F487162
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 972 | 346 | 972 | 195 |
Family's Representative Sequence
| Representative Sequence | 3300046511|Ga0495608_0120798|Ga0495608_0120798_959_1621 |
| Length | 220 |
| Sequence | MEDRMSTPPDSTPLAASRPDGADAPRAASIERKTGETDVRLSLALDGAGEGARDTGVGFLDHMLDLLARHGKIDLDVAVAGDLQTGAHHTAEDTAIVLGQALDRALGDRRGIHRYGHFVVPMDEARASCAIDISGRPHTVFHADLPSGSTGGFDHELTEEFFRALATAAKLTLHLEVQAGTNAHHMIEAAFKAFARALRQAVAVDPGEKGVPSTKGTLTS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 117 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 118 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 176 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 177 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 178 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 179 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 180 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 181 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 184 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 185 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 186 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 187 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 189 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 192 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 193 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 194 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 195 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 196 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 198 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 199 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 200 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 201 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 202 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 210 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 211 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 213 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 214 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 215 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 216 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 217 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 218 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 219 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 220 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 221 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 222 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 223 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 224 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 225 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 226 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 227 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 228 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 229 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 230 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 231 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 232 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 233 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 234 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 235 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 236 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 273 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 274 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 275 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 276 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 277 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 278 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 281 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 282 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 283 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 284 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 285 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 286 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 287 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 288 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 289 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 290 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 291 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 292 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 293 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 294 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 295 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 328 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 341 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 342 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 346 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.38 |
| Metatranscriptomes | 0.62 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.03 |
| Nodule | 0 |
| Rhizoplane | 9.88 |
| Rhizosphere | 87.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1007430 | 3300000549 | Bacteria | 1347 |
| 2 | JGI25406J46586_10037679 | 3300003203 | Unclassified | 1740 |
| 3 | JGI25407J50210_10007614 | 3300003373 | Bacteria | 2715 |
| 4 | JGI25407J50210_10046016 | 3300003373 | Bacteria | 1111 |
| 5 | Ga0070683_100017940 | 3300005329 | Bacteria | 6257 |
| 6 | Ga0070683_100035511 | 3300005329 | Bacteria | 4556 |
| 7 | Ga0070683_100051889 | 3300005329 | Bacteria | 3798 |
| 8 | Ga0070683_100165130 | 3300005329 | Bacteria | 2100 |
| 9 | Ga0070690_100243518 | 3300005330 | Bacteria | 1269 |
| 10 | Ga0070670_100256191 | 3300005331 | Bacteria | 1525 |
| 11 | Ga0070670_101056036 | 3300005331 | Bacteria | 740 |
| 12 | Ga0068869_100019169 | 3300005334 | Bacteria | 4670 |
| 13 | Ga0068869_100186159 | 3300005334 | Bacteria | 1630 |
| 14 | Ga0070666_10549680 | 3300005335 | Bacteria | 840 |
| 15 | Ga0070680_100810565 | 3300005336 | Bacteria | 807 |
| 16 | Ga0070682_100023170 | 3300005337 | Bacteria | 3686 |
| 17 | Ga0070682_100376757 | 3300005337 | Bacteria | 1066 |
| 18 | Ga0070682_100399027 | 3300005337 | Bacteria | 1040 |
| 19 | Ga0068868_100003173 | 3300005338 | Bacteria | 11441 |
| 20 | Ga0068868_100027776 | 3300005338 | Bacteria | 4319 |
| 21 | Ga0068868_100293943 | 3300005338 | Bacteria | 1378 |
| 22 | Ga0068868_100340411 | 3300005338 | Bacteria | 1282 |
| 23 | Ga0068868_100380266 | 3300005338 | Bacteria | 1215 |
| 24 | Ga0068868_100887103 | 3300005338 | Bacteria | 810 |
| 25 | Ga0070660_100003619 | 3300005339 | Bacteria | 10672 |
| 26 | Ga0070660_100046597 | 3300005339 | Bacteria | 3323 |
| 27 | Ga0070660_100068013 | 3300005339 | Bacteria | 2776 |
| 28 | Ga0070660_100561430 | 3300005339 | Bacteria | 953 |
| 29 | Ga0070689_100060626 | 3300005340 | Bacteria | 2942 |
| 30 | Ga0070689_100158234 | 3300005340 | Bacteria | 1830 |
| 31 | Ga0070689_100399760 | 3300005340 | Bacteria | 1161 |
| 32 | Ga0070691_10158276 | 3300005341 | Bacteria | 1166 |
| 33 | Ga0070687_100104910 | 3300005343 | Bacteria | 1589 |
| 34 | Ga0070687_100478350 | 3300005343 | Bacteria | 834 |
| 35 | Ga0070661_100019340 | 3300005344 | Bacteria | 4854 |
| 36 | Ga0070661_100581806 | 3300005344 | Bacteria | 903 |
| 37 | Ga0070692_10017574 | 3300005345 | Bacteria | 3423 |
| 38 | Ga0070692_10090842 | 3300005345 | Bacteria | 1660 |
| 39 | Ga0070692_10134710 | 3300005345 | Bacteria | 1392 |
| 40 | Ga0070668_100042153 | 3300005347 | Bacteria | 3498 |
| 41 | Ga0070668_100470612 | 3300005347 | Bacteria | 1084 |
| 42 | Ga0070669_100020911 | 3300005353 | Bacteria | 4675 |
| 43 | Ga0070669_100359311 | 3300005353 | Bacteria | 1184 |
| 44 | Ga0070669_100385917 | 3300005353 | Bacteria | 1143 |
| 45 | Ga0070675_100001160 | 3300005354 | Bacteria | 19040 |
| 46 | Ga0070675_100413797 | 3300005354 | Bacteria | 1205 |
| 47 | Ga0070671_100235319 | 3300005355 | Bacteria | 1554 |
| 48 | Ga0070671_100488975 | 3300005355 | Bacteria | 1058 |
| 49 | Ga0070674_100031861 | 3300005356 | Bacteria | 3498 |
| 50 | Ga0070674_100481091 | 3300005356 | Bacteria | 1030 |
| 51 | Ga0070674_101162445 | 3300005356 | Bacteria | 684 |
| 52 | Ga0070673_100871895 | 3300005364 | Bacteria | 834 |
| 53 | Ga0070688_100000027 | 3300005365 | Bacteria | 67477 |
| 54 | Ga0070688_100004986 | 3300005365 | Bacteria | 6947 |
| 55 | Ga0070688_100257611 | 3300005365 | Bacteria | 1244 |
| 56 | Ga0070659_100000037 | 3300005366 | Bacteria | 113379 |
| 57 | Ga0070659_100002687 | 3300005366 | Bacteria | 12638 |
| 58 | Ga0070659_100476154 | 3300005366 | Bacteria | 1062 |
| 59 | Ga0070659_100757011 | 3300005366 | Bacteria | 843 |
| 60 | Ga0070667_100042334 | 3300005367 | Bacteria | 3822 |
| 61 | Ga0070667_100811593 | 3300005367 | Bacteria | 869 |
| 62 | Ga0070709_10053487 | 3300005434 | Bacteria | 2542 |
| 63 | Ga0070714_100000860 | 3300005435 | Bacteria | 21534 |
| 64 | Ga0070714_100010038 | 3300005435 | Bacteria | 7470 |
| 65 | Ga0070714_100021490 | 3300005435 | Bacteria | 5280 |
| 66 | Ga0070714_100069618 | 3300005435 | Bacteria | 3040 |
| 67 | Ga0070714_100104971 | 3300005435 | Bacteria | 2494 |
| 68 | Ga0070714_100113289 | 3300005435 | Bacteria | 2405 |
| 69 | Ga0070714_100837573 | 3300005435 | Bacteria | 892 |
| 70 | Ga0070713_100324287 | 3300005436 | Bacteria | 1423 |
| 71 | Ga0070710_10000050 | 3300005437 | Bacteria | 56781 |
| 72 | Ga0070710_10097718 | 3300005437 | Bacteria | 1743 |
| 73 | Ga0070710_10201511 | 3300005437 | Bacteria | 1257 |
| 74 | Ga0070710_10423514 | 3300005437 | Bacteria | 897 |
| 75 | Ga0070701_10192589 | 3300005438 | Bacteria | 1200 |
| 76 | Ga0070711_100001237 | 3300005439 | Bacteria | 13806 |
| 77 | Ga0070711_100289029 | 3300005439 | Bacteria | 1300 |
| 78 | Ga0070705_100005024 | 3300005440 | Bacteria | 6435 |
| 79 | Ga0070705_100950972 | 3300005440 | Bacteria | 694 |
| 80 | Ga0070705_100995940 | 3300005440 | Bacteria | 680 |
| 81 | Ga0070700_100013649 | 3300005441 | Bacteria | 4567 |
| 82 | Ga0070700_100029613 | 3300005441 | Bacteria | 3266 |
| 83 | Ga0070700_100034667 | 3300005441 | Bacteria | 3049 |
| 84 | Ga0070700_100188362 | 3300005441 | Bacteria | 1441 |
| 85 | Ga0070700_100307524 | 3300005441 | Bacteria | 1159 |
| 86 | Ga0070694_100314453 | 3300005444 | Bacteria | 1203 |
| 87 | Ga0070708_100428217 | 3300005445 | Bacteria | 1248 |
| 88 | Ga0070663_100009051 | 3300005455 | Bacteria | 6152 |
| 89 | Ga0070678_100025608 | 3300005456 | Bacteria | 3973 |
| 90 | Ga0070678_100284954 | 3300005456 | Bacteria | 1398 |
| 91 | Ga0070662_100001035 | 3300005457 | Bacteria | 16981 |
| 92 | Ga0070662_100294176 | 3300005457 | Bacteria | 1317 |
| 93 | Ga0070662_100441662 | 3300005457 | Bacteria | 1079 |
| 94 | Ga0070681_10003066 | 3300005458 | Bacteria | 15497 |
| 95 | Ga0070681_10303916 | 3300005458 | Bacteria | 1505 |
| 96 | Ga0070685_10000665 | 3300005466 | Bacteria | 18706 |
| 97 | Ga0070685_10000791 | 3300005466 | Bacteria | 17160 |
| 98 | Ga0070685_10031977 | 3300005466 | Bacteria | 2944 |
| 99 | Ga0070685_10284096 | 3300005466 | Bacteria | 1109 |
| 100 | Ga0070685_10663639 | 3300005466 | Bacteria | 757 |
| 101 | Ga0070698_100623824 | 3300005471 | Bacteria | 1019 |
| 102 | Ga0070679_100035983 | 3300005530 | Bacteria | 4913 |
| 103 | Ga0070679_100043251 | 3300005530 | Bacteria | 4487 |
| 104 | Ga0070679_100070872 | 3300005530 | Bacteria | 3476 |
| 105 | Ga0070679_100151311 | 3300005530 | Bacteria | 2297 |
| 106 | Ga0070679_100436883 | 3300005530 | Bacteria | 1254 |
| 107 | Ga0070684_100035155 | 3300005535 | Bacteria | 4288 |
| 108 | Ga0070684_100035948 | 3300005535 | Bacteria | 4242 |
| 109 | Ga0070684_100106959 | 3300005535 | Bacteria | 2505 |
| 110 | Ga0070684_100216967 | 3300005535 | Bacteria | 1745 |
| 111 | Ga0070697_100407681 | 3300005536 | Bacteria | 1180 |
| 112 | Ga0070697_100509609 | 3300005536 | Bacteria | 1053 |
| 113 | Ga0068853_100390091 | 3300005539 | Bacteria | 1302 |
| 114 | Ga0070686_100224047 | 3300005544 | Bacteria | 1360 |
| 115 | Ga0070686_100229411 | 3300005544 | Bacteria | 1346 |
| 116 | Ga0070695_100191180 | 3300005545 | Bacteria | 1457 |
| 117 | Ga0070696_100021133 | 3300005546 | Bacteria | 4413 |
| 118 | Ga0070696_100407601 | 3300005546 | Bacteria | 1065 |
| 119 | Ga0070665_100036567 | 3300005548 | Bacteria | 4939 |
| 120 | Ga0070665_100075544 | 3300005548 | Bacteria | 3376 |
| 121 | Ga0070665_100113050 | 3300005548 | Bacteria | 2718 |
| 122 | Ga0070665_100485083 | 3300005548 | Bacteria | 1247 |
| 123 | Ga0070665_100515985 | 3300005548 | Bacteria | 1207 |
| 124 | Ga0070665_100600571 | 3300005548 | Bacteria | 1113 |
| 125 | Ga0070704_100223325 | 3300005549 | Bacteria | 1533 |
| 126 | Ga0068855_100452939 | 3300005563 | Bacteria | 1400 |
| 127 | Ga0068855_100960053 | 3300005563 | Bacteria | 900 |
| 128 | Ga0070664_100012431 | 3300005564 | Bacteria | 6919 |
| 129 | Ga0070664_100076082 | 3300005564 | Bacteria | 2883 |
| 130 | Ga0070664_100153674 | 3300005564 | Bacteria | 2033 |
| 131 | Ga0068857_100276104 | 3300005577 | Bacteria | 1545 |
| 132 | Ga0068857_100317982 | 3300005577 | Bacteria | 1437 |
| 133 | Ga0068854_100000116 | 3300005578 | Bacteria | 54986 |
| 134 | Ga0068854_100075637 | 3300005578 | Bacteria | 2473 |
| 135 | Ga0068854_100131953 | 3300005578 | Bacteria | 1908 |
| 136 | Ga0068854_100882361 | 3300005578 | Bacteria | 785 |
| 137 | Ga0068856_100000336 | 3300005614 | Bacteria | 51580 |
| 138 | Ga0068856_100002016 | 3300005614 | Bacteria | 21154 |
| 139 | Ga0068856_100032534 | 3300005614 | Bacteria | 5106 |
| 140 | Ga0068856_100114684 | 3300005614 | Bacteria | 2694 |
| 141 | Ga0070702_100050153 | 3300005615 | Bacteria | 2383 |
| 142 | Ga0068852_100805384 | 3300005616 | Bacteria | 954 |
| 143 | Ga0068859_100050092 | 3300005617 | Bacteria | 4195 |
| 144 | Ga0068859_100119046 | 3300005617 | Bacteria | 2707 |
| 145 | Ga0068861_100008771 | 3300005719 | Bacteria | 6963 |
| 146 | Ga0068861_100049050 | 3300005719 | Bacteria | 3195 |
| 147 | Ga0068851_10007756 | 3300005834 | Bacteria | 4938 |
| 148 | Ga0068851_10057798 | 3300005834 | Bacteria | 1981 |
| 149 | Ga0068870_10031616 | 3300005840 | Bacteria | 2683 |
| 150 | Ga0068863_100111984 | 3300005841 | Bacteria | 2599 |
| 151 | Ga0068863_100324115 | 3300005841 | Bacteria | 1497 |
| 152 | Ga0068858_100081388 | 3300005842 | Bacteria | 3010 |
| 153 | Ga0068858_100211186 | 3300005842 | Bacteria | 1837 |
| 154 | Ga0068862_100042359 | 3300005844 | Bacteria | 3878 |
| 155 | Ga0081455_10043405 | 3300005937 | Bacteria | 3933 |
| 156 | Ga0081455_10097642 | 3300005937 | Bacteria | 2366 |
| 157 | Ga0081455_10325138 | 3300005937 | Bacteria | 1094 |
| 158 | Ga0081538_10000044 | 3300005981 | Bacteria | 115394 |
| 159 | Ga0081538_10000766 | 3300005981 | Bacteria | 35083 |
| 160 | Ga0081538_10001436 | 3300005981 | Bacteria | 24497 |
| 161 | Ga0081538_10002073 | 3300005981 | Bacteria | 19976 |
| 162 | Ga0081538_10002254 | 3300005981 | Bacteria | 19094 |
| 163 | Ga0081538_10003695 | 3300005981 | Bacteria | 14357 |
| 164 | Ga0081538_10004173 | 3300005981 | Bacteria | 13410 |
| 165 | Ga0081538_10006143 | 3300005981 | Bacteria | 10654 |
| 166 | Ga0081538_10025048 | 3300005981 | Bacteria | 4226 |
| 167 | Ga0081538_10042073 | 3300005981 | Bacteria | 2889 |
| 168 | Ga0081538_10050518 | 3300005981 | Bacteria | 2510 |
| 169 | Ga0081538_10066379 | 3300005981 | Bacteria | 2023 |
| 170 | Ga0081538_10096064 | 3300005981 | Bacteria | 1511 |
| 171 | Ga0081540_1002481 | 3300005983 | Bacteria | 15029 |
| 172 | Ga0081540_1084827 | 3300005983 | Bacteria | 1412 |
| 173 | Ga0081539_10011326 | 3300005985 | Bacteria | 7075 |
| 174 | Ga0081539_10012198 | 3300005985 | Bacteria | 6669 |
| 175 | Ga0070717_10000019 | 3300006028 | Bacteria | 178051 |
| 176 | Ga0070717_10036330 | 3300006028 | Bacteria | 3995 |
| 177 | Ga0075365_10320280 | 3300006038 | Bacteria | 1092 |
| 178 | Ga0075363_100047743 | 3300006048 | Bacteria | 2275 |
| 179 | Ga0075363_100210420 | 3300006048 | Bacteria | 1113 |
| 180 | Ga0075432_10008412 | 3300006058 | Bacteria | 3519 |
| 181 | Ga0070716_100333012 | 3300006173 | Bacteria | 1068 |
| 182 | Ga0070712_100000004 | 3300006175 | Bacteria | 215464 |
| 183 | Ga0070712_100024256 | 3300006175 | Bacteria | 4017 |
| 184 | Ga0070712_100073145 | 3300006175 | Bacteria | 2458 |
| 185 | Ga0070712_100167367 | 3300006175 | Bacteria | 1703 |
| 186 | Ga0070712_100545950 | 3300006175 | Bacteria | 976 |
| 187 | Ga0068871_100396671 | 3300006358 | Bacteria | 1228 |
| 188 | Ga0075428_100172045 | 3300006844 | Bacteria | 2347 |
| 189 | Ga0075428_100281113 | 3300006844 | Bacteria | 1791 |
| 190 | Ga0075428_100407972 | 3300006844 | Bacteria | 1456 |
| 191 | Ga0075428_100417523 | 3300006844 | Bacteria | 1437 |
| 192 | Ga0075430_100001606 | 3300006846 | Bacteria | 18450 |
| 193 | Ga0075430_100125867 | 3300006846 | Bacteria | 2136 |
| 194 | Ga0075430_100159561 | 3300006846 | Bacteria | 1877 |
| 195 | Ga0075430_100174316 | 3300006846 | Bacteria | 1789 |
| 196 | Ga0075431_100014397 | 3300006847 | Bacteria | 7999 |
| 197 | Ga0075431_100102356 | 3300006847 | Bacteria | 2956 |
| 198 | Ga0075431_100244726 | 3300006847 | Bacteria | 1823 |
| 199 | Ga0075433_10069242 | 3300006852 | Bacteria | 3099 |
| 200 | Ga0075433_10224928 | 3300006852 | Bacteria | 1667 |
