Ga0207645_100749213 182
87 3300025915 Ga0207693_10004599 Ga0207693_1000459911 182
88 3300025916 Ga0207663_10309526 Ga0207663_103095262 182
89 3300025929 Ga0207664_10082008 Ga0207664_100820082 182
90 3300025934 Ga0207686_10093501 Ga0207686_100935012 182
91 3300025937 Ga0207669_10317918 Ga0207669_103179182 182
92 3300026023 Ga0207677_10180365 Ga0207677_101803652 182
93 3300026075 Ga0207708_10018439 Ga0207708_100184394 182
94 3300026089 Ga0207648_10302058 Ga0207648_103020582 182
95 3300026095 Ga0207676_10566343 Ga0207676_105663432 182
96 3300026118 Ga0207675_100657539 Ga0207675_1006575391 182
97 3300028379 Ga0268266_10365342 Ga0268266_103653422 182
98 3300044683 Ga0466965_0101923 Ga0466965_0101923_760_1359 182
99 3300044765 Ga0466970_0198559 Ga0466970_0198559_285_884 182
100 3300046535 Ga0495586_0307438 Ga0495586_0307438_286_882 182
101 3300048903 Ga0496100_0695007 Ga0496100_0695007_63_656 182
102 3300048905 Ga0496102_0138760 Ga0496102_0138760_35_628 182
103 3300048909 Ga0496106_0029323 Ga0496106_0029323_1375_1968 182
104 3300048912 Ga0496109_0373958 Ga0496109_0373958_370_963 182
105 3300048913 Ga0496110_0113433 Ga0496110_0113433_1624_2217 182
106 3300009148 Ga0105243_10795080 Ga0105243_107950802 183
107 3300044842 Ga0466957_0196176 Ga0466957_0196176_177_770 183
108 3300045976 Ga0466967_0251445 Ga0466967_0251445_567_1163 183
109 3300048905 Ga0496102_0076150 Ga0496102_0076150_2286_2846 183
110 3300049570 Ga0501033_0051742 Ga0501033_0051742_1726_2322 183
111 3300049577 Ga0501041_0024970 Ga0501041_0024970_280_876 183
112 3300049578 Ga0501042_0039746 Ga0501042_0039746_255_851 183
113 3300005439 Ga0070711_100289029 Ga0070711_1002890292 184
114 3300007076 Ga0075435_100220646 Ga0075435_1002206462 184
115 3300009098 Ga0105245_10066571 Ga0105245_100665712 184
116 3300025916 Ga0207663_10058625 Ga0207663_100586252 184
117 3300050507 nmdc:mga05p37_478418_c1 nmdc:mga05p37_478418_c1_163_750 184
118 3300005338 Ga0068868_100380266 Ga0068868_1003802662 185
119 3300005981 Ga0081538_10003695 Ga0081538_1000369510 185
120 3300006058 Ga0075432_10008412 Ga0075432_100084122 185
121 3300006852 Ga0075433_10224928 Ga0075433_102249283 185
122 3300006881 Ga0068865_100490241 Ga0068865_1004902411 185
123 3300032002 Ga0307416_101719263 Ga0307416_1017192631 185
124 3300035691 Ga0373931_0030150 Ga0373931_0030150_1857_2444 185
125 3300050515 nmdc:mga0a205_220706_c1 nmdc:mga0a205_220706_c1_1009_1596 185
126 3300005435 Ga0070714_100010038 Ga0070714_1000100385 186
127 3300025972 Ga0207668_10454504 Ga0207668_104545042 186
128 3300026078 Ga0207702_11075611 Ga0207702_110756111 186
129 3300049570 Ga0501033_0626742 Ga0501033_0626742_133_720 186
130 3300049575 Ga0501039_0551106 Ga0501039_0551106_229_816 186
131 3300049577 Ga0501041_0208496 Ga0501041_0208496_576_1163 186
132 3300049582 Ga0501048_0456802 Ga0501048_0456802_286_873 186
133 3300049588 Ga0501072_0121775 Ga0501072_0121775_803_1390 186
134 3300049824 Ga0501045_0365148 Ga0501045_0365148_327_914 186
135 3300061734 Ga0530510_0997689 Ga0530510_0997689_22_609 186
136 3300005435 Ga0070714_100113289 Ga0070714_1001132894 187
137 3300025929 Ga0207664_10002049 Ga0207664_100020499 187
138 3300031911 Ga0307412_11013148 Ga0307412_110131482 187
139 3300005336 Ga0070680_100810565 Ga0070680_1008105652 188
140 3300025926 Ga0207659_10035380 Ga0207659_100353802 188
141 3300026116 Ga0207674_10141397 Ga0207674_101413973 188
142 3300026142 Ga0207698_10086179 Ga0207698_100861794 188
143 3300005434 Ga0070709_10053487 Ga0070709_100534872 189
144 3300005435 Ga0070714_100837573 Ga0070714_1008375732 189
145 3300005440 Ga0070705_100995940 Ga0070705_1009959401 189
146 3300006175 Ga0070712_100167367 Ga0070712_1001673672 189
147 3300025898 Ga0207692_10041897 Ga0207692_100418972 189
148 3300025906 Ga0207699_10056789 Ga0207699_100567892 189
149 3300025929 Ga0207664_10382024 Ga0207664_103820242 189
150 3300045976 Ga0466967_0494918 Ga0466967_0494918_456_1052 189
151 3300048913 Ga0496110_0000242 Ga0496110_0000242_28404_28994 189
152 3300048914 Ga0496111_0004875 Ga0496111_0004875_6451_7041 189
153 3300049568 Ga0501031_0012782 Ga0501031_0012782_2053_2649 189
154 3300049572 Ga0501036_0100530 Ga0501036_0100530_1293_1889 189
155 3300049576 Ga0501040_0014377 Ga0501040_0014377_2595_3191 189
156 3300049577 Ga0501041_0196994 Ga0501041_0196994_558_1154 189
157 3300049578 Ga0501042_0081645 Ga0501042_0081645_730_1326 189
158 3300049584 Ga0501068_0353264 Ga0501068_0353264_214_810 189
159 3300049585 Ga0501069_0218953 Ga0501069_0218953_299_895 189
160 3300049587 Ga0501071_0041672 Ga0501071_0041672_1264_1860 189
161 3300049588 Ga0501072_0561092 Ga0501072_0561092_48_644 189
162 3300049591 Ga0501075_0013118 Ga0501075_0013118_2823_3419 189
163 3300049592 Ga0501076_0023338 Ga0501076_0023338_2934_3530 189
164 3300049824 Ga0501045_0540533 Ga0501045_0540533_242_838 189
165 3300053077 Ga0495601_0006880 Ga0495601_0006880_4342_4932 189
166 3300054114 Ga0501084_0042468 Ga0501084_0042468_452_1048 189
167 3300060353 Ga0501082_0068822 Ga0501082_0068822_426_1022 189
168 3300003373 JGI25407J50210_10007614 JGI25407J50210_100076143 190
169 3300003373 JGI25407J50210_10046016 JGI25407J50210_100460162 190
170 3300005981 Ga0081538_10000044 Ga0081538_1000004416 190
171 3300005981 Ga0081538_10006143 Ga0081538_1000614314 190
172 3300005329 Ga0070683_100017940 Ga0070683_1000179405 194
173 3300005339 Ga0070660_100068013 Ga0070660_1000680133 194
174 3300005343 Ga0070687_100478350 Ga0070687_1004783502 194
175 3300005347 Ga0070668_100042153 Ga0070668_1000421534 194
176 3300005354 Ga0070675_100001160 Ga0070675_1000011609 194
177 3300005365 Ga0070688_100000027 Ga0070688_10000002771 194
178 3300005365 Ga0070688_100004986 Ga0070688_1000049869 194
179 3300005367 Ga0070667_100811593 Ga0070667_1008115932 194
180 3300005440 Ga0070705_100950972 Ga0070705_1009509721 194
181 3300005466 Ga0070685_10000665 Ga0070685_1000066516 194
182 3300005466 Ga0070685_10000791 Ga0070685_1000079116 194
183 3300005471 Ga0070698_100623824 Ga0070698_1006238242 194
184 3300005530 Ga0070679_100151311 Ga0070679_1001513113 194
185 3300005535 Ga0070684_100106959 Ga0070684_1001069592 194
186 3300005544 Ga0070686_100229411 Ga0070686_1002294112 194
187 3300005563 Ga0068855_100960053 Ga0068855_1009600532 194
188 3300005577 Ga0068857_100276104 Ga0068857_1002761042 194
189 3300005578 Ga0068854_100000116 Ga0068854_10000011656 194
190 3300005614 Ga0068856_100000336 Ga0068856_1000003368 194
191 3300005614 Ga0068856_100032534 Ga0068856_1000325344 194
192 3300005834 Ga0068851_10007756 Ga0068851_100077563 194
193 3300005834 Ga0068851_10057798 Ga0068851_100577983 194
194 3300005841 Ga0068863_100111984 Ga0068863_1001119844 194
195 3300005937 Ga0081455_10043405 Ga0081455_100434055 194
196 3300005983 Ga0081540_1002481 Ga0081540_100248111 194
197 3300005983 Ga0081540_1084827 Ga0081540_10848272 194
198 3300006175 Ga0070712_100024256 Ga0070712_1000242565 194
199 3300006846 Ga0075430_100001606 Ga0075430_10000160616 194
200 3300006846 Ga0075430_100125867 Ga0075430_1001258673 194
201 3300006852 Ga0075433_10389984 Ga0075433_103899842 194