| 201 | Ga0075433_10389984 | 3300006852 | Bacteria | 1229 |
| 202 | Ga0075434_100074065 | 3300006871 | Bacteria | 3398 |
| 203 | Ga0075434_100434120 | 3300006871 | Bacteria | 1334 |
| 204 | Ga0075429_100031400 | 3300006880 | Bacteria | 4616 |
| 205 | Ga0075429_100090493 | 3300006880 | Bacteria | 2669 |
| 206 | Ga0075429_100260198 | 3300006880 | Bacteria | 1519 |
| 207 | Ga0068865_100081249 | 3300006881 | Bacteria | 2327 |
| 208 | Ga0068865_100490241 | 3300006881 | Bacteria | 1023 |
| 209 | Ga0075436_100069538 | 3300006914 | Bacteria | 2433 |
| 210 | Ga0097620_100050092 | 3300006931 | Bacteria | 4195 |
| 211 | Ga0097620_100119045 | 3300006931 | Bacteria | 2707 |
| 212 | Ga0075435_100012265 | 3300007076 | Bacteria | 6338 |
| 213 | Ga0075435_100220646 | 3300007076 | Bacteria | 1610 |
| 214 | Ga0105240_10206274 | 3300009093 | Bacteria | 2300 |
| 215 | Ga0105240_10370303 | 3300009093 | Bacteria | 1620 |
| 216 | Ga0105240_10596443 | 3300009093 | Bacteria | 1217 |
| 217 | Ga0111539_10004783 | 3300009094 | Bacteria | 17670 |
| 218 | Ga0111539_10012635 | 3300009094 | Bacteria | 10578 |
| 219 | Ga0111539_10039470 | 3300009094 | Bacteria | 5689 |
| 220 | Ga0111539_10050074 | 3300009094 | Bacteria | 4977 |
| 221 | Ga0111539_10129885 | 3300009094 | Bacteria | 2951 |
| 222 | Ga0111539_10641360 | 3300009094 | Bacteria | 1237 |
| 223 | Ga0111539_10954648 | 3300009094 | Bacteria | 997 |
| 224 | Ga0111539_11452804 | 3300009094 | Bacteria | 795 |
| 225 | Ga0105245_10000141 | 3300009098 | Bacteria | 68413 |
| 226 | Ga0105245_10002406 | 3300009098 | Bacteria | 16922 |
| 227 | Ga0105245_10003314 | 3300009098 | Bacteria | 14460 |
| 228 | Ga0105245_10014806 | 3300009098 | Bacteria | 6793 |
| 229 | Ga0105245_10015314 | 3300009098 | Bacteria | 6683 |
| 230 | Ga0105245_10066571 | 3300009098 | Bacteria | 3261 |
| 231 | Ga0105245_10358819 | 3300009098 | Bacteria | 1446 |
| 232 | Ga0105245_10588679 | 3300009098 | Bacteria | 1138 |
| 233 | Ga0105245_10688910 | 3300009098 | Bacteria | 1054 |
| 234 | Ga0105245_10971783 | 3300009098 | Bacteria | 893 |
| 235 | Ga0105247_10047392 | 3300009101 | Bacteria | 2638 |
| 236 | Ga0105247_10625075 | 3300009101 | Bacteria | 801 |
| 237 | Ga0114129_10019151 | 3300009147 | Bacteria | 9749 |
| 238 | Ga0114129_10059944 | 3300009147 | Bacteria | 5322 |
| 239 | Ga0114129_10183598 | 3300009147 | Bacteria | 2845 |
| 240 | Ga0114129_10195494 | 3300009147 | Bacteria | 2743 |
| 241 | Ga0114129_10315827 | 3300009147 | Bacteria | 2078 |
| 242 | Ga0114129_11136682 | 3300009147 | Bacteria | 976 |
| 243 | Ga0114129_12314265 | 3300009147 | Bacteria | 645 |
| 244 | Ga0105243_10011687 | 3300009148 | Bacteria | 6640 |
| 245 | Ga0105243_10012300 | 3300009148 | Bacteria | 6473 |
| 246 | Ga0105243_10079736 | 3300009148 | Bacteria | 2669 |
| 247 | Ga0105243_10576404 | 3300009148 | Bacteria | 1079 |
| 248 | Ga0105243_10795080 | 3300009148 | Bacteria | 932 |
| 249 | Ga0105243_11187265 | 3300009148 | Bacteria | 776 |
| 250 | Ga0105242_10103250 | 3300009176 | Bacteria | 2418 |
| 251 | Ga0105242_10358859 | 3300009176 | Bacteria | 1348 |
| 252 | Ga0105242_10409502 | 3300009176 | Bacteria | 1268 |
| 253 | Ga0105242_11390958 | 3300009176 | Bacteria | 729 |
| 254 | Ga0105248_10000020 | 3300009177 | Bacteria | 284637 |
| 255 | Ga0105248_10141614 | 3300009177 | Bacteria | 2713 |
| 256 | Ga0105248_10312768 | 3300009177 | Bacteria | 1769 |
| 257 | Ga0105237_10009091 | 3300009545 | Bacteria | 10677 |
| 258 | Ga0105237_10207990 | 3300009545 | Bacteria | 1957 |
| 259 | Ga0105237_10338998 | 3300009545 | Bacteria | 1508 |
| 260 | Ga0105237_10486205 | 3300009545 | Bacteria | 1241 |
| 261 | Ga0105238_10032231 | 3300009551 | Bacteria | 5333 |
| 262 | Ga0105249_10018376 | 3300009553 | Bacteria | 6217 |
| 263 | Ga0105249_10332398 | 3300009553 | Bacteria | 1534 |
| 264 | Ga0105239_10019100 | 3300010375 | Bacteria | 7575 |
| 265 | Ga0105239_10164107 | 3300010375 | Bacteria | 2483 |
| 266 | Ga0105239_10217741 | 3300010375 | Bacteria | 2141 |
| 267 | Ga0105239_10315601 | 3300010375 | Bacteria | 1762 |
| 268 | Ga0105239_10685949 | 3300010375 | Bacteria | 1171 |
| 269 | Ga0105239_11017158 | 3300010375 | Bacteria | 953 |
| 270 | Ga0105246_10236010 | 3300011119 | Bacteria | 1443 |
| 271 | Ga0157371_10011110 | 3300013102 | Bacteria | 6970 |
| 272 | Ga0157371_10230312 | 3300013102 | Bacteria | 1331 |
| 273 | Ga0157370_10013982 | 3300013104 | Bacteria | 8242 |
| 274 | Ga0157370_10327615 | 3300013104 | Bacteria | 1412 |
| 275 | Ga0157369_10004884 | 3300013105 | Bacteria | 15723 |
| 276 | Ga0157369_10203624 | 3300013105 | Bacteria | 2077 |
| 277 | Ga0157369_10390815 | 3300013105 | Bacteria | 1443 |
| 278 | Ga0157369_10677369 | 3300013105 | Bacteria | 1063 |
| 279 | Ga0157369_11298606 | 3300013105 | Bacteria | 742 |
| 280 | Ga0157374_10470627 | 3300013296 | Bacteria | 1259 |
| 281 | Ga0157374_10585624 | 3300013296 | Bacteria | 1125 |
| 282 | Ga0163162_10027306 | 3300013306 | Bacteria | 5644 |
| 283 | Ga0163162_10137792 | 3300013306 | Bacteria | 2552 |
| 284 | Ga0163162_10603452 | 3300013306 | Bacteria | 1224 |
| 285 | Ga0157372_10006642 | 3300013307 | Bacteria | 12311 |
| 286 | Ga0157372_10023168 | 3300013307 | Bacteria | 6729 |
| 287 | Ga0157372_10183403 | 3300013307 | Bacteria | 2423 |
| 288 | Ga0157372_10411817 | 3300013307 | Bacteria | 1575 |
| 289 | Ga0157375_10085478 | 3300013308 | Bacteria | 3204 |
| 290 | Ga0157375_10673008 | 3300013308 | Bacteria | 1190 |
| 291 | Ga0157375_11016385 | 3300013308 | Bacteria | 968 |
| 292 | Ga0157375_11683226 | 3300013308 | Bacteria | 751 |
| 293 | Ga0163163_10314158 | 3300014325 | Bacteria | 1620 |
| 294 | Ga0163163_10484790 | 3300014325 | Bacteria | 1298 |
| 295 | Ga0163163_11856857 | 3300014325 | Bacteria | 663 |
| 296 | Ga0157380_10006499 | 3300014326 | Bacteria | 8241 |
| 297 | Ga0157380_11273185 | 3300014326 | Bacteria | 782 |
| 298 | Ga0182008_10245237 | 3300014497 | Bacteria | 923 |
| 299 | Ga0157377_10011697 | 3300014745 | Bacteria | 4388 |
| 300 | Ga0157377_10086770 | 3300014745 | Bacteria | 1840 |
| 301 | Ga0157379_10148164 | 3300014968 | Bacteria | 2117 |
| 302 | Ga0157379_10497759 | 3300014968 | Bacteria | 1129 |
| 303 | Ga0157376_10028909 | 3300014969 | Bacteria | 4412 |
| 304 | Ga0157376_10928289 | 3300014969 | Bacteria | 890 |
| 305 | Ga0163161_10085718 | 3300017792 | Bacteria | 2323 |
| 306 | Ga0206354_10513831 | 3300020081 | Bacteria | 1601 |
| 307 | Ga0206353_10159166 | 3300020082 | Bacteria | 1368 |
| 308 | Ga0206353_10352119 | 3300020082 | Bacteria | 950 |
| 309 | Ga0206353_11218525 | 3300020082 | Bacteria | 1211 |
| 310 | Ga0213873_10054893 | 3300021358 | Bacteria | 1064 |
| 311 | Ga0213875_10032735 | 3300021388 | Bacteria | 2456 |
| 312 | Ga0224712_10103572 | 3300022467 | Bacteria | 1211 |
| 313 | Ga0207426_1013197 | 3300025302 | Bacteria | 3070 |
| 314 | Ga0207656_10039832 | 3300025321 | Bacteria | 1990 |
| 315 | Ga0207656_10193740 | 3300025321 | Bacteria | 979 |
| 316 | Ga0207692_10000022 | 3300025898 | Bacteria | 56680 |
| 317 | Ga0207692_10041897 | 3300025898 | Bacteria | 2270 |
| 318 | Ga0207692_10152908 | 3300025898 | Bacteria | 1323 |
| 319 | Ga0207688_10000813 | 3300025901 | Bacteria | 15626 |
| 320 | Ga0207688_10034319 | 3300025901 | Bacteria | 2809 |
| 321 | Ga0207688_10039540 | 3300025901 | Bacteria | 2619 |
| 322 | Ga0207688_10063504 | 3300025901 | Bacteria | 2083 |
| 323 | Ga0207688_10064925 | 3300025901 | Bacteria | 2062 |
| 324 | Ga0207688_10198878 | 3300025901 | Bacteria | 1201 |
| 325 | Ga0207680_10323462 | 3300025903 | Bacteria | 1079 |
| 326 | Ga0207699_10056789 | 3300025906 | Bacteria | 2335 |
| 327 | Ga0207645_10074921 | 3300025907 | Bacteria | 2167 |
| 328 | Ga0207643_10575587 | 3300025908 | Bacteria | 724 |
| 329 | Ga0207707_10148415 | 3300025912 | Bacteria | 2050 |
| 330 | Ga0207695_10139811 | 3300025913 | Bacteria | 2371 |
| 331 | Ga0207695_10180841 | 3300025913 | Bacteria | 2029 |
| 332 | Ga0207695_10513266 | 3300025913 | Bacteria | 1080 |
| 333 | Ga0207695_10551251 | 3300025913 | Bacteria | 1034 |
| 334 | Ga0207695_10657218 | 3300025913 | Bacteria | 929 |
| 335 | Ga0207671_10001526 | 3300025914 | Bacteria | 26567 |
| 336 | Ga0207693_10000017 | 3300025915 | Bacteria | 139308 |
| 337 | Ga0207693_10004599 | 3300025915 | Bacteria | 11642 |
| 338 | Ga0207693_10008005 | 3300025915 | Bacteria | 8678 |
| 339 | Ga0207693_10049193 | 3300025915 | Bacteria | 3311 |
| 340 | Ga0207693_10710466 | 3300025915 | Bacteria | 778 |
| 341 | Ga0207663_10002190 | 3300025916 | Bacteria | 9339 |
| 342 | Ga0207663_10055324 | 3300025916 | Bacteria | 2489 |
| 343 | Ga0207663_10058625 | 3300025916 | Bacteria | 2431 |
| 344 | Ga0207663_10309526 | 3300025916 | Bacteria | 1183 |
| 345 | Ga0207660_10006020 | 3300025917 | Bacteria | 7873 |
| 346 | Ga0207662_10077621 | 3300025918 | Bacteria | 2020 |
| 347 | Ga0207657_10006359 | 3300025919 | Bacteria | 12271 |
| 348 | Ga0207657_10057000 | 3300025919 | Bacteria | 3369 |
| 349 | Ga0207657_10417286 | 3300025919 | Bacteria | 1055 |
| 350 | Ga0207649_10176847 | 3300025920 | Bacteria | 1491 |
| 351 | Ga0207649_10327925 | 3300025920 | Bacteria | 1127 |
| 352 | Ga0207652_10008802 | 3300025921 | Bacteria | 8129 |
| 353 | Ga0207652_10094266 | 3300025921 | Bacteria | 2636 |
| 354 | Ga0207652_10095849 | 3300025921 | Bacteria | 2614 |
| 355 | Ga0207652_10127154 | 3300025921 | Bacteria | 2270 |
| 356 | Ga0207652_10812437 | 3300025921 | Bacteria | 830 |
| 357 | Ga0207681_10016814 | 3300025923 | Bacteria | 4585 |
| 358 | Ga0207681_10152625 | 3300025923 | Bacteria | 1733 |
| 359 | Ga0207694_10247360 | 3300025924 | Bacteria | 1458 |
| 360 | Ga0207650_10698466 | 3300025925 | Bacteria | 857 |
| 361 | Ga0207659_10000553 | 3300025926 | Bacteria | 22395 |
| 362 | Ga0207659_10035380 | 3300025926 | Bacteria | 3452 |
| 363 | Ga0207659_10372296 | 3300025926 | Bacteria | 1189 |
| 364 | Ga0207687_10000036 | 3300025927 | Bacteria | 121934 |
| 365 | Ga0207687_10002476 | 3300025927 | Bacteria | 12542 |
| 366 | Ga0207687_10039782 | 3300025927 | Bacteria | 3220 |
| 367 | Ga0207687_10324237 | 3300025927 | Bacteria | 1248 |
| 368 | Ga0207687_10547004 | 3300025927 | Bacteria | 971 |
| 369 | Ga0207700_10371009 | 3300025928 | Bacteria | 1250 |
| 370 | Ga0207700_10462839 | 3300025928 | Bacteria | 1119 |
| 371 | Ga0207664_10000004 | 3300025929 | Bacteria | 493014 |
| 372 | Ga0207664_10002049 | 3300025929 | Bacteria | 13273 |
| 373 | Ga0207664_10082008 | 3300025929 | Bacteria | 2626 |
| 374 | Ga0207664_10382024 | 3300025929 | Bacteria | 1250 |
| 375 | Ga0207644_10041237 | 3300025931 | Bacteria | 3265 |
| 376 | Ga0207644_10359468 | 3300025931 | Bacteria | 1184 |
| 377 | Ga0207690_10000268 | 3300025932 | Bacteria | 37289 |
| 378 | Ga0207690_10098395 | 3300025932 | Bacteria | 2084 |
| 379 | Ga0207690_10141496 | 3300025932 | Bacteria | 1773 |
| 380 | Ga0207690_10151916 | 3300025932 | Bacteria | 1717 |
| 381 | Ga0207706_10003294 | 3300025933 | Bacteria | 15460 |
| 382 | Ga0207706_10401597 | 3300025933 | Bacteria | 1188 |
| 383 | Ga0207686_10093501 | 3300025934 | Bacteria | 1991 |
| 384 | Ga0207686_10237332 | 3300025934 | Bacteria | 1325 |
| 385 | Ga0207669_10164059 | 3300025937 | Bacteria | 1573 |
| 386 | Ga0207669_10204345 | 3300025937 | Bacteria | 1437 |
| 387 | Ga0207669_10315406 | 3300025937 | Bacteria | 1194 |
| 388 | Ga0207669_10317918 | 3300025937 | Bacteria | 1190 |
| 389 | Ga0207669_10520656 | 3300025937 | Bacteria | 955 |
| 390 | Ga0207704_10034396 | 3300025938 | Bacteria | 2891 |
| 391 | Ga0207704_10242885 | 3300025938 | Bacteria | 1347 |
| 392 | Ga0207691_10078503 | 3300025940 | Bacteria | 2972 |
| 393 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 394 | Ga0207711_10210392 | 3300025941 | Bacteria | 1776 |
| 395 | Ga0207689_10041401 | 3300025942 | Bacteria | 3811 |
| 396 | Ga0207689_10254294 | 3300025942 | Bacteria | 1453 |
| 397 | Ga0207661_10000312 | 3300025944 | Bacteria | 30978 |
| 398 | Ga0207661_10028815 | 3300025944 | Bacteria | 4257 |
| 399 | Ga0207661_10131491 | 3300025944 | Bacteria | 2144 |
| 400 | Ga0207661_10248948 | 3300025944 | Bacteria | 1579 |
| 401 | Ga0207661_10915826 | 3300025944 | Bacteria | 807 |
| 402 | Ga0207679_10023802 | 3300025945 | Bacteria | 4193 |
| 403 | Ga0207679_10074750 | 3300025945 | Bacteria | 2568 |
| 404 | Ga0207679_10120470 | 3300025945 | Bacteria | 2088 |
| 405 | Ga0207651_10687143 | 3300025960 | Bacteria | 901 |
| 406 | Ga0207712_10008255 | 3300025961 | Bacteria | 6582 |
| 407 | Ga0207712_10157106 | 3300025961 | Bacteria | 1763 |
| 408 | Ga0207668_10012672 | 3300025972 | Bacteria | 5169 |
| 409 | Ga0207668_10089592 | 3300025972 | Bacteria | 2256 |
| 410 | Ga0207668_10454504 | 3300025972 | Bacteria | 1094 |
| 411 | Ga0207640_10000134 | 3300025981 | Bacteria | 54961 |
| 412 | Ga0207640_10102975 | 3300025981 | Bacteria | 2006 |
| 413 | Ga0207640_10460067 | 3300025981 | Bacteria | 1051 |
| 414 | Ga0207658_10029416 | 3300025986 | Bacteria | 3880 |
| 415 | Ga0207677_10000374 | 3300026023 | Bacteria | 31092 |
| 416 | Ga0207677_10138916 | 3300026023 | Bacteria | 1857 |
| 417 | Ga0207677_10180365 | 3300026023 | Bacteria | 1660 |
| 418 | Ga0207677_10240977 | 3300026023 | Bacteria | 1463 |
| 419 | Ga0207677_10369646 | 3300026023 | Bacteria | 1207 |
| 420 | Ga0207677_10756946 | 3300026023 | Bacteria | 866 |
| 421 | Ga0207639_10079844 | 3300026041 | Bacteria | 2586 |
| 422 | Ga0207678_10009806 | 3300026067 | Bacteria | 8420 |
| 423 | Ga0207678_10058133 | 3300026067 | Bacteria | 3327 |
| 424 | Ga0207678_10219814 | 3300026067 | Bacteria | 1626 |
| 425 | Ga0207708_10000937 | 3300026075 | Bacteria | 21842 |
| 426 | Ga0207708_10005784 | 3300026075 | Bacteria | 9140 |
| 427 | Ga0207708_10011942 | 3300026075 | Bacteria | 6469 |
| 428 | Ga0207708_10018439 | 3300026075 | Bacteria | 5256 |
| 429 | Ga0207708_10035246 | 3300026075 | Bacteria | 3808 |
| 430 | Ga0207702_10000368 | 3300026078 | Bacteria | 51559 |
| 431 | Ga0207702_10025200 | 3300026078 | Bacteria | 4936 |
| 432 | Ga0207702_10144487 | 3300026078 | Bacteria | 2157 |
| 433 | Ga0207702_11075611 | 3300026078 | Bacteria | 798 |
| 434 | Ga0207641_10054928 | 3300026088 | Bacteria | 3382 |
| 435 | Ga0207641_10505971 | 3300026088 | Bacteria | 1174 |
| 436 | Ga0207648_10204819 | 3300026089 | Bacteria | 1751 |
| 437 | Ga0207648_10302058 | 3300026089 | Bacteria | 1436 |
| 438 | Ga0207648_10385306 | 3300026089 | Bacteria | 1268 |
| 439 | Ga0207676_10062035 | 3300026095 | Bacteria | 2963 |
| 440 | Ga0207676_10566343 | 3300026095 | Bacteria | 1087 |
| 441 | Ga0207674_10141397 | 3300026116 | Bacteria | 2366 |
| 442 | Ga0207674_10152988 | 3300026116 | Bacteria | 2263 |
| 443 | Ga0207674_10349889 | 3300026116 | Bacteria | 1429 |
| 444 | Ga0207675_100004816 | 3300026118 | Bacteria | 12997 |
| 445 | Ga0207675_100033107 | 3300026118 | Bacteria | 4816 |
| 446 | Ga0207675_100101877 | 3300026118 | Bacteria | 2705 |
| 447 | Ga0207675_100657539 | 3300026118 | Bacteria | 1054 |
| 448 | Ga0207675_100733035 | 3300026118 | Bacteria | 999 |
| 449 | Ga0207683_10084011 | 3300026121 | Bacteria | 2830 |
| 450 | Ga0207683_11173117 | 3300026121 | Bacteria | 712 |
| 451 | Ga0207698_10086179 | 3300026142 | Bacteria | 2553 |
| 452 | Ga0207698_10243788 | 3300026142 | Bacteria | 1640 |
| 453 | Ga0207428_10055052 | 3300027907 | Bacteria | 3165 |
| 454 | Ga0207428_10201634 | 3300027907 | Bacteria | 1497 |
| 455 | Ga0207428_10273695 | 3300027907 | Bacteria | 1255 |
| 456 | Ga0268266_10010879 | 3300028379 | Bacteria | 7925 |
| 457 | Ga0268266_10063353 | 3300028379 | Bacteria | 3192 |
| 458 | Ga0268266_10365342 | 3300028379 | Bacteria | 1359 |
| 459 | Ga0268266_10366927 | 3300028379 | Bacteria | 1355 |
| 460 | Ga0268264_10563193 | 3300028381 | Bacteria | 1119 |
| 461 | Ga0265337_1012291 | 3300028556 | Bacteria | 2916 |
| 462 | Ga0265337_1079678 | 3300028556 | Bacteria | 897 |
| 463 | Ga0265326_10000630 | 3300028558 | Bacteria | 13168 |
| 464 | Ga0265326_10000833 | 3300028558 | Bacteria | 11353 |
| 465 | Ga0265319_1000353 | 3300028563 | Bacteria | 33333 |
| 466 | Ga0265319_1001381 | 3300028563 | Bacteria | 14593 |
| 467 | Ga0265319_1009072 | 3300028563 | Bacteria | 4285 |
| 468 | Ga0265334_10000002 | 3300028573 | Bacteria | 325014 |
| 469 | Ga0265318_10001586 | 3300028577 | Bacteria | 13166 |
| 470 | Ga0265318_10005786 | 3300028577 | Bacteria | 5769 |
| 471 | Ga0265318_10047329 | 3300028577 | Bacteria | 1622 |
| 472 | Ga0265318_10075213 | 3300028577 | Bacteria | 1250 |
| 473 | Ga0265323_10120796 | 3300028653 | Bacteria | 854 |
| 474 | Ga0265336_10000005 | 3300028666 | Bacteria | 399349 |
| 475 | Ga0265336_10002183 | 3300028666 | Bacteria | 8258 |
| 476 | Ga0265338_10000001 | 3300028800 | Bacteria | 1177449 |
| 477 | Ga0265338_10024856 | 3300028800 | Bacteria | 6104 |
| 478 | Ga0265338_10147335 | 3300028800 | Bacteria | 1834 |
| 479 | Ga0265338_10386672 | 3300028800 | Bacteria | 1000 |
| 480 | Ga0265320_10008105 | 3300031240 | Bacteria | 6458 |
| 481 | Ga0265320_10047466 | 3300031240 | Bacteria | 2100 |
| 482 | Ga0265325_10085887 | 3300031241 | Bacteria | 1558 |
| 483 | Ga0265340_10000001 | 3300031247 | Bacteria | 1647668 |
| 484 | Ga0265327_10121611 | 3300031251 | Bacteria | 1236 |
| 485 | Ga0265327_10211865 | 3300031251 | Bacteria | 874 |
| 486 | Ga0265316_10129048 | 3300031344 | Bacteria | 1905 |
| 487 | Ga0307408_100149363 | 3300031548 | Bacteria | 1843 |
| 488 | Ga0307408_100270750 | 3300031548 | Bacteria | 1410 |
| 489 | Ga0307408_100272361 | 3300031548 | Bacteria | 1406 |
| 490 | Ga0307408_100614185 | 3300031548 | Bacteria | 968 |
| 491 | Ga0265314_10273943 | 3300031711 | Bacteria | 958 |
| 492 | Ga0307405_10047556 | 3300031731 | Bacteria | 2642 |
| 493 | Ga0307405_10071547 | 3300031731 | Bacteria | 2232 |
| 494 | Ga0307405_10158330 | 3300031731 | Bacteria | 1601 |
| 495 | Ga0307413_10067704 | 3300031824 | Bacteria | 2234 |
| 496 | Ga0307413_10084903 | 3300031824 | Bacteria | 2042 |
| 497 | Ga0307413_10961614 | 3300031824 | Bacteria | 729 |
| 498 | Ga0307410_10020116 | 3300031852 | Bacteria | 4076 |
| 499 | Ga0307410_10035996 | 3300031852 | Bacteria | 3220 |
| 500 | Ga0307410_10050510 | 3300031852 | Bacteria | 2797 |
| 501 | Ga0307410_10853731 | 3300031852 | Bacteria | 777 |
| 502 | Ga0307410_10983725 | 3300031852 | Bacteria | 727 |
| 503 | Ga0326468_10011767 | 3300031889 | Bacteria | 909 |
| 504 | Ga0307406_10027100 | 3300031901 | Bacteria | 3449 |
| 505 | Ga0307406_10131462 | 3300031901 | Bacteria | 1758 |
| 506 | Ga0307407_10098143 | 3300031903 | Bacteria | 1812 |
| 507 | Ga0307407_10358508 | 3300031903 | Bacteria | 1035 |
| 508 | Ga0307412_10131209 | 3300031911 | Bacteria | 1820 |
| 509 | Ga0307412_11013148 | 3300031911 | Bacteria | 734 |
| 510 | Ga0307409_100011229 | 3300031995 | Bacteria | 5631 |
| 511 | Ga0307409_100017566 | 3300031995 | Bacteria | 4774 |
| 512 | Ga0307409_100056097 | 3300031995 | Bacteria | 3045 |
| 513 | Ga0307409_100066444 | 3300031995 | Bacteria | 2844 |
| 514 | Ga0307409_100091978 | 3300031995 | Bacteria | 2488 |
| 515 | Ga0307409_100182248 | 3300031995 | Bacteria | 1860 |
| 516 | Ga0307409_100357287 | 3300031995 | Bacteria | 1381 |
| 517 | Ga0307416_100028146 | 3300032002 | Bacteria | 4175 |
| 518 | Ga0307416_100060399 | 3300032002 | Bacteria | 3087 |
| 519 | Ga0307416_100240649 | 3300032002 | Bacteria | 1753 |
| 520 | Ga0307416_100309296 | 3300032002 | Bacteria | 1576 |
| 521 | Ga0307416_100348654 | 3300032002 | Bacteria | 1497 |
| 522 | Ga0307416_100379049 | 3300032002 | Bacteria | 1444 |
| 523 | Ga0307416_100401692 | 3300032002 | Bacteria | 1408 |
| 524 | Ga0307416_100982852 | 3300032002 | Bacteria | 947 |
| 525 | Ga0307416_101021688 | 3300032002 | Bacteria | 930 |
| 526 | Ga0307416_101285132 | 3300032002 | Bacteria | 838 |
| 527 | Ga0307416_101719263 | 3300032002 | Bacteria | 732 |
| 528 | Ga0307414_10100122 | 3300032004 | Bacteria | 2179 |
| 529 | Ga0307411_10114352 | 3300032005 | Bacteria | 1939 |
| 530 | Ga0307411_10445148 | 3300032005 | Bacteria | 1082 |
| 531 | Ga0307411_10977401 | 3300032005 | Bacteria | 757 |
| 532 | Ga0307415_100003017 | 3300032126 | Bacteria | 8473 |
| 533 | Ga0307415_100069572 | 3300032126 | Bacteria | 2469 |
| 534 | Ga0307415_100132044 | 3300032126 | Bacteria | 1892 |
| 535 | Ga0307415_100133214 | 3300032126 | Bacteria | 1885 |
| 536 | Ga0307415_100218137 | 3300032126 | Bacteria | 1527 |
| 537 | Ga0307415_100318338 | 3300032126 | Bacteria | 1296 |
| 538 | Ga0307415_100363516 | 3300032126 | Bacteria | 1223 |
| 539 | Ga0307415_100514303 | 3300032126 | Bacteria | 1049 |
| 540 | Ga0307415_100794725 | 3300032126 | Bacteria | 863 |
| 541 | Ga0373944_0113250 | 3300035089 | Bacteria | 928 |
| 542 | Ga0373960_0042544 | 3300035121 | Bacteria | 1319 |
| 543 | Ga0373943_0051887 | 3300035170 | Bacteria | 2021 |
| 544 | Ga0373946_0274255 | 3300035171 | Bacteria | 828 |
| 545 | Ga0373955_0624287 | 3300035172 | Bacteria | 660 |
| 546 | Ga0373961_0085827 | 3300035241 | Bacteria | 998 |
| 547 | Ga0373931_0030150 | 3300035691 | Bacteria | 2791 |
| 548 | Ga0373931_0187096 | 3300035691 | Bacteria | 1230 |
| 549 | Ga0373927_0173552 | 3300035695 | Bacteria | 1414 |
| 550 | Ga0373947_0138010 | 3300035725 | Bacteria | 1562 |
| 551 | Ga0373925_0517403 | 3300037068 | Bacteria | 980 |
| 552 | Ga0395899_0204295 | 3300037312 | Bacteria | 1376 |
| 553 | Ga0395900_0717592 | 3300037418 | Bacteria | 932 |
| 554 | Ga0395900_0736322 | 3300037418 | Bacteria | 917 |
| 555 | Ga0395900_1120423 | 3300037418 | Bacteria | 704 |
| 556 | Ga0395898_0047298 | 3300037466 | Bacteria | 4223 |
| 557 | Ga0395898_0181894 | 3300037466 | Bacteria | 2009 |
| 558 | Ga0395898_0384537 | 3300037466 | Bacteria | 1338 |
| 559 | Ga0395898_0421362 | 3300037466 | Bacteria | 1272 |
| 560 | Ga0395898_0445794 | 3300037466 | Bacteria | 1233 |
| 561 | Ga0395905_0441897 | 3300037471 | Bacteria | 1198 |
| 562 | Ga0395905_0492484 | 3300037471 | Bacteria | 1126 |
| 563 | Ga0436364_0069355 | 3300037853 | Bacteria | 825 |
| 564 | Ga0436364_0637349 | 3300037853 | Bacteria | 2787 |
| 565 | Ga0395901_0009771 | 3300038443 | Bacteria | 9729 |
| 566 | Ga0395901_0026246 | 3300038443 | Bacteria | 5980 |
| 567 | Ga0395901_0096926 | 3300038443 | Bacteria | 3091 |
| 568 | Ga0395901_0172676 | 3300038443 | Bacteria | 2268 |
| 569 | Ga0395901_0285448 | 3300038443 | Bacteria | 1714 |
| 570 | Ga0395901_0946536 | 3300038443 | Bacteria | 840 |
| 571 | Ga0395901_0988665 | 3300038443 | Bacteria | 818 |
| 572 | Ga0436365_0367556 | 3300039437 | Bacteria | 5407 |
| 573 | Ga0436365_0869569 | 3300039437 | Bacteria | 690 |
| 574 | Ga0436365_1517862 | 3300039437 | Bacteria | 5102 |
| 575 | Ga0436363_0311232 | 3300039450 | Bacteria | 675 |
| 576 | Ga0436363_1637204 | 3300039450 | Bacteria | 1004 |
| 577 | Ga0436362_0383083 | 3300039453 | Bacteria | 1374 |
| 578 | Ga0436362_0577753 | 3300039453 | Bacteria | 820 |
| 579 | Ga0451853_0704132 | 3300041512 | Bacteria | 1834 |
| 580 | Ga0466969_0030135 | 3300044656 | Bacteria | 2766 |
| 581 | Ga0466965_0101923 | 3300044683 | Bacteria | 1469 |
| 582 | Ga0466965_0641259 | 3300044683 | Bacteria | 606 |
| 583 | Ga0466966_0014445 | 3300044684 | Bacteria | 5228 |
| 584 | Ga0466966_0040633 | 3300044684 | Bacteria | 2993 |
| 585 | Ga0466966_0074139 | 3300044684 | Bacteria | 2128 |
| 586 | Ga0466966_0378420 | 3300044684 | Bacteria | 851 |
| 587 | Ga0466961_0004147 | 3300044693 | Bacteria | 9049 |
| 588 | Ga0466961_0103773 | 3300044693 | Bacteria | 1790 |
| 589 | Ga0466961_0342961 | 3300044693 | Bacteria | 910 |
| 590 | Ga0466963_0016615 | 3300044694 | Bacteria | 4578 |
| 591 | Ga0466963_0251045 | 3300044694 | Bacteria | 1241 |
| 592 | Ga0466963_0565513 | 3300044694 | Bacteria | 803 |
| 593 | Ga0466963_0627894 | 3300044694 | Bacteria | 758 |
| 594 | Ga0466963_0854409 | 3300044694 | Bacteria | 642 |
| 595 | Ga0466964_0091450 | 3300044706 | Bacteria | 1325 |
| 596 | Ga0466964_0214286 | 3300044706 | Bacteria | 932 |
| 597 | Ga0466971_0169199 | 3300044719 | Bacteria | 1025 |
| 598 | Ga0466968_0023973 | 3300044735 | Bacteria | 2491 |
| 599 | Ga0466968_0030132 | 3300044735 | Bacteria | 2247 |
| 600 | Ga0466970_0186309 | 3300044765 | Bacteria | 1152 |
| 601 | Ga0466970_0198559 | 3300044765 | Bacteria | 1116 |
| 602 | Ga0466957_0005022 | 3300044842 | Bacteria | 7408 |
| 603 | Ga0466957_0196176 | 3300044842 | Bacteria | 1324 |
| 604 | Ga0466957_0198208 | 3300044842 | Bacteria | 1318 |
| 605 | Ga0466957_0498444 | 3300044842 | Bacteria | 844 |
| 606 | Ga0466957_0539345 | 3300044842 | Bacteria | 812 |
| 607 | Ga0466957_0561600 | 3300044842 | Bacteria | 796 |
| 608 | Ga0466960_0025275 | 3300044901 | Bacteria | 2686 |
| 609 | Ga0466960_0079028 | 3300044901 | Bacteria | 1653 |
| 610 | Ga0466960_0173092 | 3300044901 | Bacteria | 1166 |
| 611 | Ga0466960_0245859 | 3300044901 | Bacteria | 992 |
| 612 | Ga0466960_0278035 | 3300044901 | Bacteria | 937 |
| 613 | Ga0466959_0025843 | 3300045049 | Bacteria | 4354 |
| 614 | Ga0466959_0029413 | 3300045049 | Bacteria | 4070 |
| 615 | Ga0466959_0189196 | 3300045049 | Bacteria | 1437 |
| 616 | Ga0466958_0008664 | 3300045836 | Bacteria | 5648 |
| 617 | Ga0466958_0036525 | 3300045836 | Bacteria | 2941 |
| 618 | Ga0466958_0052338 | 3300045836 | Bacteria | 2475 |
| 619 | Ga0466958_0137732 | 3300045836 | Bacteria | 1536 |
| 620 | Ga0466967_0005031 | 3300045976 | Bacteria | 9059 |
| 621 | Ga0466967_0023219 | 3300045976 | Bacteria | 5079 |
| 622 | Ga0466967_0027316 | 3300045976 | Bacteria | 4746 |
| 623 | Ga0466967_0132475 | 3300045976 | Bacteria | 2315 |
| 624 | Ga0466967_0215269 | 3300045976 | Bacteria | 1823 |
| 625 | Ga0466967_0225689 | 3300045976 | Bacteria | 1782 |
| 626 | Ga0466967_0251445 | 3300045976 | Bacteria | 1688 |
| 627 | Ga0466967_0297834 | 3300045976 | Bacteria | 1551 |
| 628 | Ga0466967_0494918 | 3300045976 | Bacteria | 1199 |
| 629 | Ga0466967_0523551 | 3300045976 | Bacteria | 1165 |
| 630 | Ga0466967_0572986 | 3300045976 | Bacteria | 1112 |
| 631 | Ga0495603_0144193 | 3300046455 | Bacteria | 1385 |
| 632 | Ga0495603_0406041 | 3300046455 | Bacteria | 781 |
| 633 | Ga0495629_0007258 | 3300046459 | Bacteria | 8163 |
| 634 | Ga0495629_0105003 | 3300046459 | Bacteria | 1970 |
| 635 | Ga0495629_0411793 | 3300046459 | Bacteria | 918 |
| 636 | Ga0495641_0010982 | 3300046461 | Bacteria | 5199 |
| 637 | Ga0495653_0000179 | 3300046463 | Bacteria | 52301 |
| 638 | Ga0495580_0336198 | 3300046472 | Bacteria | 1025 |
| 639 | Ga0495582_0257222 | 3300046473 | Bacteria | 1002 |
| 640 | Ga0495605_0142622 | 3300046474 | Bacteria | 1074 |
| 641 | Ga0495664_0000012 | 3300046477 | Bacteria | 226118 |
| 642 | Ga0495664_0288244 | 3300046477 | Bacteria | 992 |
| 643 | Ga0495594_0000011 | 3300046499 | Bacteria | 118444 |
| 644 | Ga0495606_0000586 | 3300046507 | Bacteria | 57795 |
| 645 | Ga0495608_0120798 | 3300046511 | Bacteria | 1680 |
| 646 | Ga0495618_0000352 | 3300046514 | Bacteria | 32977 |
| 647 | Ga0495628_0370922 | 3300046516 | Bacteria | 1050 |
| 648 | Ga0495630_0000075 | 3300046517 | Bacteria | 77378 |
| 649 | Ga0495630_0011902 | 3300046517 | Bacteria | 6307 |
| 650 | Ga0495644_0123461 | 3300046523 | Bacteria | 986 |
| 651 | Ga0495644_0150753 | 3300046523 | Bacteria | 890 |
| 652 | Ga0495652_0053133 | 3300046529 | Bacteria | 3454 |
| 653 | Ga0495586_0261191 | 3300046535 | Bacteria | 989 |
| 654 | Ga0495586_0307438 | 3300046535 | Bacteria | 909 |
| 655 | Ga0495597_0126169 | 3300046542 | Bacteria | 1064 |
| 656 | Ga0495645_0000012 | 3300046543 | Bacteria | 209044 |
| 657 | Ga0495667_0348810 | 3300046559 | Bacteria | 935 |
| 658 | Ga0495656_0194779 | 3300046615 | Bacteria | 1003 |
| 659 | Ga0495657_0000007 | 3300046675 | Bacteria | 222471 |
| 660 | Ga0495599_0465602 | 3300046678 | Bacteria | 747 |
| 661 | Ga0495647_0000419 | 3300046681 | Bacteria | 12163 |
| 662 | Ga0495624_0000027 | 3300046690 | Bacteria | 93611 |
| 663 | Ga0495600_0028472 | 3300046809 | Bacteria | 3615 |
| 664 | Ga0495660_0055941 | 3300046810 | Bacteria | 2134 |
| 665 | Ga0495674_0207925 | 3300047319 | Bacteria | 1622 |
| 666 | Ga0495672_0054488 | 3300047320 | Bacteria | 2337 |
| 667 | Ga0495676_0019702 | 3300047321 | Bacteria | 5930 |
| 668 | Ga0495676_0227660 | 3300047321 | Bacteria | 1282 |
| 669 | Ga0495680_0055337 | 3300047322 | Bacteria | 3078 |
| 670 | Ga0495677_0134406 | 3300047445 | Bacteria | 948 |
| 671 | Ga0495684_0002969 | 3300047471 | Bacteria | 13357 |
| 672 | Ga0495684_0036602 | 3300047471 | Bacteria | 3762 |
| 673 | Ga0495593_0018850 | 3300047673 | Bacteria | 3873 |
| 674 | Ga0495593_0118145 | 3300047673 | Bacteria | 1351 |
| 675 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 676 | Ga0496100_0005518 | 3300048903 | Bacteria | 6825 |
| 677 | Ga0496100_0005686 | 3300048903 | Bacteria | 6744 |
| 678 | Ga0496100_0011761 | 3300048903 | Bacteria | 4992 |
| 679 | Ga0496100_0061411 | 3300048903 | Bacteria | 2477 |
| 680 | Ga0496100_0375744 | 3300048903 | Bacteria | 1078 |
| 681 | Ga0496100_0669049 | 3300048903 | Bacteria | 809 |
| 682 | Ga0496100_0695007 | 3300048903 | Bacteria | 794 |
| 683 | Ga0496101_0000004 | 3300048904 | Bacteria | 331599 |
| 684 | Ga0496101_0005308 | 3300048904 | Bacteria | 8206 |
| 685 | Ga0496101_0011694 | 3300048904 | Bacteria | 5832 |
| 686 | Ga0496101_0243794 | 3300048904 | Bacteria | 1399 |
| 687 | Ga0496102_0000027 | 3300048905 | Bacteria | 225466 |
| 688 | Ga0496102_0001758 | 3300048905 | Bacteria | 18871 |
| 689 | Ga0496102_0012087 | 3300048905 | Bacteria | 7460 |
| 690 | Ga0496102_0076150 | 3300048905 | Bacteria | 3085 |
| 691 | Ga0496102_0081859 | 3300048905 | Bacteria | 2977 |
| 692 | Ga0496102_0138760 | 3300048905 | Bacteria | 2279 |
| 693 | Ga0496103_0001348 | 3300048906 | Bacteria | 16570 |
| 694 | Ga0496103_0007177 | 3300048906 | Bacteria | 6644 |
| 695 | Ga0496103_0009119 | 3300048906 | Bacteria | 5875 |
| 696 | Ga0496103_0086878 | 3300048906 | Bacteria | 1971 |
| 697 | Ga0496104_0000026 | 3300048907 | Bacteria | 210098 |
| 698 | Ga0496104_0003438 | 3300048907 | Bacteria | 13654 |
| 699 | Ga0496104_0015713 | 3300048907 | Bacteria | 6866 |
| 700 | Ga0496104_0065216 | 3300048907 | Bacteria | 3455 |
| 701 | Ga0496104_0194632 | 3300048907 | Bacteria | 1940 |
| 702 | Ga0496104_0450871 | 3300048907 | Bacteria | 1198 |
| 703 | Ga0496104_0877699 | 3300048907 | Bacteria | 802 |
| 704 | Ga0496105_0023481 | 3300048908 | Bacteria | 5002 |
| 705 | Ga0496105_0092970 | 3300048908 | Bacteria | 2490 |
| 706 | Ga0496105_0170169 | 3300048908 | Bacteria | 1786 |
| 707 | Ga0496105_0348997 | 3300048908 | Bacteria | 1182 |
| 708 | Ga0496105_0463918 | 3300048908 | Bacteria | 998 |
| 709 | Ga0496106_0000414 | 3300048909 | Bacteria | 30298 |
| 710 | Ga0496106_0029323 | 3300048909 | Bacteria | 4101 |
| 711 | Ga0496106_0029356 | 3300048909 | Bacteria | 4097 |
| 712 | Ga0496106_0044920 | 3300048909 | Bacteria | 3317 |
| 713 | Ga0496106_0062139 | 3300048909 | Bacteria | 2835 |
| 714 | Ga0496106_0065354 | 3300048909 | Bacteria | 2770 |
| 715 | Ga0496107_0000005 | 3300048910 | Bacteria | 281747 |
| 716 | Ga0496107_0008283 | 3300048910 | Bacteria | 7191 |
| 717 | Ga0496107_0009275 | 3300048910 | Bacteria | 6822 |
| 718 | Ga0496107_0239060 | 3300048910 | Bacteria | 1351 |
| 719 | Ga0496107_0569221 | 3300048910 | Unclassified | 838 |
| 720 | Ga0496107_0608924 | 3300048910 | Bacteria | 807 |
| 721 | Ga0496108_0006662 | 3300048911 | Bacteria | 9355 |
| 722 | Ga0496108_0042757 | 3300048911 | Bacteria | 3783 |
| 723 | Ga0496108_0161303 | 3300048911 | Bacteria | 1938 |
| 724 | Ga0496108_0429061 | 3300048911 | Bacteria | 1154 |
| 725 | Ga0496108_1187811 | 3300048911 | Unclassified | 645 |
| 726 | Ga0496109_0023996 | 3300048912 | Bacteria | 5417 |
| 727 | Ga0496109_0111247 | 3300048912 | Bacteria | 2547 |
| 728 | Ga0496109_0122434 | 3300048912 | Bacteria | 2424 |
| 729 | Ga0496109_0187399 | 3300048912 | Bacteria | 1944 |
| 730 | Ga0496109_0373958 | 3300048912 | Bacteria | 1346 |
| 731 | Ga0496109_0451959 | 3300048912 | Bacteria | 1213 |
| 732 | Ga0496109_0594754 | 3300048912 | Bacteria | 1042 |
| 733 | Ga0496110_0000242 | 3300048913 | Bacteria | 35454 |
| 734 | Ga0496110_0000716 | 3300048913 | Bacteria | 22903 |
| 735 | Ga0496110_0003019 | 3300048913 | Bacteria | 12771 |
| 736 | Ga0496110_0062723 | 3300048913 | Bacteria | 3283 |
| 737 | Ga0496110_0113433 | 3300048913 | Bacteria | 2438 |
| 738 | Ga0496110_0502409 | 3300048913 | Bacteria | 1104 |
| 739 | Ga0496110_0808958 | 3300048913 | Bacteria | 842 |
| 740 | Ga0496110_0954202 | 3300048913 | Bacteria | 764 |
| 741 | Ga0496111_0000366 | 3300048914 | Bacteria | 22446 |
| 742 | Ga0496111_0001332 | 3300048914 | Bacteria | 13911 |
| 743 | Ga0496111_0004875 | 3300048914 | Bacteria | 8519 |
| 744 | Ga0496111_0011253 | 3300048914 | Bacteria | 6023 |
| 745 | Ga0496111_0032700 | 3300048914 | Bacteria | 3709 |
| 746 | Ga0496111_0066011 | 3300048914 | Bacteria | 2627 |
| 747 | Ga0496111_0284439 | 3300048914 | Unclassified | 1227 |
| 748 | Ga0496111_0310200 | 3300048914 | Bacteria | 1169 |
| 749 | Ga0496112_0000200 | 3300048915 | Bacteria | 39289 |
| 750 | Ga0496112_0007945 | 3300048915 | Bacteria | 9459 |
| 751 | Ga0496112_0025245 | 3300048915 | Bacteria | 5704 |
| 752 | Ga0496112_0045162 | 3300048915 | Bacteria | 4318 |
| 753 | Ga0496112_0124638 | 3300048915 | Bacteria | 2547 |
| 754 | Ga0496112_0180021 | 3300048915 | Bacteria | 2078 |
| 755 | Ga0496112_0511496 | 3300048915 | Bacteria | 1136 |
| 756 | Ga0496112_0554970 | 3300048915 | Bacteria | 1082 |
| 757 | Ga0496112_0617699 | 3300048915 | Bacteria | 1015 |
| 758 | Ga0496112_0821146 | 3300048915 | Bacteria | 854 |
| 759 | Ga0496113_0000027 | 3300048916 | Bacteria | 63463 |
| 760 | Ga0496113_0009548 | 3300048916 | Bacteria | 6363 |
| 761 | Ga0496113_0090241 | 3300048916 | Bacteria | 2360 |
| 762 | Ga0496113_0118977 | 3300048916 | Bacteria | 2063 |
| 763 | Ga0496114_0181378 | 3300048917 | Bacteria | 1839 |
| 764 | Ga0496114_0467708 | 3300048917 | Bacteria | 1116 |
| 765 | Ga0496114_0640806 | 3300048917 | Bacteria | 935 |
| 766 | Ga0496114_0733901 | 3300048917 | Bacteria | 864 |
| 767 | Ga0496115_0000143 | 3300048918 | Bacteria | 65909 |
| 768 | Ga0496115_0055013 | 3300048918 | Bacteria | 3196 |
| 769 | Ga0496115_0411658 | 3300048918 | Bacteria | 1096 |
| 770 | Ga0496115_0468815 | 3300048918 | Bacteria | 1015 |
| 771 | Ga0496116_0000176 | 3300048919 | Bacteria | 128426 |
| 772 | Ga0496117_0012250 | 3300048920 | Bacteria | 7582 |
| 773 | Ga0496118_0005822 | 3300048921 | Bacteria | 13815 |