202 3300009098 Ga0105245_10000141 Ga0105245_1000014170 194
203 3300009098 Ga0105245_10002406 Ga0105245_100024065 194
204 3300009098 Ga0105245_10588679 Ga0105245_105886792 194
205 3300009147 Ga0114129_10315827 Ga0114129_103158273 194
206 3300009147 Ga0114129_12314265 Ga0114129_123142651 194
207 3300009148 Ga0105243_10011687 Ga0105243_100116875 194
208 3300009176 Ga0105242_11390958 Ga0105242_113909581 194
209 3300009177 Ga0105248_10000020 Ga0105248_100000208 194
210 3300010375 Ga0105239_11017158 Ga0105239_110171582 194
211 3300013102 Ga0157371_10011110 Ga0157371_100111108 194
212 3300013104 Ga0157370_10013982 Ga0157370_100139824 194
213 3300013105 Ga0157369_10004884 Ga0157369_1000488412 194
214 3300013105 Ga0157369_10203624 Ga0157369_102036241 194
215 3300013296 Ga0157374_10585624 Ga0157374_105856242 194
216 3300014326 Ga0157380_10006499 Ga0157380_100064999 194
217 3300025302 Ga0207426_1013197 Ga0207426_10131973 194
218 3300025321 Ga0207656_10039832 Ga0207656_100398323 194
219 3300025912 Ga0207707_10148415 Ga0207707_101484153 194
220 3300025915 Ga0207693_10008005 Ga0207693_100080059 194
221 3300025921 Ga0207652_10095849 Ga0207652_100958492 194
222 3300025926 Ga0207659_10000553 Ga0207659_1000055322 194
223 3300025927 Ga0207687_10000036 Ga0207687_100000368 194
224 3300025927 Ga0207687_10002476 Ga0207687_100024769 194
225 3300025927 Ga0207687_10547004 Ga0207687_105470042 194
226 3300025941 Ga0207711_10000006 Ga0207711_10000006367 194
227 3300025944 Ga0207661_10000312 Ga0207661_1000031237 194
228 3300025972 Ga0207668_10012672 Ga0207668_100126724 194
229 3300025981 Ga0207640_10000134 Ga0207640_1000013457 194
230 3300026023 Ga0207677_10000374 Ga0207677_1000037432 194
231 3300026078 Ga0207702_10000368 Ga0207702_1000036854 194
232 3300026078 Ga0207702_10025200 Ga0207702_100252003 194
233 3300026116 Ga0207674_10349889 Ga0207674_103498891 194
234 3300031548 Ga0307408_100614185 Ga0307408_1006141852 194
235 3300037312 Ga0395899_0204295 Ga0395899_0204295_479_1069 194
236 3300037418 Ga0395900_0717592 Ga0395900_0717592_184_774 194
237 3300037418 Ga0395900_0736322 Ga0395900_0736322_132_722 194
238 3300037466 Ga0395898_0181894 Ga0395898_0181894_1237_1851 194
239 3300037466 Ga0395898_0384537 Ga0395898_0384537_74_664 194
240 3300037466 Ga0395898_0445794 Ga0395898_0445794_633_1217 194
241 3300037471 Ga0395905_0441897 Ga0395905_0441897_563_1153 194
242 3300038443 Ga0395901_0009771 Ga0395901_0009771_8346_8936 194
243 3300038443 Ga0395901_0096926 Ga0395901_0096926_2413_3003 194
244 3300038443 Ga0395901_0946536 Ga0395901_0946536_72_686 194
245 3300041512 Ga0451853_0704132 Ga0451853_0704132_1099_1689 194
246 3300044684 Ga0466966_0014445 Ga0466966_0014445_630_1223 194
247 3300046455 Ga0495603_0406041 Ga0495603_0406041_135_725 194
248 3300046459 Ga0495629_0007258 Ga0495629_0007258_1467_2057 194
249 3300046461 Ga0495641_0010982 Ga0495641_0010982_2007_2597 194
250 3300046499 Ga0495594_0000011 Ga0495594_0000011_80644_81237 194
251 3300046507 Ga0495606_0000586 Ga0495606_0000586_5046_5636 194
252 3300046517 Ga0495630_0000075 Ga0495630_0000075_71255_71845 194
253 3300046681 Ga0495647_0000419 Ga0495647_0000419_8857_9447 194
254 3300046690 Ga0495624_0000027 Ga0495624_0000027_86941_87528 194
255 3300046810 Ga0495660_0055941 Ga0495660_0055941_491_1081 194
256 3300047321 Ga0495676_0019702 Ga0495676_0019702_4541_5131 194
257 3300047445 Ga0495677_0134406 Ga0495677_0134406_273_863 194
258 3300047673 Ga0495593_0018850 Ga0495593_0018850_1862_2452 194
259 3300047673 Ga0495593_0118145 Ga0495593_0118145_302_895 194
260 3300048903 Ga0496100_0000001 Ga0496100_0000001_523222_523812 194
261 3300048904 Ga0496101_0000004 Ga0496101_0000004_324574_325164 194
262 3300048906 Ga0496103_0007177 Ga0496103_0007177_1685_2278 194
263 3300048907 Ga0496104_0877699 Ga0496104_0877699_110_703 194
264 3300048909 Ga0496106_0000414 Ga0496106_0000414_23339_23929 194
265 3300048909 Ga0496106_0062139 Ga0496106_0062139_1150_1740 194
266 3300048910 Ga0496107_0000005 Ga0496107_0000005_6436_7026 194
267 3300048910 Ga0496107_0569221 Ga0496107_0569221_154_744 194
268 3300048910 Ga0496107_0608924 Ga0496107_0608924_166_756 194
269 3300048911 Ga0496108_1187811 Ga0496108_1187811_16_606 194
270 3300048912 Ga0496109_0122434 Ga0496109_0122434_917_1507 194
271 3300048913 Ga0496110_0502409 Ga0496110_0502409_271_861 194
272 3300048914 Ga0496111_0284439 Ga0496111_0284439_118_708 194
273 3300048914 Ga0496111_0310200 Ga0496111_0310200_488_1078 194
274 3300048915 Ga0496112_0007945 Ga0496112_0007945_6362_6952 194
275 3300048916 Ga0496113_0000027 Ga0496113_0000027_56220_56810 194
276 3300049571 Ga0501034_0174514 Ga0501034_0174514_388_978 194
277 3300049580 Ga0501046_0291423 Ga0501046_0291423_267_860 194
278 3300049581 Ga0501047_0085868 Ga0501047_0085868_150_743 194
279 3300049581 Ga0501047_0125226 Ga0501047_0125226_1691_2281 194
280 3300049581 Ga0501047_0274239 Ga0501047_0274239_328_918 194
281 3300049585 Ga0501069_0047028 Ga0501069_0047028_1080_1670 194
282 3300049586 Ga0501070_0338896 Ga0501070_0338896_242_832 194
283 3300049590 Ga0501074_0040709 Ga0501074_0040709_1059_1649 194
284 3300049741 Ga0501079_0041381 Ga0501079_0041381_922_1512 194
285 3300049742 Ga0501080_0299224 Ga0501080_0299224_54_644 194
286 3300049744 Ga0501083_0027131 Ga0501083_0027131_575_1165 194
287 3300049823 Ga0501044_0022596 Ga0501044_0022596_5410_6000 194
288 3300050491 nmdc:mga00v17_165783_c1 nmdc:mga00v17_165783_c1_636_1229 194
289 3300050491 nmdc:mga00v17_387567_c1 nmdc:mga00v17_387567_c1_74_664 194
290 3300050509 nmdc:mga0qj67_5408_c1 nmdc:mga0qj67_5408_c1_8293_8886 194
291 3300050509 nmdc:mga0qj67_70656_c1 nmdc:mga0qj67_70656_c1_1552_2142 194
292 3300050513 nmdc:mga0rr50_193863_c1 nmdc:mga0rr50_193863_c1_707_1297 194
293 3300053078 Ga0495612_0002167 Ga0495612_0002167_2114_2704 194
294 3300053085 Ga0495619_0000047 Ga0495619_0000047_6510_7100 194
295 3300000549 LJQas_1007430 LJQas_10074302 195
296 3300003203 JGI25406J46586_10037679 JGI25406J46586_100376792 195
297 3300005329 Ga0070683_100035511 Ga0070683_1000355113 195
298 3300005329 Ga0070683_100051889 Ga0070683_1000518894 195
299 3300005329 Ga0070683_100165130 Ga0070683_1001651302 195
300 3300005331 Ga0070670_101056036 Ga0070670_1010560361 195
301 3300005334 Ga0068869_100019169 Ga0068869_1000191693 195
302 3300005335 Ga0070666_10549680 Ga0070666_105496801 195
303 3300005337 Ga0070682_100023170 Ga0070682_1000231705 195
304 3300005337 Ga0070682_100399027 Ga0070682_1003990272 195
305 3300005338 Ga0068868_100003173 Ga0068868_1000031732 195
306 3300005338 Ga0068868_100293943 Ga0068868_1002939432 195
307 3300005338 Ga0068868_100340411 Ga0068868_1003404112 195
308 3300005338 Ga0068868_100887103 Ga0068868_1008871032 195
309 3300005339 Ga0070660_100003619 Ga0070660_10000361914 195
310 3300005339 Ga0070660_100046597 Ga0070660_1000465974 195
311 3300005340 Ga0070689_100060626 Ga0070689_1000606262 195
312 3300005340 Ga0070689_100158234 Ga0070689_1001582342 195
313 3300005341 Ga0070691_10158276 Ga0070691_101582762 195
314 3300005343 Ga0070687_100104910 Ga0070687_1001049102 195
315 3300005344 Ga0070661_100019340 Ga0070661_1000193403 195