| 774 | Ga0496118_0189826 | 3300048921 | Bacteria | 1230 |
| 775 | Ga0496119_0022041 | 3300048922 | Bacteria | 4578 |
| 776 | Ga0496119_0045653 | 3300048922 | Bacteria | 2744 |
| 777 | Ga0496120_0008785 | 3300048923 | Bacteria | 7261 |
| 778 | Ga0496121_0128403 | 3300048924 | Bacteria | 1902 |
| 779 | Ga0496121_0193951 | 3300048924 | Bacteria | 1454 |
| 780 | Ga0496124_0017107 | 3300048927 | Bacteria | 6855 |
| 781 | Ga0496126_0373062 | 3300048929 | Bacteria | 1163 |
| 782 | Ga0501291_059373 | 3300049514 | Bacteria | 716 |
| 783 | Ga0501031_0004602 | 3300049568 | Bacteria | 8945 |
| 784 | Ga0501031_0012782 | 3300049568 | Bacteria | 5486 |
| 785 | Ga0501031_0019873 | 3300049568 | Bacteria | 4378 |
| 786 | Ga0501031_0087685 | 3300049568 | Bacteria | 2029 |
| 787 | Ga0501032_0002323 | 3300049569 | Bacteria | 14908 |
| 788 | Ga0501032_0005183 | 3300049569 | Bacteria | 9712 |
| 789 | Ga0501033_0001255 | 3300049570 | Bacteria | 22735 |
| 790 | Ga0501033_0028212 | 3300049570 | Bacteria | 4219 |
| 791 | Ga0501033_0051742 | 3300049570 | Bacteria | 3045 |
| 792 | Ga0501033_0626742 | 3300049570 | Bacteria | 736 |
| 793 | Ga0501034_0016423 | 3300049571 | Bacteria | 7598 |
| 794 | Ga0501034_0174514 | 3300049571 | Bacteria | 2116 |
| 795 | Ga0501034_0367342 | 3300049571 | Bacteria | 1365 |
| 796 | Ga0501034_0710376 | 3300049571 | Bacteria | 903 |
| 797 | Ga0501034_0939652 | 3300049571 | Bacteria | 751 |
| 798 | Ga0501036_0004619 | 3300049572 | Bacteria | 11128 |
| 799 | Ga0501036_0100530 | 3300049572 | Bacteria | 2446 |
| 800 | Ga0501036_0161191 | 3300049572 | Bacteria | 1891 |
| 801 | Ga0501036_0178674 | 3300049572 | Bacteria | 1787 |
| 802 | Ga0501036_0507748 | 3300049572 | Bacteria | 1003 |
| 803 | Ga0501036_0621470 | 3300049572 | Bacteria | 895 |
| 804 | Ga0501037_0002105 | 3300049573 | Bacteria | 14423 |
| 805 | Ga0501037_0084212 | 3300049573 | Bacteria | 2303 |
| 806 | Ga0501038_0003549 | 3300049574 | Bacteria | 14517 |
| 807 | Ga0501038_0028808 | 3300049574 | Bacteria | 4929 |
| 808 | Ga0501038_0339781 | 3300049574 | Bacteria | 1171 |
| 809 | Ga0501039_0015041 | 3300049575 | Bacteria | 5920 |
| 810 | Ga0501039_0016303 | 3300049575 | Bacteria | 5693 |
| 811 | Ga0501039_0051757 | 3300049575 | Bacteria | 3177 |
| 812 | Ga0501039_0551106 | 3300049575 | Bacteria | 905 |
| 813 | Ga0501039_0777105 | 3300049575 | Bacteria | 747 |
| 814 | Ga0501040_0014377 | 3300049576 | Bacteria | 5215 |
| 815 | Ga0501040_0046498 | 3300049576 | Bacteria | 2963 |
| 816 | Ga0501041_0024970 | 3300049577 | Bacteria | 3590 |
| 817 | Ga0501041_0073997 | 3300049577 | Bacteria | 2093 |
| 818 | Ga0501041_0108610 | 3300049577 | Bacteria | 1721 |
| 819 | Ga0501041_0196994 | 3300049577 | Bacteria | 1262 |
| 820 | Ga0501041_0208496 | 3300049577 | Bacteria | 1226 |
| 821 | Ga0501042_0039746 | 3300049578 | Bacteria | 3344 |
| 822 | Ga0501042_0065224 | 3300049578 | Bacteria | 2602 |
| 823 | Ga0501042_0081645 | 3300049578 | Bacteria | 2317 |
| 824 | Ga0501042_0092955 | 3300049578 | Bacteria | 2166 |
| 825 | Ga0501042_0103883 | 3300049578 | Bacteria | 2044 |
| 826 | Ga0501042_0250936 | 3300049578 | Bacteria | 1277 |
| 827 | Ga0501043_0002925 | 3300049579 | Bacteria | 14258 |
| 828 | Ga0501043_0081375 | 3300049579 | Bacteria | 2544 |
| 829 | Ga0501043_0428448 | 3300049579 | Bacteria | 997 |
| 830 | Ga0501046_0003552 | 3300049580 | Bacteria | 14279 |
| 831 | Ga0501046_0009834 | 3300049580 | Bacteria | 8247 |
| 832 | Ga0501046_0100685 | 3300049580 | Bacteria | 2217 |
| 833 | Ga0501046_0291423 | 3300049580 | Bacteria | 1194 |
| 834 | Ga0501046_0483342 | 3300049580 | Bacteria | 888 |
| 835 | Ga0501047_0002361 | 3300049581 | Bacteria | 18047 |
| 836 | Ga0501047_0057684 | 3300049581 | Bacteria | 3754 |
| 837 | Ga0501047_0061159 | 3300049581 | Bacteria | 3634 |
| 838 | Ga0501047_0085868 | 3300049581 | Bacteria | 3023 |
| 839 | Ga0501047_0119545 | 3300049581 | Bacteria | 2517 |
| 840 | Ga0501047_0125226 | 3300049581 | Bacteria | 2450 |
| 841 | Ga0501047_0134553 | 3300049581 | Bacteria | 2352 |
| 842 | Ga0501047_0274239 | 3300049581 | Bacteria | 1532 |
| 843 | Ga0501048_0002577 | 3300049582 | Bacteria | 13867 |
| 844 | Ga0501048_0198898 | 3300049582 | Bacteria | 1420 |
| 845 | Ga0501048_0290307 | 3300049582 | Bacteria | 1163 |
| 846 | Ga0501048_0456802 | 3300049582 | Bacteria | 915 |
| 847 | Ga0501067_0003591 | 3300049583 | Bacteria | 8545 |
| 848 | Ga0501068_0009293 | 3300049584 | Bacteria | 5496 |
| 849 | Ga0501068_0031540 | 3300049584 | Bacteria | 3148 |
| 850 | Ga0501068_0353264 | 3300049584 | Bacteria | 945 |
| 851 | Ga0501069_0003034 | 3300049585 | Bacteria | 8625 |
| 852 | Ga0501069_0047028 | 3300049585 | Bacteria | 2394 |
| 853 | Ga0501069_0079700 | 3300049585 | Bacteria | 1843 |
| 854 | Ga0501069_0218953 | 3300049585 | Bacteria | 1106 |
| 855 | Ga0501070_0000832 | 3300049586 | Bacteria | 28030 |
| 856 | Ga0501070_0009212 | 3300049586 | Bacteria | 8349 |
| 857 | Ga0501070_0338896 | 3300049586 | Bacteria | 1221 |
| 858 | Ga0501071_0041672 | 3300049587 | Bacteria | 3288 |
| 859 | Ga0501071_0053674 | 3300049587 | Bacteria | 2907 |
| 860 | Ga0501071_0076231 | 3300049587 | Bacteria | 2449 |
| 861 | Ga0501072_0007453 | 3300049588 | Bacteria | 8299 |
| 862 | Ga0501072_0016434 | 3300049588 | Bacteria | 5682 |
| 863 | Ga0501072_0121775 | 3300049588 | Bacteria | 2079 |
| 864 | Ga0501072_0247865 | 3300049588 | Bacteria | 1418 |
| 865 | Ga0501072_0561092 | 3300049588 | Bacteria | 901 |
| 866 | Ga0501073_0007834 | 3300049589 | Bacteria | 7930 |
| 867 | Ga0501073_0009603 | 3300049589 | Bacteria | 7134 |
| 868 | Ga0501074_0007166 | 3300049590 | Bacteria | 8051 |
| 869 | Ga0501074_0035154 | 3300049590 | Bacteria | 3630 |
| 870 | Ga0501074_0040709 | 3300049590 | Bacteria | 3364 |
| 871 | Ga0501074_0083958 | 3300049590 | Bacteria | 2283 |
| 872 | Ga0501074_0295117 | 3300049590 | Bacteria | 1152 |
| 873 | Ga0501074_0376689 | 3300049590 | Bacteria | 1007 |
| 874 | Ga0501075_0013118 | 3300049591 | Bacteria | 5909 |
| 875 | Ga0501075_0148563 | 3300049591 | Bacteria | 1786 |
| 876 | Ga0501076_0023338 | 3300049592 | Bacteria | 4767 |
| 877 | Ga0501076_0056905 | 3300049592 | Bacteria | 3104 |
| 878 | Ga0501076_0100517 | 3300049592 | Bacteria | 2330 |
| 879 | Ga0501076_0309229 | 3300049592 | Bacteria | 1296 |
| 880 | Ga0501076_0341570 | 3300049592 | Bacteria | 1229 |
| 881 | Ga0501079_0009011 | 3300049741 | Bacteria | 7557 |
| 882 | Ga0501079_0039174 | 3300049741 | Bacteria | 3655 |
| 883 | Ga0501079_0041381 | 3300049741 | Bacteria | 3556 |
| 884 | Ga0501079_0176701 | 3300049741 | Bacteria | 1665 |
| 885 | Ga0501080_0007024 | 3300049742 | Bacteria | 10165 |
| 886 | Ga0501080_0042368 | 3300049742 | Bacteria | 4239 |
| 887 | Ga0501080_0267252 | 3300049742 | Bacteria | 1557 |
| 888 | Ga0501080_0299224 | 3300049742 | Bacteria | 1459 |
| 889 | Ga0501080_1049355 | 3300049742 | Bacteria | 705 |
| 890 | Ga0501081_0058683 | 3300049743 | Bacteria | 2663 |
| 891 | Ga0501083_0002406 | 3300049744 | Bacteria | 12801 |
| 892 | Ga0501083_0027131 | 3300049744 | Bacteria | 3953 |
| 893 | Ga0501083_0038323 | 3300049744 | Bacteria | 3259 |
| 894 | Ga0501083_0114676 | 3300049744 | Bacteria | 1769 |
| 895 | Ga0501035_0004128 | 3300049822 | Bacteria | 13802 |
| 896 | Ga0501035_0022019 | 3300049822 | Bacteria | 5855 |
| 897 | Ga0501035_0259373 | 3300049822 | Bacteria | 1474 |
| 898 | Ga0501044_0000684 | 3300049823 | Bacteria | 40967 |
| 899 | Ga0501044_0022596 | 3300049823 | Bacteria | 6702 |
| 900 | Ga0501044_0064508 | 3300049823 | Bacteria | 3739 |
| 901 | Ga0501045_0053737 | 3300049824 | Bacteria | 2943 |
| 902 | Ga0501045_0094821 | 3300049824 | Bacteria | 2207 |
| 903 | Ga0501045_0140998 | 3300049824 | Bacteria | 1792 |
| 904 | Ga0501045_0365148 | 3300049824 | Bacteria | 1074 |
| 905 | Ga0501045_0540533 | 3300049824 | Bacteria | 864 |
| 906 | nmdc:mga00v17_165783_c1 | 3300050491 | Bacteria | 1423 |
| 907 | nmdc:mga00v17_387567_c1 | 3300050491 | Bacteria | 908 |
| 908 | nmdc:mga00v17_495179_c1 | 3300050491 | Bacteria | 792 |
| 909 | nmdc:mga05p37_1164634_c1 | 3300050507 | Bacteria | 800 |
| 910 | nmdc:mga05p37_140993_c1 | 3300050507 | Bacteria | 2953 |
| 911 | nmdc:mga05p37_1604883_c1 | 3300050507 | Bacteria | 640 |
| 912 | nmdc:mga05p37_262700_c1 | 3300050507 | Bacteria | 2065 |
| 913 | nmdc:mga05p37_45564_c1 | 3300050507 | Bacteria | 5393 |
| 914 | nmdc:mga05p37_478418_c1 | 3300050507 | Bacteria | 1435 |
| 915 | nmdc:mga05p37_704595_c1 | 3300050507 | Bacteria | 1121 |
| 916 | nmdc:mga09592_163983_c1 | 3300050508 | Bacteria | 1920 |
| 917 | nmdc:mga09592_19237_c1 | 3300050508 | Bacteria | 5605 |
| 918 | nmdc:mga09592_385900_c1 | 3300050508 | Bacteria | 1211 |
| 919 | nmdc:mga09592_390814_c1 | 3300050508 | Bacteria | 1202 |
| 920 | nmdc:mga09592_6990_c1 | 3300050508 | Bacteria | 9174 |
| 921 | nmdc:mga0qj67_334433_c1 | 3300050509 | Bacteria | 1225 |
| 922 | nmdc:mga0qj67_50370_c1 | 3300050509 | Bacteria | 3293 |
| 923 | nmdc:mga0qj67_5408_c1 | 3300050509 | Bacteria | 9321 |
| 924 | nmdc:mga0qj67_70656_c1 | 3300050509 | Bacteria | 2785 |
| 925 | nmdc:mga06r32_13488_c1 | 3300050510 | Bacteria | 7405 |
| 926 | nmdc:mga06r32_190968_c1 | 3300050510 | Bacteria | 2036 |
| 927 | nmdc:mga06r32_32616_c1 | 3300050510 | Bacteria | 4902 |
| 928 | nmdc:mga08y16_118758_c1 | 3300050511 | Bacteria | 2752 |
| 929 | nmdc:mga08y16_190763_c1 | 3300050511 | Bacteria | 2126 |
| 930 | nmdc:mga08y16_276486_c1 | 3300050511 | Bacteria | 1733 |
| 931 | nmdc:mga08y16_35631_c1 | 3300050511 | Bacteria | 5226 |
| 932 | nmdc:mga08y16_37510_c1 | 3300050511 | Bacteria | 5089 |
| 933 | nmdc:mga08y16_652245_c1 | 3300050511 | Bacteria | 1057 |
| 934 | nmdc:mga0n895_121418_c1 | 3300050512 | Bacteria | 2634 |
| 935 | nmdc:mga0n895_326177_c1 | 3300050512 | Bacteria | 1555 |
| 936 | nmdc:mga0n895_601864_c1 | 3300050512 | Bacteria | 1101 |
| 937 | nmdc:mga0n895_64787_c1 | 3300050512 | Bacteria | 3615 |
| 938 | nmdc:mga0rr50_193863_c1 | 3300050513 | Bacteria | 1666 |
| 939 | nmdc:mga0a205_220706_c1 | 3300050515 | Bacteria | 1781 |
| 940 | nmdc:mga0a205_51769_c1 | 3300050515 | Bacteria | 3964 |
| 941 | nmdc:mga0a205_828417_c1 | 3300050515 | Bacteria | 773 |
| 942 | Ga0495601_0000595 | 3300053077 | Bacteria | 19251 |
| 943 | Ga0495601_0005015 | 3300053077 | Bacteria | 7684 |
| 944 | Ga0495601_0006880 | 3300053077 | Bacteria | 6662 |
| 945 | Ga0495612_0000023 | 3300053078 | Bacteria | 118413 |
| 946 | Ga0495612_0002167 | 3300053078 | Bacteria | 8080 |
| 947 | Ga0495655_0073885 | 3300053083 | Bacteria | 959 |
| 948 | Ga0495655_0080651 | 3300053083 | Bacteria | 930 |
| 949 | Ga0495619_0000047 | 3300053085 | Bacteria | 102152 |
| 950 | Ga0495619_0123674 | 3300053085 | Bacteria | 1775 |
| 951 | Ga0500568_0175941 | 3300053139 | Bacteria | 787 |
| 952 | Ga0500616_0025481 | 3300053153 | Bacteria | 3280 |
| 953 | Ga0500616_0142130 | 3300053153 | Bacteria | 1120 |
| 954 | Ga0501084_0021707 | 3300054114 | Bacteria | 5353 |
| 955 | Ga0501084_0042468 | 3300054114 | Bacteria | 3804 |
| 956 | Ga0501084_0044658 | 3300054114 | Bacteria | 3710 |
| 957 | Ga0501084_0506402 | 3300054114 | Bacteria | 1020 |
| 958 | Ga0587071_045024 | 3300060344 | Bacteria | 896 |
| 959 | Ga0501082_0008369 | 3300060353 | Bacteria | 8922 |
| 960 | Ga0501082_0046329 | 3300060353 | Bacteria | 3748 |
| 961 | Ga0501082_0068822 | 3300060353 | Bacteria | 3048 |
| 962 | Ga0501082_0090176 | 3300060353 | Bacteria | 2647 |
| 963 | Ga0501082_0698602 | 3300060353 | Bacteria | 888 |
| 964 | Ga0501082_0754966 | 3300060353 | Bacteria | 851 |
| 965 | Ga0466962_0054943 | 3300061719 | Bacteria | 1903 |
| 966 | Ga0466962_0086446 | 3300061719 | Bacteria | 1501 |
| 967 | Ga0530510_0009957 | 3300061734 | Bacteria | 6668 |
| 968 | Ga0530510_0093190 | 3300061734 | Bacteria | 2199 |
| 969 | Ga0530510_0213005 | 3300061734 | Bacteria | 1435 |
| 970 | Ga0530510_0434603 | 3300061734 | Bacteria | 991 |
| 971 | Ga0530510_0555932 | 3300061734 | Bacteria | 872 |
| 972 | Ga0530510_0997689 | 3300061734 | Bacteria | 641 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009098 | Ga0105245_10688910 | Ga0105245_106889101 | 160 |
| 2 | 3300005330 | Ga0070690_100243518 | Ga0070690_1002435182 | 171 |
| 3 | 3300035695 | Ga0373927_0173552 | Ga0373927_0173552_122_715 | 171 |
| 4 | 3300048903 | Ga0496100_0005518 | Ga0496100_0005518_1371_1961 | 171 |
| 5 | 3300048904 | Ga0496101_0005308 | Ga0496101_0005308_2185_2775 | 171 |
| 6 | 3300048909 | Ga0496106_0029356 | Ga0496106_0029356_3242_3832 | 171 |
| 7 | 3300048910 | Ga0496107_0008283 | Ga0496107_0008283_4999_5589 | 171 |
| 8 | 3300048917 | Ga0496114_0181378 | Ga0496114_0181378_357_947 | 171 |
| 9 | 3300005334 | Ga0068869_100186159 | Ga0068869_1001861592 | 172 |
| 10 | 3300035089 | Ga0373944_0113250 | Ga0373944_0113250_48_641 | 173 |
| 11 | 3300035171 | Ga0373946_0274255 | Ga0373946_0274255_224_817 | 173 |
| 12 | 3300035725 | Ga0373947_0138010 | Ga0373947_0138010_587_1180 | 173 |
| 13 | 3300005331 | Ga0070670_100256191 | Ga0070670_1002561912 | 174 |
| 14 | 3300005337 | Ga0070682_100376757 | Ga0070682_1003767572 | 174 |
| 15 | 3300005339 | Ga0070660_100561430 | Ga0070660_1005614302 | 175 |
| 16 | 3300009093 | Ga0105240_10206274 | Ga0105240_102062743 | 175 |
| 17 | 3300009094 | Ga0111539_10954648 | Ga0111539_109546482 | 175 |
| 18 | 3300025901 | Ga0207688_10198878 | Ga0207688_101988782 | 175 |
| 19 | 3300025913 | Ga0207695_10180841 | Ga0207695_101808412 | 175 |
| 20 | 3300028556 | Ga0265337_1012291 | Ga0265337_10122912 | 175 |
| 21 | 3300028558 | Ga0265326_10000833 | Ga0265326_100008332 | 175 |
| 22 | 3300028563 | Ga0265319_1000353 | Ga0265319_100035333 | 175 |
| 23 | 3300028577 | Ga0265318_10001586 | Ga0265318_1000158612 | 175 |
| 24 | 3300028666 | Ga0265336_10000005 | Ga0265336_10000005345 | 175 |
| 25 | 3300028800 | Ga0265338_10000001 | Ga0265338_100000011162 | 175 |
| 26 | 3300031241 | Ga0265325_10085887 | Ga0265325_100858872 | 175 |
| 27 | 3300031247 | Ga0265340_10000001 | Ga0265340_100000011160 | 175 |
| 28 | 3300031344 | Ga0265316_10129048 | Ga0265316_101290482 | 175 |
| 29 | 3300035172 | Ga0373955_0624287 | Ga0373955_0624287_15_548 | 175 |
| 30 | 3300053085 | Ga0495619_0123674 | Ga0495619_0123674_248_895 | 175 |
| 31 | 3300046542 | Ga0495597_0126169 | Ga0495597_0126169_176_766 | 176 |
| 32 | 3300047471 | Ga0495684_0002969 | Ga0495684_0002969_12300_12878 | 176 |
| 33 | 3300048918 | Ga0496115_0000143 | Ga0496115_0000143_60914_61519 | 176 |
| 34 | 3300005548 | Ga0070665_100113050 | Ga0070665_1001130503 | 177 |
| 35 | 3300028379 | Ga0268266_10063353 | Ga0268266_100633535 | 177 |
| 36 | 3300046514 | Ga0495618_0000352 | Ga0495618_0000352_5858_6466 | 177 |
| 37 | 3300047320 | Ga0495672_0054488 | Ga0495672_0054488_672_1259 | 177 |
| 38 | 3300048907 | Ga0496104_0000026 | Ga0496104_0000026_203900_204514 | 177 |
| 39 | 3300048913 | Ga0496110_0000716 | Ga0496110_0000716_16705_17319 | 177 |
| 40 | 3300048914 | Ga0496111_0000366 | Ga0496111_0000366_7632_8246 | 177 |
| 41 | 3300050491 | nmdc:mga00v17_495179_c1 | nmdc:mga00v17_495179_c1_232_768 | 177 |
| 42 | 3300005437 | Ga0070710_10423514 | Ga0070710_104235142 | 178 |
| 43 | 3300020082 | Ga0206353_11218525 | Ga0206353_112185252 | 178 |
| 44 | 3300032126 | Ga0307415_100318338 | Ga0307415_1003183382 | 178 |
| 45 | 3300049571 | Ga0501034_0939652 | Ga0501034_0939652_48_653 | 178 |
| 46 | 3300006038 | Ga0075365_10320280 | Ga0075365_103202802 | 179 |
| 47 | 3300006844 | Ga0075428_100417523 | Ga0075428_1004175232 | 180 |
| 48 | 3300006846 | Ga0075430_100174316 | Ga0075430_1001743162 | 180 |
| 49 | 3300006847 | Ga0075431_100014397 | Ga0075431_10001439710 | 180 |
| 50 | 3300020082 | Ga0206353_10352119 | Ga0206353_103521192 | 180 |
| 51 | 3300039450 | Ga0436363_1637204 | Ga0436363_1637204_153_743 | 180 |
| 52 | 3300044683 | Ga0466965_0641259 | Ga0466965_0641259_14_565 | 180 |
| 53 | 3300044693 | Ga0466961_0342961 | Ga0466961_0342961_70_675 | 180 |
| 54 | 3300046463 | Ga0495653_0000179 | Ga0495653_0000179_43250_43843 | 180 |
| 55 | 3300046474 | Ga0495605_0142622 | Ga0495605_0142622_434_1021 | 180 |
| 56 | 3300046523 | Ga0495644_0150753 | Ga0495644_0150753_106_693 | 180 |
| 57 | 3300046535 | Ga0495586_0261191 | Ga0495586_0261191_318_866 | 180 |
| 58 | 3300050507 | nmdc:mga05p37_262700_c1 | nmdc:mga05p37_262700_c1_98_685 | 180 |
| 59 | 3300050508 | nmdc:mga09592_163983_c1 | nmdc:mga09592_163983_c1_300_887 | 180 |
| 60 | 3300050509 | nmdc:mga0qj67_50370_c1 | nmdc:mga0qj67_50370_c1_466_1053 | 180 |
| 61 | 3300050510 | nmdc:mga06r32_13488_c1 | nmdc:mga06r32_13488_c1_6468_7055 | 180 |
| 62 | 3300053077 | Ga0495601_0000595 | Ga0495601_0000595_12027_12617 | 180 |
| 63 | 3300005981 | Ga0081538_10096064 | Ga0081538_100960643 | 181 |
| 64 | 3300014497 | Ga0182008_10245237 | Ga0182008_102452372 | 181 |
| 65 | 3300044901 | Ga0466960_0278035 | Ga0466960_0278035_298_903 | 181 |
| 66 | 3300005338 | Ga0068868_100027776 | Ga0068868_1000277762 | 182 |
| 67 | 3300005340 | Ga0070689_100399760 | Ga0070689_1003997602 | 182 |
| 68 | 3300005345 | Ga0070692_10090842 | Ga0070692_100908422 | 182 |
| 69 | 3300005435 | Ga0070714_100104971 | Ga0070714_1001049712 | 182 |
| 70 | 3300005441 | Ga0070700_100013649 | Ga0070700_1000136493 | 182 |
| 71 | 3300005466 | Ga0070685_10284096 | Ga0070685_102840962 | 182 |
| 72 | 3300005615 | Ga0070702_100050153 | Ga0070702_1000501533 | 182 |
| 73 | 3300005617 | Ga0068859_100119046 | Ga0068859_1001190463 | 182 |
| 74 | 3300005842 | Ga0068858_100081388 | Ga0068858_1000813882 | 182 |
| 75 | 3300005937 | Ga0081455_10097642 | Ga0081455_100976424 | 182 |
| 76 | 3300005981 | Ga0081538_10004173 | Ga0081538_100041736 | 182 |
| 77 | 3300005981 | Ga0081538_10025048 | Ga0081538_100250486 | 182 |
| 78 | 3300006931 | Ga0097620_100119045 | Ga0097620_1001190453 | 182 |
| 79 | 3300009098 | Ga0105245_10015314 | Ga0105245_100153145 | 182 |
| 80 | 3300009148 | Ga0105243_10012300 | Ga0105243_100123005 | 182 |
| 81 | 3300009176 | Ga0105242_10103250 | Ga0105242_101032502 | 182 |
| 82 | 3300010375 | Ga0105239_10685949 | Ga0105239_106859492 | 182 |
| 83 | 3300011119 | Ga0105246_10236010 | Ga0105246_102360102 | 182 |
| 84 | 3300014968 | Ga0157379_10497759 | Ga0157379_104977591 | 182 |
| 85 | 3300025901 | Ga0207688_10063504 | Ga0207688_100635043 | 182 |
| 86 | 3300025907 | Ga0207645_10074921 | Ga0207645_100749213 | 182 |
| 87 | 3300025915 | Ga0207693_10004599 | Ga0207693_1000459911 | 182 |
| 88 | 3300025916 | Ga0207663_10309526 | Ga0207663_103095262 | 182 |
| 89 | 3300025929 | Ga0207664_10082008 | Ga0207664_100820082 | 182 |
| 90 | 3300025934 | Ga0207686_10093501 | Ga0207686_100935012 | 182 |
| 91 | 3300025937 | Ga0207669_10317918 | Ga0207669_103179182 | 182 |
| 92 | 3300026023 | Ga0207677_10180365 | Ga0207677_101803652 | 182 |
| 93 | 3300026075 | Ga0207708_10018439 | Ga0207708_100184394 | 182 |
| 94 | 3300026089 | Ga0207648_10302058 | Ga0207648_103020582 | 182 |
| 95 | 3300026095 | Ga0207676_10566343 | Ga0207676_105663432 | 182 |
| 96 | 3300026118 | Ga0207675_100657539 | Ga0207675_1006575391 | 182 |
| 97 | 3300028379 | Ga0268266_10365342 | Ga0268266_103653422 | 182 |
| 98 | 3300044683 | Ga0466965_0101923 | Ga0466965_0101923_760_1359 | 182 |
| 99 | 3300044765 | Ga0466970_0198559 | Ga0466970_0198559_285_884 | 182 |
| 100 | 3300046535 | Ga0495586_0307438 | Ga0495586_0307438_286_882 | 182 |
| 101 | 3300048903 | Ga0496100_0695007 | Ga0496100_0695007_63_656 | 182 |
| 102 | 3300048905 | Ga0496102_0138760 | Ga0496102_0138760_35_628 | 182 |
| 103 | 3300048909 | Ga0496106_0029323 | Ga0496106_0029323_1375_1968 | 182 |
| 104 | 3300048912 | Ga0496109_0373958 | Ga0496109_0373958_370_963 | 182 |
| 105 | 3300048913 | Ga0496110_0113433 | Ga0496110_0113433_1624_2217 | 182 |
| 106 | 3300009148 | Ga0105243_10795080 | Ga0105243_107950802 | 183 |
| 107 | 3300044842 | Ga0466957_0196176 | Ga0466957_0196176_177_770 | 183 |
| 108 | 3300045976 | Ga0466967_0251445 | Ga0466967_0251445_567_1163 | 183 |
| 109 | 3300048905 | Ga0496102_0076150 | Ga0496102_0076150_2286_2846 | 183 |
| 110 | 3300049570 | Ga0501033_0051742 | Ga0501033_0051742_1726_2322 | 183 |
| 111 | 3300049577 | Ga0501041_0024970 | Ga0501041_0024970_280_876 | 183 |
| 112 | 3300049578 | Ga0501042_0039746 | Ga0501042_0039746_255_851 | 183 |
| 113 | 3300005439 | Ga0070711_100289029 | Ga0070711_1002890292 | 184 |
| 114 | 3300007076 | Ga0075435_100220646 | Ga0075435_1002206462 | 184 |
| 115 | 3300009098 | Ga0105245_10066571 | Ga0105245_100665712 | 184 |
| 116 | 3300025916 | Ga0207663_10058625 | Ga0207663_100586252 | 184 |
| 117 | 3300050507 | nmdc:mga05p37_478418_c1 | nmdc:mga05p37_478418_c1_163_750 | 184 |
| 118 | 3300005338 | Ga0068868_100380266 | Ga0068868_1003802662 | 185 |
| 119 | 3300005981 | Ga0081538_10003695 | Ga0081538_1000369510 | 185 |
| 120 | 3300006058 | Ga0075432_10008412 | Ga0075432_100084122 | 185 |
| 121 | 3300006852 | Ga0075433_10224928 | Ga0075433_102249283 | 185 |
| 122 | 3300006881 | Ga0068865_100490241 | Ga0068865_1004902411 | 185 |
| 123 | 3300032002 | Ga0307416_101719263 | Ga0307416_1017192631 | 185 |
| 124 | 3300035691 | Ga0373931_0030150 | Ga0373931_0030150_1857_2444 | 185 |
| 125 | 3300050515 | nmdc:mga0a205_220706_c1 | nmdc:mga0a205_220706_c1_1009_1596 | 185 |
| 126 | 3300005435 | Ga0070714_100010038 | Ga0070714_1000100385 | 186 |
| 127 | 3300025972 | Ga0207668_10454504 | Ga0207668_104545042 | 186 |
| 128 | 3300026078 | Ga0207702_11075611 | Ga0207702_110756111 | 186 |
| 129 | 3300049570 | Ga0501033_0626742 | Ga0501033_0626742_133_720 | 186 |
| 130 | 3300049575 | Ga0501039_0551106 | Ga0501039_0551106_229_816 | 186 |
| 131 | 3300049577 | Ga0501041_0208496 | Ga0501041_0208496_576_1163 | 186 |
| 132 | 3300049582 | Ga0501048_0456802 | Ga0501048_0456802_286_873 | 186 |
| 133 | 3300049588 | Ga0501072_0121775 | Ga0501072_0121775_803_1390 | 186 |
| 134 | 3300049824 | Ga0501045_0365148 | Ga0501045_0365148_327_914 | 186 |
| 135 | 3300061734 | Ga0530510_0997689 | Ga0530510_0997689_22_609 | 186 |
| 136 | 3300005435 | Ga0070714_100113289 | Ga0070714_1001132894 | 187 |
| 137 | 3300025929 | Ga0207664_10002049 | Ga0207664_100020499 | 187 |
| 138 | 3300031911 | Ga0307412_11013148 | Ga0307412_110131482 | 187 |
| 139 | 3300005336 | Ga0070680_100810565 | Ga0070680_1008105652 | 188 |
| 140 | 3300025926 | Ga0207659_10035380 | Ga0207659_100353802 | 188 |
| 141 | 3300026116 | Ga0207674_10141397 | Ga0207674_101413973 | 188 |
| 142 | 3300026142 | Ga0207698_10086179 | Ga0207698_100861794 | 188 |
| 143 | 3300005434 | Ga0070709_10053487 | Ga0070709_100534872 | 189 |
| 144 | 3300005435 | Ga0070714_100837573 | Ga0070714_1008375732 | 189 |
| 145 | 3300005440 | Ga0070705_100995940 | Ga0070705_1009959401 | 189 |
| 146 | 3300006175 | Ga0070712_100167367 | Ga0070712_1001673672 | 189 |
| 147 | 3300025898 | Ga0207692_10041897 | Ga0207692_100418972 | 189 |
| 148 | 3300025906 | Ga0207699_10056789 | Ga0207699_100567892 | 189 |
| 149 | 3300025929 | Ga0207664_10382024 | Ga0207664_103820242 | 189 |
| 150 | 3300045976 | Ga0466967_0494918 | Ga0466967_0494918_456_1052 | 189 |
| 151 | 3300048913 | Ga0496110_0000242 | Ga0496110_0000242_28404_28994 | 189 |
| 152 | 3300048914 | Ga0496111_0004875 | Ga0496111_0004875_6451_7041 | 189 |
| 153 | 3300049568 | Ga0501031_0012782 | Ga0501031_0012782_2053_2649 | 189 |
| 154 | 3300049572 | Ga0501036_0100530 | Ga0501036_0100530_1293_1889 | 189 |
| 155 | 3300049576 | Ga0501040_0014377 | Ga0501040_0014377_2595_3191 | 189 |
| 156 | 3300049577 | Ga0501041_0196994 | Ga0501041_0196994_558_1154 | 189 |
| 157 | 3300049578 | Ga0501042_0081645 | Ga0501042_0081645_730_1326 | 189 |
| 158 | 3300049584 | Ga0501068_0353264 | Ga0501068_0353264_214_810 | 189 |
| 159 | 3300049585 | Ga0501069_0218953 | Ga0501069_0218953_299_895 | 189 |
| 160 | 3300049587 | Ga0501071_0041672 | Ga0501071_0041672_1264_1860 | 189 |
| 161 | 3300049588 | Ga0501072_0561092 | Ga0501072_0561092_48_644 | 189 |
| 162 | 3300049591 | Ga0501075_0013118 | Ga0501075_0013118_2823_3419 | 189 |
| 163 | 3300049592 | Ga0501076_0023338 | Ga0501076_0023338_2934_3530 | 189 |
| 164 | 3300049824 | Ga0501045_0540533 | Ga0501045_0540533_242_838 | 189 |
| 165 | 3300053077 | Ga0495601_0006880 | Ga0495601_0006880_4342_4932 | 189 |
| 166 | 3300054114 | Ga0501084_0042468 | Ga0501084_0042468_452_1048 | 189 |
| 167 | 3300060353 | Ga0501082_0068822 | Ga0501082_0068822_426_1022 | 189 |
| 168 | 3300003373 | JGI25407J50210_10007614 | JGI25407J50210_100076143 | 190 |
| 169 | 3300003373 | JGI25407J50210_10046016 | JGI25407J50210_100460162 | 190 |
| 170 | 3300005981 | Ga0081538_10000044 | Ga0081538_1000004416 | 190 |
| 171 | 3300005981 | Ga0081538_10006143 | Ga0081538_1000614314 | 190 |
| 172 | 3300005329 | Ga0070683_100017940 | Ga0070683_1000179405 | 194 |
| 173 | 3300005339 | Ga0070660_100068013 | Ga0070660_1000680133 | 194 |
| 174 | 3300005343 | Ga0070687_100478350 | Ga0070687_1004783502 | 194 |
| 175 | 3300005347 | Ga0070668_100042153 | Ga0070668_1000421534 | 194 |
| 176 | 3300005354 | Ga0070675_100001160 | Ga0070675_1000011609 | 194 |
| 177 | 3300005365 | Ga0070688_100000027 | Ga0070688_10000002771 | 194 |
| 178 | 3300005365 | Ga0070688_100004986 | Ga0070688_1000049869 | 194 |
| 179 | 3300005367 | Ga0070667_100811593 | Ga0070667_1008115932 | 194 |
| 180 | 3300005440 | Ga0070705_100950972 | Ga0070705_1009509721 | 194 |
| 181 | 3300005466 | Ga0070685_10000665 | Ga0070685_1000066516 | 194 |
| 182 | 3300005466 | Ga0070685_10000791 | Ga0070685_1000079116 | 194 |
| 183 | 3300005471 | Ga0070698_100623824 | Ga0070698_1006238242 | 194 |
| 184 | 3300005530 | Ga0070679_100151311 | Ga0070679_1001513113 | 194 |
| 185 | 3300005535 | Ga0070684_100106959 | Ga0070684_1001069592 | 194 |
| 186 | 3300005544 | Ga0070686_100229411 | Ga0070686_1002294112 | 194 |
| 187 | 3300005563 | Ga0068855_100960053 | Ga0068855_1009600532 | 194 |
| 188 | 3300005577 | Ga0068857_100276104 | Ga0068857_1002761042 | 194 |
| 189 | 3300005578 | Ga0068854_100000116 | Ga0068854_10000011656 | 194 |
| 190 | 3300005614 | Ga0068856_100000336 | Ga0068856_1000003368 | 194 |
| 191 | 3300005614 | Ga0068856_100032534 | Ga0068856_1000325344 | 194 |
| 192 | 3300005834 | Ga0068851_10007756 | Ga0068851_100077563 | 194 |
| 193 | 3300005834 | Ga0068851_10057798 | Ga0068851_100577983 | 194 |
| 194 | 3300005841 | Ga0068863_100111984 | Ga0068863_1001119844 | 194 |
| 195 | 3300005937 | Ga0081455_10043405 | Ga0081455_100434055 | 194 |
| 196 | 3300005983 | Ga0081540_1002481 | Ga0081540_100248111 | 194 |
| 197 | 3300005983 | Ga0081540_1084827 | Ga0081540_10848272 | 194 |
| 198 | 3300006175 | Ga0070712_100024256 | Ga0070712_1000242565 | 194 |
| 199 | 3300006846 | Ga0075430_100001606 | Ga0075430_10000160616 | 194 |
| 200 | 3300006846 | Ga0075430_100125867 | Ga0075430_1001258673 | 194 |
| 201 | 3300006852 | Ga0075433_10389984 | Ga0075433_103899842 | 194 |
| 202 | 3300009098 | Ga0105245_10000141 | Ga0105245_1000014170 | 194 |
| 203 | 3300009098 | Ga0105245_10002406 | Ga0105245_100024065 | 194 |
| 204 | 3300009098 | Ga0105245_10588679 | Ga0105245_105886792 | 194 |
| 205 | 3300009147 | Ga0114129_10315827 | Ga0114129_103158273 | 194 |
| 206 | 3300009147 | Ga0114129_12314265 | Ga0114129_123142651 | 194 |
| 207 | 3300009148 | Ga0105243_10011687 | Ga0105243_100116875 | 194 |
| 208 | 3300009176 | Ga0105242_11390958 | Ga0105242_113909581 | 194 |
| 209 | 3300009177 | Ga0105248_10000020 | Ga0105248_100000208 | 194 |
| 210 | 3300010375 | Ga0105239_11017158 | Ga0105239_110171582 | 194 |
| 211 | 3300013102 | Ga0157371_10011110 | Ga0157371_100111108 | 194 |
| 212 | 3300013104 | Ga0157370_10013982 | Ga0157370_100139824 | 194 |
| 213 | 3300013105 | Ga0157369_10004884 | Ga0157369_1000488412 | 194 |
| 214 | 3300013105 | Ga0157369_10203624 | Ga0157369_102036241 | 194 |
| 215 | 3300013296 | Ga0157374_10585624 | Ga0157374_105856242 | 194 |
| 216 | 3300014326 | Ga0157380_10006499 | Ga0157380_100064999 | 194 |
| 217 | 3300025302 | Ga0207426_1013197 | Ga0207426_10131973 | 194 |
| 218 | 3300025321 | Ga0207656_10039832 | Ga0207656_100398323 | 194 |
| 219 | 3300025912 | Ga0207707_10148415 | Ga0207707_101484153 | 194 |
| 220 | 3300025915 | Ga0207693_10008005 | Ga0207693_100080059 | 194 |
| 221 | 3300025921 | Ga0207652_10095849 | Ga0207652_100958492 | 194 |
| 222 | 3300025926 | Ga0207659_10000553 | Ga0207659_1000055322 | 194 |
| 223 | 3300025927 | Ga0207687_10000036 | Ga0207687_100000368 | 194 |
| 224 | 3300025927 | Ga0207687_10002476 | Ga0207687_100024769 | 194 |
| 225 | 3300025927 | Ga0207687_10547004 | Ga0207687_105470042 | 194 |
| 226 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006367 | 194 |
| 227 | 3300025944 | Ga0207661_10000312 | Ga0207661_1000031237 | 194 |
| 228 | 3300025972 | Ga0207668_10012672 | Ga0207668_100126724 | 194 |
| 229 | 3300025981 | Ga0207640_10000134 | Ga0207640_1000013457 | 194 |
| 230 | 3300026023 | Ga0207677_10000374 | Ga0207677_1000037432 | 194 |
| 231 | 3300026078 | Ga0207702_10000368 | Ga0207702_1000036854 | 194 |
| 232 | 3300026078 | Ga0207702_10025200 | Ga0207702_100252003 | 194 |
| 233 | 3300026116 | Ga0207674_10349889 | Ga0207674_103498891 | 194 |
| 234 | 3300031548 | Ga0307408_100614185 | Ga0307408_1006141852 | 194 |
| 235 | 3300037312 | Ga0395899_0204295 | Ga0395899_0204295_479_1069 | 194 |
| 236 | 3300037418 | Ga0395900_0717592 | Ga0395900_0717592_184_774 | 194 |
| 237 | 3300037418 | Ga0395900_0736322 | Ga0395900_0736322_132_722 | 194 |
| 238 | 3300037466 | Ga0395898_0181894 | Ga0395898_0181894_1237_1851 | 194 |
| 239 | 3300037466 | Ga0395898_0384537 | Ga0395898_0384537_74_664 | 194 |
| 240 | 3300037466 | Ga0395898_0445794 | Ga0395898_0445794_633_1217 | 194 |
| 241 | 3300037471 | Ga0395905_0441897 | Ga0395905_0441897_563_1153 | 194 |
| 242 | 3300038443 | Ga0395901_0009771 | Ga0395901_0009771_8346_8936 | 194 |
| 243 | 3300038443 | Ga0395901_0096926 | Ga0395901_0096926_2413_3003 | 194 |
| 244 | 3300038443 | Ga0395901_0946536 | Ga0395901_0946536_72_686 | 194 |
| 245 | 3300041512 | Ga0451853_0704132 | Ga0451853_0704132_1099_1689 | 194 |
| 246 | 3300044684 | Ga0466966_0014445 | Ga0466966_0014445_630_1223 | 194 |
| 247 | 3300046455 | Ga0495603_0406041 | Ga0495603_0406041_135_725 | 194 |
| 248 | 3300046459 | Ga0495629_0007258 | Ga0495629_0007258_1467_2057 | 194 |
| 249 | 3300046461 | Ga0495641_0010982 | Ga0495641_0010982_2007_2597 | 194 |
| 250 | 3300046499 | Ga0495594_0000011 | Ga0495594_0000011_80644_81237 | 194 |
| 251 | 3300046507 | Ga0495606_0000586 | Ga0495606_0000586_5046_5636 | 194 |
| 252 | 3300046517 | Ga0495630_0000075 | Ga0495630_0000075_71255_71845 | 194 |
| 253 | 3300046681 | Ga0495647_0000419 | Ga0495647_0000419_8857_9447 | 194 |
| 254 | 3300046690 | Ga0495624_0000027 | Ga0495624_0000027_86941_87528 | 194 |
| 255 | 3300046810 | Ga0495660_0055941 | Ga0495660_0055941_491_1081 | 194 |
| 256 | 3300047321 | Ga0495676_0019702 | Ga0495676_0019702_4541_5131 | 194 |
| 257 | 3300047445 | Ga0495677_0134406 | Ga0495677_0134406_273_863 | 194 |
| 258 | 3300047673 | Ga0495593_0018850 | Ga0495593_0018850_1862_2452 | 194 |
| 259 | 3300047673 | Ga0495593_0118145 | Ga0495593_0118145_302_895 | 194 |
| 260 | 3300048903 | Ga0496100_0000001 | Ga0496100_0000001_523222_523812 | 194 |
| 261 | 3300048904 | Ga0496101_0000004 | Ga0496101_0000004_324574_325164 | 194 |
| 262 | 3300048906 | Ga0496103_0007177 | Ga0496103_0007177_1685_2278 | 194 |
| 263 | 3300048907 | Ga0496104_0877699 | Ga0496104_0877699_110_703 | 194 |
| 264 | 3300048909 | Ga0496106_0000414 | Ga0496106_0000414_23339_23929 | 194 |
| 265 | 3300048909 | Ga0496106_0062139 | Ga0496106_0062139_1150_1740 | 194 |
| 266 | 3300048910 | Ga0496107_0000005 | Ga0496107_0000005_6436_7026 | 194 |
| 267 | 3300048910 | Ga0496107_0569221 | Ga0496107_0569221_154_744 | 194 |
| 268 | 3300048910 | Ga0496107_0608924 | Ga0496107_0608924_166_756 | 194 |
| 269 | 3300048911 | Ga0496108_1187811 | Ga0496108_1187811_16_606 | 194 |
| 270 | 3300048912 | Ga0496109_0122434 | Ga0496109_0122434_917_1507 | 194 |
| 271 | 3300048913 | Ga0496110_0502409 | Ga0496110_0502409_271_861 | 194 |
| 272 | 3300048914 | Ga0496111_0284439 | Ga0496111_0284439_118_708 | 194 |
| 273 | 3300048914 | Ga0496111_0310200 | Ga0496111_0310200_488_1078 | 194 |
| 274 | 3300048915 | Ga0496112_0007945 | Ga0496112_0007945_6362_6952 | 194 |
| 275 | 3300048916 | Ga0496113_0000027 | Ga0496113_0000027_56220_56810 | 194 |
| 276 | 3300049571 | Ga0501034_0174514 | Ga0501034_0174514_388_978 | 194 |
| 277 | 3300049580 | Ga0501046_0291423 | Ga0501046_0291423_267_860 | 194 |
| 278 | 3300049581 | Ga0501047_0085868 | Ga0501047_0085868_150_743 | 194 |
| 279 | 3300049581 | Ga0501047_0125226 | Ga0501047_0125226_1691_2281 | 194 |
| 280 | 3300049581 | Ga0501047_0274239 | Ga0501047_0274239_328_918 | 194 |
| 281 | 3300049585 | Ga0501069_0047028 | Ga0501069_0047028_1080_1670 | 194 |
| 282 | 3300049586 | Ga0501070_0338896 | Ga0501070_0338896_242_832 | 194 |
| 283 | 3300049590 | Ga0501074_0040709 | Ga0501074_0040709_1059_1649 | 194 |
| 284 | 3300049741 | Ga0501079_0041381 | Ga0501079_0041381_922_1512 | 194 |
| 285 | 3300049742 | Ga0501080_0299224 | Ga0501080_0299224_54_644 | 194 |
| 286 | 3300049744 | Ga0501083_0027131 | Ga0501083_0027131_575_1165 | 194 |
| 287 | 3300049823 | Ga0501044_0022596 | Ga0501044_0022596_5410_6000 | 194 |
| 288 | 3300050491 | nmdc:mga00v17_165783_c1 | nmdc:mga00v17_165783_c1_636_1229 | 194 |
| 289 | 3300050491 | nmdc:mga00v17_387567_c1 | nmdc:mga00v17_387567_c1_74_664 | 194 |
| 290 | 3300050509 | nmdc:mga0qj67_5408_c1 | nmdc:mga0qj67_5408_c1_8293_8886 | 194 |
| 291 | 3300050509 | nmdc:mga0qj67_70656_c1 | nmdc:mga0qj67_70656_c1_1552_2142 | 194 |
| 292 | 3300050513 | nmdc:mga0rr50_193863_c1 | nmdc:mga0rr50_193863_c1_707_1297 | 194 |
| 293 | 3300053078 | Ga0495612_0002167 | Ga0495612_0002167_2114_2704 | 194 |
| 294 | 3300053085 | Ga0495619_0000047 | Ga0495619_0000047_6510_7100 | 194 |
| 295 | 3300000549 | LJQas_1007430 | LJQas_10074302 | 195 |
| 296 | 3300003203 | JGI25406J46586_10037679 | JGI25406J46586_100376792 | 195 |
| 297 | 3300005329 | Ga0070683_100035511 | Ga0070683_1000355113 | 195 |
| 298 | 3300005329 | Ga0070683_100051889 | Ga0070683_1000518894 | 195 |
| 299 | 3300005329 | Ga0070683_100165130 | Ga0070683_1001651302 | 195 |
| 300 | 3300005331 | Ga0070670_101056036 | Ga0070670_1010560361 | 195 |
| 301 | 3300005334 | Ga0068869_100019169 | Ga0068869_1000191693 | 195 |
| 302 | 3300005335 | Ga0070666_10549680 | Ga0070666_105496801 | 195 |