316 3300005344 Ga0070661_100581806 Ga0070661_1005818061 195
317 3300005345 Ga0070692_10017574 Ga0070692_100175743 195
318 3300005345 Ga0070692_10134710 Ga0070692_101347102 195
319 3300005347 Ga0070668_100470612 Ga0070668_1004706122 195
320 3300005353 Ga0070669_100020911 Ga0070669_1000209114 195
321 3300005353 Ga0070669_100359311 Ga0070669_1003593112 195
322 3300005353 Ga0070669_100385917 Ga0070669_1003859172 195
323 3300005354 Ga0070675_100413797 Ga0070675_1004137971 195
324 3300005355 Ga0070671_100235319 Ga0070671_1002353191 195
325 3300005355 Ga0070671_100488975 Ga0070671_1004889752 195
326 3300005356 Ga0070674_100031861 Ga0070674_1000318612 195
327 3300005356 Ga0070674_100481091 Ga0070674_1004810912 195
328 3300005356 Ga0070674_101162445 Ga0070674_1011624451 195
329 3300005364 Ga0070673_100871895 Ga0070673_1008718952 195
330 3300005365 Ga0070688_100257611 Ga0070688_1002576112 195
331 3300005366 Ga0070659_100000037 Ga0070659_100000037119 195
332 3300005366 Ga0070659_100002687 Ga0070659_10000268715 195
333 3300005366 Ga0070659_100476154 Ga0070659_1004761542 195
334 3300005366 Ga0070659_100757011 Ga0070659_1007570112 195
335 3300005367 Ga0070667_100042334 Ga0070667_1000423342 195
336 3300005435 Ga0070714_100000860 Ga0070714_1000008608 195
337 3300005435 Ga0070714_100021490 Ga0070714_1000214904 195
338 3300005435 Ga0070714_100069618 Ga0070714_1000696183 195
339 3300005436 Ga0070713_100324287 Ga0070713_1003242872 195
340 3300005437 Ga0070710_10000050 Ga0070710_1000005059 195
341 3300005437 Ga0070710_10097718 Ga0070710_100977181 195
342 3300005437 Ga0070710_10201511 Ga0070710_102015112 195
343 3300005438 Ga0070701_10192589 Ga0070701_101925892 195
344 3300005439 Ga0070711_100001237 Ga0070711_10000123712 195
345 3300005440 Ga0070705_100005024 Ga0070705_1000050245 195
346 3300005441 Ga0070700_100029613 Ga0070700_1000296133 195
347 3300005441 Ga0070700_100034667 Ga0070700_1000346672 195
348 3300005441 Ga0070700_100188362 Ga0070700_1001883622 195
349 3300005441 Ga0070700_100307524 Ga0070700_1003075242 195
350 3300005444 Ga0070694_100314453 Ga0070694_1003144532 195
351 3300005445 Ga0070708_100428217 Ga0070708_1004282172 195
352 3300005455 Ga0070663_100009051 Ga0070663_1000090514 195
353 3300005456 Ga0070678_100025608 Ga0070678_1000256086 195
354 3300005456 Ga0070678_100284954 Ga0070678_1002849542 195
355 3300005457 Ga0070662_100001035 Ga0070662_1000010355 195
356 3300005457 Ga0070662_100294176 Ga0070662_1002941762 195
357 3300005457 Ga0070662_100441662 Ga0070662_1004416622 195
358 3300005458 Ga0070681_10003066 Ga0070681_1000306618 195
359 3300005458 Ga0070681_10303916 Ga0070681_103039162 195
360 3300005466 Ga0070685_10031977 Ga0070685_100319772 195
361 3300005466 Ga0070685_10663639 Ga0070685_106636391 195
362 3300005530 Ga0070679_100035983 Ga0070679_1000359833 195
363 3300005530 Ga0070679_100043251 Ga0070679_1000432513 195
364 3300005530 Ga0070679_100070872 Ga0070679_1000708722 195
365 3300005530 Ga0070679_100436883 Ga0070679_1004368832 195
366 3300005535 Ga0070684_100035155 Ga0070684_1000351553 195
367 3300005535 Ga0070684_100035948 Ga0070684_1000359484 195
368 3300005535 Ga0070684_100216967 Ga0070684_1002169672 195
369 3300005536 Ga0070697_100407681 Ga0070697_1004076812 195
370 3300005536 Ga0070697_100509609 Ga0070697_1005096092 195
371 3300005539 Ga0068853_100390091 Ga0068853_1003900912 195
372 3300005544 Ga0070686_100224047 Ga0070686_1002240472 195
373 3300005545 Ga0070695_100191180 Ga0070695_1001911802 195
374 3300005546 Ga0070696_100021133 Ga0070696_1000211331 195
375 3300005546 Ga0070696_100407601 Ga0070696_1004076012 195
376 3300005548 Ga0070665_100036567 Ga0070665_1000365674 195
377 3300005548 Ga0070665_100075544 Ga0070665_1000755443 195
378 3300005548 Ga0070665_100485083 Ga0070665_1004850832 195
379 3300005548 Ga0070665_100515985 Ga0070665_1005159852 195
380 3300005548 Ga0070665_100600571 Ga0070665_1006005712 195
381 3300005549 Ga0070704_100223325 Ga0070704_1002233252 195
382 3300005563 Ga0068855_100452939 Ga0068855_1004529391 195
383 3300005564 Ga0070664_100012431 Ga0070664_1000124317 195
384 3300005564 Ga0070664_100076082 Ga0070664_1000760822 195
385 3300005564 Ga0070664_100153674 Ga0070664_1001536743 195
386 3300005577 Ga0068857_100317982 Ga0068857_1003179822 195
387 3300005578 Ga0068854_100075637 Ga0068854_1000756372 195
388 3300005578 Ga0068854_100131953 Ga0068854_1001319532 195
389 3300005578 Ga0068854_100882361 Ga0068854_1008823612 195
390 3300005614 Ga0068856_100002016 Ga0068856_10000201625 195
391 3300005614 Ga0068856_100114684 Ga0068856_1001146842 195
392 3300005616 Ga0068852_100805384 Ga0068852_1008053841 195
393 3300005617 Ga0068859_100050092 Ga0068859_1000500925 195
394 3300005719 Ga0068861_100008771 Ga0068861_1000087714 195
395 3300005719 Ga0068861_100049050 Ga0068861_1000490503 195
396 3300005840 Ga0068870_10031616 Ga0068870_100316164 195
397 3300005841 Ga0068863_100324115 Ga0068863_1003241152 195
398 3300005842 Ga0068858_100211186 Ga0068858_1002111862 195
399 3300005844 Ga0068862_100042359 Ga0068862_1000423594 195
400 3300005937 Ga0081455_10325138 Ga0081455_103251382 195
401 3300005981 Ga0081538_10000766 Ga0081538_1000076618 195
402 3300005981 Ga0081538_10001436 Ga0081538_1000143614 195
403 3300005981 Ga0081538_10002073 Ga0081538_100020735 195
404 3300005981 Ga0081538_10002254 Ga0081538_1000225413 195
405 3300005981 Ga0081538_10042073 Ga0081538_100420733 195
406 3300005981 Ga0081538_10050518 Ga0081538_100505182 195
407 3300005981 Ga0081538_10066379 Ga0081538_100663793 195
408 3300005985 Ga0081539_10011326 Ga0081539_100113265 195
409 3300005985 Ga0081539_10012198 Ga0081539_100121987 195
410 3300006028 Ga0070717_10000019 Ga0070717_10000019174 195
411 3300006028 Ga0070717_10036330 Ga0070717_100363302 195
412 3300006048 Ga0075363_100047743 Ga0075363_1000477433 195
413 3300006048 Ga0075363_100210420 Ga0075363_1002104202 195
414 3300006173 Ga0070716_100333012 Ga0070716_1003330122 195
415 3300006175 Ga0070712_100000004 Ga0070712_100000004210 195
416 3300006175 Ga0070712_100073145 Ga0070712_1000731454 195
417 3300006175 Ga0070712_100545950 Ga0070712_1005459501 195
418 3300006358 Ga0068871_100396671 Ga0068871_1003966712 195
419 3300006844 Ga0075428_100172045 Ga0075428_1001720452 195
420 3300006844 Ga0075428_100281113 Ga0075428_1002811132 195
421 3300006844 Ga0075428_100407972 Ga0075428_1004079722 195
422 3300006846 Ga0075430_100159561 Ga0075430_1001595613 195
423 3300006847 Ga0075431_100102356 Ga0075431_1001023564 195
424 3300006847 Ga0075431_100244726 Ga0075431_1002447262 195
425 3300006852 Ga0075433_10069242 Ga0075433_100692423 195
426 3300006871 Ga0075434_100074065 Ga0075434_1000740654 195
427 3300006871 Ga0075434_100434120 Ga0075434_1004341202 195
428 3300006880 Ga0075429_100031400 Ga0075429_1000314003 195
429 3300006880 Ga0075429_100090493 Ga0075429_1000904932 195
430 3300006880 Ga0075429_100260198 Ga0075429_1002601982 195
431 3300006881 Ga0068865_100081249 Ga0068865_1000812492 195
432 3300006914 Ga0075436_100069538 Ga0075436_1000695383 195
433 3300006931 Ga0097620_100050092 Ga0097620_1000500922 195