| 303 | 3300005337 | Ga0070682_100023170 | Ga0070682_1000231705 | 195 |
| 304 | 3300005337 | Ga0070682_100399027 | Ga0070682_1003990272 | 195 |
| 305 | 3300005338 | Ga0068868_100003173 | Ga0068868_1000031732 | 195 |
| 306 | 3300005338 | Ga0068868_100293943 | Ga0068868_1002939432 | 195 |
| 307 | 3300005338 | Ga0068868_100340411 | Ga0068868_1003404112 | 195 |
| 308 | 3300005338 | Ga0068868_100887103 | Ga0068868_1008871032 | 195 |
| 309 | 3300005339 | Ga0070660_100003619 | Ga0070660_10000361914 | 195 |
| 310 | 3300005339 | Ga0070660_100046597 | Ga0070660_1000465974 | 195 |
| 311 | 3300005340 | Ga0070689_100060626 | Ga0070689_1000606262 | 195 |
| 312 | 3300005340 | Ga0070689_100158234 | Ga0070689_1001582342 | 195 |
| 313 | 3300005341 | Ga0070691_10158276 | Ga0070691_101582762 | 195 |
| 314 | 3300005343 | Ga0070687_100104910 | Ga0070687_1001049102 | 195 |
| 315 | 3300005344 | Ga0070661_100019340 | Ga0070661_1000193403 | 195 |
| 316 | 3300005344 | Ga0070661_100581806 | Ga0070661_1005818061 | 195 |
| 317 | 3300005345 | Ga0070692_10017574 | Ga0070692_100175743 | 195 |
| 318 | 3300005345 | Ga0070692_10134710 | Ga0070692_101347102 | 195 |
| 319 | 3300005347 | Ga0070668_100470612 | Ga0070668_1004706122 | 195 |
| 320 | 3300005353 | Ga0070669_100020911 | Ga0070669_1000209114 | 195 |
| 321 | 3300005353 | Ga0070669_100359311 | Ga0070669_1003593112 | 195 |
| 322 | 3300005353 | Ga0070669_100385917 | Ga0070669_1003859172 | 195 |
| 323 | 3300005354 | Ga0070675_100413797 | Ga0070675_1004137971 | 195 |
| 324 | 3300005355 | Ga0070671_100235319 | Ga0070671_1002353191 | 195 |
| 325 | 3300005355 | Ga0070671_100488975 | Ga0070671_1004889752 | 195 |
| 326 | 3300005356 | Ga0070674_100031861 | Ga0070674_1000318612 | 195 |
| 327 | 3300005356 | Ga0070674_100481091 | Ga0070674_1004810912 | 195 |
| 328 | 3300005356 | Ga0070674_101162445 | Ga0070674_1011624451 | 195 |
| 329 | 3300005364 | Ga0070673_100871895 | Ga0070673_1008718952 | 195 |
| 330 | 3300005365 | Ga0070688_100257611 | Ga0070688_1002576112 | 195 |
| 331 | 3300005366 | Ga0070659_100000037 | Ga0070659_100000037119 | 195 |
| 332 | 3300005366 | Ga0070659_100002687 | Ga0070659_10000268715 | 195 |
| 333 | 3300005366 | Ga0070659_100476154 | Ga0070659_1004761542 | 195 |
| 334 | 3300005366 | Ga0070659_100757011 | Ga0070659_1007570112 | 195 |
| 335 | 3300005367 | Ga0070667_100042334 | Ga0070667_1000423342 | 195 |
| 336 | 3300005435 | Ga0070714_100000860 | Ga0070714_1000008608 | 195 |
| 337 | 3300005435 | Ga0070714_100021490 | Ga0070714_1000214904 | 195 |
| 338 | 3300005435 | Ga0070714_100069618 | Ga0070714_1000696183 | 195 |
| 339 | 3300005436 | Ga0070713_100324287 | Ga0070713_1003242872 | 195 |
| 340 | 3300005437 | Ga0070710_10000050 | Ga0070710_1000005059 | 195 |
| 341 | 3300005437 | Ga0070710_10097718 | Ga0070710_100977181 | 195 |
| 342 | 3300005437 | Ga0070710_10201511 | Ga0070710_102015112 | 195 |
| 343 | 3300005438 | Ga0070701_10192589 | Ga0070701_101925892 | 195 |
| 344 | 3300005439 | Ga0070711_100001237 | Ga0070711_10000123712 | 195 |
| 345 | 3300005440 | Ga0070705_100005024 | Ga0070705_1000050245 | 195 |
| 346 | 3300005441 | Ga0070700_100029613 | Ga0070700_1000296133 | 195 |
| 347 | 3300005441 | Ga0070700_100034667 | Ga0070700_1000346672 | 195 |
| 348 | 3300005441 | Ga0070700_100188362 | Ga0070700_1001883622 | 195 |
| 349 | 3300005441 | Ga0070700_100307524 | Ga0070700_1003075242 | 195 |
| 350 | 3300005444 | Ga0070694_100314453 | Ga0070694_1003144532 | 195 |
| 351 | 3300005445 | Ga0070708_100428217 | Ga0070708_1004282172 | 195 |
| 352 | 3300005455 | Ga0070663_100009051 | Ga0070663_1000090514 | 195 |
| 353 | 3300005456 | Ga0070678_100025608 | Ga0070678_1000256086 | 195 |
| 354 | 3300005456 | Ga0070678_100284954 | Ga0070678_1002849542 | 195 |
| 355 | 3300005457 | Ga0070662_100001035 | Ga0070662_1000010355 | 195 |
| 356 | 3300005457 | Ga0070662_100294176 | Ga0070662_1002941762 | 195 |
| 357 | 3300005457 | Ga0070662_100441662 | Ga0070662_1004416622 | 195 |
| 358 | 3300005458 | Ga0070681_10003066 | Ga0070681_1000306618 | 195 |
| 359 | 3300005458 | Ga0070681_10303916 | Ga0070681_103039162 | 195 |
| 360 | 3300005466 | Ga0070685_10031977 | Ga0070685_100319772 | 195 |
| 361 | 3300005466 | Ga0070685_10663639 | Ga0070685_106636391 | 195 |
| 362 | 3300005530 | Ga0070679_100035983 | Ga0070679_1000359833 | 195 |
| 363 | 3300005530 | Ga0070679_100043251 | Ga0070679_1000432513 | 195 |
| 364 | 3300005530 | Ga0070679_100070872 | Ga0070679_1000708722 | 195 |
| 365 | 3300005530 | Ga0070679_100436883 | Ga0070679_1004368832 | 195 |
| 366 | 3300005535 | Ga0070684_100035155 | Ga0070684_1000351553 | 195 |
| 367 | 3300005535 | Ga0070684_100035948 | Ga0070684_1000359484 | 195 |
| 368 | 3300005535 | Ga0070684_100216967 | Ga0070684_1002169672 | 195 |
| 369 | 3300005536 | Ga0070697_100407681 | Ga0070697_1004076812 | 195 |
| 370 | 3300005536 | Ga0070697_100509609 | Ga0070697_1005096092 | 195 |
| 371 | 3300005539 | Ga0068853_100390091 | Ga0068853_1003900912 | 195 |
| 372 | 3300005544 | Ga0070686_100224047 | Ga0070686_1002240472 | 195 |
| 373 | 3300005545 | Ga0070695_100191180 | Ga0070695_1001911802 | 195 |
| 374 | 3300005546 | Ga0070696_100021133 | Ga0070696_1000211331 | 195 |
| 375 | 3300005546 | Ga0070696_100407601 | Ga0070696_1004076012 | 195 |
| 376 | 3300005548 | Ga0070665_100036567 | Ga0070665_1000365674 | 195 |
| 377 | 3300005548 | Ga0070665_100075544 | Ga0070665_1000755443 | 195 |
| 378 | 3300005548 | Ga0070665_100485083 | Ga0070665_1004850832 | 195 |
| 379 | 3300005548 | Ga0070665_100515985 | Ga0070665_1005159852 | 195 |
| 380 | 3300005548 | Ga0070665_100600571 | Ga0070665_1006005712 | 195 |
| 381 | 3300005549 | Ga0070704_100223325 | Ga0070704_1002233252 | 195 |
| 382 | 3300005563 | Ga0068855_100452939 | Ga0068855_1004529391 | 195 |
| 383 | 3300005564 | Ga0070664_100012431 | Ga0070664_1000124317 | 195 |
| 384 | 3300005564 | Ga0070664_100076082 | Ga0070664_1000760822 | 195 |
| 385 | 3300005564 | Ga0070664_100153674 | Ga0070664_1001536743 | 195 |
| 386 | 3300005577 | Ga0068857_100317982 | Ga0068857_1003179822 | 195 |
| 387 | 3300005578 | Ga0068854_100075637 | Ga0068854_1000756372 | 195 |
| 388 | 3300005578 | Ga0068854_100131953 | Ga0068854_1001319532 | 195 |
| 389 | 3300005578 | Ga0068854_100882361 | Ga0068854_1008823612 | 195 |
| 390 | 3300005614 | Ga0068856_100002016 | Ga0068856_10000201625 | 195 |
| 391 | 3300005614 | Ga0068856_100114684 | Ga0068856_1001146842 | 195 |
| 392 | 3300005616 | Ga0068852_100805384 | Ga0068852_1008053841 | 195 |
| 393 | 3300005617 | Ga0068859_100050092 | Ga0068859_1000500925 | 195 |
| 394 | 3300005719 | Ga0068861_100008771 | Ga0068861_1000087714 | 195 |
| 395 | 3300005719 | Ga0068861_100049050 | Ga0068861_1000490503 | 195 |
| 396 | 3300005840 | Ga0068870_10031616 | Ga0068870_100316164 | 195 |
| 397 | 3300005841 | Ga0068863_100324115 | Ga0068863_1003241152 | 195 |
| 398 | 3300005842 | Ga0068858_100211186 | Ga0068858_1002111862 | 195 |
| 399 | 3300005844 | Ga0068862_100042359 | Ga0068862_1000423594 | 195 |
| 400 | 3300005937 | Ga0081455_10325138 | Ga0081455_103251382 | 195 |
| 401 | 3300005981 | Ga0081538_10000766 | Ga0081538_1000076618 | 195 |
| 402 | 3300005981 | Ga0081538_10001436 | Ga0081538_1000143614 | 195 |
| 403 | 3300005981 | Ga0081538_10002073 | Ga0081538_100020735 | 195 |
| 404 | 3300005981 | Ga0081538_10002254 | Ga0081538_1000225413 | 195 |
| 405 | 3300005981 | Ga0081538_10042073 | Ga0081538_100420733 | 195 |
| 406 | 3300005981 | Ga0081538_10050518 | Ga0081538_100505182 | 195 |
| 407 | 3300005981 | Ga0081538_10066379 | Ga0081538_100663793 | 195 |
| 408 | 3300005985 | Ga0081539_10011326 | Ga0081539_100113265 | 195 |
| 409 | 3300005985 | Ga0081539_10012198 | Ga0081539_100121987 | 195 |
| 410 | 3300006028 | Ga0070717_10000019 | Ga0070717_10000019174 | 195 |
| 411 | 3300006028 | Ga0070717_10036330 | Ga0070717_100363302 | 195 |
| 412 | 3300006048 | Ga0075363_100047743 | Ga0075363_1000477433 | 195 |
| 413 | 3300006048 | Ga0075363_100210420 | Ga0075363_1002104202 | 195 |
| 414 | 3300006173 | Ga0070716_100333012 | Ga0070716_1003330122 | 195 |
| 415 | 3300006175 | Ga0070712_100000004 | Ga0070712_100000004210 | 195 |
| 416 | 3300006175 | Ga0070712_100073145 | Ga0070712_1000731454 | 195 |
| 417 | 3300006175 | Ga0070712_100545950 | Ga0070712_1005459501 | 195 |
| 418 | 3300006358 | Ga0068871_100396671 | Ga0068871_1003966712 | 195 |
| 419 | 3300006844 | Ga0075428_100172045 | Ga0075428_1001720452 | 195 |
| 420 | 3300006844 | Ga0075428_100281113 | Ga0075428_1002811132 | 195 |
| 421 | 3300006844 | Ga0075428_100407972 | Ga0075428_1004079722 | 195 |
| 422 | 3300006846 | Ga0075430_100159561 | Ga0075430_1001595613 | 195 |
| 423 | 3300006847 | Ga0075431_100102356 | Ga0075431_1001023564 | 195 |
| 424 | 3300006847 | Ga0075431_100244726 | Ga0075431_1002447262 | 195 |
| 425 | 3300006852 | Ga0075433_10069242 | Ga0075433_100692423 | 195 |
| 426 | 3300006871 | Ga0075434_100074065 | Ga0075434_1000740654 | 195 |
| 427 | 3300006871 | Ga0075434_100434120 | Ga0075434_1004341202 | 195 |
| 428 | 3300006880 | Ga0075429_100031400 | Ga0075429_1000314003 | 195 |
| 429 | 3300006880 | Ga0075429_100090493 | Ga0075429_1000904932 | 195 |
| 430 | 3300006880 | Ga0075429_100260198 | Ga0075429_1002601982 | 195 |
| 431 | 3300006881 | Ga0068865_100081249 | Ga0068865_1000812492 | 195 |
| 432 | 3300006914 | Ga0075436_100069538 | Ga0075436_1000695383 | 195 |
| 433 | 3300006931 | Ga0097620_100050092 | Ga0097620_1000500922 | 195 |
| 434 | 3300007076 | Ga0075435_100012265 | Ga0075435_1000122657 | 195 |
| 435 | 3300009093 | Ga0105240_10370303 | Ga0105240_103703033 | 195 |
| 436 | 3300009093 | Ga0105240_10596443 | Ga0105240_105964432 | 195 |
| 437 | 3300009094 | Ga0111539_10004783 | Ga0111539_1000478319 | 195 |
| 438 | 3300009094 | Ga0111539_10012635 | Ga0111539_1001263510 | 195 |
| 439 | 3300009094 | Ga0111539_10039470 | Ga0111539_100394705 | 195 |
| 440 | 3300009094 | Ga0111539_10050074 | Ga0111539_100500745 | 195 |
| 441 | 3300009094 | Ga0111539_10129885 | Ga0111539_101298853 | 195 |
| 442 | 3300009094 | Ga0111539_10641360 | Ga0111539_106413601 | 195 |
| 443 | 3300009094 | Ga0111539_11452804 | Ga0111539_114528042 | 195 |
| 444 | 3300009098 | Ga0105245_10003314 | Ga0105245_100033142 | 195 |
| 445 | 3300009098 | Ga0105245_10014806 | Ga0105245_100148065 | 195 |
| 446 | 3300009098 | Ga0105245_10358819 | Ga0105245_103588192 | 195 |
| 447 | 3300009098 | Ga0105245_10971783 | Ga0105245_109717832 | 195 |
| 448 | 3300009101 | Ga0105247_10047392 | Ga0105247_100473923 | 195 |
| 449 | 3300009101 | Ga0105247_10625075 | Ga0105247_106250751 | 195 |
| 450 | 3300009147 | Ga0114129_10019151 | Ga0114129_100191518 | 195 |
| 451 | 3300009147 | Ga0114129_10059944 | Ga0114129_100599444 | 195 |
| 452 | 3300009147 | Ga0114129_10183598 | Ga0114129_101835984 | 195 |
| 453 | 3300009147 | Ga0114129_10195494 | Ga0114129_101954944 | 195 |
| 454 | 3300009147 | Ga0114129_11136682 | Ga0114129_111366822 | 195 |
| 455 | 3300009148 | Ga0105243_10079736 | Ga0105243_100797362 | 195 |
| 456 | 3300009148 | Ga0105243_10576404 | Ga0105243_105764042 | 195 |
| 457 | 3300009148 | Ga0105243_11187265 | Ga0105243_111872651 | 195 |
| 458 | 3300009176 | Ga0105242_10358859 | Ga0105242_103588592 | 195 |
| 459 | 3300009176 | Ga0105242_10409502 | Ga0105242_104095022 | 195 |
| 460 | 3300009177 | Ga0105248_10141614 | Ga0105248_101416141 | 195 |
| 461 | 3300009177 | Ga0105248_10312768 | Ga0105248_103127682 | 195 |
| 462 | 3300009545 | Ga0105237_10009091 | Ga0105237_100090915 | 195 |
| 463 | 3300009545 | Ga0105237_10207990 | Ga0105237_102079902 | 195 |
| 464 | 3300009545 | Ga0105237_10338998 | Ga0105237_103389983 | 195 |
| 465 | 3300009545 | Ga0105237_10486205 | Ga0105237_104862052 | 195 |
| 466 | 3300009551 | Ga0105238_10032231 | Ga0105238_100322316 | 195 |
| 467 | 3300009553 | Ga0105249_10018376 | Ga0105249_100183764 | 195 |
| 468 | 3300009553 | Ga0105249_10332398 | Ga0105249_103323983 | 195 |
| 469 | 3300010375 | Ga0105239_10019100 | Ga0105239_100191007 | 195 |
| 470 | 3300010375 | Ga0105239_10164107 | Ga0105239_101641072 | 195 |
| 471 | 3300010375 | Ga0105239_10217741 | Ga0105239_102177412 | 195 |
| 472 | 3300010375 | Ga0105239_10315601 | Ga0105239_103156012 | 195 |
| 473 | 3300013102 | Ga0157371_10230312 | Ga0157371_102303122 | 195 |
| 474 | 3300013104 | Ga0157370_10327615 | Ga0157370_103276152 | 195 |
| 475 | 3300013105 | Ga0157369_10390815 | Ga0157369_103908152 | 195 |
| 476 | 3300013105 | Ga0157369_10677369 | Ga0157369_106773692 | 195 |
| 477 | 3300013105 | Ga0157369_11298606 | Ga0157369_112986061 | 195 |
| 478 | 3300013296 | Ga0157374_10470627 | Ga0157374_104706272 | 195 |
| 479 | 3300013306 | Ga0163162_10027306 | Ga0163162_100273065 | 195 |
| 480 | 3300013306 | Ga0163162_10137792 | Ga0163162_101377923 | 195 |
| 481 | 3300013306 | Ga0163162_10603452 | Ga0163162_106034522 | 195 |
| 482 | 3300013307 | Ga0157372_10006642 | Ga0157372_100066425 | 195 |
| 483 | 3300013307 | Ga0157372_10023168 | Ga0157372_100231687 | 195 |
| 484 | 3300013307 | Ga0157372_10183403 | Ga0157372_101834033 | 195 |
| 485 | 3300013307 | Ga0157372_10411817 | Ga0157372_104118172 | 195 |
| 486 | 3300013308 | Ga0157375_10085478 | Ga0157375_100854783 | 195 |
| 487 | 3300013308 | Ga0157375_10673008 | Ga0157375_106730081 | 195 |
| 488 | 3300013308 | Ga0157375_11016385 | Ga0157375_110163852 | 195 |
| 489 | 3300013308 | Ga0157375_11683226 | Ga0157375_116832261 | 195 |
| 490 | 3300014325 | Ga0163163_10314158 | Ga0163163_103141582 | 195 |
| 491 | 3300014325 | Ga0163163_10484790 | Ga0163163_104847902 | 195 |
| 492 | 3300014325 | Ga0163163_11856857 | Ga0163163_118568571 | 195 |
| 493 | 3300014326 | Ga0157380_11273185 | Ga0157380_112731851 | 195 |
| 494 | 3300014745 | Ga0157377_10011697 | Ga0157377_100116972 | 195 |
| 495 | 3300014745 | Ga0157377_10086770 | Ga0157377_100867704 | 195 |
| 496 | 3300014968 | Ga0157379_10148164 | Ga0157379_101481642 | 195 |
| 497 | 3300014969 | Ga0157376_10028909 | Ga0157376_100289092 | 195 |
| 498 | 3300014969 | Ga0157376_10928289 | Ga0157376_109282892 | 195 |
| 499 | 3300017792 | Ga0163161_10085718 | Ga0163161_100857183 | 195 |
| 500 | 3300020081 | Ga0206354_10513831 | Ga0206354_105138313 | 195 |
| 501 | 3300020082 | Ga0206353_10159166 | Ga0206353_101591662 | 195 |
| 502 | 3300021358 | Ga0213873_10054893 | Ga0213873_100548931 | 195 |
| 503 | 3300021388 | Ga0213875_10032735 | Ga0213875_100327352 | 195 |
| 504 | 3300022467 | Ga0224712_10103572 | Ga0224712_101035722 | 195 |
| 505 | 3300025321 | Ga0207656_10193740 | Ga0207656_101937402 | 195 |
| 506 | 3300025898 | Ga0207692_10000022 | Ga0207692_1000002210 | 195 |
| 507 | 3300025898 | Ga0207692_10152908 | Ga0207692_101529082 | 195 |
| 508 | 3300025901 | Ga0207688_10000813 | Ga0207688_1000081318 | 195 |
| 509 | 3300025901 | Ga0207688_10034319 | Ga0207688_100343193 | 195 |
| 510 | 3300025901 | Ga0207688_10039540 | Ga0207688_100395401 | 195 |
| 511 | 3300025901 | Ga0207688_10064925 | Ga0207688_100649253 | 195 |
| 512 | 3300025903 | Ga0207680_10323462 | Ga0207680_103234622 | 195 |
| 513 | 3300025908 | Ga0207643_10575587 | Ga0207643_105755871 | 195 |
| 514 | 3300025913 | Ga0207695_10139811 | Ga0207695_101398112 | 195 |
| 515 | 3300025913 | Ga0207695_10513266 | Ga0207695_105132662 | 195 |
| 516 | 3300025913 | Ga0207695_10551251 | Ga0207695_105512512 | 195 |
| 517 | 3300025913 | Ga0207695_10657218 | Ga0207695_106572182 | 195 |
| 518 | 3300025914 | Ga0207671_10001526 | Ga0207671_1000152621 | 195 |
| 519 | 3300025915 | Ga0207693_10000017 | Ga0207693_100000179 | 195 |
| 520 | 3300025915 | Ga0207693_10049193 | Ga0207693_100491934 | 195 |
| 521 | 3300025915 | Ga0207693_10710466 | Ga0207693_107104662 | 195 |
| 522 | 3300025916 | Ga0207663_10002190 | Ga0207663_100021905 | 195 |
| 523 | 3300025916 | Ga0207663_10055324 | Ga0207663_100553243 | 195 |
| 524 | 3300025917 | Ga0207660_10006020 | Ga0207660_100060208 | 195 |
| 525 | 3300025918 | Ga0207662_10077621 | Ga0207662_100776212 | 195 |
| 526 | 3300025919 | Ga0207657_10006359 | Ga0207657_1000635917 | 195 |
| 527 | 3300025919 | Ga0207657_10057000 | Ga0207657_100570004 | 195 |
| 528 | 3300025919 | Ga0207657_10417286 | Ga0207657_104172862 | 195 |
| 529 | 3300025920 | Ga0207649_10176847 | Ga0207649_101768471 | 195 |
| 530 | 3300025920 | Ga0207649_10327925 | Ga0207649_103279252 | 195 |
| 531 | 3300025921 | Ga0207652_10008802 | Ga0207652_100088024 | 195 |
| 532 | 3300025921 | Ga0207652_10094266 | Ga0207652_100942664 | 195 |
| 533 | 3300025921 | Ga0207652_10127154 | Ga0207652_101271543 | 195 |
| 534 | 3300025921 | Ga0207652_10812437 | Ga0207652_108124372 | 195 |
| 535 | 3300025923 | Ga0207681_10016814 | Ga0207681_100168144 | 195 |
| 536 | 3300025923 | Ga0207681_10152625 | Ga0207681_101526252 | 195 |
| 537 | 3300025924 | Ga0207694_10247360 | Ga0207694_102473602 | 195 |
| 538 | 3300025925 | Ga0207650_10698466 | Ga0207650_106984662 | 195 |
| 539 | 3300025926 | Ga0207659_10372296 | Ga0207659_103722961 | 195 |
| 540 | 3300025927 | Ga0207687_10039782 | Ga0207687_100397823 | 195 |
| 541 | 3300025927 | Ga0207687_10324237 | Ga0207687_103242372 | 195 |
| 542 | 3300025928 | Ga0207700_10371009 | Ga0207700_103710092 | 195 |
| 543 | 3300025928 | Ga0207700_10462839 | Ga0207700_104628392 | 195 |
| 544 | 3300025929 | Ga0207664_10000004 | Ga0207664_10000004497 | 195 |
| 545 | 3300025931 | Ga0207644_10041237 | Ga0207644_100412372 | 195 |
| 546 | 3300025931 | Ga0207644_10359468 | Ga0207644_103594682 | 195 |
| 547 | 3300025932 | Ga0207690_10000268 | Ga0207690_1000026834 | 195 |
| 548 | 3300025932 | Ga0207690_10098395 | Ga0207690_100983952 | 195 |
| 549 | 3300025932 | Ga0207690_10141496 | Ga0207690_101414962 | 195 |
| 550 | 3300025932 | Ga0207690_10151916 | Ga0207690_101519162 | 195 |
| 551 | 3300025933 | Ga0207706_10003294 | Ga0207706_1000329420 | 195 |
| 552 | 3300025933 | Ga0207706_10401597 | Ga0207706_104015972 | 195 |
| 553 | 3300025934 | Ga0207686_10237332 | Ga0207686_102373322 | 195 |
| 554 | 3300025937 | Ga0207669_10164059 | Ga0207669_101640592 | 195 |
| 555 | 3300025937 | Ga0207669_10204345 | Ga0207669_102043452 | 195 |
| 556 | 3300025937 | Ga0207669_10315406 | Ga0207669_103154062 | 195 |
| 557 | 3300025937 | Ga0207669_10520656 | Ga0207669_105206562 | 195 |
| 558 | 3300025938 | Ga0207704_10034396 | Ga0207704_100343963 | 195 |
| 559 | 3300025938 | Ga0207704_10242885 | Ga0207704_102428852 | 195 |
| 560 | 3300025940 | Ga0207691_10078503 | Ga0207691_100785031 | 195 |
| 561 | 3300025941 | Ga0207711_10210392 | Ga0207711_102103923 | 195 |
| 562 | 3300025942 | Ga0207689_10041401 | Ga0207689_100414013 | 195 |
| 563 | 3300025942 | Ga0207689_10254294 | Ga0207689_102542942 | 195 |
| 564 | 3300025944 | Ga0207661_10028815 | Ga0207661_100288154 | 195 |
| 565 | 3300025944 | Ga0207661_10131491 | Ga0207661_101314913 | 195 |
| 566 | 3300025944 | Ga0207661_10248948 | Ga0207661_102489482 | 195 |
| 567 | 3300025944 | Ga0207661_10915826 | Ga0207661_109158261 | 195 |
| 568 | 3300025945 | Ga0207679_10023802 | Ga0207679_100238022 | 195 |
| 569 | 3300025945 | Ga0207679_10074750 | Ga0207679_100747502 | 195 |
| 570 | 3300025945 | Ga0207679_10120470 | Ga0207679_101204702 | 195 |
| 571 | 3300025960 | Ga0207651_10687143 | Ga0207651_106871432 | 195 |
| 572 | 3300025961 | Ga0207712_10008255 | Ga0207712_100082552 | 195 |
| 573 | 3300025961 | Ga0207712_10157106 | Ga0207712_101571062 | 195 |
| 574 | 3300025972 | Ga0207668_10089592 | Ga0207668_100895923 | 195 |
| 575 | 3300025981 | Ga0207640_10102975 | Ga0207640_101029753 | 195 |
| 576 | 3300025981 | Ga0207640_10460067 | Ga0207640_104600672 | 195 |
| 577 | 3300025986 | Ga0207658_10029416 | Ga0207658_100294162 | 195 |
| 578 | 3300026023 | Ga0207677_10138916 | Ga0207677_101389162 | 195 |
| 579 | 3300026023 | Ga0207677_10240977 | Ga0207677_102409772 | 195 |
| 580 | 3300026023 | Ga0207677_10369646 | Ga0207677_103696462 | 195 |
| 581 | 3300026023 | Ga0207677_10756946 | Ga0207677_107569461 | 195 |
| 582 | 3300026041 | Ga0207639_10079844 | Ga0207639_100798442 | 195 |
| 583 | 3300026067 | Ga0207678_10009806 | Ga0207678_100098064 | 195 |
| 584 | 3300026067 | Ga0207678_10058133 | Ga0207678_100581332 | 195 |
| 585 | 3300026067 | Ga0207678_10219814 | Ga0207678_102198142 | 195 |
| 586 | 3300026075 | Ga0207708_10000937 | Ga0207708_100009375 | 195 |
| 587 | 3300026075 | Ga0207708_10005784 | Ga0207708_100057846 | 195 |
| 588 | 3300026075 | Ga0207708_10011942 | Ga0207708_100119429 | 195 |
| 589 | 3300026075 | Ga0207708_10035246 | Ga0207708_100352462 | 195 |
| 590 | 3300026078 | Ga0207702_10144487 | Ga0207702_101444872 | 195 |
| 591 | 3300026088 | Ga0207641_10054928 | Ga0207641_100549284 | 195 |
| 592 | 3300026088 | Ga0207641_10505971 | Ga0207641_105059712 | 195 |
| 593 | 3300026089 | Ga0207648_10204819 | Ga0207648_102048192 | 195 |
| 594 | 3300026089 | Ga0207648_10385306 | Ga0207648_103853062 | 195 |
| 595 | 3300026095 | Ga0207676_10062035 | Ga0207676_100620352 | 195 |
| 596 | 3300026116 | Ga0207674_10152988 | Ga0207674_101529882 | 195 |
| 597 | 3300026118 | Ga0207675_100004816 | Ga0207675_1000048168 | 195 |
| 598 | 3300026118 | Ga0207675_100033107 | Ga0207675_1000331073 | 195 |
| 599 | 3300026118 | Ga0207675_100101877 | Ga0207675_1001018773 | 195 |
| 600 | 3300026118 | Ga0207675_100733035 | Ga0207675_1007330351 | 195 |
| 601 | 3300026121 | Ga0207683_10084011 | Ga0207683_100840112 | 195 |
| 602 | 3300026121 | Ga0207683_11173117 | Ga0207683_111731172 | 195 |
| 603 | 3300026142 | Ga0207698_10243788 | Ga0207698_102437881 | 195 |
| 604 | 3300027907 | Ga0207428_10055052 | Ga0207428_100550522 | 195 |
| 605 | 3300027907 | Ga0207428_10201634 | Ga0207428_102016342 | 195 |
| 606 | 3300027907 | Ga0207428_10273695 | Ga0207428_102736952 | 195 |
| 607 | 3300028379 | Ga0268266_10010879 | Ga0268266_100108793 | 195 |
| 608 | 3300028379 | Ga0268266_10366927 | Ga0268266_103669272 | 195 |
| 609 | 3300028381 | Ga0268264_10563193 | Ga0268264_105631932 | 195 |
| 610 | 3300028556 | Ga0265337_1079678 | Ga0265337_10796782 | 195 |
| 611 | 3300028558 | Ga0265326_10000630 | Ga0265326_1000063010 | 195 |
| 612 | 3300028563 | Ga0265319_1001381 | Ga0265319_10013815 | 195 |
| 613 | 3300028563 | Ga0265319_1009072 | Ga0265319_10090722 | 195 |
| 614 | 3300028573 | Ga0265334_10000002 | Ga0265334_1000000211 | 195 |
| 615 | 3300028577 | Ga0265318_10005786 | Ga0265318_100057865 | 195 |
| 616 | 3300028577 | Ga0265318_10047329 | Ga0265318_100473292 | 195 |
| 617 | 3300028577 | Ga0265318_10075213 | Ga0265318_100752132 | 195 |
| 618 | 3300028653 | Ga0265323_10120796 | Ga0265323_101207962 | 195 |
| 619 | 3300028666 | Ga0265336_10002183 | Ga0265336_100021836 | 195 |
| 620 | 3300028800 | Ga0265338_10024856 | Ga0265338_100248565 | 195 |
| 621 | 3300028800 | Ga0265338_10147335 | Ga0265338_101473352 | 195 |
| 622 | 3300028800 | Ga0265338_10386672 | Ga0265338_103866722 | 195 |
| 623 | 3300031240 | Ga0265320_10008105 | Ga0265320_100081055 | 195 |
| 624 | 3300031240 | Ga0265320_10047466 | Ga0265320_100474662 | 195 |
| 625 | 3300031251 | Ga0265327_10121611 | Ga0265327_101216112 | 195 |
| 626 | 3300031251 | Ga0265327_10211865 | Ga0265327_102118652 | 195 |
| 627 | 3300031548 | Ga0307408_100149363 | Ga0307408_1001493632 | 195 |
| 628 | 3300031548 | Ga0307408_100270750 | Ga0307408_1002707502 | 195 |
| 629 | 3300031548 | Ga0307408_100272361 | Ga0307408_1002723612 | 195 |
| 630 | 3300031711 | Ga0265314_10273943 | Ga0265314_102739432 | 195 |
| 631 | 3300031731 | Ga0307405_10047556 | Ga0307405_100475562 | 195 |
| 632 | 3300031731 | Ga0307405_10071547 | Ga0307405_100715473 | 195 |
| 633 | 3300031731 | Ga0307405_10158330 | Ga0307405_101583302 | 195 |
| 634 | 3300031824 | Ga0307413_10067704 | Ga0307413_100677043 | 195 |
| 635 | 3300031824 | Ga0307413_10084903 | Ga0307413_100849032 | 195 |
| 636 | 3300031824 | Ga0307413_10961614 | Ga0307413_109616141 | 195 |
| 637 | 3300031852 | Ga0307410_10020116 | Ga0307410_100201162 | 195 |
| 638 | 3300031852 | Ga0307410_10035996 | Ga0307410_100359962 | 195 |
| 639 | 3300031852 | Ga0307410_10050510 | Ga0307410_100505103 | 195 |
| 640 | 3300031852 | Ga0307410_10853731 | Ga0307410_108537312 | 195 |
| 641 | 3300031852 | Ga0307410_10983725 | Ga0307410_109837252 | 195 |
| 642 | 3300031889 | Ga0326468_10011767 | Ga0326468_100117672 | 195 |
| 643 | 3300031901 | Ga0307406_10027100 | Ga0307406_100271002 | 195 |
| 644 | 3300031901 | Ga0307406_10131462 | Ga0307406_101314623 | 195 |
| 645 | 3300031903 | Ga0307407_10098143 | Ga0307407_100981432 | 195 |
| 646 | 3300031903 | Ga0307407_10358508 | Ga0307407_103585082 | 195 |
| 647 | 3300031911 | Ga0307412_10131209 | Ga0307412_101312092 | 195 |
| 648 | 3300031995 | Ga0307409_100011229 | Ga0307409_1000112295 | 195 |
| 649 | 3300031995 | Ga0307409_100017566 | Ga0307409_1000175665 | 195 |
| 650 | 3300031995 | Ga0307409_100056097 | Ga0307409_1000560972 | 195 |
| 651 | 3300031995 | Ga0307409_100066444 | Ga0307409_1000664441 | 195 |
| 652 | 3300031995 | Ga0307409_100091978 | Ga0307409_1000919783 | 195 |
| 653 | 3300031995 | Ga0307409_100182248 | Ga0307409_1001822482 | 195 |
| 654 | 3300031995 | Ga0307409_100357287 | Ga0307409_1003572872 | 195 |
| 655 | 3300032002 | Ga0307416_100028146 | Ga0307416_1000281462 | 195 |
| 656 | 3300032002 | Ga0307416_100060399 | Ga0307416_1000603992 | 195 |
| 657 | 3300032002 | Ga0307416_100240649 | Ga0307416_1002406492 | 195 |
| 658 | 3300032002 | Ga0307416_100309296 | Ga0307416_1003092962 | 195 |
| 659 | 3300032002 | Ga0307416_100348654 | Ga0307416_1003486542 | 195 |
| 660 | 3300032002 | Ga0307416_100379049 | Ga0307416_1003790492 | 195 |
| 661 | 3300032002 | Ga0307416_100401692 | Ga0307416_1004016922 | 195 |
| 662 | 3300032002 | Ga0307416_100982852 | Ga0307416_1009828521 | 195 |
| 663 | 3300032002 | Ga0307416_101021688 | Ga0307416_1010216882 | 195 |
| 664 | 3300032002 | Ga0307416_101285132 | Ga0307416_1012851321 | 195 |
| 665 | 3300032004 | Ga0307414_10100122 | Ga0307414_101001223 | 195 |
| 666 | 3300032005 | Ga0307411_10114352 | Ga0307411_101143522 | 195 |
| 667 | 3300032005 | Ga0307411_10445148 | Ga0307411_104451482 | 195 |
| 668 | 3300032005 | Ga0307411_10977401 | Ga0307411_109774012 | 195 |
| 669 | 3300032126 | Ga0307415_100003017 | Ga0307415_1000030177 | 195 |
| 670 | 3300032126 | Ga0307415_100069572 | Ga0307415_1000695723 | 195 |
| 671 | 3300032126 | Ga0307415_100132044 | Ga0307415_1001320442 | 195 |
| 672 | 3300032126 | Ga0307415_100133214 | Ga0307415_1001332142 | 195 |
| 673 | 3300032126 | Ga0307415_100218137 | Ga0307415_1002181372 | 195 |
| 674 | 3300032126 | Ga0307415_100363516 | Ga0307415_1003635162 | 195 |
| 675 | 3300032126 | Ga0307415_100514303 | Ga0307415_1005143032 | 195 |
| 676 | 3300032126 | Ga0307415_100794725 | Ga0307415_1007947252 | 195 |
| 677 | 3300035121 | Ga0373960_0042544 | Ga0373960_0042544_269_856 | 195 |
| 678 | 3300035170 | Ga0373943_0051887 | Ga0373943_0051887_1316_1903 | 195 |
| 679 | 3300035241 | Ga0373961_0085827 | Ga0373961_0085827_267_863 | 195 |
| 680 | 3300035691 | Ga0373931_0187096 | Ga0373931_0187096_116_712 | 195 |
| 681 | 3300037068 | Ga0373925_0517403 | Ga0373925_0517403_253_840 | 195 |
| 682 | 3300037418 | Ga0395900_1120423 | Ga0395900_1120423_68_661 | 195 |
| 683 | 3300037466 | Ga0395898_0047298 | Ga0395898_0047298_2152_2745 | 195 |
| 684 | 3300037466 | Ga0395898_0421362 | Ga0395898_0421362_530_1120 | 195 |
| 685 | 3300037471 | Ga0395905_0492484 | Ga0395905_0492484_330_917 | 195 |
| 686 | 3300037853 | Ga0436364_0069355 | Ga0436364_0069355_208_798 | 195 |
| 687 | 3300037853 | Ga0436364_0637349 | Ga0436364_0637349_1575_2165 | 195 |
| 688 | 3300038443 | Ga0395901_0026246 | Ga0395901_0026246_56_649 | 195 |
| 689 | 3300038443 | Ga0395901_0172676 | Ga0395901_0172676_1063_1656 | 195 |
| 690 | 3300038443 | Ga0395901_0285448 | Ga0395901_0285448_366_959 | 195 |
| 691 | 3300038443 | Ga0395901_0988665 | Ga0395901_0988665_202_801 | 195 |
| 692 | 3300039437 | Ga0436365_0367556 | Ga0436365_0367556_1171_1761 | 195 |
| 693 | 3300039437 | Ga0436365_0869569 | Ga0436365_0869569_82_672 | 195 |
| 694 | 3300039437 | Ga0436365_1517862 | Ga0436365_1517862_2490_3092 | 195 |
| 695 | 3300039450 | Ga0436363_0311232 | Ga0436363_0311232_44_637 | 195 |
| 696 | 3300039453 | Ga0436362_0383083 | Ga0436362_0383083_50_652 | 195 |
| 697 | 3300039453 | Ga0436362_0577753 | Ga0436362_0577753_114_707 | 195 |
| 698 | 3300044656 | Ga0466969_0030135 | Ga0466969_0030135_565_1155 | 195 |
| 699 | 3300044684 | Ga0466966_0040633 | Ga0466966_0040633_1741_2334 | 195 |
| 700 | 3300044684 | Ga0466966_0074139 | Ga0466966_0074139_174_800 | 195 |
| 701 | 3300044684 | Ga0466966_0378420 | Ga0466966_0378420_177_767 | 195 |
| 702 | 3300044693 | Ga0466961_0004147 | Ga0466961_0004147_8134_8727 | 195 |
| 703 | 3300044693 | Ga0466961_0103773 | Ga0466961_0103773_455_1045 | 195 |
| 704 | 3300044694 | Ga0466963_0016615 | Ga0466963_0016615_441_1046 | 195 |
| 705 | 3300044694 | Ga0466963_0251045 | Ga0466963_0251045_29_625 | 195 |
| 706 | 3300044694 | Ga0466963_0565513 | Ga0466963_0565513_14_604 | 195 |
| 707 | 3300044694 | Ga0466963_0627894 | Ga0466963_0627894_151_741 | 195 |
| 708 | 3300044694 | Ga0466963_0854409 | Ga0466963_0854409_26_613 | 195 |
| 709 | 3300044706 | Ga0466964_0091450 | Ga0466964_0091450_657_1253 | 195 |
| 710 | 3300044706 | Ga0466964_0214286 | Ga0466964_0214286_167_757 | 195 |
| 711 | 3300044719 | Ga0466971_0169199 | Ga0466971_0169199_177_770 | 195 |
| 712 | 3300044735 | Ga0466968_0023973 | Ga0466968_0023973_1007_1600 | 195 |
| 713 | 3300044735 | Ga0466968_0030132 | Ga0466968_0030132_909_1499 | 195 |
| 714 | 3300044765 | Ga0466970_0186309 | Ga0466970_0186309_348_941 | 195 |
| 715 | 3300044842 | Ga0466957_0005022 | Ga0466957_0005022_1620_2210 | 195 |
| 716 | 3300044842 | Ga0466957_0198208 | Ga0466957_0198208_477_1082 | 195 |
| 717 | 3300044842 | Ga0466957_0498444 | Ga0466957_0498444_166_756 | 195 |
| 718 | 3300044842 | Ga0466957_0539345 | Ga0466957_0539345_74_709 | 195 |
| 719 | 3300044842 | Ga0466957_0561600 | Ga0466957_0561600_185_781 | 195 |
| 720 | 3300044901 | Ga0466960_0025275 | Ga0466960_0025275_1017_1610 | 195 |
| 721 | 3300044901 | Ga0466960_0079028 | Ga0466960_0079028_593_1186 | 195 |
| 722 | 3300044901 | Ga0466960_0173092 | Ga0466960_0173092_197_793 | 195 |
| 723 | 3300044901 | Ga0466960_0245859 | Ga0466960_0245859_170_763 | 195 |
| 724 | 3300045049 | Ga0466959_0025843 | Ga0466959_0025843_3275_3865 | 195 |
| 725 | 3300045049 | Ga0466959_0029413 | Ga0466959_0029413_3257_3850 | 195 |
| 726 | 3300045049 | Ga0466959_0189196 | Ga0466959_0189196_330_920 | 195 |
| 727 | 3300045836 | Ga0466958_0008664 | Ga0466958_0008664_3179_3769 | 195 |
| 728 | 3300045836 | Ga0466958_0036525 | Ga0466958_0036525_1256_1846 | 195 |
| 729 | 3300045836 | Ga0466958_0052338 | Ga0466958_0052338_826_1419 | 195 |
| 730 | 3300045836 | Ga0466958_0137732 | Ga0466958_0137732_909_1505 | 195 |
| 731 | 3300045976 | Ga0466967_0005031 | Ga0466967_0005031_7353_7952 | 195 |
| 732 | 3300045976 | Ga0466967_0023219 | Ga0466967_0023219_1787_2383 | 195 |
| 733 | 3300045976 | Ga0466967_0027316 | Ga0466967_0027316_820_1416 | 195 |
| 734 | 3300045976 | Ga0466967_0132475 | Ga0466967_0132475_1208_1807 | 195 |
| 735 | 3300045976 | Ga0466967_0215269 | Ga0466967_0215269_233_829 | 195 |
| 736 | 3300045976 | Ga0466967_0225689 | Ga0466967_0225689_489_1079 | 195 |
| 737 | 3300045976 | Ga0466967_0297834 | Ga0466967_0297834_652_1239 | 195 |
| 738 | 3300045976 | Ga0466967_0523551 | Ga0466967_0523551_495_1091 | 195 |
| 739 | 3300045976 | Ga0466967_0572986 | Ga0466967_0572986_462_1061 | 195 |
| 740 | 3300046455 | Ga0495603_0144193 | Ga0495603_0144193_133_726 | 195 |
| 741 | 3300046459 | Ga0495629_0105003 | Ga0495629_0105003_1198_1791 | 195 |
| 742 | 3300046459 | Ga0495629_0411793 | Ga0495629_0411793_19_627 | 195 |
| 743 | 3300046472 | Ga0495580_0336198 | Ga0495580_0336198_82_675 | 195 |
| 744 | 3300046473 | Ga0495582_0257222 | Ga0495582_0257222_123_716 | 195 |
| 745 | 3300046477 | Ga0495664_0000012 | Ga0495664_0000012_216072_216689 | 195 |
| 746 | 3300046477 | Ga0495664_0288244 | Ga0495664_0288244_14_604 | 195 |
| 747 | 3300046511 | Ga0495608_0120798 | Ga0495608_0120798_959_1621 | 195 |
| 748 | 3300046516 | Ga0495628_0370922 | Ga0495628_0370922_54_644 | 195 |
| 749 | 3300046517 | Ga0495630_0011902 | Ga0495630_0011902_1372_1965 | 195 |
| 750 | 3300046523 | Ga0495644_0123461 | Ga0495644_0123461_309_896 | 195 |
| 751 | 3300046529 | Ga0495652_0053133 | Ga0495652_0053133_2814_3440 | 195 |
| 752 | 3300046543 | Ga0495645_0000012 | Ga0495645_0000012_5973_6581 | 195 |
| 753 | 3300046559 | Ga0495667_0348810 | Ga0495667_0348810_52_645 | 195 |
| 754 | 3300046615 | Ga0495656_0194779 | Ga0495656_0194779_387_980 | 195 |
| 755 | 3300046675 | Ga0495657_0000007 | Ga0495657_0000007_173144_173737 | 195 |
| 756 | 3300046678 | Ga0495599_0465602 | Ga0495599_0465602_92_700 | 195 |
| 757 | 3300046809 | Ga0495600_0028472 | Ga0495600_0028472_1813_2475 | 195 |
| 758 | 3300047319 | Ga0495674_0207925 | Ga0495674_0207925_670_1263 | 195 |
| 759 | 3300047321 | Ga0495676_0227660 | Ga0495676_0227660_653_1243 | 195 |
| 760 | 3300047322 | Ga0495680_0055337 | Ga0495680_0055337_354_947 | 195 |
| 761 | 3300047471 | Ga0495684_0036602 | Ga0495684_0036602_1780_2373 | 195 |
| 762 | 3300048903 | Ga0496100_0005686 | Ga0496100_0005686_1157_1762 | 195 |
| 763 | 3300048903 | Ga0496100_0011761 | Ga0496100_0011761_874_1467 | 195 |
| 764 | 3300048903 | Ga0496100_0061411 | Ga0496100_0061411_109_702 | 195 |
| 765 | 3300048903 | Ga0496100_0375744 | Ga0496100_0375744_207_803 | 195 |
| 766 | 3300048903 | Ga0496100_0669049 | Ga0496100_0669049_191_787 | 195 |
| 767 | 3300048904 | Ga0496101_0011694 | Ga0496101_0011694_1360_1953 | 195 |
| 768 | 3300048904 | Ga0496101_0243794 | Ga0496101_0243794_264_857 | 195 |
| 769 | 3300048905 | Ga0496102_0000027 | Ga0496102_0000027_218515_219132 | 195 |
| 770 | 3300048905 | Ga0496102_0001758 | Ga0496102_0001758_10220_10813 | 195 |
| 771 | 3300048905 | Ga0496102_0012087 | Ga0496102_0012087_4077_4664 | 195 |
| 772 | 3300048905 | Ga0496102_0081859 | Ga0496102_0081859_330_926 | 195 |
| 773 | 3300048906 | Ga0496103_0001348 | Ga0496103_0001348_8492_9109 | 195 |
| 774 | 3300048906 | Ga0496103_0009119 | Ga0496103_0009119_1166_1762 | 195 |
| 775 | 3300048906 | Ga0496103_0086878 | Ga0496103_0086878_402_998 | 195 |
| 776 | 3300048907 | Ga0496104_0003438 | Ga0496104_0003438_6026_6619 | 195 |
| 777 | 3300048907 | Ga0496104_0015713 | Ga0496104_0015713_1215_1811 | 195 |
| 778 | 3300048907 | Ga0496104_0065216 | Ga0496104_0065216_41_628 | 195 |