434 3300007076 Ga0075435_100012265 Ga0075435_1000122657 195
435 3300009093 Ga0105240_10370303 Ga0105240_103703033 195
436 3300009093 Ga0105240_10596443 Ga0105240_105964432 195
437 3300009094 Ga0111539_10004783 Ga0111539_1000478319 195
438 3300009094 Ga0111539_10012635 Ga0111539_1001263510 195
439 3300009094 Ga0111539_10039470 Ga0111539_100394705 195
440 3300009094 Ga0111539_10050074 Ga0111539_100500745 195
441 3300009094 Ga0111539_10129885 Ga0111539_101298853 195
442 3300009094 Ga0111539_10641360 Ga0111539_106413601 195
443 3300009094 Ga0111539_11452804 Ga0111539_114528042 195
444 3300009098 Ga0105245_10003314 Ga0105245_100033142 195
445 3300009098 Ga0105245_10014806 Ga0105245_100148065 195
446 3300009098 Ga0105245_10358819 Ga0105245_103588192 195
447 3300009098 Ga0105245_10971783 Ga0105245_109717832 195
448 3300009101 Ga0105247_10047392 Ga0105247_100473923 195
449 3300009101 Ga0105247_10625075 Ga0105247_106250751 195
450 3300009147 Ga0114129_10019151 Ga0114129_100191518 195
451 3300009147 Ga0114129_10059944 Ga0114129_100599444 195
452 3300009147 Ga0114129_10183598 Ga0114129_101835984 195
453 3300009147 Ga0114129_10195494 Ga0114129_101954944 195
454 3300009147 Ga0114129_11136682 Ga0114129_111366822 195
455 3300009148 Ga0105243_10079736 Ga0105243_100797362 195
456 3300009148 Ga0105243_10576404 Ga0105243_105764042 195
457 3300009148 Ga0105243_11187265 Ga0105243_111872651 195
458 3300009176 Ga0105242_10358859 Ga0105242_103588592 195
459 3300009176 Ga0105242_10409502 Ga0105242_104095022 195
460 3300009177 Ga0105248_10141614 Ga0105248_101416141 195
461 3300009177 Ga0105248_10312768 Ga0105248_103127682 195
462 3300009545 Ga0105237_10009091 Ga0105237_100090915 195
463 3300009545 Ga0105237_10207990 Ga0105237_102079902 195
464 3300009545 Ga0105237_10338998 Ga0105237_103389983 195
465 3300009545 Ga0105237_10486205 Ga0105237_104862052 195
466 3300009551 Ga0105238_10032231 Ga0105238_100322316 195
467 3300009553 Ga0105249_10018376 Ga0105249_100183764 195
468 3300009553 Ga0105249_10332398 Ga0105249_103323983 195
469 3300010375 Ga0105239_10019100 Ga0105239_100191007 195
470 3300010375 Ga0105239_10164107 Ga0105239_101641072 195
471 3300010375 Ga0105239_10217741 Ga0105239_102177412 195
472 3300010375 Ga0105239_10315601 Ga0105239_103156012 195
473 3300013102 Ga0157371_10230312 Ga0157371_102303122 195
474 3300013104 Ga0157370_10327615 Ga0157370_103276152 195
475 3300013105 Ga0157369_10390815 Ga0157369_103908152 195
476 3300013105 Ga0157369_10677369 Ga0157369_106773692 195
477 3300013105 Ga0157369_11298606 Ga0157369_112986061 195
478 3300013296 Ga0157374_10470627 Ga0157374_104706272 195
479 3300013306 Ga0163162_10027306 Ga0163162_100273065 195
480 3300013306 Ga0163162_10137792 Ga0163162_101377923 195
481 3300013306 Ga0163162_10603452 Ga0163162_106034522 195
482 3300013307 Ga0157372_10006642 Ga0157372_100066425 195
483 3300013307 Ga0157372_10023168 Ga0157372_100231687 195
484 3300013307 Ga0157372_10183403 Ga0157372_101834033 195
485 3300013307 Ga0157372_10411817 Ga0157372_104118172 195
486 3300013308 Ga0157375_10085478 Ga0157375_100854783 195
487 3300013308 Ga0157375_10673008 Ga0157375_106730081 195
488 3300013308 Ga0157375_11016385 Ga0157375_110163852 195
489 3300013308 Ga0157375_11683226 Ga0157375_116832261 195
490 3300014325 Ga0163163_10314158 Ga0163163_103141582 195
491 3300014325 Ga0163163_10484790 Ga0163163_104847902 195
492 3300014325 Ga0163163_11856857 Ga0163163_118568571 195
493 3300014326 Ga0157380_11273185 Ga0157380_112731851 195
494 3300014745 Ga0157377_10011697 Ga0157377_100116972 195
495 3300014745 Ga0157377_10086770 Ga0157377_100867704 195
496 3300014968 Ga0157379_10148164 Ga0157379_101481642 195
497 3300014969 Ga0157376_10028909 Ga0157376_100289092 195
498 3300014969 Ga0157376_10928289 Ga0157376_109282892 195
499 3300017792 Ga0163161_10085718 Ga0163161_100857183 195
500 3300020081 Ga0206354_10513831 Ga0206354_105138313 195
501 3300020082 Ga0206353_10159166 Ga0206353_101591662 195
502 3300021358 Ga0213873_10054893 Ga0213873_100548931 195
503 3300021388 Ga0213875_10032735 Ga0213875_100327352 195
504 3300022467 Ga0224712_10103572 Ga0224712_101035722 195
505 3300025321 Ga0207656_10193740 Ga0207656_101937402 195
506 3300025898 Ga0207692_10000022 Ga0207692_1000002210 195
507 3300025898 Ga0207692_10152908 Ga0207692_101529082 195
508 3300025901 Ga0207688_10000813 Ga0207688_1000081318 195
509 3300025901 Ga0207688_10034319 Ga0207688_100343193 195
510 3300025901 Ga0207688_10039540 Ga0207688_100395401 195
511 3300025901 Ga0207688_10064925 Ga0207688_100649253 195
512 3300025903 Ga0207680_10323462 Ga0207680_103234622 195
513 3300025908 Ga0207643_10575587 Ga0207643_105755871 195
514 3300025913 Ga0207695_10139811 Ga0207695_101398112 195
515 3300025913 Ga0207695_10513266 Ga0207695_105132662 195
516 3300025913 Ga0207695_10551251 Ga0207695_105512512 195
517 3300025913 Ga0207695_10657218 Ga0207695_106572182 195
518 3300025914 Ga0207671_10001526 Ga0207671_1000152621 195
519 3300025915 Ga0207693_10000017 Ga0207693_100000179 195
520 3300025915 Ga0207693_10049193 Ga0207693_100491934 195
521 3300025915 Ga0207693_10710466 Ga0207693_107104662 195
522 3300025916 Ga0207663_10002190 Ga0207663_100021905 195
523 3300025916 Ga0207663_10055324 Ga0207663_100553243 195
524 3300025917 Ga0207660_10006020 Ga0207660_100060208 195
525 3300025918 Ga0207662_10077621 Ga0207662_100776212 195
526 3300025919 Ga0207657_10006359 Ga0207657_1000635917 195
527 3300025919 Ga0207657_10057000 Ga0207657_100570004 195
528 3300025919 Ga0207657_10417286 Ga0207657_104172862 195
529 3300025920 Ga0207649_10176847 Ga0207649_101768471 195
530 3300025920 Ga0207649_10327925 Ga0207649_103279252 195
531 3300025921 Ga0207652_10008802 Ga0207652_100088024 195
532 3300025921 Ga0207652_10094266 Ga0207652_100942664 195
533 3300025921 Ga0207652_10127154 Ga0207652_101271543 195
534 3300025921 Ga0207652_10812437 Ga0207652_108124372 195
535 3300025923 Ga0207681_10016814 Ga0207681_100168144 195
536 3300025923 Ga0207681_10152625 Ga0207681_101526252 195
537 3300025924 Ga0207694_10247360 Ga0207694_102473602 195
538 3300025925 Ga0207650_10698466 Ga0207650_106984662 195
539 3300025926 Ga0207659_10372296 Ga0207659_103722961 195
540 3300025927 Ga0207687_10039782 Ga0207687_100397823 195
541 3300025927 Ga0207687_10324237 Ga0207687_103242372 195
542 3300025928 Ga0207700_10371009 Ga0207700_103710092 195
543 3300025928 Ga0207700_10462839 Ga0207700_104628392 195
544 3300025929 Ga0207664_10000004 Ga0207664_10000004497 195
545 3300025931 Ga0207644_10041237 Ga0207644_100412372 195
546 3300025931 Ga0207644_10359468 Ga0207644_103594682 195
547 3300025932 Ga0207690_10000268 Ga0207690_1000026834 195
548 3300025932 Ga0207690_10098395 Ga0207690_100983952 195
549 3300025932 Ga0207690_10141496 Ga0207690_101414962 195
550 3300025932 Ga0207690_10151916 Ga0207690_101519162 195
551 3300025933 Ga0207706_10003294 Ga0207706_1000329420 195
552 3300025933 Ga0207706_10401597 Ga0207706_104015972 195
553 3300025934 Ga0207686_10237332 Ga0207686_102373322 195
554 3300025937 Ga0207669_10164059 Ga0207669_101640592 195
555 3300025937 Ga0207669_10204345 Ga0207669_102043452 195
556 3300025937 Ga0207669_10315406 Ga0207669_103154062 195
557 3300025937 Ga0207669_10520656 Ga0207669_105206562 195
558 3300025938 Ga0207704_10034396 Ga0207704_100343963 195
559 3300025938 Ga0207704_10242885 Ga0207704_102428852 195
560 3300025940 Ga0207691_10078503 Ga0207691_100785031 195
561 3300025941 Ga0207711_10210392 Ga0207711_102103923 195
562 3300025942 Ga0207689_10041401 Ga0207689_100414013 195
563 3300025942 Ga0207689_10254294 Ga0207689_102542942 195
564 3300025944 Ga0207661_10028815 Ga0207661_100288154 195
565 3300025944 Ga0207661_10131491 Ga0207661_101314913 195
566 3300025944 Ga0207661_10248948 Ga0207661_102489482 195
567 3300025944 Ga0207661_10915826 Ga0207661_109158261 195
568 3300025945 Ga0207679_10023802 Ga0207679_100238022 195
569 3300025945 Ga0207679_10074750 Ga0207679_100747502 195
570 3300025945 Ga0207679_10120470 Ga0207679_101204702 195
571 3300025960 Ga0207651_10687143 Ga0207651_106871432 195
572 3300025961 Ga0207712_10008255 Ga0207712_100082552 195
573 3300025961 Ga0207712_10157106 Ga0207712_101571062 195
574 3300025972 Ga0207668_10089592 Ga0207668_100895923 195
575 3300025981 Ga0207640_10102975 Ga0207640_101029753 195
576 3300025981 Ga0207640_10460067 Ga0207640_104600672 195
577 3300025986 Ga0207658_10029416 Ga0207658_100294162 195
578 3300026023 Ga0207677_10138916 Ga0207677_101389162 195
579 3300026023 Ga0207677_10240977 Ga0207677_102409772 195
580 3300026023 Ga0207677_10369646 Ga0207677_103696462 195
581 3300026023 Ga0207677_10756946 Ga0207677_107569461 195
582 3300026041 Ga0207639_10079844 Ga0207639_100798442 195
583 3300026067 Ga0207678_10009806 Ga0207678_100098064 195
584 3300026067 Ga0207678_10058133 Ga0207678_100581332 195
585 3300026067 Ga0207678_10219814 Ga0207678_102198142 195
586 3300026075 Ga0207708_10000937 Ga0207708_100009375 195
587 3300026075 Ga0207708_10005784 Ga0207708_100057846 195
588 3300026075 Ga0207708_10011942 Ga0207708_100119429 195
589 3300026075 Ga0207708_10035246 Ga0207708_100352462 195
590 3300026078 Ga0207702_10144487 Ga0207702_101444872 195
591 3300026088 Ga0207641_10054928 Ga0207641_100549284 195
592 3300026088 Ga0207641_10505971 Ga0207641_105059712 195
593 3300026089 Ga0207648_10204819 Ga0207648_102048192 195
594 3300026089 Ga0207648_10385306 Ga0207648_103853062 195
595 3300026095 Ga0207676_10062035 Ga0207676_100620352 195
596 3300026116 Ga0207674_10152988 Ga0207674_101529882 195
597 3300026118 Ga0207675_100004816 Ga0207675_1000048168 195
598 3300026118 Ga0207675_100033107 Ga0207675_1000331073 195
599 3300026118 Ga0207675_100101877 Ga0207675_1001018773 195
600 3300026118 Ga0207675_100733035 Ga0207675_1007330351 195
601 3300026121 Ga0207683_10084011 Ga0207683_100840112 195
602 3300026121 Ga0207683_11173117 Ga0207683_111731172 195
603 3300026142 Ga0207698_10243788 Ga0207698_102437881 195
604 3300027907 Ga0207428_10055052 Ga0207428_100550522 195
605 3300027907 Ga0207428_10201634 Ga0207428_102016342 195
606 3300027907 Ga0207428_10273695 Ga0207428_102736952 195
607 3300028379 Ga0268266_10010879 Ga0268266_100108793 195
608 3300028379 Ga0268266_10366927 Ga0268266_103669272 195
609 3300028381 Ga0268264_10563193 Ga0268264_105631932 195
610 3300028556 Ga0265337_1079678 Ga0265337_10796782 195
611 3300028558 Ga0265326_10000630 Ga0265326_1000063010 195
612 3300028563 Ga0265319_1001381 Ga0265319_10013815 195
613 3300028563 Ga0265319_1009072 Ga0265319_10090722 195
614 3300028573 Ga0265334_10000002 Ga0265334_1000000211 195
615 3300028577 Ga0265318_10005786 Ga0265318_100057865 195
616 3300028577 Ga0265318_10047329 Ga0265318_100473292 195
617 3300028577 Ga0265318_10075213 Ga0265318_100752132 195
618 3300028653 Ga0265323_10120796 Ga0265323_101207962 195
619 3300028666 Ga0265336_10002183 Ga0265336_100021836 195
620 3300028800 Ga0265338_10024856 Ga0265338_100248565 195
621 3300028800 Ga0265338_10147335 Ga0265338_101473352 195
622 3300028800 Ga0265338_10386672 Ga0265338_103866722 195
623 3300031240 Ga0265320_10008105 Ga0265320_100081055 195
624 3300031240 Ga0265320_10047466 Ga0265320_100474662 195
625 3300031251 Ga0265327_10121611 Ga0265327_101216112 195
626 3300031251 Ga0265327_10211865 Ga0265327_102118652 195
627 3300031548 Ga0307408_100149363 Ga0307408_1001493632 195
628 3300031548 Ga0307408_100270750 Ga0307408_1002707502 195
629 3300031548 Ga0307408_100272361 Ga0307408_1002723612 195
630 3300031711 Ga0265314_10273943 Ga0265314_102739432 195
631 3300031731 Ga0307405_10047556 Ga0307405_100475562 195
632 3300031731 Ga0307405_10071547 Ga0307405_100715473 195
633 3300031731 Ga0307405_10158330 Ga0307405_101583302 195
634 3300031824 Ga0307413_10067704 Ga0307413_100677043 195
635 3300031824 Ga0307413_10084903 Ga0307413_100849032 195
636 3300031824 Ga0307413_10961614 Ga0307413_109616141 195
637 3300031852 Ga0307410_10020116 Ga0307410_100201162 195
638 3300031852 Ga0307410_10035996 Ga0307410_100359962 195
639 3300031852 Ga0307410_10050510 Ga0307410_100505103 195
640 3300031852 Ga0307410_10853731 Ga0307410_108537312 195
641 3300031852 Ga0307410_10983725 Ga0307410_109837252 195
642 3300031889 Ga0326468_10011767 Ga0326468_100117672 195
643 3300031901 Ga0307406_10027100 Ga0307406_100271002 195
644 3300031901 Ga0307406_10131462 Ga0307406_101314623 195
645 3300031903 Ga0307407_10098143 Ga0307407_100981432 195
646 3300031903 Ga0307407_10358508 Ga0307407_103585082 195
647 3300031911 Ga0307412_10131209 Ga0307412_101312092 195
648 3300031995 Ga0307409_100011229 Ga0307409_1000112295 195
649 3300031995 Ga0307409_100017566 Ga0307409_1000175665 195
650 3300031995 Ga0307409_100056097 Ga0307409_1000560972 195
651 3300031995 Ga0307409_100066444 Ga0307409_1000664441 195
652 3300031995 Ga0307409_100091978 Ga0307409_1000919783 195
653 3300031995 Ga0307409_100182248 Ga0307409_1001822482 195
654 3300031995 Ga0307409_100357287 Ga0307409_1003572872 195
655 3300032002 Ga0307416_100028146 Ga0307416_1000281462 195
656 3300032002 Ga0307416_100060399 Ga0307416_1000603992 195
657 3300032002 Ga0307416_100240649 Ga0307416_1002406492 195
658 3300032002 Ga0307416_100309296 Ga0307416_1003092962 195
659 3300032002 Ga0307416_100348654 Ga0307416_1003486542 195
660 3300032002 Ga0307416_100379049 Ga0307416_1003790492 195
661 3300032002 Ga0307416_100401692 Ga0307416_1004016922 195
662 3300032002 Ga0307416_100982852 Ga0307416_1009828521 195
663 3300032002 Ga0307416_101021688 Ga0307416_1010216882 195
664 3300032002 Ga0307416_101285132 Ga0307416_1012851321 195
665 3300032004 Ga0307414_10100122 Ga0307414_101001223 195
666 3300032005 Ga0307411_10114352 Ga0307411_101143522 195
667 3300032005 Ga0307411_10445148 Ga0307411_104451482 195
668 3300032005 Ga0307411_10977401 Ga0307411_109774012 195
669 3300032126 Ga0307415_100003017 Ga0307415_1000030177 195
670 3300032126 Ga0307415_100069572 Ga0307415_1000695723 195
671 3300032126 Ga0307415_100132044 Ga0307415_1001320442 195
672 3300032126 Ga0307415_100133214 Ga0307415_1001332142 195
673 3300032126 Ga0307415_100218137 Ga0307415_1002181372 195
674 3300032126 Ga0307415_100363516 Ga0307415_1003635162 195
675 3300032126 Ga0307415_100514303 Ga0307415_1005143032 195
676 3300032126 Ga0307415_100794725 Ga0307415_1007947252 195
677 3300035121 Ga0373960_0042544 Ga0373960_0042544_269_856 195
678 3300035170 Ga0373943_0051887 Ga0373943_0051887_1316_1903 195
679 3300035241 Ga0373961_0085827 Ga0373961_0085827_267_863 195
680 3300035691 Ga0373931_0187096 Ga0373931_0187096_116_712 195
681 3300037068 Ga0373925_0517403 Ga0373925_0517403_253_840 195
682 3300037418 Ga0395900_1120423 Ga0395900_1120423_68_661 195
683 3300037466 Ga0395898_0047298 Ga0395898_0047298_2152_2745 195
684 3300037466 Ga0395898_0421362 Ga0395898_0421362_530_1120 195
685 3300037471 Ga0395905_0492484 Ga0395905_0492484_330_917 195
686 3300037853 Ga0436364_0069355 Ga0436364_0069355_208_798 195
687 3300037853 Ga0436364_0637349 Ga0436364_0637349_1575_2165 195
688 3300038443 Ga0395901_0026246 Ga0395901_0026246_56_649 195
689 3300038443 Ga0395901_0172676 Ga0395901_0172676_1063_1656 195
690 3300038443 Ga0395901_0285448 Ga0395901_0285448_366_959 195
691 3300038443 Ga0395901_0988665 Ga0395901_0988665_202_801 195
692 3300039437 Ga0436365_0367556 Ga0436365_0367556_1171_1761 195
693 3300039437 Ga0436365_0869569 Ga0436365_0869569_82_672 195
694 3300039437 Ga0436365_1517862 Ga0436365_1517862_2490_3092 195
695 3300039450 Ga0436363_0311232 Ga0436363_0311232_44_637 195
696 3300039453 Ga0436362_0383083 Ga0436362_0383083_50_652 195
697 3300039453 Ga0436362_0577753 Ga0436362_0577753_114_707 195
698 3300044656 Ga0466969_0030135 Ga0466969_0030135_565_1155 195
699 3300044684 Ga0466966_0040633 Ga0466966_0040633_1741_2334 195
700 3300044684 Ga0466966_0074139 Ga0466966_0074139_174_800 195
701 3300044684 Ga0466966_0378420 Ga0466966_0378420_177_767 195
702 3300044693 Ga0466961_0004147 Ga0466961_0004147_8134_8727 195
703 3300044693 Ga0466961_0103773 Ga0466961_0103773_455_1045 195
704 3300044694 Ga0466963_0016615 Ga0466963_0016615_441_1046 195
705 3300044694 Ga0466963_0251045 Ga0466963_0251045_29_625 195
706 3300044694 Ga0466963_0565513 Ga0466963_0565513_14_604 195
707 3300044694 Ga0466963_0627894 Ga0466963_0627894_151_741 195
708 3300044694 Ga0466963_0854409 Ga0466963_0854409_26_613 195
709 3300044706 Ga0466964_0091450 Ga0466964_0091450_657_1253 195
710 3300044706 Ga0466964_0214286 Ga0466964_0214286_167_757 195
711 3300044719 Ga0466971_0169199 Ga0466971_0169199_177_770 195
712 3300044735 Ga0466968_0023973 Ga0466968_0023973_1007_1600 195
713 3300044735 Ga0466968_0030132 Ga0466968_0030132_909_1499 195
714 3300044765 Ga0466970_0186309 Ga0466970_0186309_348_941 195
715 3300044842 Ga0466957_0005022 Ga0466957_0005022_1620_2210 195
716 3300044842 Ga0466957_0198208 Ga0466957_0198208_477_1082 195
717 3300044842 Ga0466957_0498444 Ga0466957_0498444_166_756 195
718 3300044842 Ga0466957_0539345 Ga0466957_0539345_74_709 195
719 3300044842 Ga0466957_0561600 Ga0466957_0561600_185_781 195
720 3300044901 Ga0466960_0025275 Ga0466960_0025275_1017_1610 195
721 3300044901 Ga0466960_0079028 Ga0466960_0079028_593_1186 195
722 3300044901 Ga0466960_0173092 Ga0466960_0173092_197_793 195
723 3300044901 Ga0466960_0245859 Ga0466960_0245859_170_763 195
724 3300045049 Ga0466959_0025843 Ga0466959_0025843_3275_3865 195
725 3300045049 Ga0466959_0029413 Ga0466959_0029413_3257_3850 195
726 3300045049 Ga0466959_0189196 Ga0466959_0189196_330_920 195
727 3300045836 Ga0466958_0008664 Ga0466958_0008664_3179_3769 195
728 3300045836 Ga0466958_0036525 Ga0466958_0036525_1256_1846 195
729 3300045836 Ga0466958_0052338 Ga0466958_0052338_826_1419 195
730 3300045836 Ga0466958_0137732 Ga0466958_0137732_909_1505 195
731 3300045976 Ga0466967_0005031 Ga0466967_0005031_7353_7952 195
732 3300045976 Ga0466967_0023219 Ga0466967_0023219_1787_2383 195
733 3300045976 Ga0466967_0027316 Ga0466967_0027316_820_1416 195
734 3300045976 Ga0466967_0132475 Ga0466967_0132475_1208_1807 195
735 3300045976 Ga0466967_0215269 Ga0466967_0215269_233_829 195
736 3300045976 Ga0466967_0225689 Ga0466967_0225689_489_1079 195
737 3300045976 Ga0466967_0297834 Ga0466967_0297834_652_1239 195
738 3300045976 Ga0466967_0523551 Ga0466967_0523551_495_1091 195
739 3300045976 Ga0466967_0572986 Ga0466967_0572986_462_1061 195
740 3300046455 Ga0495603_0144193 Ga0495603_0144193_133_726 195
741 3300046459 Ga0495629_0105003 Ga0495629_0105003_1198_1791 195
742 3300046459 Ga0495629_0411793 Ga0495629_0411793_19_627 195
743 3300046472 Ga0495580_0336198 Ga0495580_0336198_82_675 195
744 3300046473 Ga0495582_0257222 Ga0495582_0257222_123_716 195
745 3300046477 Ga0495664_0000012 Ga0495664_0000012_216072_216689 195
746 3300046477 Ga0495664_0288244 Ga0495664_0288244_14_604 195
747 3300046511 Ga0495608_0120798 Ga0495608_0120798_959_1621 195
748 3300046516 Ga0495628_0370922 Ga0495628_0370922_54_644 195
749 3300046517 Ga0495630_0011902 Ga0495630_0011902_1372_1965 195
750 3300046523 Ga0495644_0123461 Ga0495644_0123461_309_896 195
751 3300046529 Ga0495652_0053133 Ga0495652_0053133_2814_3440 195
752 3300046543 Ga0495645_0000012 Ga0495645_0000012_5973_6581 195
753 3300046559 Ga0495667_0348810 Ga0495667_0348810_52_645 195
754 3300046615 Ga0495656_0194779 Ga0495656_0194779_387_980 195
755 3300046675 Ga0495657_0000007 Ga0495657_0000007_173144_173737 195
756 3300046678 Ga0495599_0465602 Ga0495599_0465602_92_700 195
757 3300046809 Ga0495600_0028472 Ga0495600_0028472_1813_2475 195
758 3300047319 Ga0495674_0207925 Ga0495674_0207925_670_1263 195
759 3300047321 Ga0495676_0227660 Ga0495676_0227660_653_1243 195
760 3300047322 Ga0495680_0055337 Ga0495680_0055337_354_947 195
761 3300047471 Ga0495684_0036602 Ga0495684_0036602_1780_2373 195
762 3300048903 Ga0496100_0005686 Ga0496100_0005686_1157_1762 195
763 3300048903 Ga0496100_0011761 Ga0496100_0011761_874_1467 195
764 3300048903 Ga0496100_0061411 Ga0496100_0061411_109_702 195
765 3300048903 Ga0496100_0375744 Ga0496100_0375744_207_803 195
766 3300048903 Ga0496100_0669049 Ga0496100_0669049_191_787 195
767 3300048904 Ga0496101_0011694 Ga0496101_0011694_1360_1953 195
768 3300048904 Ga0496101_0243794 Ga0496101_0243794_264_857 195
769 3300048905 Ga0496102_0000027 Ga0496102_0000027_218515_219132 195
770 3300048905 Ga0496102_0001758 Ga0496102_0001758_10220_10813 195
771 3300048905 Ga0496102_0012087 Ga0496102_0012087_4077_4664 195
772 3300048905 Ga0496102_0081859 Ga0496102_0081859_330_926 195
773 3300048906 Ga0496103_0001348 Ga0496103_0001348_8492_9109 195
774 3300048906 Ga0496103_0009119 Ga0496103_0009119_1166_1762 195
775 3300048906 Ga0496103_0086878 Ga0496103_0086878_402_998 195
776 3300048907 Ga0496104_0003438 Ga0496104_0003438_6026_6619 195
777 3300048907 Ga0496104_0015713 Ga0496104_0015713_1215_1811 195
778 3300048907 Ga0496104_0065216 Ga0496104_0065216_41_628 195
779 3300048907 Ga0496104_0194632 Ga0496104_0194632_294_887 195
780 3300048907 Ga0496104_0450871 Ga0496104_0450871_449_1042 195
781 3300048908 Ga0496105_0023481 Ga0496105_0023481_2915_3508 195
782 3300048908 Ga0496105_0092970 Ga0496105_0092970_900_1487 195
783 3300048908 Ga0496105_0170169 Ga0496105_0170169_1158_1754 195
784 3300048908 Ga0496105_0348997 Ga0496105_0348997_313_909 195
785 3300048908 Ga0496105_0463918 Ga0496105_0463918_383_988 195
786 3300048909 Ga0496106_0044920 Ga0496106_0044920_719_1312 195
787 3300048909 Ga0496106_0065354 Ga0496106_0065354_1584_2171 195
788 3300048910 Ga0496107_0009275 Ga0496107_0009275_4552_5139 195
789 3300048910 Ga0496107_0239060 Ga0496107_0239060_10_606 195
790 3300048911 Ga0496108_0006662 Ga0496108_0006662_4112_4699 195
791 3300048911 Ga0496108_0042757 Ga0496108_0042757_253_846 195
792 3300048911 Ga0496108_0161303 Ga0496108_0161303_495_1088 195
793 3300048911 Ga0496108_0429061 Ga0496108_0429061_163_759 195
794 3300048912 Ga0496109_0023996 Ga0496109_0023996_1276_1863 195
795 3300048912 Ga0496109_0111247 Ga0496109_0111247_503_1096 195
796 3300048912 Ga0496109_0187399 Ga0496109_0187399_773_1366 195
797 3300048912 Ga0496109_0451959 Ga0496109_0451959_553_1146 195
798 3300048912 Ga0496109_0594754 Ga0496109_0594754_231_824 195
799 3300048913 Ga0496110_0003019 Ga0496110_0003019_3899_4486 195
800 3300048913 Ga0496110_0062723 Ga0496110_0062723_2089_2682 195
801 3300048913 Ga0496110_0808958 Ga0496110_0808958_108_704 195
802 3300048913 Ga0496110_0954202 Ga0496110_0954202_93_686 195
803 3300048914 Ga0496111_0001332 Ga0496111_0001332_2558_3145 195
804 3300048914 Ga0496111_0011253 Ga0496111_0011253_2874_3467 195
805 3300048914 Ga0496111_0032700 Ga0496111_0032700_332_928 195
806 3300048914 Ga0496111_0066011 Ga0496111_0066011_1366_1959 195
807 3300048915 Ga0496112_0000200 Ga0496112_0000200_5960_6553 195
808 3300048915 Ga0496112_0025245 Ga0496112_0025245_84_677 195
809 3300048915 Ga0496112_0045162 Ga0496112_0045162_353_946 195
810 3300048915 Ga0496112_0124638 Ga0496112_0124638_571_1158 195
811 3300048915 Ga0496112_0180021 Ga0496112_0180021_402_992 195
812 3300048915 Ga0496112_0511496 Ga0496112_0511496_434_1027 195
813 3300048915 Ga0496112_0554970 Ga0496112_0554970_386_982 195
814 3300048915 Ga0496112_0617699 Ga0496112_0617699_193_783 195
815 3300048915 Ga0496112_0821146 Ga0496112_0821146_132_728 195
816 3300048916 Ga0496113_0009548 Ga0496113_0009548_1760_2347 195
817 3300048916 Ga0496113_0090241 Ga0496113_0090241_170_763 195
818 3300048916 Ga0496113_0118977 Ga0496113_0118977_164_757 195
819 3300048917 Ga0496114_0467708 Ga0496114_0467708_79_666 195
820 3300048917 Ga0496114_0640806 Ga0496114_0640806_243_836 195
821 3300048917 Ga0496114_0733901 Ga0496114_0733901_123_716 195
822 3300048918 Ga0496115_0055013 Ga0496115_0055013_737_1333 195
823 3300048918 Ga0496115_0411658 Ga0496115_0411658_171_764 195
824 3300048918 Ga0496115_0468815 Ga0496115_0468815_336_929 195
825 3300048919 Ga0496116_0000176 Ga0496116_0000176_85367_85963 195
826 3300048920 Ga0496117_0012250 Ga0496117_0012250_5608_6204 195
827 3300048921 Ga0496118_0005822 Ga0496118_0005822_7622_8218 195
828 3300048921 Ga0496118_0189826 Ga0496118_0189826_253_849 195
829 3300048922 Ga0496119_0022041 Ga0496119_0022041_1301_1897 195
830 3300048922 Ga0496119_0045653 Ga0496119_0045653_131_727 195
831 3300048923 Ga0496120_0008785 Ga0496120_0008785_4992_5588 195
832 3300048924 Ga0496121_0128403 Ga0496121_0128403_555_1151 195
833 3300048924 Ga0496121_0193951 Ga0496121_0193951_277_873 195
834 3300048927 Ga0496124_0017107 Ga0496124_0017107_5255_5851 195
835 3300048929 Ga0496126_0373062 Ga0496126_0373062_325_921 195
836 3300049514 Ga0501291_059373 Ga0501291_059373_37_630 195
837 3300049568 Ga0501031_0004602 Ga0501031_0004602_534_1130 195
838 3300049568 Ga0501031_0019873 Ga0501031_0019873_1356_1943 195
839 3300049568 Ga0501031_0087685 Ga0501031_0087685_1002_1598 195
840 3300049569 Ga0501032_0002323 Ga0501032_0002323_7783_8379 195
841 3300049569 Ga0501032_0005183 Ga0501032_0005183_7254_7841 195
842 3300049570 Ga0501033_0001255 Ga0501033_0001255_14331_14927 195
843 3300049570 Ga0501033_0028212 Ga0501033_0028212_1117_1704 195
844 3300049571 Ga0501034_0016423 Ga0501034_0016423_953_1549 195
845 3300049571 Ga0501034_0367342 Ga0501034_0367342_230_832 195
846 3300049571 Ga0501034_0710376 Ga0501034_0710376_260_847 195
847 3300049572 Ga0501036_0004619 Ga0501036_0004619_2723_3319 195
848 3300049572 Ga0501036_0161191 Ga0501036_0161191_1094_1690 195
849 3300049572 Ga0501036_0178674 Ga0501036_0178674_1108_1695 195
850 3300049572 Ga0501036_0507748 Ga0501036_0507748_284_886 195
851 3300049572 Ga0501036_0621470 Ga0501036_0621470_133_729 195
852 3300049573 Ga0501037_0002105 Ga0501037_0002105_7820_8416 195
853 3300049573 Ga0501037_0084212 Ga0501037_0084212_910_1506 195
854 3300049574 Ga0501038_0003549 Ga0501038_0003549_7721_8317 195
855 3300049574 Ga0501038_0028808 Ga0501038_0028808_974_1561 195
856 3300049574 Ga0501038_0339781 Ga0501038_0339781_428_1015 195
857 3300049575 Ga0501039_0015041 Ga0501039_0015041_4147_4743 195
858 3300049575 Ga0501039_0016303 Ga0501039_0016303_873_1469 195
859 3300049575 Ga0501039_0051757 Ga0501039_0051757_2072_2659 195
860 3300049575 Ga0501039_0777105 Ga0501039_0777105_80_667 195
861 3300049576 Ga0501040_0046498 Ga0501040_0046498_1329_1916 195
862 3300049577 Ga0501041_0073997 Ga0501041_0073997_408_1004 195
863 3300049577 Ga0501041_0108610 Ga0501041_0108610_372_959 195
864 3300049578 Ga0501042_0065224 Ga0501042_0065224_1067_1663 195
865 3300049578 Ga0501042_0092955 Ga0501042_0092955_1359_1955 195
866 3300049578 Ga0501042_0103883 Ga0501042_0103883_407_994 195
867 3300049578 Ga0501042_0250936 Ga0501042_0250936_380_967 195
868 3300049579 Ga0501043_0002925 Ga0501043_0002925_7742_8338 195
869 3300049579 Ga0501043_0081375 Ga0501043_0081375_1622_2209 195
870 3300049579 Ga0501043_0428448 Ga0501043_0428448_249_845 195
871 3300049580 Ga0501046_0003552 Ga0501046_0003552_5921_6517 195
872 3300049580 Ga0501046_0009834 Ga0501046_0009834_4290_4877 195
873 3300049580 Ga0501046_0100685 Ga0501046_0100685_1466_2062 195
874 3300049580 Ga0501046_0483342 Ga0501046_0483342_241_837 195
875 3300049581 Ga0501047_0002361 Ga0501047_0002361_11402_11998 195
876 3300049581 Ga0501047_0057684 Ga0501047_0057684_2873_3460 195
877 3300049581 Ga0501047_0061159 Ga0501047_0061159_1690_2286 195
878 3300049581 Ga0501047_0119545 Ga0501047_0119545_783_1379 195
879 3300049581 Ga0501047_0134553 Ga0501047_0134553_113_709 195
880 3300049582 Ga0501048_0002577 Ga0501048_0002577_5495_6091 195
881 3300049582 Ga0501048_0198898 Ga0501048_0198898_740_1336 195
882 3300049582 Ga0501048_0290307 Ga0501048_0290307_250_846 195
883 3300049583 Ga0501067_0003591 Ga0501067_0003591_5397_5984 195
884 3300049584 Ga0501068_0009293 Ga0501068_0009293_199_795 195
885 3300049584 Ga0501068_0031540 Ga0501068_0031540_407_994 195
886 3300049585 Ga0501069_0003034 Ga0501069_0003034_3254_3850 195
887 3300049585 Ga0501069_0079700 Ga0501069_0079700_853_1449 195
888 3300049586 Ga0501070_0000832 Ga0501070_0000832_19727_20323 195
889 3300049586 Ga0501070_0009212 Ga0501070_0009212_6263_6859 195
890 3300049587 Ga0501071_0053674 Ga0501071_0053674_1020_1616 195
891 3300049587 Ga0501071_0076231 Ga0501071_0076231_922_1509 195
892 3300049588 Ga0501072_0007453 Ga0501072_0007453_5488_6084 195
893 3300049588 Ga0501072_0016434 Ga0501072_0016434_2686_3282 195
894 3300049588 Ga0501072_0247865 Ga0501072_0247865_377_973 195
895 3300049589 Ga0501073_0007834 Ga0501073_0007834_5921_6517 195
896 3300049589 Ga0501073_0009603 Ga0501073_0009603_4385_4972 195
897 3300049590 Ga0501074_0007166 Ga0501074_0007166_4560_5156 195
898 3300049590 Ga0501074_0035154 Ga0501074_0035154_1962_2549 195
899 3300049590 Ga0501074_0083958 Ga0501074_0083958_1552_2148 195
900 3300049590 Ga0501074_0295117 Ga0501074_0295117_469_1056 195
901 3300049590 Ga0501074_0376689 Ga0501074_0376689_245_841 195
902 3300049591 Ga0501075_0148563 Ga0501075_0148563_992_1588 195
903 3300049592 Ga0501076_0056905 Ga0501076_0056905_2078_2665 195
904 3300049592 Ga0501076_0100517 Ga0501076_0100517_1009_1605 195
905 3300049592 Ga0501076_0309229 Ga0501076_0309229_656_1252 195
906 3300049592 Ga0501076_0341570 Ga0501076_0341570_216_803 195
907 3300049741 Ga0501079_0009011 Ga0501079_0009011_1164_1760 195
908 3300049741 Ga0501079_0039174 Ga0501079_0039174_1908_2495 195
909 3300049741 Ga0501079_0176701 Ga0501079_0176701_764_1351 195
910 3300049742 Ga0501080_0007024 Ga0501080_0007024_7764_8360 195
911 3300049742 Ga0501080_0042368 Ga0501080_0042368_1769_2356 195
912 3300049742 Ga0501080_0267252 Ga0501080_0267252_58_648 195
913 3300049742 Ga0501080_1049355 Ga0501080_1049355_69_665 195
914 3300049743 Ga0501081_0058683 Ga0501081_0058683_1929_2516 195
915 3300049744 Ga0501083_0002406 Ga0501083_0002406_5258_5854 195
916 3300049744 Ga0501083_0038323 Ga0501083_0038323_464_1051 195
917 3300049744 Ga0501083_0114676 Ga0501083_0114676_1132_1728 195
918 3300049822 Ga0501035_0004128 Ga0501035_0004128_7786_8382 195
919 3300049822 Ga0501035_0022019 Ga0501035_0022019_2874_3461 195
920 3300049822 Ga0501035_0259373 Ga0501035_0259373_281_868 195
921 3300049823 Ga0501044_0000684 Ga0501044_0000684_33931_34527 195
922 3300049823 Ga0501044_0064508 Ga0501044_0064508_521_1117 195
923 3300049824 Ga0501045_0053737 Ga0501045_0053737_571_1167 195
924 3300049824 Ga0501045_0094821 Ga0501045_0094821_1247_1834 195
925 3300049824 Ga0501045_0140998 Ga0501045_0140998_433_1020 195
926 3300050507 nmdc:mga05p37_1164634_c1 nmdc:mga05p37_1164634_c1_71_667 195
927 3300050507 nmdc:mga05p37_140993_c1 nmdc:mga05p37_140993_c1_353_943 195
928 3300050507 nmdc:mga05p37_1604883_c1 nmdc:mga05p37_1604883_c1_27_626 195
929 3300050507 nmdc:mga05p37_45564_c1 nmdc:mga05p37_45564_c1_2378_2965 195
930 3300050507 nmdc:mga05p37_704595_c1 nmdc:mga05p37_704595_c1_105_692 195
931 3300050508 nmdc:mga09592_19237_c1 nmdc:mga09592_19237_c1_1639_2226 195
932 3300050508 nmdc:mga09592_385900_c1 nmdc:mga09592_385900_c1_228_815 195
933 3300050508 nmdc:mga09592_390814_c1 nmdc:mga09592_390814_c1_326_916 195
934 3300050508 nmdc:mga09592_6990_c1 nmdc:mga09592_6990_c1_2590_3183 195
935 3300050509 nmdc:mga0qj67_334433_c1 nmdc:mga0qj67_334433_c1_478_1065 195
936 3300050510 nmdc:mga06r32_190968_c1 nmdc:mga06r32_190968_c1_1221_1808 195
937 3300050510 nmdc:mga06r32_32616_c1 nmdc:mga06r32_32616_c1_35_625 195
938 3300050511 nmdc:mga08y16_118758_c1 nmdc:mga08y16_118758_c1_1394_1990 195
939 3300050511 nmdc:mga08y16_190763_c1 nmdc:mga08y16_190763_c1_1109_1696 195
940 3300050511 nmdc:mga08y16_276486_c1 nmdc:mga08y16_276486_c1_489_1085 195
941 3300050511 nmdc:mga08y16_35631_c1 nmdc:mga08y16_35631_c1_2664_3260 195
942 3300050511 nmdc:mga08y16_37510_c1 nmdc:mga08y16_37510_c1_2019_2606 195
943 3300050511 nmdc:mga08y16_652245_c1 nmdc:mga08y16_652245_c1_428_1018 195
944 3300050512 nmdc:mga0n895_121418_c1 nmdc:mga0n895_121418_c1_328_918 195
945 3300050512 nmdc:mga0n895_326177_c1 nmdc:mga0n895_326177_c1_195_782 195
946 3300050512 nmdc:mga0n895_601864_c1 nmdc:mga0n895_601864_c1_166_759 195
947 3300050512 nmdc:mga0n895_64787_c1 nmdc:mga0n895_64787_c1_539_1135 195
948 3300050515 nmdc:mga0a205_51769_c1 nmdc:mga0a205_51769_c1_2043_2633 195
949 3300050515 nmdc:mga0a205_828417_c1 nmdc:mga0a205_828417_c1_43_639 195
950 3300053077 Ga0495601_0005015 Ga0495601_0005015_1454_2047 195
951 3300053078 Ga0495612_0000023 Ga0495612_0000023_5659_6249 195
952 3300053083 Ga0495655_0073885 Ga0495655_0073885_266_853 195
953 3300053083 Ga0495655_0080651 Ga0495655_0080651_223_831 195
954 3300053139 Ga0500568_0175941 Ga0500568_0175941_106_708 195
955 3300053153 Ga0500616_0025481 Ga0500616_0025481_309_902 195
956 3300053153 Ga0500616_0142130 Ga0500616_0142130_324_926 195
957 3300054114 Ga0501084_0021707 Ga0501084_0021707_3293_3880 195
958 3300054114 Ga0501084_0044658 Ga0501084_0044658_2221_2817 195
959 3300054114 Ga0501084_0506402 Ga0501084_0506402_312_908 195
960 3300060344 Ga0587071_045024 Ga0587071_045024_167_784 195
961 3300060353 Ga0501082_0008369 Ga0501082_0008369_1350_1946 195
962 3300060353 Ga0501082_0046329 Ga0501082_0046329_742_1329 195
963 3300060353 Ga0501082_0090176 Ga0501082_0090176_1874_2461 195
964 3300060353 Ga0501082_0698602 Ga0501082_0698602_123_719 195
965 3300060353 Ga0501082_0754966 Ga0501082_0754966_205_792 195
966 3300061719 Ga0466962_0054943 Ga0466962_0054943_287_877 195
967 3300061719 Ga0466962_0086446 Ga0466962_0086446_204_839 195
968 3300061734 Ga0530510_0009957 Ga0530510_0009957_1122_1709 195
969 3300061734 Ga0530510_0093190 Ga0530510_0093190_1291_1878 195
970 3300061734 Ga0530510_0213005 Ga0530510_0213005_138_734 195
971 3300061734 Ga0530510_0434603 Ga0530510_0434603_109_705 195
972 3300061734 Ga0530510_0555932 Ga0530510_0555932_25_621 195

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00475

IGPD

Imidazoleglycerol-phosphate dehydratase

55

198

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f1d-assembly1.cif.gz_D x-ray structure of imidazoleglycerol-phosphate dehydratase 0.9807 3 183
4mu0-assembly1.cif.gz_A the structure of wt a. thaliana igpd2 in complex with mn2+ and 1,2,4-triazole at 1.3 a resolution 0.9806 1 183
4mu3-assembly1.cif.gz_A the form a structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and a mixture of its substrate, 2r3s-igp, and an inhibitor, 2s3s-igp, to 1.12 a resolution 0.9794 1 183
7oj5-assembly1.cif.gz_A cryo-em structure of medicago truncatula hisn5 protein 0.9739 3 183
4mu4-assembly1.cif.gz_A the form b structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and its substrate, 2r3s-igp, to 1.41 a resolution 0.9714 1 193
ID Description Score Start End Superfamily
af_C6T988_68_169_3.30.230.40 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9793 2 89 3.30.230.40
4qnkD01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.972 1 89 3.30.230.40
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9665 91 183 3.30.230.40
af_Q2FUU0_1_87_3.30.230.40 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9646 4 83 3.30.230.40
af_Q2FUU0_88_192_3.30.230.40 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9511 91 193 3.30.230.40
ID Description Score Start End GO Terms
AF-A0A2V8ST04-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9951 1 115 GO:0000105
GO:0004424
AF-A0A534WID5-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9949 2 107 GO:0000105
GO:0004424
AF-A0A3C0Y201-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9942 1 99 GO:0000105
GO:0004424
AF-A0A3C0KJQ1-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9937 1 114 GO:0000105
GO:0004424
AF-A0A351J0U9-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9935 3 117 GO:0000105
GO:0004424

Feature Viewer

pLDDT pTM Quality
94.24 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map