| 779 | 3300048907 | Ga0496104_0194632 | Ga0496104_0194632_294_887 | 195 |
| 780 | 3300048907 | Ga0496104_0450871 | Ga0496104_0450871_449_1042 | 195 |
| 781 | 3300048908 | Ga0496105_0023481 | Ga0496105_0023481_2915_3508 | 195 |
| 782 | 3300048908 | Ga0496105_0092970 | Ga0496105_0092970_900_1487 | 195 |
| 783 | 3300048908 | Ga0496105_0170169 | Ga0496105_0170169_1158_1754 | 195 |
| 784 | 3300048908 | Ga0496105_0348997 | Ga0496105_0348997_313_909 | 195 |
| 785 | 3300048908 | Ga0496105_0463918 | Ga0496105_0463918_383_988 | 195 |
| 786 | 3300048909 | Ga0496106_0044920 | Ga0496106_0044920_719_1312 | 195 |
| 787 | 3300048909 | Ga0496106_0065354 | Ga0496106_0065354_1584_2171 | 195 |
| 788 | 3300048910 | Ga0496107_0009275 | Ga0496107_0009275_4552_5139 | 195 |
| 789 | 3300048910 | Ga0496107_0239060 | Ga0496107_0239060_10_606 | 195 |
| 790 | 3300048911 | Ga0496108_0006662 | Ga0496108_0006662_4112_4699 | 195 |
| 791 | 3300048911 | Ga0496108_0042757 | Ga0496108_0042757_253_846 | 195 |
| 792 | 3300048911 | Ga0496108_0161303 | Ga0496108_0161303_495_1088 | 195 |
| 793 | 3300048911 | Ga0496108_0429061 | Ga0496108_0429061_163_759 | 195 |
| 794 | 3300048912 | Ga0496109_0023996 | Ga0496109_0023996_1276_1863 | 195 |
| 795 | 3300048912 | Ga0496109_0111247 | Ga0496109_0111247_503_1096 | 195 |
| 796 | 3300048912 | Ga0496109_0187399 | Ga0496109_0187399_773_1366 | 195 |
| 797 | 3300048912 | Ga0496109_0451959 | Ga0496109_0451959_553_1146 | 195 |
| 798 | 3300048912 | Ga0496109_0594754 | Ga0496109_0594754_231_824 | 195 |
| 799 | 3300048913 | Ga0496110_0003019 | Ga0496110_0003019_3899_4486 | 195 |
| 800 | 3300048913 | Ga0496110_0062723 | Ga0496110_0062723_2089_2682 | 195 |
| 801 | 3300048913 | Ga0496110_0808958 | Ga0496110_0808958_108_704 | 195 |
| 802 | 3300048913 | Ga0496110_0954202 | Ga0496110_0954202_93_686 | 195 |
| 803 | 3300048914 | Ga0496111_0001332 | Ga0496111_0001332_2558_3145 | 195 |
| 804 | 3300048914 | Ga0496111_0011253 | Ga0496111_0011253_2874_3467 | 195 |
| 805 | 3300048914 | Ga0496111_0032700 | Ga0496111_0032700_332_928 | 195 |
| 806 | 3300048914 | Ga0496111_0066011 | Ga0496111_0066011_1366_1959 | 195 |
| 807 | 3300048915 | Ga0496112_0000200 | Ga0496112_0000200_5960_6553 | 195 |
| 808 | 3300048915 | Ga0496112_0025245 | Ga0496112_0025245_84_677 | 195 |
| 809 | 3300048915 | Ga0496112_0045162 | Ga0496112_0045162_353_946 | 195 |
| 810 | 3300048915 | Ga0496112_0124638 | Ga0496112_0124638_571_1158 | 195 |
| 811 | 3300048915 | Ga0496112_0180021 | Ga0496112_0180021_402_992 | 195 |
| 812 | 3300048915 | Ga0496112_0511496 | Ga0496112_0511496_434_1027 | 195 |
| 813 | 3300048915 | Ga0496112_0554970 | Ga0496112_0554970_386_982 | 195 |
| 814 | 3300048915 | Ga0496112_0617699 | Ga0496112_0617699_193_783 | 195 |
| 815 | 3300048915 | Ga0496112_0821146 | Ga0496112_0821146_132_728 | 195 |
| 816 | 3300048916 | Ga0496113_0009548 | Ga0496113_0009548_1760_2347 | 195 |
| 817 | 3300048916 | Ga0496113_0090241 | Ga0496113_0090241_170_763 | 195 |
| 818 | 3300048916 | Ga0496113_0118977 | Ga0496113_0118977_164_757 | 195 |
| 819 | 3300048917 | Ga0496114_0467708 | Ga0496114_0467708_79_666 | 195 |
| 820 | 3300048917 | Ga0496114_0640806 | Ga0496114_0640806_243_836 | 195 |
| 821 | 3300048917 | Ga0496114_0733901 | Ga0496114_0733901_123_716 | 195 |
| 822 | 3300048918 | Ga0496115_0055013 | Ga0496115_0055013_737_1333 | 195 |
| 823 | 3300048918 | Ga0496115_0411658 | Ga0496115_0411658_171_764 | 195 |
| 824 | 3300048918 | Ga0496115_0468815 | Ga0496115_0468815_336_929 | 195 |
| 825 | 3300048919 | Ga0496116_0000176 | Ga0496116_0000176_85367_85963 | 195 |
| 826 | 3300048920 | Ga0496117_0012250 | Ga0496117_0012250_5608_6204 | 195 |
| 827 | 3300048921 | Ga0496118_0005822 | Ga0496118_0005822_7622_8218 | 195 |
| 828 | 3300048921 | Ga0496118_0189826 | Ga0496118_0189826_253_849 | 195 |
| 829 | 3300048922 | Ga0496119_0022041 | Ga0496119_0022041_1301_1897 | 195 |
| 830 | 3300048922 | Ga0496119_0045653 | Ga0496119_0045653_131_727 | 195 |
| 831 | 3300048923 | Ga0496120_0008785 | Ga0496120_0008785_4992_5588 | 195 |
| 832 | 3300048924 | Ga0496121_0128403 | Ga0496121_0128403_555_1151 | 195 |
| 833 | 3300048924 | Ga0496121_0193951 | Ga0496121_0193951_277_873 | 195 |
| 834 | 3300048927 | Ga0496124_0017107 | Ga0496124_0017107_5255_5851 | 195 |
| 835 | 3300048929 | Ga0496126_0373062 | Ga0496126_0373062_325_921 | 195 |
| 836 | 3300049514 | Ga0501291_059373 | Ga0501291_059373_37_630 | 195 |
| 837 | 3300049568 | Ga0501031_0004602 | Ga0501031_0004602_534_1130 | 195 |
| 838 | 3300049568 | Ga0501031_0019873 | Ga0501031_0019873_1356_1943 | 195 |
| 839 | 3300049568 | Ga0501031_0087685 | Ga0501031_0087685_1002_1598 | 195 |
| 840 | 3300049569 | Ga0501032_0002323 | Ga0501032_0002323_7783_8379 | 195 |
| 841 | 3300049569 | Ga0501032_0005183 | Ga0501032_0005183_7254_7841 | 195 |
| 842 | 3300049570 | Ga0501033_0001255 | Ga0501033_0001255_14331_14927 | 195 |
| 843 | 3300049570 | Ga0501033_0028212 | Ga0501033_0028212_1117_1704 | 195 |
| 844 | 3300049571 | Ga0501034_0016423 | Ga0501034_0016423_953_1549 | 195 |
| 845 | 3300049571 | Ga0501034_0367342 | Ga0501034_0367342_230_832 | 195 |
| 846 | 3300049571 | Ga0501034_0710376 | Ga0501034_0710376_260_847 | 195 |
| 847 | 3300049572 | Ga0501036_0004619 | Ga0501036_0004619_2723_3319 | 195 |
| 848 | 3300049572 | Ga0501036_0161191 | Ga0501036_0161191_1094_1690 | 195 |
| 849 | 3300049572 | Ga0501036_0178674 | Ga0501036_0178674_1108_1695 | 195 |
| 850 | 3300049572 | Ga0501036_0507748 | Ga0501036_0507748_284_886 | 195 |
| 851 | 3300049572 | Ga0501036_0621470 | Ga0501036_0621470_133_729 | 195 |
| 852 | 3300049573 | Ga0501037_0002105 | Ga0501037_0002105_7820_8416 | 195 |
| 853 | 3300049573 | Ga0501037_0084212 | Ga0501037_0084212_910_1506 | 195 |
| 854 | 3300049574 | Ga0501038_0003549 | Ga0501038_0003549_7721_8317 | 195 |
| 855 | 3300049574 | Ga0501038_0028808 | Ga0501038_0028808_974_1561 | 195 |
| 856 | 3300049574 | Ga0501038_0339781 | Ga0501038_0339781_428_1015 | 195 |
| 857 | 3300049575 | Ga0501039_0015041 | Ga0501039_0015041_4147_4743 | 195 |
| 858 | 3300049575 | Ga0501039_0016303 | Ga0501039_0016303_873_1469 | 195 |
| 859 | 3300049575 | Ga0501039_0051757 | Ga0501039_0051757_2072_2659 | 195 |
| 860 | 3300049575 | Ga0501039_0777105 | Ga0501039_0777105_80_667 | 195 |
| 861 | 3300049576 | Ga0501040_0046498 | Ga0501040_0046498_1329_1916 | 195 |
| 862 | 3300049577 | Ga0501041_0073997 | Ga0501041_0073997_408_1004 | 195 |
| 863 | 3300049577 | Ga0501041_0108610 | Ga0501041_0108610_372_959 | 195 |
| 864 | 3300049578 | Ga0501042_0065224 | Ga0501042_0065224_1067_1663 | 195 |
| 865 | 3300049578 | Ga0501042_0092955 | Ga0501042_0092955_1359_1955 | 195 |
| 866 | 3300049578 | Ga0501042_0103883 | Ga0501042_0103883_407_994 | 195 |
| 867 | 3300049578 | Ga0501042_0250936 | Ga0501042_0250936_380_967 | 195 |
| 868 | 3300049579 | Ga0501043_0002925 | Ga0501043_0002925_7742_8338 | 195 |
| 869 | 3300049579 | Ga0501043_0081375 | Ga0501043_0081375_1622_2209 | 195 |
| 870 | 3300049579 | Ga0501043_0428448 | Ga0501043_0428448_249_845 | 195 |
| 871 | 3300049580 | Ga0501046_0003552 | Ga0501046_0003552_5921_6517 | 195 |
| 872 | 3300049580 | Ga0501046_0009834 | Ga0501046_0009834_4290_4877 | 195 |
| 873 | 3300049580 | Ga0501046_0100685 | Ga0501046_0100685_1466_2062 | 195 |
| 874 | 3300049580 | Ga0501046_0483342 | Ga0501046_0483342_241_837 | 195 |
| 875 | 3300049581 | Ga0501047_0002361 | Ga0501047_0002361_11402_11998 | 195 |
| 876 | 3300049581 | Ga0501047_0057684 | Ga0501047_0057684_2873_3460 | 195 |
| 877 | 3300049581 | Ga0501047_0061159 | Ga0501047_0061159_1690_2286 | 195 |
| 878 | 3300049581 | Ga0501047_0119545 | Ga0501047_0119545_783_1379 | 195 |
| 879 | 3300049581 | Ga0501047_0134553 | Ga0501047_0134553_113_709 | 195 |
| 880 | 3300049582 | Ga0501048_0002577 | Ga0501048_0002577_5495_6091 | 195 |
| 881 | 3300049582 | Ga0501048_0198898 | Ga0501048_0198898_740_1336 | 195 |
| 882 | 3300049582 | Ga0501048_0290307 | Ga0501048_0290307_250_846 | 195 |
| 883 | 3300049583 | Ga0501067_0003591 | Ga0501067_0003591_5397_5984 | 195 |
| 884 | 3300049584 | Ga0501068_0009293 | Ga0501068_0009293_199_795 | 195 |
| 885 | 3300049584 | Ga0501068_0031540 | Ga0501068_0031540_407_994 | 195 |
| 886 | 3300049585 | Ga0501069_0003034 | Ga0501069_0003034_3254_3850 | 195 |
| 887 | 3300049585 | Ga0501069_0079700 | Ga0501069_0079700_853_1449 | 195 |
| 888 | 3300049586 | Ga0501070_0000832 | Ga0501070_0000832_19727_20323 | 195 |
| 889 | 3300049586 | Ga0501070_0009212 | Ga0501070_0009212_6263_6859 | 195 |
| 890 | 3300049587 | Ga0501071_0053674 | Ga0501071_0053674_1020_1616 | 195 |
| 891 | 3300049587 | Ga0501071_0076231 | Ga0501071_0076231_922_1509 | 195 |
| 892 | 3300049588 | Ga0501072_0007453 | Ga0501072_0007453_5488_6084 | 195 |
| 893 | 3300049588 | Ga0501072_0016434 | Ga0501072_0016434_2686_3282 | 195 |
| 894 | 3300049588 | Ga0501072_0247865 | Ga0501072_0247865_377_973 | 195 |
| 895 | 3300049589 | Ga0501073_0007834 | Ga0501073_0007834_5921_6517 | 195 |
| 896 | 3300049589 | Ga0501073_0009603 | Ga0501073_0009603_4385_4972 | 195 |
| 897 | 3300049590 | Ga0501074_0007166 | Ga0501074_0007166_4560_5156 | 195 |
| 898 | 3300049590 | Ga0501074_0035154 | Ga0501074_0035154_1962_2549 | 195 |
| 899 | 3300049590 | Ga0501074_0083958 | Ga0501074_0083958_1552_2148 | 195 |
| 900 | 3300049590 | Ga0501074_0295117 | Ga0501074_0295117_469_1056 | 195 |
| 901 | 3300049590 | Ga0501074_0376689 | Ga0501074_0376689_245_841 | 195 |
| 902 | 3300049591 | Ga0501075_0148563 | Ga0501075_0148563_992_1588 | 195 |
| 903 | 3300049592 | Ga0501076_0056905 | Ga0501076_0056905_2078_2665 | 195 |
| 904 | 3300049592 | Ga0501076_0100517 | Ga0501076_0100517_1009_1605 | 195 |
| 905 | 3300049592 | Ga0501076_0309229 | Ga0501076_0309229_656_1252 | 195 |
| 906 | 3300049592 | Ga0501076_0341570 | Ga0501076_0341570_216_803 | 195 |
| 907 | 3300049741 | Ga0501079_0009011 | Ga0501079_0009011_1164_1760 | 195 |
| 908 | 3300049741 | Ga0501079_0039174 | Ga0501079_0039174_1908_2495 | 195 |
| 909 | 3300049741 | Ga0501079_0176701 | Ga0501079_0176701_764_1351 | 195 |
| 910 | 3300049742 | Ga0501080_0007024 | Ga0501080_0007024_7764_8360 | 195 |
| 911 | 3300049742 | Ga0501080_0042368 | Ga0501080_0042368_1769_2356 | 195 |
| 912 | 3300049742 | Ga0501080_0267252 | Ga0501080_0267252_58_648 | 195 |
| 913 | 3300049742 | Ga0501080_1049355 | Ga0501080_1049355_69_665 | 195 |
| 914 | 3300049743 | Ga0501081_0058683 | Ga0501081_0058683_1929_2516 | 195 |
| 915 | 3300049744 | Ga0501083_0002406 | Ga0501083_0002406_5258_5854 | 195 |
| 916 | 3300049744 | Ga0501083_0038323 | Ga0501083_0038323_464_1051 | 195 |
| 917 | 3300049744 | Ga0501083_0114676 | Ga0501083_0114676_1132_1728 | 195 |
| 918 | 3300049822 | Ga0501035_0004128 | Ga0501035_0004128_7786_8382 | 195 |
| 919 | 3300049822 | Ga0501035_0022019 | Ga0501035_0022019_2874_3461 | 195 |
| 920 | 3300049822 | Ga0501035_0259373 | Ga0501035_0259373_281_868 | 195 |
| 921 | 3300049823 | Ga0501044_0000684 | Ga0501044_0000684_33931_34527 | 195 |
| 922 | 3300049823 | Ga0501044_0064508 | Ga0501044_0064508_521_1117 | 195 |
| 923 | 3300049824 | Ga0501045_0053737 | Ga0501045_0053737_571_1167 | 195 |
| 924 | 3300049824 | Ga0501045_0094821 | Ga0501045_0094821_1247_1834 | 195 |
| 925 | 3300049824 | Ga0501045_0140998 | Ga0501045_0140998_433_1020 | 195 |
| 926 | 3300050507 | nmdc:mga05p37_1164634_c1 | nmdc:mga05p37_1164634_c1_71_667 | 195 |
| 927 | 3300050507 | nmdc:mga05p37_140993_c1 | nmdc:mga05p37_140993_c1_353_943 | 195 |
| 928 | 3300050507 | nmdc:mga05p37_1604883_c1 | nmdc:mga05p37_1604883_c1_27_626 | 195 |
| 929 | 3300050507 | nmdc:mga05p37_45564_c1 | nmdc:mga05p37_45564_c1_2378_2965 | 195 |
| 930 | 3300050507 | nmdc:mga05p37_704595_c1 | nmdc:mga05p37_704595_c1_105_692 | 195 |
| 931 | 3300050508 | nmdc:mga09592_19237_c1 | nmdc:mga09592_19237_c1_1639_2226 | 195 |
| 932 | 3300050508 | nmdc:mga09592_385900_c1 | nmdc:mga09592_385900_c1_228_815 | 195 |
| 933 | 3300050508 | nmdc:mga09592_390814_c1 | nmdc:mga09592_390814_c1_326_916 | 195 |
| 934 | 3300050508 | nmdc:mga09592_6990_c1 | nmdc:mga09592_6990_c1_2590_3183 | 195 |
| 935 | 3300050509 | nmdc:mga0qj67_334433_c1 | nmdc:mga0qj67_334433_c1_478_1065 | 195 |
| 936 | 3300050510 | nmdc:mga06r32_190968_c1 | nmdc:mga06r32_190968_c1_1221_1808 | 195 |
| 937 | 3300050510 | nmdc:mga06r32_32616_c1 | nmdc:mga06r32_32616_c1_35_625 | 195 |
| 938 | 3300050511 | nmdc:mga08y16_118758_c1 | nmdc:mga08y16_118758_c1_1394_1990 | 195 |
| 939 | 3300050511 | nmdc:mga08y16_190763_c1 | nmdc:mga08y16_190763_c1_1109_1696 | 195 |
| 940 | 3300050511 | nmdc:mga08y16_276486_c1 | nmdc:mga08y16_276486_c1_489_1085 | 195 |
| 941 | 3300050511 | nmdc:mga08y16_35631_c1 | nmdc:mga08y16_35631_c1_2664_3260 | 195 |
| 942 | 3300050511 | nmdc:mga08y16_37510_c1 | nmdc:mga08y16_37510_c1_2019_2606 | 195 |
| 943 | 3300050511 | nmdc:mga08y16_652245_c1 | nmdc:mga08y16_652245_c1_428_1018 | 195 |
| 944 | 3300050512 | nmdc:mga0n895_121418_c1 | nmdc:mga0n895_121418_c1_328_918 | 195 |
| 945 | 3300050512 | nmdc:mga0n895_326177_c1 | nmdc:mga0n895_326177_c1_195_782 | 195 |
| 946 | 3300050512 | nmdc:mga0n895_601864_c1 | nmdc:mga0n895_601864_c1_166_759 | 195 |
| 947 | 3300050512 | nmdc:mga0n895_64787_c1 | nmdc:mga0n895_64787_c1_539_1135 | 195 |
| 948 | 3300050515 | nmdc:mga0a205_51769_c1 | nmdc:mga0a205_51769_c1_2043_2633 | 195 |
| 949 | 3300050515 | nmdc:mga0a205_828417_c1 | nmdc:mga0a205_828417_c1_43_639 | 195 |
| 950 | 3300053077 | Ga0495601_0005015 | Ga0495601_0005015_1454_2047 | 195 |
| 951 | 3300053078 | Ga0495612_0000023 | Ga0495612_0000023_5659_6249 | 195 |
| 952 | 3300053083 | Ga0495655_0073885 | Ga0495655_0073885_266_853 | 195 |
| 953 | 3300053083 | Ga0495655_0080651 | Ga0495655_0080651_223_831 | 195 |
| 954 | 3300053139 | Ga0500568_0175941 | Ga0500568_0175941_106_708 | 195 |
| 955 | 3300053153 | Ga0500616_0025481 | Ga0500616_0025481_309_902 | 195 |
| 956 | 3300053153 | Ga0500616_0142130 | Ga0500616_0142130_324_926 | 195 |
| 957 | 3300054114 | Ga0501084_0021707 | Ga0501084_0021707_3293_3880 | 195 |
| 958 | 3300054114 | Ga0501084_0044658 | Ga0501084_0044658_2221_2817 | 195 |
| 959 | 3300054114 | Ga0501084_0506402 | Ga0501084_0506402_312_908 | 195 |
| 960 | 3300060344 | Ga0587071_045024 | Ga0587071_045024_167_784 | 195 |
| 961 | 3300060353 | Ga0501082_0008369 | Ga0501082_0008369_1350_1946 | 195 |
| 962 | 3300060353 | Ga0501082_0046329 | Ga0501082_0046329_742_1329 | 195 |
| 963 | 3300060353 | Ga0501082_0090176 | Ga0501082_0090176_1874_2461 | 195 |
| 964 | 3300060353 | Ga0501082_0698602 | Ga0501082_0698602_123_719 | 195 |
| 965 | 3300060353 | Ga0501082_0754966 | Ga0501082_0754966_205_792 | 195 |
| 966 | 3300061719 | Ga0466962_0054943 | Ga0466962_0054943_287_877 | 195 |
| 967 | 3300061719 | Ga0466962_0086446 | Ga0466962_0086446_204_839 | 195 |
| 968 | 3300061734 | Ga0530510_0009957 | Ga0530510_0009957_1122_1709 | 195 |
| 969 | 3300061734 | Ga0530510_0093190 | Ga0530510_0093190_1291_1878 | 195 |
| 970 | 3300061734 | Ga0530510_0213005 | Ga0530510_0213005_138_734 | 195 |
| 971 | 3300061734 | Ga0530510_0434603 | Ga0530510_0434603_109_705 | 195 |
| 972 | 3300061734 | Ga0530510_0555932 | Ga0530510_0555932_25_621 | 195 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2f1d-assembly1.cif.gz_D | x-ray structure of imidazoleglycerol-phosphate dehydratase | 0.9807 | 3 | 183 |
| 4mu0-assembly1.cif.gz_A | the structure of wt a. thaliana igpd2 in complex with mn2+ and 1,2,4-triazole at 1.3 a resolution | 0.9806 | 1 | 183 |
| 4mu3-assembly1.cif.gz_A | the form a structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and a mixture of its substrate, 2r3s-igp, and an inhibitor, 2s3s-igp, to 1.12 a resolution | 0.9794 | 1 | 183 |
| 7oj5-assembly1.cif.gz_A | cryo-em structure of medicago truncatula hisn5 protein | 0.9739 | 3 | 183 |
| 4mu4-assembly1.cif.gz_A | the form b structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and its substrate, 2r3s-igp, to 1.41 a resolution | 0.9714 | 1 | 193 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6T988_68_169_3.30.230.40 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9793 | 2 | 89 | 3.30.230.40 |
| 4qnkD01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.972 | 1 | 89 | 3.30.230.40 |
| 2f1dA02 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9665 | 91 | 183 | 3.30.230.40 |
| af_Q2FUU0_1_87_3.30.230.40 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9646 | 4 | 83 | 3.30.230.40 |
| af_Q2FUU0_88_192_3.30.230.40 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9511 | 91 | 193 | 3.30.230.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8ST04-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase | 0.9951 | 1 | 115 |
GO:0000105
GO:0004424 |
| AF-A0A534WID5-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase | 0.9949 | 2 | 107 |
GO:0000105
GO:0004424 |
| AF-A0A3C0Y201-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase | 0.9942 | 1 | 99 |
GO:0000105
GO:0004424 |
| AF-A0A3C0KJQ1-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase | 0.9937 | 1 | 114 |
GO:0000105
GO:0004424 |
| AF-A0A351J0U9-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase | 0.9935 | 3 | 117 |
GO:0000105
GO:0004424 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar