F487119

General Info

Members Datasets Scaffolds Average Seq Length
971 388 952 244

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10002528|Ga0163162_100025282
Length 290
Sequence MGRVQQTIASSGEKCFHALFSTSIAAYSRFIAQFAPNRTGNAKLLMSQPDAEIVQFDNVGLRYGTGKEVLTDISFTLYPGCFYFLTGASGAGKTSLLKLLYLSQRPSRGLIRMFGTDAITLPRERLPGFRRRLGVVFQDFRLVPHLSAFDNVALPLRVAGVSEKEITKPVTEMLDWVGLGDRINARPATLSGGEQQRVAIARAVIARPDMLVADEPTGNVDPDMALKLLRLFESLNRLGTTVVVATHDLHLIRNVPESLIMRLDKGRLSDPTGALRYPPRRSTTSASGVR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
4 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
5 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
6 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
7 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
8 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
9 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
10 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
11 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
12 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
13 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
14 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
15 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
16 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
17 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
18 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
19 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
20 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
21 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
22 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
23 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
24 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
25 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
26 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
27 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
28 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
29 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
30 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
31 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
32 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
33 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
34 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
35 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
36 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
37 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
38 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
39 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
40 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
41 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
42 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
43 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
44 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
45 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
46 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
49 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
50 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
51 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
52 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
55 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
56 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
57 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
58 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
59 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
60 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
61 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
62 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
65 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
66 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
69 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
70 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
71 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
92 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
141 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
147 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
201 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
206 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
207 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
208 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
209 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
210 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
211 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
212 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
213 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
214 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
215 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
216 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
217 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
218 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
219 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
220 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
221 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
222 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
223 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
224 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
227 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
228 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
229 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
230 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
231 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
232 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
233 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
234 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
235 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
236 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
237 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
238 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
239 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
240 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
241 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
242 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
243 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
244 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
245 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
246 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
247 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
248 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
249 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
250 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
251 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
252 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
253 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
254 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
255 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
256 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
257 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
258 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
259 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
260 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
261 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
262 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
263 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
264 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
265 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
266 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
267 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
268 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
269 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
270 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
271 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
272 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
273 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
274 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
275 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
276 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
277 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
278 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
279 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
280 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
281 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
282 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
283 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
284 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
285 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
286 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
287 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
288 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
289 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
290 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
291 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
292 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
293 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
294 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
295 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
296 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
297 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
298 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
299 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
300 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
301 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
302 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
303 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
304 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
305 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
306 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
307 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
308 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
309 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
310 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
311 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
312 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
313 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
314 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
315 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
316 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
317 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
318 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
319 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
320 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
321 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
322 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
323 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
324 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
325 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
326 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
327 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
328 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
329 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
330 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
331 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
332 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
338 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
339 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
340 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
341 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
342 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
343 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
344 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
345 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
348 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
349 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
350 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
351 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
352 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
353 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
354 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
355 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
356 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
357 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
358 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
359 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
360 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
361 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
362 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
363 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
364 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
365 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
366 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
367 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
368 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
369 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
370 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
371 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
372 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
373 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
374 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
375 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
376 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
377 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
378 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
379 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
380 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
381 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
382 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
383 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
384 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
385 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
386 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
387 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
388 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.84
Metatranscriptomes 0.21
Isolates 1.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.26
Nodule 0
Rhizoplane 4.22
Rhizosphere 73.02
Stem 0
Stem Tuber 0
Unclassified 10.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1117632 2162886007 Bacteria 1287
2 SwRhRL2b_contig_1955283 2162886007 Bacteria 9060
3 SwRhRL2b_contig_2752641 2162886007 Bacteria 1143
4 SwRhRL2b_contig_3948926 2162886007 Bacteria 15742
5 JGI24736J21556_1001607 3300001904 Bacteria 4109
6 JGI24741J21665_1000677 3300001915 Bacteria 10260
7 JGI24752J21851_1004063 3300001976 Bacteria 1921
8 JGI24740J21852_10002676 3300001979 Bacteria 7995
9 JGI24739J22299_10012561 3300001989 Bacteria 3106
10 JGI24737J22298_10002657 3300001990 Bacteria 6320
11 JGI24737J22298_10003202 3300001990 Bacteria 5808
12 JGI24737J22298_10018518 3300001990 Bacteria 2234
13 JGI24735J21928_10000951 3300002067 Bacteria 10337
14 JGI24748J21848_1001609 3300002074 Bacteria 2510
15 JGI24738J21930_10001235 3300002075 Bacteria 7187
16 JGI24738J21930_10005188 3300002075 Bacteria 3145
17 JGI24742J22300_10016742 3300002244 Bacteria 1238
18 JGI24751J29686_10000323 3300002459 Bacteria 17632
19 JGI24751J29686_10019978 3300002459 Bacteria 1387
20 JGI25150J39212_1000966 3300002774 Bacteria 9083
21 JGI25151J46595_10005487 3300003187 Bacteria 6544
22 JGI25153J46596_10000045 3300003215 Bacteria 149347
23 Ga0055532_1011407 3300003758 Bacteria 1047
24 Ga0055525_1000080 3300003759 Bacteria 164642
25 Ga0055542_1000012 3300003762 Bacteria 391808
26 Ga0055529_1000002 3300003763 Bacteria 537914
27 Ga0055529_1000004 3300003763 Bacteria 433331
28 Ga0055526_1004036 3300003771 Bacteria 9020
29 Ga0055537_1002102 3300003773 Bacteria 6999
30 Ga0055524_1000244 3300003775 Bacteria 56875
31 Ga0055530_10000429 3300003791 Bacteria 37251
32 Ga0055530_10005249 3300003791 Bacteria 6251
33 Ga0055540_1001899 3300003792 Bacteria 11712
34 Ga0055531_10000472 3300003794 Bacteria 37251
35 Ga0055531_10009286 3300003794 Bacteria 5048
36 Ga0055531_10022390 3300003794 Bacteria 2409
37 Ga0055543_1020794 3300004625 Bacteria 1202
38 Ga0065165_1002357 3300005262 Bacteria 16372
39 Ga0065165_1007153 3300005262 Bacteria 5584
40 Ga0065165_1038795 3300005262 Bacteria 1432
41 Ga0065165_1042953 3300005262 Bacteria 1330
42 Ga0065704_10075413 3300005289 Bacteria 5605
43 Ga0065704_10082534 3300005289 Bacteria 3587
44 Ga0065704_10129257 3300005289 Bacteria 1651
45 Ga0065704_10173451 3300005289 Bacteria 1278
46 Ga0070658_10000003 3300005327 Bacteria 465963
47 Ga0070658_10000062 3300005327 Bacteria 107844
48 Ga0070658_10000167 3300005327 Bacteria 57334
49 Ga0070658_10004751 3300005327 Bacteria 11051
50 Ga0070658_10017808 3300005327 Bacteria 5681
51 Ga0070658_10044462 3300005327 Bacteria 3589
52 Ga0070658_10054793 3300005327 Bacteria 3238
53 Ga0070658_10102810 3300005327 Bacteria 2363
54 Ga0070658_10115593 3300005327 Bacteria 2226
55 Ga0070658_10158829 3300005327 Bacteria 1896
56 Ga0070658_10275481 3300005327 Bacteria 1431
57 Ga0070670_100025864 3300005331 Bacteria 5049
58 Ga0070670_100059410 3300005331 Bacteria 3282
59 Ga0070670_100084102 3300005331 Bacteria 2734
60 Ga0070677_10000114 3300005333 Bacteria 26571
61 Ga0068869_100126975 3300005334 Bacteria 1957
62 Ga0070666_10001598 3300005335 Bacteria 13778
63 Ga0070666_10005216 3300005335 Bacteria 7957
64 Ga0070666_10025868 3300005335 Bacteria 3828
65 Ga0070666_10298636 3300005335 Bacteria 1147
66 Ga0070680_100002171 3300005336 Bacteria 14459
67 Ga0070680_100112775 3300005336 Bacteria 2264
68 Ga0070680_100512988 3300005336 Bacteria 1026
69 Ga0070660_100000991 3300005339 Bacteria 19050
70 Ga0070660_100001813 3300005339 Bacteria 14658
71 Ga0070660_100003112 3300005339 Bacteria 11392
72 Ga0070660_100007024 3300005339 Bacteria 7819
73 Ga0070660_100045418 3300005339 Bacteria 3362
74 Ga0070660_100173063 3300005339 Bacteria 1745
75 Ga0070660_100182926 3300005339 Bacteria 1696
76 Ga0070660_100264924 3300005339 Bacteria 1404
77 Ga0070687_100219985 3300005343 Bacteria 1162
78 Ga0070661_100006660 3300005344 Bacteria 7965
79 Ga0070661_100006864 3300005344 Bacteria 7853
80 Ga0070661_100097671 3300005344 Bacteria 2181
81 Ga0070661_100121778 3300005344 Bacteria 1955
82 Ga0070661_100248303 3300005344 Bacteria 1372
83 Ga0070692_10000469 3300005345 Bacteria 12367
84 Ga0070668_100000050 3300005347 Bacteria 73885
85 Ga0070668_100001905 3300005347 Bacteria 15260
86 Ga0070668_100010145 3300005347 Bacteria 6983
87 Ga0070668_100037299 3300005347 Bacteria 3711
88 Ga0070668_100084213 3300005347 Bacteria 2497
89 Ga0070669_100000039 3300005353 Bacteria 135033
90 Ga0070669_100000048 3300005353 Bacteria 118472
91 Ga0070669_100000094 3300005353 Bacteria 87053
92 Ga0070669_100002467 3300005353 Bacteria 13394
93 Ga0070669_100007602 3300005353 Bacteria 7749
94 Ga0070669_100039460 3300005353 Bacteria 3431
95 Ga0070669_100105111 3300005353 Bacteria 2135
96 Ga0070669_100257216 3300005353 Bacteria 1392
97 Ga0070675_100106692 3300005354 Bacteria 2364
98 Ga0070675_100142897 3300005354 Bacteria 2047
99 Ga0070671_100000119 3300005355 Bacteria 51011
100 Ga0070671_100000243 3300005355 Bacteria 36590
101 Ga0070671_100007867 3300005355 Bacteria 8523
102 Ga0070671_100119854 3300005355 Bacteria 2214
103 Ga0070671_100129126 3300005355 Bacteria 2128
104 Ga0070671_100134440 3300005355 Bacteria 2084
105 Ga0070674_100039534 3300005356 Bacteria 3186
106 Ga0070673_100039063 3300005364 Bacteria 3629
107 Ga0070659_100000005 3300005366 Bacteria 259902
108 Ga0070659_100014130 3300005366 Bacteria 5958
109 Ga0070659_100017500 3300005366 Bacteria 5398
110 Ga0070659_100154606 3300005366 Bacteria 1872
111 Ga0070659_100157208 3300005366 Bacteria 1857
112 Ga0070659_100243779 3300005366 Bacteria 1488
113 Ga0070659_100251963 3300005366 Bacteria 1463
114 Ga0070667_100000025 3300005367 Bacteria 190744
115 Ga0070667_100000390 3300005367 Bacteria 47461
116 Ga0070667_100000660 3300005367 Bacteria 33497
117 Ga0070667_100017834 3300005367 Bacteria 5883
118 Ga0070667_100022278 3300005367 Bacteria 5256
119 Ga0070667_100045962 3300005367 Bacteria 3672
120 Ga0070667_100049302 3300005367 Bacteria 3546
121 Ga0070667_100070472 3300005367 Bacteria 2976
122 Ga0070667_100313234 3300005367 Bacteria 1415
123 Ga0070705_100076287 3300005440 Bacteria 2044
124 Ga0070708_100019346 3300005445 Bacteria 5720
125 Ga0070663_100012592 3300005455 Bacteria 5358
126 Ga0070663_100094978 3300005455 Bacteria 2215
127 Ga0070663_100151440 3300005455 Bacteria 1779
128 Ga0070663_100329408 3300005455 Bacteria 1230
129 Ga0070678_100002558 3300005456 Bacteria 9990
130 Ga0070662_100000795 3300005457 Bacteria 19378
131 Ga0070662_100004642 3300005457 Bacteria 8709
132 Ga0070662_100034298 3300005457 Bacteria 3578
133 Ga0070662_100057763 3300005457 Bacteria 2820
134 Ga0070662_100070881 3300005457 Bacteria 2568
135 Ga0070681_10032181 3300005458 Bacteria 5263
136 Ga0070681_10044606 3300005458 Bacteria 4439
137 Ga0070698_100134563 3300005471 Bacteria 2426
138 Ga0070679_100001927 3300005530 Bacteria 18644
139 Ga0070679_100022137 3300005530 Bacteria 6210
140 Ga0070679_100032968 3300005530 Bacteria 5126
141 Ga0070679_100780336 3300005530 Bacteria 899
142 Ga0070684_100077170 3300005535 Bacteria 2942
143 Ga0070684_100302988 3300005535 Bacteria 1466
144 Ga0068853_100003449 3300005539 Bacteria 12095
145 Ga0068853_100022626 3300005539 Bacteria 5252
146 Ga0068853_100030617 3300005539 Bacteria 4547
147 Ga0068853_100118110 3300005539 Bacteria 2363
148 Ga0068853_100359093 3300005539 Bacteria 1357
149 Ga0068853_100455372 3300005539 Bacteria 1204
150 Ga0070672_100018880 3300005543 Bacteria 4994
151 Ga0070672_100150810 3300005543 Bacteria 1923
152 Ga0070686_100000191 3300005544 Bacteria 42686
153 Ga0070665_100000088 3300005548 Bacteria 177729
154 Ga0070665_100000168 3300005548 Bacteria 119133
155 Ga0070665_100001278 3300005548 Bacteria 30172
156 Ga0070665_100003938 3300005548 Bacteria 15667
157 Ga0070665_100019960 3300005548 Bacteria 6730
158 Ga0070665_100090309 3300005548 Bacteria 3069
159 Ga0070665_100105251 3300005548 Bacteria 2823
160 Ga0068855_100001435 3300005563 Bacteria 29650
161 Ga0068855_100021313 3300005563 Bacteria 7771
162 Ga0068855_100026517 3300005563 Bacteria 6932
163 Ga0068855_100037627 3300005563 Bacteria 5753
164 Ga0068855_100039611 3300005563 Bacteria 5594
165 Ga0068855_100188948 3300005563 Bacteria 2325
166 Ga0068855_100476651 3300005563 Bacteria 1359
167 Ga0070664_100019373 3300005564 Bacteria 5599
168 Ga0070664_100023476 3300005564 Bacteria 5095
169 Ga0070664_100119593 3300005564 Bacteria 2305
170 Ga0070664_100611300 3300005564 Bacteria 1011
171 Ga0068857_100036896 3300005577 Bacteria 4329
172 Ga0068857_100096790 3300005577 Bacteria 2645
173 Ga0068857_100232343 3300005577 Bacteria 1687
174 Ga0068857_100273925 3300005577 Bacteria 1551
175 Ga0068857_100288371 3300005577 Bacteria 1511
176 Ga0068857_100850541 3300005577 Bacteria 873
177 Ga0068854_100001399 3300005578 Bacteria 14551
178 Ga0068854_100173017 3300005578 Bacteria 1681
179 Ga0068854_100215264 3300005578 Bacteria 1517
180 Ga0068854_100264331 3300005578 Bacteria 1379
181 Ga0068854_100311138 3300005578 Bacteria 1277
182 Ga0068856_100003976 3300005614 Bacteria 14808
183 Ga0068856_100009259 3300005614 Bacteria 9568
184 Ga0068856_100052680 3300005614 Bacteria 4013
185 Ga0068856_100369712 3300005614 Bacteria 1453
186 Ga0068852_100000919 3300005616 Bacteria 19508
187 Ga0068852_100050975 3300005616 Bacteria 3549
188 Ga0068852_100264633 3300005616 Bacteria 1652
189 Ga0068852_100349433 3300005616 Bacteria 1443
190 Ga0068852_100769502 3300005616 Bacteria 976
191 Ga0068852_100892356 3300005616 Bacteria 906
192 Ga0068859_100015185 3300005617 Bacteria 7730
193 Ga0068859_100033051 3300005617 Bacteria 5196
194 Ga0068864_100002231 3300005618 Bacteria 16006
195 Ga0068864_100008568 3300005618 Bacteria 8440
196 Ga0068851_10018950 3300005834 Bacteria 3322
197 Ga0068851_10121208 3300005834 Bacteria 1405
198 Ga0068851_10130618 3300005834 Bacteria 1358
199 Ga0068863_100000058 3300005841 Bacteria 123096
200 Ga0068863_100000187 3300005841 Bacteria 65873
201 Ga0068863_100001079 3300005841 Bacteria 27286
202 Ga0068863_100006943 3300005841 Bacteria 11101
203 Ga0068863_100035369 3300005841 Bacteria 4758
204 Ga0068863_100039107 3300005841 Bacteria 4514
205 Ga0068863_100097701 3300005841 Bacteria 2789
206 Ga0068858_100017541 3300005842 Bacteria 6714
207 Ga0068858_100027896 3300005842 Bacteria 5245
208 Ga0068858_100069896 3300005842 Bacteria 3254
209 Ga0068858_100602663 3300005842 Bacteria 1065
210 Ga0068860_100000057 3300005843 Bacteria 201847
211 Ga0068860_100003627 3300005843 Bacteria 15876
212 Ga0068860_100021480 3300005843 Bacteria 6249
213 Ga0068860_100024116 3300005843 Bacteria 5881
214 Ga0068860_100058249 3300005843 Bacteria 3672
215 Ga0068860_100058391 3300005843 Bacteria 3667
216 Ga0068860_100096730 3300005843 Bacteria 2814
217 Ga0068862_100000191 3300005844 Bacteria 67742
218 Ga0068862_100032566 3300005844 Bacteria 4405
219 Ga0068862_100054582 3300005844 Bacteria 3421
220 Ga0081539_10019651 3300005985 Bacteria 4612
221 Ga0075368_10000565 3300006042 Bacteria 11108
222 Ga0075364_10040053 3300006051 Bacteria 3039
223 Ga0075364_10079961 3300006051 Bacteria 2161
224 Ga0075432_10002220 3300006058 Bacteria 6464
225 Ga0075362_10000029 3300006177 Bacteria 56587
226 Ga0075362_10058309 3300006177 Bacteria 1741
227 Ga0075367_10007298 3300006178 Bacteria 5652
228 Ga0075369_10015041 3300006186 Bacteria 3100
229 Ga0075369_10040936 3300006186 Bacteria 1982
230 Ga0075366_10052037 3300006195 Bacteria 2433
231 Ga0097621_100122169 3300006237 Bacteria 2210
232 Ga0075370_10000011 3300006353 Bacteria 66429
233 Ga0075370_10002340 3300006353 Bacteria 8759
234 Ga0075370_10175836 3300006353 Bacteria 1259
235 Ga0075370_10218609 3300006353 Bacteria 1126
236 Ga0075434_100248156 3300006871 Bacteria 1799
237 Ga0075429_100105775 3300006880 Bacteria 2458
238 Ga0097620_100015185 3300006931 Bacteria 7730
239 Ga0097620_100023748 3300006931 Bacteria 6154
240 Ga0097620_100033051 3300006931 Bacteria 5196
241 Ga0105251_10000276 3300009011 Bacteria 51560
242 Ga0105251_10008893 3300009011 Bacteria 6011
243 Ga0105251_10035720 3300009011 Bacteria 2450
244 Ga0105250_10009073 3300009092 Bacteria 4201
245 Ga0105240_10003393 3300009093 Bacteria 24772
246 Ga0105240_10010858 3300009093 Bacteria 12756
247 Ga0105240_10252079 3300009093 Bacteria 2041
248 Ga0105240_10269265 3300009093 Bacteria 1962
249 Ga0105240_10319237 3300009093 Bacteria 1771
250 Ga0105240_10501760 3300009093 Bacteria 1349
251 Ga0105247_10033832 3300009101 Bacteria 3111
252 Ga0114129_10441353 3300009147 Bacteria 1708
253 Ga0105243_10001077 3300009148 Bacteria 24977
254 Ga0105243_10094543 3300009148 Bacteria 2468
255 Ga0105243_10155385 3300009148 Bacteria 1967
256 Ga0105243_10326533 3300009148 Bacteria 1400
257 Ga0105241_10002141 3300009174 Bacteria 14918
258 Ga0105241_10028145 3300009174 Bacteria 4186
259 Ga0105241_10650088 3300009174 Bacteria 958
260 Ga0105248_10026581 3300009177 Bacteria 6437
261 Ga0105248_10068994 3300009177 Bacteria 3969
262 Ga0105237_10001660 3300009545 Bacteria 28885
263 Ga0105237_10017714 3300009545 Bacteria 7383
264 Ga0105237_10443373 3300009545 Bacteria 1304
265 Ga0105237_10512954 3300009545 Bacteria 1205
266 Ga0105238_10370976 3300009551 Bacteria 1421
267 Ga0105238_10797365 3300009551 Bacteria 960
268 Ga0105249_10002820 3300009553 Bacteria 14999
269 Ga0105249_10007484 3300009553 Bacteria 9528
270 Ga0105249_10057499 3300009553 Bacteria 3563
271 Ga0105249_10101485 3300009553 Bacteria 2706
272 Ga0105249_10398377 3300009553 Bacteria 1406
273 Ga0105148_100452 3300009978 Bacteria 3936
274 Ga0105239_10002472 3300010375 Bacteria 23554
275 Ga0105246_10001372 3300011119 Bacteria 14354
276 Ga0105246_10951712 3300011119 Bacteria 774
277 Ga0157327_1001126 3300012512 Bacteria 1611
278 Ga0157373_10003673 3300013100 Bacteria 11604
279 Ga0157373_10014350 3300013100 Bacteria 5805
280 Ga0157373_10109959 3300013100 Bacteria 1937
281 Ga0157371_10000062 3300013102 Bacteria 169669
282 Ga0157371_10002207 3300013102 Bacteria 18854
283 Ga0157371_10021083 3300013102 Bacteria 4790
284 Ga0157371_10504304 3300013102 Bacteria 894
285 Ga0157370_10005110 3300013104 Bacteria 14804
286 Ga0157370_10051227 3300013104 Bacteria 3943
287 Ga0157370_10074081 3300013104 Bacteria 3212
288 Ga0157369_10118596 3300013105 Bacteria 2809
289 Ga0157369_10167954 3300013105 Bacteria 2313
290 Ga0157369_10240104 3300013105 Bacteria 1893
291 Ga0157378_10006122 3300013297 Bacteria 10534
292 Ga0163162_10000232 3300013306 Bacteria 51019
293 Ga0163162_10002528 3300013306 Bacteria 17307
294 Ga0163162_10010482 3300013306 Bacteria 9011
295 Ga0163162_10023635 3300013306 Bacteria 6068
296 Ga0157372_10007274 3300013307 Bacteria 11788
297 Ga0157372_10014494 3300013307 Bacteria 8436
298 Ga0157372_10128915 3300013307 Bacteria 2909
299 Ga0157372_10137500 3300013307 Bacteria 2814
300 Ga0157372_10357253 3300013307 Bacteria 1702
301 Ga0157372_10497766 3300013307 Bacteria 1421
302 Ga0157375_10107516 3300013308 Bacteria 2883
303 Ga0157375_10548635 3300013308 Bacteria 1318
304 Ga0157375_11003094 3300013308 Bacteria 975
305 Ga0163163_10028485 3300014325 Bacteria 5365
306 Ga0163163_10655296 3300014325 Bacteria 1113
307 Ga0157379_10150015 3300014968 Bacteria 2103
308 Ga0157379_10323996 3300014968 Bacteria 1407
309 Ga0157376_11034093 3300014969 Bacteria 845
310 Ga0163161_10065480 3300017792 Bacteria 2652
311 Ga0163161_10117356 3300017792 Bacteria 1996
312 Ga0163161_10123799 3300017792 Bacteria 1945
313 Ga0206356_10967351 3300020070 Bacteria 1154
314 Ga0206353_11419480 3300020082 Bacteria 1555
315 Ga0213873_10000026 3300021358 Bacteria 74525
316 Ga0213876_10000149 3300021384 Bacteria 74548
317 Ga0213876_10000371 3300021384 Bacteria 38154
318 Ga0213876_10012241 3300021384 Bacteria 4567
319 Ga0209674_104378 3300025226 Bacteria 2310
320 Ga0209147_100882 3300025229 Bacteria 13811
321 Ga0209563_100058 3300025230 Bacteria 302571
322 Ga0209677_109030 3300025253 Bacteria 1841
323 Ga0209148_1000008 3300025254 Bacteria 1504371
324 Ga0209129_1003496 3300025258 Bacteria 6786
325 Ga0209565_1000029 3300025263 Bacteria 340335
326 Ga0209565_1000251 3300025263 Bacteria 57054
327 Ga0209455_1000002 3300025272 Bacteria 1505459
328 Ga0209673_1009829 3300025273 Bacteria 4098
329 Ga0209673_1025148 3300025273 Bacteria 1985
330 Ga0209025_1000993 3300025294 Bacteria 42002
331 Ga0209025_1103877 3300025294 Bacteria 891
332 Ga0209564_1001873 3300025295 Bacteria 18970
333 Ga0209758_1000002 3300025297 Bacteria 1400310
334 Ga0209758_1000007 3300025297 Bacteria 1270410
335 Ga0209758_1010016 3300025297 Bacteria 5756
336 Ga0209050_1000001 3300025298 Bacteria 3563507
337 Ga0209050_1000167 3300025298 Bacteria 151608
338 Ga0209050_1005376 3300025298 Bacteria 8093
339 Ga0209256_1000008 3300025299 Bacteria 975723
340 Ga0209051_1000360 3300025303 Bacteria 67080
341 Ga0209257_1000028 3300025304 Bacteria 699493
342 Ga0209257_1000893 3300025304 Bacteria 41890
343 Ga0209257_1007672 3300025304 Bacteria 6448
344 Ga0209257_1014531 3300025304 Bacteria 3375
345 Ga0209257_1015466 3300025304 Bacteria 3172
346 Ga0207656_10009546 3300025321 Bacteria 3605
347 Ga0207656_10079668 3300025321 Bacteria 1470
348 Ga0207656_10090765 3300025321 Bacteria 1386
349 Ga0207696_1005122 3300025711 Bacteria 5504
350 Ga0207713_1002506 3300025735 Bacteria 13305
351 Ga0207682_10002396 3300025893 Bacteria 8436
352 Ga0207710_10003855 3300025900 Bacteria 6629
353 Ga0207710_10050837 3300025900 Bacteria 1860
354 Ga0207688_10172340 3300025901 Bacteria 1287
355 Ga0207680_10000817 3300025903 Bacteria 14674
356 Ga0207680_10003518 3300025903 Bacteria 7370
357 Ga0207680_10092063 3300025903 Bacteria 1931
358 Ga0207680_10360599 3300025903 Bacteria 1022
359 Ga0207647_10004690 3300025904 Bacteria 10121
360 Ga0207647_10007524 3300025904 Bacteria 7859
361 Ga0207647_10017114 3300025904 Bacteria 4935
362 Ga0207647_10040920 3300025904 Bacteria 2916
363 Ga0207647_10169648 3300025904 Bacteria 1271
364 Ga0207645_10140691 3300025907 Bacteria 1572
365 Ga0207705_10000004 3300025909 Bacteria 705756
366 Ga0207705_10000005 3300025909 Bacteria 673478
367 Ga0207705_10000103 3300025909 Bacteria 97511
368 Ga0207705_10002703 3300025909 Bacteria 13568
369 Ga0207705_10046649 3300025909 Bacteria 3114
370 Ga0207705_10047290 3300025909 Bacteria 3094
371 Ga0207705_10089732 3300025909 Bacteria 2250
372 Ga0207705_10146704 3300025909 Bacteria 1766
373 Ga0207654_10000150 3300025911 Bacteria 44134
374 Ga0207654_10080212 3300025911 Bacteria 1962
375 Ga0207707_10023608 3300025912 Bacteria 5379
376 Ga0207707_10042890 3300025912 Bacteria 3948
377 Ga0207707_10342203 3300025912 Bacteria 1289
378 Ga0207695_10013603 3300025913 Bacteria 9692
379 Ga0207695_10018738 3300025913 Bacteria 7991
380 Ga0207695_10028019 3300025913 Bacteria 6257
381 Ga0207695_10132032 3300025913 Bacteria 2454
382 Ga0207695_10216992 3300025913 Bacteria 1821
383 Ga0207671_10000567 3300025914 Bacteria 49547
384 Ga0207671_10007737 3300025914 Bacteria 9257
385 Ga0207671_10034313 3300025914 Bacteria 3770
386 Ga0207660_10018096 3300025917 Bacteria 4693
387 Ga0207660_10463219 3300025917 Bacteria 1026
388 Ga0207657_10002582 3300025919 Bacteria 19592
389 Ga0207657_10002937 3300025919 Bacteria 18285
390 Ga0207657_10003198 3300025919 Bacteria 17527
391 Ga0207657_10008473 3300025919 Bacteria 10431
392 Ga0207657_10020085 3300025919 Bacteria 6325
393 Ga0207657_10088520 3300025919 Bacteria 2588
394 Ga0207657_10406177 3300025919 Bacteria 1071
395 Ga0207649_10003386 3300025920 Bacteria 8721
396 Ga0207649_10013635 3300025920 Bacteria 4541
397 Ga0207649_10312493 3300025920 Bacteria 1152
398 Ga0207652_10000489 3300025921 Bacteria 40293
399 Ga0207652_10026835 3300025921 Bacteria 4799
400 Ga0207652_10029162 3300025921 Bacteria 4611
401 Ga0207652_10095574 3300025921 Bacteria 2618
402 Ga0207652_10612319 3300025921 Bacteria 976
403 Ga0207681_10000050 3300025923 Bacteria 118481
404 Ga0207681_10000144 3300025923 Bacteria 59200
405 Ga0207681_10001096 3300025923 Bacteria 17540
406 Ga0207681_10003059 3300025923 Bacteria 10513
407 Ga0207681_10005654 3300025923 Bacteria 7674
408 Ga0207681_10133717 3300025923 Bacteria 1837
409 Ga0207681_10159210 3300025923 Bacteria 1700
410 Ga0207694_10131777 3300025924 Bacteria 2004
411 Ga0207650_10067376 3300025925 Bacteria 2686
412 Ga0207650_10228576 3300025925 Bacteria 1500
413 Ga0207650_10268151 3300025925 Bacteria 1387
414 Ga0207650_10374090 3300025925 Bacteria 1176
415 Ga0207659_10115202 3300025926 Bacteria 2050
416 Ga0207644_10000056 3300025931 Bacteria 84033
417 Ga0207644_10000134 3300025931 Bacteria 53152
418 Ga0207644_10000367 3300025931 Bacteria 29435
419 Ga0207644_10027263 3300025931 Bacteria 3946
420 Ga0207644_10097687 3300025931 Bacteria 2200
421 Ga0207644_10123750 3300025931 Bacteria 1972
422 Ga0207644_10160788 3300025931 Bacteria 1746
423 Ga0207644_10174712 3300025931 Bacteria 1679
424 Ga0207690_10000002 3300025932 Bacteria 807473
425 Ga0207690_10001516 3300025932 Bacteria 14528
426 Ga0207690_10002450 3300025932 Bacteria 11213
427 Ga0207690_10022186 3300025932 Bacteria 3946
428 Ga0207690_10228960 3300025932 Bacteria 1426
429 Ga0207706_10002382 3300025933 Bacteria 18355
430 Ga0207706_10030470 3300025933 Bacteria 4811
431 Ga0207706_10048453 3300025933 Bacteria 3758
432 Ga0207706_10053084 3300025933 Bacteria 3578
433 Ga0207706_10080509 3300025933 Bacteria 2864
434 Ga0207706_10087295 3300025933 Bacteria 2743
435 Ga0207709_10000005 3300025935 Bacteria 806813
436 Ga0207709_10253795 3300025935 Bacteria 1286
437 Ga0207669_10000174 3300025937 Bacteria 30026
438 Ga0207691_10033158 3300025940 Bacteria 4810
439 Ga0207691_10268079 3300025940 Bacteria 1471
440 Ga0207711_10021765 3300025941 Bacteria 5354
441 Ga0207689_10075646 3300025942 Bacteria 2768
442 Ga0207661_10030507 3300025944 Bacteria 4154
443 Ga0207661_10032877 3300025944 Bacteria 4023
444 Ga0207661_10674760 3300025944 Bacteria 950
445 Ga0207679_10015535 3300025945 Bacteria 5034
446 Ga0207679_10053837 3300025945 Bacteria 2960
447 Ga0207667_10000001 3300025949 Bacteria 1178522
448 Ga0207667_10001089 3300025949 Bacteria 34437
449 Ga0207667_10002432 3300025949 Bacteria 23319
450 Ga0207667_10009256 3300025949 Bacteria 11628
451 Ga0207667_10043432 3300025949 Bacteria 4770
452 Ga0207667_10105863 3300025949 Bacteria 2902
453 Ga0207667_10108443 3300025949 Bacteria 2864
454 Ga0207667_10484163 3300025949 Bacteria 1256
455 Ga0207651_10080622 3300025960 Bacteria 2343
456 Ga0207712_10001292 3300025961 Bacteria 17177
457 Ga0207712_10007474 3300025961 Bacteria 6899
458 Ga0207712_10011280 3300025961 Bacteria 5688
459 Ga0207712_10071925 3300025961 Bacteria 2489
460 Ga0207668_10000094 3300025972 Bacteria 63810
461 Ga0207668_10000436 3300025972 Bacteria 26329
462 Ga0207668_10068584 3300025972 Bacteria 2522
463 Ga0207668_10093353 3300025972 Bacteria 2217
464 Ga0207668_10171525 3300025972 Bacteria 1702
465 Ga0207640_10004898 3300025981 Bacteria 7275
466 Ga0207640_10007874 3300025981 Bacteria 5880
467 Ga0207640_10013210 3300025981 Bacteria 4727
468 Ga0207640_10038253 3300025981 Bacteria 3026
469 Ga0207640_10070550 3300025981 Bacteria 2350
470 Ga0207640_10092308 3300025981 Bacteria 2100
471 Ga0207640_10268623 3300025981 Bacteria 1333
472 Ga0207640_10284912 3300025981 Bacteria 1300
473 Ga0207658_10000023 3300025986 Bacteria 190806
474 Ga0207658_10000216 3300025986 Bacteria 60563
475 Ga0207658_10002737 3300025986 Bacteria 12730
476 Ga0207658_10003041 3300025986 Bacteria 11988
477 Ga0207658_10008354 3300025986 Bacteria 7047
478 Ga0207658_10010305 3300025986 Bacteria 6352
479 Ga0207658_10061944 3300025986 Bacteria 2798
480 Ga0207658_10115529 3300025986 Bacteria 2130
481 Ga0207677_10000100 3300026023 Bacteria 70908
482 Ga0207677_10226311 3300026023 Bacteria 1503
483 Ga0207703_10002369 3300026035 Bacteria 16392
484 Ga0207703_10003301 3300026035 Bacteria 13539
485 Ga0207703_10019876 3300026035 Bacteria 5249
486 Ga0207703_10105257 3300026035 Bacteria 2398
487 Ga0207703_10305518 3300026035 Bacteria 1452
488 Ga0207639_10001191 3300026041 Bacteria 17663
489 Ga0207639_10003214 3300026041 Bacteria 10985
490 Ga0207639_10007673 3300026041 Bacteria 7364
491 Ga0207639_10041254 3300026041 Bacteria 3451
492 Ga0207639_10097932 3300026041 Bacteria 2363
493 Ga0207639_10182258 3300026041 Bacteria 1787
494 Ga0207639_10287754 3300026041 Bacteria 1448
495 Ga0207678_10000079 3300026067 Bacteria 78764
496 Ga0207678_10013240 3300026067 Bacteria 7238
497 Ga0207678_10091516 3300026067 Bacteria 2600
498 Ga0207678_10320248 3300026067 Bacteria 1334
499 Ga0207702_10001332 3300026078 Bacteria 24705
500 Ga0207702_10013826 3300026078 Bacteria 6703
501 Ga0207702_10041221 3300026078 Bacteria 3871
502 Ga0207702_10187154 3300026078 Bacteria 1910
503 Ga0207702_10338539 3300026078 Bacteria 1437
504 Ga0207641_10000269 3300026088 Bacteria 66008
505 Ga0207641_10002412 3300026088 Bacteria 17264
506 Ga0207641_10003855 3300026088 Bacteria 13129
507 Ga0207641_10004669 3300026088 Bacteria 11816
508 Ga0207641_10004972 3300026088 Bacteria 11403
509 Ga0207641_10017468 3300026088 Bacteria 5873
510 Ga0207641_10089951 3300026088 Bacteria 2683
511 Ga0207641_10127064 3300026088 Bacteria 2284
512 Ga0207676_10001569 3300026095 Bacteria 16846
513 Ga0207676_10027677 3300026095 Bacteria 4224
514 Ga0207676_10032111 3300026095 Bacteria 3954
515 Ga0207676_10111941 3300026095 Bacteria 2286
516 Ga0207674_10016564 3300026116 Bacteria 8062
517 Ga0207674_10028880 3300026116 Bacteria 5846
518 Ga0207674_10124108 3300026116 Bacteria 2548
519 Ga0207674_10124747 3300026116 Bacteria 2541
520 Ga0207674_10810575 3300026116 Bacteria 903
521 Ga0207675_100009530 3300026118 Bacteria 9083
522 Ga0207683_10003668 3300026121 Bacteria 13351
523 Ga0207683_10230163 3300026121 Bacteria 1690
524 Ga0207698_10000019 3300026142 Bacteria 145910
525 Ga0207698_10000186 3300026142 Bacteria 38318
526 Ga0207698_10028185 3300026142 Bacteria 4001
527 Ga0207698_10041197 3300026142 Bacteria 3439
528 Ga0207698_10788321 3300026142 Bacteria 952
529 Ga0207698_10812398 3300026142 Bacteria 938
530 Ga0209813_10001114 3300027866 Bacteria 5991
531 Ga0207428_10069745 3300027907 Bacteria 2764
532 Ga0268266_10000074 3300028379 Bacteria 230993
533 Ga0268266_10000130 3300028379 Bacteria 147912
534 Ga0268266_10001691 3300028379 Bacteria 25327
535 Ga0268266_10002428 3300028379 Bacteria 20045
536 Ga0268266_10002447 3300028379 Bacteria 19919
537 Ga0268266_10019026 3300028379 Bacteria 5850
538 Ga0268266_10416723 3300028379 Bacteria 1272
539 Ga0268265_10000102 3300028380 Bacteria 106737
540 Ga0268265_10000271 3300028380 Bacteria 58874
541 Ga0268265_10018322 3300028380 Bacteria 4849
542 Ga0268265_10040823 3300028380 Bacteria 3428
543 Ga0268265_10054272 3300028380 Bacteria 3040
544 Ga0268265_10273429 3300028380 Bacteria 1508
545 Ga0268264_10000078 3300028381 Bacteria 249595
546 Ga0268264_10000180 3300028381 Bacteria 134339
547 Ga0268264_10004368 3300028381 Bacteria 12064
548 Ga0268264_10007758 3300028381 Bacteria 8936
549 Ga0268264_10008451 3300028381 Bacteria 8563
550 Ga0268264_10017221 3300028381 Bacteria 5919
551 Ga0268264_10046311 3300028381 Bacteria 3612
552 Ga0268264_10071817 3300028381 Bacteria 2934
553 Ga0307517_10012427 3300028786 Bacteria 11686
554 Ga0307517_10037285 3300028786 Bacteria 5435
555 Ga0316177_1051669 3300030731 Bacteria 1174
556 Ga0265331_10086685 3300031250 Bacteria 1450
557 Ga0307513_10060125 3300031456 Bacteria 4029
558 Ga0307513_10132909 3300031456 Bacteria 2430
559 Ga0307408_100055244 3300031548 Bacteria 2874
560 Ga0307408_100078202 3300031548 Bacteria 2465
561 Ga0307408_100150390 3300031548 Bacteria 1837
562 Ga0307408_100575655 3300031548 Bacteria 997
563 Ga0307508_10218068 3300031616 Bacteria 1508
564 Ga0307405_10003177 3300031731 Bacteria 7475
565 Ga0307405_10413462 3300031731 Bacteria 1059
566 Ga0307413_10005727 3300031824 Bacteria 5585
567 Ga0307413_10009668 3300031824 Bacteria 4628
568 Ga0307413_10327094 3300031824 Bacteria 1173
569 Ga0307410_10005363 3300031852 Bacteria 6780
570 Ga0307410_10035115 3300031852 Bacteria 3253
571 Ga0307410_10096682 3300031852 Bacteria 2108
572 Ga0307410_10120342 3300031852 Bacteria 1914
573 Ga0307406_10248438 3300031901 Bacteria 1338
574 Ga0307407_10208043 3300031903 Bacteria 1315
575 Ga0307412_10000126 3300031911 Bacteria 56270
576 Ga0307412_10005327 3300031911 Bacteria 7220
577 Ga0307412_10171259 3300031911 Bacteria 1624
578 Ga0307409_100231919 3300031995 Bacteria 1674
579 Ga0307409_100331238 3300031995 Bacteria 1429
580 Ga0307409_100519028 3300031995 Bacteria 1163
581 Ga0307416_100122197 3300032002 Bacteria 2323
582 Ga0307416_100212031 3300032002 Bacteria 1848
583 Ga0307416_100370836 3300032002 Bacteria 1457
584 Ga0307416_100451249 3300032002 Bacteria 1338
585 Ga0307414_10000270 3300032004 Bacteria 32016
586 Ga0307414_10044113 3300032004 Bacteria 3042
587 Ga0307414_10103634 3300032004 Bacteria 2147
588 Ga0307414_10145329 3300032004 Bacteria 1862
589 Ga0307414_10253571 3300032004 Bacteria 1464
590 Ga0307414_10467753 3300032004 Bacteria 1109
591 Ga0307414_10628695 3300032004 Bacteria 966
592 Ga0307411_10074514 3300032005 Bacteria 2313
593 Ga0307411_10119820 3300032005 Bacteria 1902
594 Ga0307411_10165095 3300032005 Bacteria 1663
595 Ga0307411_10234898 3300032005 Bacteria 1431
596 Ga0307411_10299278 3300032005 Bacteria 1289
597 Ga0307415_100064979 3300032126 Bacteria 2541
598 Ga0307415_100315582 3300032126 Bacteria 1301
599 Ga0316583_10007557 3300032133 Bacteria 3914
600 Ga0307510_10211222 3300033180 Bacteria 1463
601 Ga0307510_10356259 3300033180 Bacteria 913
602 Ga0373962_0068779 3300035242 Bacteria 1054
603 Ga0373931_0003323 3300035691 Bacteria 7206
604 Ga0373927_0232837 3300035695 Bacteria 1210
605 Ga0316582_0030777 3300036647 Bacteria 3273
606 Ga0316584_0106575 3300036712 Bacteria 2097
607 Ga0316584_0345309 3300036712 Bacteria 1069
608 Ga0316584_0556861 3300036712 Bacteria 800
609 Ga0395899_0037987 3300037312 Bacteria 3609
610 Ga0395900_0050564 3300037418 Bacteria 4281
611 Ga0395905_0081567 3300037471 Bacteria 3031
612 Ga0395905_0230214 3300037471 Bacteria 1733
613 Ga0237819_03911 3300038705 Bacteria 2543
614 Ga0436365_0083543 3300039437 Bacteria 85224
615 Ga0436365_0124207 3300039437 Bacteria 44215
616 Ga0436365_0922968 3300039437 Bacteria 9993
617 Ga0436365_1181252 3300039437 Bacteria 2793
618 Ga0436365_1272877 3300039437 Bacteria 2798
619 Ga0436363_0832933 3300039450 Bacteria 1410
620 Ga0436363_1317039 3300039450 Bacteria 777
621 Ga0436362_0376260 3300039453 Bacteria 74620
622 Ga0439436_0006762 3300041404 Bacteria 3524
623 Ga0439439_0011842 3300041406 Bacteria 2103
624 Ga0439439_0040713 3300041406 Bacteria 1203
625 Ga0439461_0000005 3300041410 Bacteria 28399
626 Ga0439461_0001836 3300041410 Bacteria 3342
627 Ga0439465_0005156 3300041413 Bacteria 4192
628 Ga0439465_0005367 3300041413 Bacteria 4088
629 Ga0439431_0000066 3300041997 Bacteria 16712
630 Ga0439431_0011328 3300041997 Bacteria 2036
631 Ga0439442_024642 3300042002 Bacteria 1252
632 Ga0439445_0003763 3300042004 Bacteria 3406
633 Ga0439445_0003804 3300042004 Bacteria 3392
634 Ga0439445_0013081 3300042004 Bacteria 2005
635 Ga0439448_0035805 3300042005 Bacteria 1591
636 Ga0439448_0039282 3300042005 Bacteria 1525
637 Ga0439448_0083156 3300042005 Bacteria 1076
638 Ga0439432_008221 3300042006 Bacteria 3669
639 Ga0439452_007753 3300042010 Bacteria 3267
640 Ga0439452_016440 3300042010 Bacteria 2010
641 Ga0439455_0002972 3300042012 Bacteria 3177
642 Ga0439455_0028443 3300042012 Bacteria 1376
643 Ga0439462_0000552 3300042015 Bacteria 7411
644 Ga0439462_0000631 3300042015 Bacteria 7071
645 Ga0450894_011747 3300042131 Bacteria 1141
646 Ga0439458_0000263 3300042157 Bacteria 12825
647 Ga0439458_0004273 3300042157 Bacteria 3295
648 Ga0439458_0006327 3300042157 Bacteria 2641
649 Ga0439434_0005169 3300042435 Bacteria 3816
650 Ga0439434_0018492 3300042435 Bacteria 2086
651 Ga0466966_0058247 3300044684 Bacteria 2442
652 Ga0466961_0009584 3300044693 Bacteria 6164
653 Ga0466964_0016699 3300044706 Bacteria 2804
654 Ga0466971_0011526 3300044719 Bacteria 3870
655 Ga0466971_0066471 3300044719 Bacteria 1634
656 Ga0466968_0004499 3300044735 Bacteria 5214
657 Ga0466970_0024989 3300044765 Bacteria 3126
658 Ga0466957_0020005 3300044842 Bacteria 3940
659 Ga0466960_0000991 3300044901 Bacteria 10127
660 Ga0466959_0021515 3300045049 Bacteria 4757
661 Ga0451576_0000017 3300045051 Bacteria 558261
662 Ga0466958_0030818 3300045836 Bacteria 3187
663 Ga0466958_0034088 3300045836 Bacteria 3036
664 Ga0466967_0462283 3300045976 Bacteria 1241
665 Ga0495617_006845 3300046452 Bacteria 3982
666 Ga0495617_010490 3300046452 Bacteria 3174
667 Ga0495627_000336 3300046453 Bacteria 44344
668 Ga0495627_001139 3300046453 Bacteria 17196
669 Ga0495638_0000068 3300046460 Bacteria 167596
670 Ga0495638_0016810 3300046460 Bacteria 4892
671 Ga0495638_0046222 3300046460 Bacteria 2736
672 Ga0495650_0000091 3300046471 Bacteria 228697
673 Ga0495650_0001028 3300046471 Bacteria 31367
674 Ga0495650_0001420 3300046471 Bacteria 23288
675 Ga0495650_0051284 3300046471 Bacteria 1701
676 Ga0495584_0136670 3300046491 Bacteria 1244
677 Ga0495585_0005357 3300046492 Bacteria 8098
678 Ga0495596_0000267 3300046500 Bacteria 34545
679 Ga0495607_0020242 3300046501 Bacteria 4211
680 Ga0495607_0030552 3300046501 Bacteria 3306
681 Ga0495583_0000269 3300046506 Bacteria 85380
682 Ga0495583_0000406 3300046506 Bacteria 65391
683 Ga0495583_0017415 3300046506 Bacteria 3815
684 Ga0495606_0000457 3300046507 Bacteria 67044
685 Ga0495606_0142636 3300046507 Bacteria 1413
686 Ga0495610_0000015 3300046512 Bacteria 391489
687 Ga0495610_0000083 3300046512 Bacteria 112946
688 Ga0495616_0000010 3300046513 Bacteria 224378
689 Ga0495616_0097461 3300046513 Bacteria 1383
690 Ga0495620_0029925 3300046515 Bacteria 2513
691 Ga0495631_0074987 3300046518 Bacteria 1460
692 Ga0495631_0128273 3300046518 Bacteria 1090
693 Ga0495632_0000351 3300046519 Bacteria 43708
694 Ga0495632_0001120 3300046519 Bacteria 22955
695 Ga0495632_0029442 3300046519 Bacteria 2859
696 Ga0495632_0052897 3300046519 Bacteria 1995
697 Ga0495632_0161298 3300046519 Bacteria 1033
698 Ga0495637_0105205 3300046520 Bacteria 1099
699 Ga0495643_0009428 3300046522 Bacteria 6068
700 Ga0495643_0011767 3300046522 Bacteria 5308
701 Ga0495643_0025484 3300046522 Bacteria 3345
702 Ga0495643_0030194 3300046522 Bacteria 3028
703 Ga0495643_0044184 3300046522 Bacteria 2422
704 Ga0495643_0048857 3300046522 Bacteria 2284
705 Ga0495643_0052511 3300046522 Bacteria 2188
706 Ga0495648_0000046 3300046524 Bacteria 167725
707 Ga0495648_0000114 3300046524 Bacteria 98677
708 Ga0495648_0013048 3300046524 Bacteria 6164
709 Ga0495648_0156523 3300046524 Bacteria 1182
710 Ga0495663_0006507 3300046525 Bacteria 3225
711 Ga0495642_0003030 3300046528 Bacteria 6691
712 Ga0495654_0044137 3300046530 Bacteria 2206
713 Ga0495654_0061539 3300046530 Bacteria 1802
714 Ga0495654_0074574 3300046530 Bacteria 1602
715 Ga0495654_0094515 3300046530 Bacteria 1383
716 Ga0495621_0004419 3300046539 Bacteria 3950
717 Ga0495597_0038934 3300046542 Bacteria 2130
718 Ga0495633_0000739 3300046558 Bacteria 29507
719 Ga0495633_0000929 3300046558 Bacteria 24783
720 Ga0495633_0016576 3300046558 Bacteria 3794
721 Ga0495633_0033973 3300046558 Bacteria 2455
722 Ga0495633_0034668 3300046558 Bacteria 2426
723 Ga0495668_0000022 3300046616 Bacteria 363999
724 Ga0495668_0031988 3300046616 Bacteria 2962
725 Ga0495668_0087011 3300046616 Bacteria 1714
726 Ga0495611_0062972 3300046648 Bacteria 1687
727 Ga0495611_0076407 3300046648 Bacteria 1535
728 Ga0495625_0032785 3300046660 Bacteria 3847
729 Ga0495625_0047750 3300046660 Bacteria 3086
730 Ga0495625_0048759 3300046660 Bacteria 3047
731 Ga0495625_0140058 3300046660 Bacteria 1632
732 Ga0495625_0372997 3300046660 Bacteria 897
733 Ga0495661_0027151 3300046665 Bacteria 3677
734 Ga0495661_0143917 3300046665 Bacteria 1294
735 Ga0495669_0000047 3300046684 Bacteria 82672
736 Ga0495670_0000019 3300046691 Bacteria 114488
737 Ga0495670_0032241 3300046691 Bacteria 2606
738 Ga0495671_0000057 3300046692 Bacteria 114166
739 Ga0495671_0015063 3300046692 Bacteria 4152
740 Ga0495660_0010290 3300046810 Bacteria 5438
741 Ga0495683_0008682 3300047323 Bacteria 5424
742 Ga0495687_000043 3300047443 Bacteria 216711
743 Ga0495687_000083 3300047443 Bacteria 145688
744 Ga0495687_029728 3300047443 Bacteria 2524
745 Ga0495677_0007237 3300047445 Bacteria 4152
746 Ga0495673_0000110 3300047469 Bacteria 166127
747 Ga0495673_0037586 3300047469 Bacteria 2210
748 Ga0495673_0052135 3300047469 Bacteria 1789
749 Ga0495681_0000036 3300047470 Bacteria 124207
750 Ga0495681_0000445 3300047470 Bacteria 31682
751 Ga0495681_0051438 3300047470 Bacteria 1937
752 Ga0495686_0000273 3300047472 Bacteria 91936
753 Ga0495686_0000985 3300047472 Bacteria 34770
754 Ga0495593_0198735 3300047673 Bacteria 1008
755 Ga0495615_0001607 3300048090 Bacteria 3403
756 Ga0495626_0000808 3300048091 Bacteria 28273
757 Ga0496100_0002118 3300048903 Bacteria 9992
758 Ga0496100_0221074 3300048903 Bacteria 1390
759 Ga0496100_0494182 3300048903 Bacteria 942
760 Ga0496101_0028746 3300048904 Bacteria 3884
761 Ga0496102_0000022 3300048905 Bacteria 246314
762 Ga0496102_0001244 3300048905 Bacteria 23041
763 Ga0496102_0139972 3300048905 Bacteria 2269
764 Ga0496103_0000167 3300048906 Bacteria 68561
765 Ga0496103_0000648 3300048906 Bacteria 26322
766 Ga0496103_0001474 3300048906 Bacteria 15742
767 Ga0496103_0030200 3300048906 Bacteria 3297
768 Ga0496104_0000882 3300048907 Bacteria 25819
769 Ga0496104_0001962 3300048907 Bacteria 17811
770 Ga0496104_0025352 3300048907 Bacteria 5466
771 Ga0496105_0000447 3300048908 Bacteria 27187
772 Ga0496105_0000479 3300048908 Bacteria 26244
773 Ga0496105_0006155 3300048908 Bacteria 9200
774 Ga0496105_0017067 3300048908 Bacteria 5811
775 Ga0496106_0007027 3300048909 Bacteria 8313
776 Ga0496107_0000287 3300048910 Bacteria 26834
777 Ga0496107_0093085 3300048910 Bacteria 2204
778 Ga0496108_0000270 3300048911 Bacteria 44669
779 Ga0496109_0267471 3300048912 Bacteria 1611
780 Ga0496109_0537217 3300048912 Bacteria 1103
781 Ga0496110_0018059 3300048913 Bacteria 5908
782 Ga0496110_0119140 3300048913 Bacteria 2377
783 Ga0496110_0523614 3300048913 Bacteria 1078
784 Ga0496110_0583010 3300048913 Bacteria 1015
785 Ga0496111_0013236 3300048914 Bacteria 5607
786 Ga0496111_0020176 3300048914 Bacteria 4637
787 Ga0496111_0054137 3300048914 Bacteria 2900
788 Ga0496111_0106914 3300048914 Bacteria 2059
789 Ga0496111_0145735 3300048914 Bacteria 1755
790 Ga0496112_0014916 3300048915 Bacteria 7230
791 Ga0496113_0000442 3300048916 Bacteria 20174
792 Ga0496113_0002636 3300048916 Bacteria 10501
793 Ga0496113_0021719 3300048916 Bacteria 4531
794 Ga0496114_0002987 3300048917 Bacteria 12971
795 Ga0496114_0023598 3300048917 Bacteria 5021
796 Ga0496115_0000029 3300048918 Bacteria 141359
797 Ga0496115_0000665 3300048918 Bacteria 25387
798 Ga0496116_0008266 3300048919 Bacteria 9052
799 Ga0496116_0031125 3300048919 Bacteria 3826
800 Ga0496116_0055889 3300048919 Bacteria 2590
801 Ga0496117_0000260 3300048920 Bacteria 99636
802 Ga0496117_0000566 3300048920 Bacteria 60778
803 Ga0496117_0005957 3300048920 Bacteria 12569
804 Ga0496117_0016880 3300048920 Bacteria 6129
805 Ga0496117_0029232 3300048920 Bacteria 4252
806 Ga0496117_0090680 3300048920 Bacteria 1968
807 Ga0496117_0090940 3300048920 Bacteria 1965
808 Ga0496118_0000039 3300048921 Bacteria 305458
809 Ga0496118_0009583 3300048921 Bacteria 9748
810 Ga0496118_0013474 3300048921 Bacteria 7728
811 Ga0496118_0015672 3300048921 Bacteria 7000
812 Ga0496118_0016400 3300048921 Bacteria 6799
813 Ga0496118_0018558 3300048921 Bacteria 6266
814 Ga0496118_0019153 3300048921 Bacteria 6129
815 Ga0496118_0020492 3300048921 Bacteria 5859
816 Ga0496118_0048476 3300048921 Bacteria 3281
817 Ga0496119_0002088 3300048922 Bacteria 22564
818 Ga0496119_0010119 3300048922 Bacteria 7964
819 Ga0496120_0001454 3300048923 Bacteria 28335
820 Ga0496120_0017516 3300048923 Bacteria 4642
821 Ga0496120_0031863 3300048923 Bacteria 3186
822 Ga0496121_0000683 3300048924 Bacteria 63257
823 Ga0496121_0001144 3300048924 Bacteria 46508
824 Ga0496121_0001713 3300048924 Bacteria 35897
825 Ga0496121_0002098 3300048924 Bacteria 31368
826 Ga0496121_0002348 3300048924 Bacteria 29182
827 Ga0496121_0003389 3300048924 Bacteria 22816
828 Ga0496121_0014109 3300048924 Bacteria 8516
829 Ga0496121_0022572 3300048924 Bacteria 6098
830 Ga0496121_0031799 3300048924 Bacteria 4813
831 Ga0496122_0003064 3300048925 Bacteria 22543
832 Ga0496122_0007119 3300048925 Bacteria 12558
833 Ga0496122_0012916 3300048925 Bacteria 8245
834 Ga0496122_0028094 3300048925 Bacteria 4787
835 Ga0496122_0045084 3300048925 Bacteria 3432
836 Ga0496122_0057644 3300048925 Bacteria 2882
837 Ga0496122_0066300 3300048925 Bacteria 2610
838 Ga0496123_0002028 3300048926 Bacteria 26145
839 Ga0496123_0009892 3300048926 Bacteria 8510
840 Ga0496123_0012423 3300048926 Bacteria 7260
841 Ga0496123_0173308 3300048926 Bacteria 1135
842 Ga0496124_0000076 3300048927 Bacteria 215767
843 Ga0496124_0001874 3300048927 Bacteria 28945
844 Ga0496124_0002194 3300048927 Bacteria 26062
845 Ga0496124_0008780 3300048927 Bacteria 10497
846 Ga0496124_0011818 3300048927 Bacteria 8697
847 Ga0496124_0019841 3300048927 Bacteria 6237
848 Ga0496124_0019879 3300048927 Bacteria 6229
849 Ga0496124_0063899 3300048927 Bacteria 3073
850 Ga0496124_0105055 3300048927 Bacteria 2283
851 Ga0496124_0118901 3300048927 Bacteria 2114
852 Ga0496125_0000505 3300048928 Bacteria 67726
853 Ga0496125_0007784 3300048928 Bacteria 11334
854 Ga0496125_0009478 3300048928 Bacteria 9993
855 Ga0496125_0014467 3300048928 Bacteria 7683
856 Ga0496125_0020907 3300048928 Bacteria 6123
857 Ga0496125_0034865 3300048928 Bacteria 4427
858 Ga0496125_0062742 3300048928 Bacteria 2969
859 Ga0496125_0066007 3300048928 Bacteria 2862
860 Ga0496125_0087920 3300048928 Bacteria 2344
861 Ga0496126_0000158 3300048929 Bacteria 156032
862 Ga0496126_0000469 3300048929 Bacteria 80156
863 Ga0496126_0003395 3300048929 Bacteria 20150
864 Ga0496126_0016624 3300048929 Bacteria 7353
865 Ga0496126_0018513 3300048929 Bacteria 6896
866 Ga0496126_0034157 3300048929 Bacteria 4780
867 Ga0496126_0037665 3300048929 Bacteria 4510
868 Ga0496126_0054595 3300048929 Bacteria 3617
869 Ga0496126_0079211 3300048929 Bacteria 2909
870 Ga0495678_027194 3300049459 Bacteria 2430
871 Ga0501033_0340072 3300049570 Bacteria 1052
872 Ga0501034_0021162 3300049571 Bacteria 6635
873 Ga0501034_0036153 3300049571 Bacteria 5005
874 Ga0501034_0079638 3300049571 Bacteria 3280
875 Ga0501034_0555334 3300049571 Bacteria 1057
876 Ga0501036_0151941 3300049572 Bacteria 1953
877 Ga0501037_0099976 3300049573 Bacteria 2095
878 Ga0501047_0241651 3300049581 Bacteria 1656
879 Ga0501047_0305110 3300049581 Bacteria 1434
880 Ga0501223_000135 3300049663 Bacteria 20935
881 Ga0501224_000042 3300049664 Bacteria 22403
882 Ga0501233_035122 3300049668 Bacteria 1153
883 Ga0501235_010553 3300049669 Bacteria 2018
884 Ga0501249_000256 3300049679 Bacteria 15740
885 Ga0501225_0000134 3300049705 Bacteria 22398
886 Ga0501225_0005268 3300049705 Bacteria 3806
887 Ga0501080_0604152 3300049742 Bacteria 974
888 Ga0501083_0070382 3300049744 Bacteria 2327
889 Ga0501035_0376890 3300049822 Bacteria 1184
890 Ga0501044_0237619 3300049823 Bacteria 1767
891 Ga0501044_0338903 3300049823 Bacteria 1425
892 Ga0501226_000099 3300049853 Bacteria 21088
893 nmdc:mga03683_52_c1 3300050489 Bacteria 49169
894 nmdc:mga03683_757_c1 3300050489 Bacteria 9260
895 nmdc:mga03n38_1944_c1 3300050490 Bacteria 6196
896 nmdc:mga00v17_205795_c1 3300050491 Bacteria 1273
897 nmdc:mga0k408_118952_c1 3300050493 Bacteria 1564
898 nmdc:mga0k408_12_c1 3300050493 Bacteria 125427
899 nmdc:mga06z11_119_c1 3300050494 Bacteria 32670
900 nmdc:mga04h51_37_c1 3300050495 Bacteria 45941
901 nmdc:mga07m45_11_c1 3300050496 Bacteria 163532
902 nmdc:mga07m45_172015_c1 3300050496 Bacteria 1259
903 nmdc:mga07m45_9729_c1 3300050496 Bacteria 4997
904 nmdc:mga05p37_847944_c1 3300050507 Bacteria 993
905 nmdc:mga09592_111294_c1 3300050508 Bacteria 2349
906 nmdc:mga0n895_28520_c1 3300050512 Bacteria 5310
907 nmdc:mga0sz30_1423_c1 3300050516 Bacteria 8554
908 nmdc:mga0sz30_39425_c1 3300050516 Bacteria 1982
909 Ga0500610_0000508 3300053079 Bacteria 11987
910 Ga0500643_000001 3300053087 Bacteria 1440111
911 Ga0500643_000044 3300053087 Bacteria 155319
912 Ga0500643_007423 3300053087 Bacteria 4425
913 Ga0500643_012451 3300053087 Bacteria 3046
914 Ga0500643_015888 3300053087 Bacteria 2568
915 Ga0500643_021524 3300053087 Bacteria 2088
916 Ga0500566_0004226 3300053094 Bacteria 8564
917 Ga0500562_003253 3300053108 Bacteria 4061
918 Ga0500594_0005674 3300053118 Bacteria 2774
919 Ga0500594_0027135 3300053118 Bacteria 1480
920 Ga0500595_000814 3300053119 Bacteria 18012
921 Ga0500595_050618 3300053119 Bacteria 1289
922 Ga0500597_000193 3300053120 Bacteria 12502
923 Ga0500608_000042 3300053122 Bacteria 56626
924 Ga0500626_111952 3300053128 Bacteria 1177
925 Ga0500642_0001178 3300053130 Bacteria 7485
926 Ga0500658_0001159 3300053134 Bacteria 10717
927 Ga0500658_0010532 3300053134 Bacteria 3410
928 Ga0500559_0001036 3300053136 Bacteria 16988
929 Ga0500559_0027208 3300053136 Bacteria 2440
930 Ga0500559_0065641 3300053136 Bacteria 1626
931 Ga0500559_0135001 3300053136 Bacteria 1153
932 Ga0500564_005997 3300053138 Bacteria 5025
933 Ga0500568_0022365 3300053139 Bacteria 2705
934 Ga0500590_102144 3300053148 Bacteria 1375
935 Ga0500604_0000108 3300053151 Bacteria 25410
936 Ga0500604_0004017 3300053151 Bacteria 3924
937 Ga0500616_0000161 3300053153 Bacteria 111424
938 Ga0500616_0001142 3300053153 Bacteria 27275
939 Ga0500616_0001975 3300053153 Bacteria 18211
940 Ga0500619_016693 3300053154 Bacteria 2026
941 Ga0500622_0011523 3300053156 Bacteria 4813
942 Ga0500624_000003 3300053157 Bacteria 253364
943 Ga0500627_0000204 3300053158 Bacteria 17192
944 Ga0500636_0007966 3300053177 Bacteria 6129
945 Ga0500637_0000024 3300053178 Bacteria 59926
946 Ga0500567_000588 3300053723 Bacteria 12916
947 Ga0500625_000157 3300053729 Bacteria 14392
948 Ga0500645_000038 3300053730 Bacteria 112786
949 Ga0500645_000842 3300053730 Bacteria 18101
950 Ga0500596_003694 3300053735 Bacteria 2875
951 Ga0500661_013092 3300055283 Bacteria 1495
952 Ga0466962_0021624 3300061719 Bacteria 3087

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042004 Ga0439445_0013081 Ga0439445_0013081_500_1297 221
2 3300005336 Ga0070680_100112775 Ga0070680_1001127752 225
3 3300005458 Ga0070681_10032181 Ga0070681_100321814 225
4 3300005530 Ga0070679_100022137 Ga0070679_1000221375 225
5 3300025912 Ga0207707_10042890 Ga0207707_100428902 225
6 3300025917 Ga0207660_10018096 Ga0207660_100180962 225
7 3300025921 Ga0207652_10026835 Ga0207652_100268354 225
8 3300048912 Ga0496109_0267471 Ga0496109_0267471_670_1389 228
9 iso_pu_bacteria 2895880812 2895882177 229
10 3300002774 JGI25150J39212_1000966 JGI25150J39212_10009665 233
11 3300003187 JGI25151J46595_10005487 JGI25151J46595_100054874 233
12 3300003771 Ga0055526_1004036 Ga0055526_10040365 233
13 3300003773 Ga0055537_1002102 Ga0055537_10021025 233
14 3300003775 Ga0055524_1000244 Ga0055524_100024452 233
15 3300003791 Ga0055530_10000429 Ga0055530_1000042940 233
16 3300003791 Ga0055530_10005249 Ga0055530_100052497 233
17 3300003792 Ga0055540_1001899 Ga0055540_10018995 233
18 3300003794 Ga0055531_10000472 Ga0055531_1000047240 233
19 3300003794 Ga0055531_10009286 Ga0055531_100092864 233
20 3300004625 Ga0055543_1020794 Ga0055543_10207942 233
21 3300005262 Ga0065165_1007153 Ga0065165_10071537 233
22 3300005262 Ga0065165_1038795 Ga0065165_10387951 233
23 3300005563 Ga0068855_100476651 Ga0068855_1004766511 233
24 3300005616 Ga0068852_100892356 Ga0068852_1008923562 233
25 3300005985 Ga0081539_10019651 Ga0081539_100196512 233
26 3300012512 Ga0157327_1001126 Ga0157327_10011262 233
27 3300017792 Ga0163161_10123799 Ga0163161_101237992 233
28 3300025263 Ga0209565_1000029 Ga0209565_1000029120 233
29 3300025263 Ga0209565_1000251 Ga0209565_100025132 233
30 3300025273 Ga0209673_1009829 Ga0209673_10098293 233
31 3300025273 Ga0209673_1025148 Ga0209673_10251482 233
32 3300025295 Ga0209564_1001873 Ga0209564_10018737 233
33 3300025297 Ga0209758_1010016 Ga0209758_10100167 233
34 3300025298 Ga0209050_1000001 Ga0209050_1000001630 233
35 3300025298 Ga0209050_1000167 Ga0209050_100016718 233
36 3300025298 Ga0209050_1005376 Ga0209050_10053764 233
37 3300025299 Ga0209256_1000008 Ga0209256_1000008729 233
38 3300025303 Ga0209051_1000360 Ga0209051_100036056 233
39 3300025304 Ga0209257_1000028 Ga0209257_1000028718 233
40 3300025304 Ga0209257_1000893 Ga0209257_100089318 233
41 3300025304 Ga0209257_1007672 Ga0209257_10076722 233
42 3300025304 Ga0209257_1014531 Ga0209257_10145312 233
43 3300025304 Ga0209257_1015466 Ga0209257_10154662 233
44 3300026142 Ga0207698_10812398 Ga0207698_108123981 233
45 3300039450 Ga0436363_1317039 Ga0436363_1317039_15_737 233
46 3300041404 Ga0439436_0006762 Ga0439436_0006762_1723_2424 233
47 3300041406 Ga0439439_0011842 Ga0439439_0011842_288_989 233
48 3300041406 Ga0439439_0040713 Ga0439439_0040713_255_956 233
49 3300041410 Ga0439461_0000005 Ga0439461_0000005_5286_5987 233
50 3300041410 Ga0439461_0001836 Ga0439461_0001836_1542_2243 233
51 3300041413 Ga0439465_0005156 Ga0439465_0005156_431_1132 233
52 3300041413 Ga0439465_0005367 Ga0439465_0005367_1187_1888 233
53 3300041997 Ga0439431_0000066 Ga0439431_0000066_12947_13648 233
54 3300041997 Ga0439431_0011328 Ga0439431_0011328_1004_1705 233
55 3300042002 Ga0439442_024642 Ga0439442_024642_517_1218 233
56 3300042004 Ga0439445_0003763 Ga0439445_0003763_1668_2369 233
57 3300042004 Ga0439445_0003804 Ga0439445_0003804_2261_2962 233
58 3300042006 Ga0439432_008221 Ga0439432_008221_177_878 233
59 3300042010 Ga0439452_007753 Ga0439452_007753_2073_2774 233
60 3300042010 Ga0439452_016440 Ga0439452_016440_627_1328 233
61 3300042015 Ga0439462_0000631 Ga0439462_0000631_5729_6430 233
62 3300042131 Ga0450894_011747 Ga0450894_011747_336_1037 233
63 3300042435 Ga0439434_0005169 Ga0439434_0005169_1688_2389 233
64 3300042435 Ga0439434_0018492 Ga0439434_0018492_74_775 233
65 3300046691 Ga0495670_0000019 Ga0495670_0000019_84255_84956 233
66 3300047472 Ga0495686_0000985 Ga0495686_0000985_13667_14380 233
67 3300048918 Ga0496115_0000665 Ga0496115_0000665_11567_12268 233
68 3300048920 Ga0496117_0090940 Ga0496117_0090940_505_1209 233
69 3300053087 Ga0500643_015888 Ga0500643_015888_502_1203 233
70 3300053094 Ga0500566_0004226 Ga0500566_0004226_5136_5837 233
71 3300053128 Ga0500626_111952 Ga0500626_111952_11_712 233
72 3300053134 Ga0500658_0001159 Ga0500658_0001159_6706_7407 233
73 3300053134 Ga0500658_0010532 Ga0500658_0010532_2435_3136 233
74 3300053139 Ga0500568_0022365 Ga0500568_0022365_430_1131 233
75 3300053153 Ga0500616_0001975 Ga0500616_0001975_16801_17502 233
76 iso_pu_bacteria 2510917021 2511128130 233
77 iso_pu_bacteria 8054302542 8054305263 233
78 3300001989 JGI24739J22299_10012561 JGI24739J22299_100125612 234
79 3300001990 JGI24737J22298_10018518 JGI24737J22298_100185184 234
80 3300002075 JGI24738J21930_10005188 JGI24738J21930_100051883 234
81 3300002244 JGI24742J22300_10016742 JGI24742J22300_100167422 234
82 3300003215 JGI25153J46596_10000045 JGI25153J46596_10000045106 234
83 3300003759 Ga0055525_1000080 Ga0055525_1000080106 234
84 3300003762 Ga0055542_1000012 Ga0055542_1000012195 234
85 3300003763 Ga0055529_1000002 Ga0055529_1000002111 234
86 3300003763 Ga0055529_1000004 Ga0055529_1000004338 234
87 3300005262 Ga0065165_1002357 Ga0065165_100235712 234
88 3300005262 Ga0065165_1042953 Ga0065165_10429531 234
89 3300005327 Ga0070658_10000062 Ga0070658_10000062112 234
90 3300005331 Ga0070670_100084102 Ga0070670_1000841022 234
91 3300005335 Ga0070666_10298636 Ga0070666_102986361 234
92 3300005339 Ga0070660_100000991 Ga0070660_1000009917 234
93 3300005339 Ga0070660_100045418 Ga0070660_1000454182 234
94 3300005344 Ga0070661_100121778 Ga0070661_1001217783 234
95 3300005353 Ga0070669_100039460 Ga0070669_1000394602 234
96 3300005354 Ga0070675_100106692 Ga0070675_1001066923 234
97 3300005356 Ga0070674_100039534 Ga0070674_1000395343 234
98 3300005364 Ga0070673_100039063 Ga0070673_1000390634 234
99 3300005366 Ga0070659_100154606 Ga0070659_1001546062 234
100 3300005367 Ga0070667_100022278 Ga0070667_1000222785 234
101 3300005456 Ga0070678_100002558 Ga0070678_1000025587 234
102 3300005457 Ga0070662_100070881 Ga0070662_1000708813 234
103 3300005539 Ga0068853_100118110 Ga0068853_1001181103 234
104 3300005543 Ga0070672_100018880 Ga0070672_1000188805 234
105 3300005548 Ga0070665_100000088 Ga0070665_10000008830 234
106 3300005577 Ga0068857_100036896 Ga0068857_1000368964 234
107 3300005577 Ga0068857_100232343 Ga0068857_1002323431 234
108 3300005614 Ga0068856_100052680 Ga0068856_1000526804 234
109 3300006237 Ga0097621_100122169 Ga0097621_1001221693 234
110 3300009093 Ga0105240_10501760 Ga0105240_105017601 234
111 3300009148 Ga0105243_10001077 Ga0105243_1000107712 234
112 3300009174 Ga0105241_10028145 Ga0105241_100281455 234
113 3300009174 Ga0105241_10650088 Ga0105241_106500881 234
114 3300009545 Ga0105237_10001660 Ga0105237_1000166025 234
115 3300009545 Ga0105237_10443373 Ga0105237_104433731 234
116 3300009551 Ga0105238_10797365 Ga0105238_107973651 234
117 3300011119 Ga0105246_10951712 Ga0105246_109517121 234
118 3300013100 Ga0157373_10014350 Ga0157373_100143506 234
119 3300013102 Ga0157371_10000062 Ga0157371_10000062152 234
120 3300013102 Ga0157371_10504304 Ga0157371_105043041 234
121 3300013105 Ga0157369_10118596 Ga0157369_101185962 234
122 3300013297 Ga0157378_10006122 Ga0157378_100061229 234
123 3300013306 Ga0163162_10023635 Ga0163162_100236356 234
124 3300013307 Ga0157372_10014494 Ga0157372_100144945 234
125 3300013307 Ga0157372_10128915 Ga0157372_101289153 234
126 3300013307 Ga0157372_10497766 Ga0157372_104977662 234
127 3300013308 Ga0157375_11003094 Ga0157375_110030941 234
128 3300025230 Ga0209563_100058 Ga0209563_100058227 234
129 3300025253 Ga0209677_109030 Ga0209677_1090302 234
130 3300025254 Ga0209148_1000008 Ga0209148_1000008829 234
131 3300025272 Ga0209455_1000002 Ga0209455_1000002596 234
132 3300025297 Ga0209758_1000007 Ga0209758_1000007958 234
133 3300025901 Ga0207688_10172340 Ga0207688_101723402 234
134 3300025903 Ga0207680_10360599 Ga0207680_103605991 234
135 3300025904 Ga0207647_10004690 Ga0207647_100046902 234
136 3300025904 Ga0207647_10007524 Ga0207647_100075245 234
137 3300025904 Ga0207647_10017114 Ga0207647_100171146 234
138 3300025907 Ga0207645_10140691 Ga0207645_101406912 234
139 3300025909 Ga0207705_10002703 Ga0207705_1000270310 234
140 3300025914 Ga0207671_10000567 Ga0207671_100005679 234
141 3300025919 Ga0207657_10002582 Ga0207657_1000258218 234
142 3300025919 Ga0207657_10406177 Ga0207657_104061772 234
143 3300025931 Ga0207644_10160788 Ga0207644_101607882 234
144 3300025933 Ga0207706_10053084 Ga0207706_100530844 234
145 3300025933 Ga0207706_10087295 Ga0207706_100872952 234
146 3300025935 Ga0207709_10000005 Ga0207709_10000005264 234
147 3300025937 Ga0207669_10000174 Ga0207669_1000017416 234
148 3300025940 Ga0207691_10033158 Ga0207691_100331585 234
149 3300025942 Ga0207689_10075646 Ga0207689_100756462 234
150 3300025960 Ga0207651_10080622 Ga0207651_100806222 234
151 3300025986 Ga0207658_10061944 Ga0207658_100619443 234
152 3300026023 Ga0207677_10226311 Ga0207677_102263111 234
153 3300026116 Ga0207674_10028880 Ga0207674_100288803 234
154 3300026121 Ga0207683_10003668 Ga0207683_100036689 234
155 3300026121 Ga0207683_10230163 Ga0207683_102301632 234
156 3300026142 Ga0207698_10000186 Ga0207698_1000018625 234
157 3300028379 Ga0268266_10000074 Ga0268266_10000074130 234
158 3300028786 Ga0307517_10012427 Ga0307517_1001242710 234
159 3300028786 Ga0307517_10037285 Ga0307517_100372857 234
160 3300031456 Ga0307513_10060125 Ga0307513_100601254 234
161 3300031911 Ga0307412_10171259 Ga0307412_101712591 234
162 3300033180 Ga0307510_10211222 Ga0307510_102112222 234
163 3300037312 Ga0395899_0037987 Ga0395899_0037987_2742_3452 234
164 3300037418 Ga0395900_0050564 Ga0395900_0050564_3243_3950 234
165 3300037471 Ga0395905_0081567 Ga0395905_0081567_1927_2634 234
166 3300037471 Ga0395905_0230214 Ga0395905_0230214_616_1326 234
167 3300039437 Ga0436365_1181252 Ga0436365_1181252_1674_2384 234
168 3300042005 Ga0439448_0039282 Ga0439448_0039282_48_755 234
169 3300042012 Ga0439455_0002972 Ga0439455_0002972_1062_1769 234
170 3300042157 Ga0439458_0000263 Ga0439458_0000263_6313_7020 234
171 3300042157 Ga0439458_0004273 Ga0439458_0004273_1546_2253 234
172 3300042157 Ga0439458_0006327 Ga0439458_0006327_1280_1987 234
173 3300044684 Ga0466966_0058247 Ga0466966_0058247_757_1464 234
174 3300044693 Ga0466961_0009584 Ga0466961_0009584_2012_2719 234
175 3300044706 Ga0466964_0016699 Ga0466964_0016699_775_1482 234
176 3300044719 Ga0466971_0011526 Ga0466971_0011526_1081_1788 234
177 3300044719 Ga0466971_0066471 Ga0466971_0066471_303_1010 234
178 3300044765 Ga0466970_0024989 Ga0466970_0024989_1977_2684 234
179 3300044842 Ga0466957_0020005 Ga0466957_0020005_468_1175 234
180 3300044901 Ga0466960_0000991 Ga0466960_0000991_943_1650 234
181 3300045049 Ga0466959_0021515 Ga0466959_0021515_3422_4129 234
182 3300045836 Ga0466958_0030818 Ga0466958_0030818_442_1149 234
183 3300045836 Ga0466958_0034088 Ga0466958_0034088_2155_2862 234
184 3300045976 Ga0466967_0462283 Ga0466967_0462283_137_844 234
185 3300046452 Ga0495617_006845 Ga0495617_006845_3111_3821 234
186 3300046471 Ga0495650_0000091 Ga0495650_0000091_184912_185622 234
187 3300046491 Ga0495584_0136670 Ga0495584_0136670_402_1112 234
188 3300046492 Ga0495585_0005357 Ga0495585_0005357_60_770 234
189 3300046501 Ga0495607_0020242 Ga0495607_0020242_453_1160 234
190 3300046506 Ga0495583_0000406 Ga0495583_0000406_55125_55835 234
191 3300046506 Ga0495583_0017415 Ga0495583_0017415_2962_3672 234
192 3300046507 Ga0495606_0000457 Ga0495606_0000457_43160_43870 234
193 3300046507 Ga0495606_0142636 Ga0495606_0142636_102_812 234
194 3300046513 Ga0495616_0097461 Ga0495616_0097461_505_1215 234
195 3300046518 Ga0495631_0074987 Ga0495631_0074987_79_789 234
196 3300046518 Ga0495631_0128273 Ga0495631_0128273_56_766 234
197 3300046519 Ga0495632_0161298 Ga0495632_0161298_158_865 234
198 3300046520 Ga0495637_0105205 Ga0495637_0105205_40_750 234
199 3300046522 Ga0495643_0009428 Ga0495643_0009428_4592_5302 234
200 3300046522 Ga0495643_0011767 Ga0495643_0011767_218_928 234
201 3300046522 Ga0495643_0025484 Ga0495643_0025484_17_727 234
202 3300046524 Ga0495648_0000114 Ga0495648_0000114_56812_57522 234
203 3300046524 Ga0495648_0156523 Ga0495648_0156523_72_779 234
204 3300046525 Ga0495663_0006507 Ga0495663_0006507_2249_2959 234
205 3300046528 Ga0495642_0003030 Ga0495642_0003030_2231_2941 234
206 3300046542 Ga0495597_0038934 Ga0495597_0038934_1279_1989 234
207 3300046558 Ga0495633_0000739 Ga0495633_0000739_22800_23510 234
208 3300046558 Ga0495633_0034668 Ga0495633_0034668_695_1405 234
209 3300046616 Ga0495668_0000022 Ga0495668_0000022_146696_147406 234
210 3300046648 Ga0495611_0062972 Ga0495611_0062972_775_1485 234
211 3300046648 Ga0495611_0076407 Ga0495611_0076407_41_751 234
212 3300046660 Ga0495625_0048759 Ga0495625_0048759_56_766 234
213 3300046660 Ga0495625_0140058 Ga0495625_0140058_83_793 234
214 3300046660 Ga0495625_0372997 Ga0495625_0372997_56_766 234
215 3300046665 Ga0495661_0143917 Ga0495661_0143917_83_793 234
216 3300046684 Ga0495669_0000047 Ga0495669_0000047_81949_82659 234
217 3300046691 Ga0495670_0032241 Ga0495670_0032241_927_1637 234
218 3300046692 Ga0495671_0015063 Ga0495671_0015063_1351_2082 234
219 3300046810 Ga0495660_0010290 Ga0495660_0010290_2806_3516 234
220 3300047323 Ga0495683_0008682 Ga0495683_0008682_2493_3203 234
221 3300047443 Ga0495687_000043 Ga0495687_000043_91250_91960 234
222 3300047443 Ga0495687_000083 Ga0495687_000083_108706_109416 234
223 3300047443 Ga0495687_029728 Ga0495687_029728_604_1311 234
224 3300047445 Ga0495677_0007237 Ga0495677_0007237_1250_1960 234
225 3300047469 Ga0495673_0037586 Ga0495673_0037586_342_1052 234
226 3300047470 Ga0495681_0051438 Ga0495681_0051438_1049_1759 234
227 3300048903 Ga0496100_0494182 Ga0496100_0494182_147_857 234
228 3300048904 Ga0496101_0028746 Ga0496101_0028746_631_1341 234
229 3300048905 Ga0496102_0000022 Ga0496102_0000022_135836_136546 234
230 3300048906 Ga0496103_0000167 Ga0496103_0000167_46145_46855 234
231 3300048907 Ga0496104_0001962 Ga0496104_0001962_6019_6729 234
232 3300048908 Ga0496105_0000479 Ga0496105_0000479_19590_20300 234
233 3300048910 Ga0496107_0093085 Ga0496107_0093085_1022_1732 234
234 3300048914 Ga0496111_0013236 Ga0496111_0013236_4504_5214 234
235 3300048914 Ga0496111_0145735 Ga0496111_0145735_60_767 234
236 3300048916 Ga0496113_0021719 Ga0496113_0021719_104_814 234
237 3300048917 Ga0496114_0002987 Ga0496114_0002987_5457_6167 234
238 3300048918 Ga0496115_0000029 Ga0496115_0000029_94168_94878 234
239 3300048919 Ga0496116_0008266 Ga0496116_0008266_2316_3026 234
240 3300048920 Ga0496117_0000260 Ga0496117_0000260_58554_59264 234
241 3300048920 Ga0496117_0005957 Ga0496117_0005957_2358_3065 234
242 3300048921 Ga0496118_0000039 Ga0496118_0000039_226730_227440 234
243 3300048921 Ga0496118_0015672 Ga0496118_0015672_1188_1895 234
244 3300048921 Ga0496118_0020492 Ga0496118_0020492_531_1238 234
245 3300048922 Ga0496119_0010119 Ga0496119_0010119_5865_6575 234
246 3300048923 Ga0496120_0017516 Ga0496120_0017516_3861_4571 234
247 3300048923 Ga0496120_0031863 Ga0496120_0031863_706_1413 234
248 3300048924 Ga0496121_0000683 Ga0496121_0000683_40423_41133 234
249 3300048924 Ga0496121_0031799 Ga0496121_0031799_2889_3596 234
250 3300048925 Ga0496122_0007119 Ga0496122_0007119_5626_6333 234
251 3300048925 Ga0496122_0028094 Ga0496122_0028094_2170_2877 234
252 3300048926 Ga0496123_0012423 Ga0496123_0012423_2264_2971 234
253 3300048927 Ga0496124_0000076 Ga0496124_0000076_78928_79638 234
254 3300048927 Ga0496124_0002194 Ga0496124_0002194_4455_5162 234
255 3300048928 Ga0496125_0000505 Ga0496125_0000505_54838_55548 234
256 3300048928 Ga0496125_0007784 Ga0496125_0007784_1772_2479 234
257 3300048929 Ga0496126_0000469 Ga0496126_0000469_46391_47101 234
258 3300048929 Ga0496126_0037665 Ga0496126_0037665_756_1463 234
259 3300049679 Ga0501249_000256 Ga0501249_000256_412_1119 234
260 3300050493 nmdc:mga0k408_118952_c1 nmdc:mga0k408_118952_c1_401_1108 234
261 3300053079 Ga0500610_0000508 Ga0500610_0000508_84_794 234
262 3300053118 Ga0500594_0005674 Ga0500594_0005674_254_985 234
263 3300053119 Ga0500595_000814 Ga0500595_000814_16836_17546 234
264 3300053130 Ga0500642_0001178 Ga0500642_0001178_2192_2902 234
265 3300053154 Ga0500619_016693 Ga0500619_016693_749_1459 234
266 3300053177 Ga0500636_0007966 Ga0500636_0007966_786_1496 234
267 3300053730 Ga0500645_000038 Ga0500645_000038_24840_25550 234
268 3300053730 Ga0500645_000842 Ga0500645_000842_4282_4989 234
269 3300053735 Ga0500596_003694 Ga0500596_003694_319_1029 234
270 3300061719 Ga0466962_0021624 Ga0466962_0021624_1367_2074 234
271 iso_pu_bacteria 2896253425 2896256083 234
272 iso_pu_bacteria 2919709256 2919712539 234
273 3300001904 JGI24736J21556_1001607 JGI24736J21556_10016075 235
274 3300001915 JGI24741J21665_1000677 JGI24741J21665_100067714 235
275 3300001976 JGI24752J21851_1004063 JGI24752J21851_10040632 235
276 3300001979 JGI24740J21852_10002676 JGI24740J21852_100026766 235
277 3300001990 JGI24737J22298_10003202 JGI24737J22298_100032024 235
278 3300002067 JGI24735J21928_10000951 JGI24735J21928_100009514 235
279 3300002075 JGI24738J21930_10001235 JGI24738J21930_100012355 235
280 3300002459 JGI24751J29686_10019978 JGI24751J29686_100199782 235
281 3300003758 Ga0055532_1011407 Ga0055532_10114072 235
282 3300005327 Ga0070658_10158829 Ga0070658_101588292 235
283 3300005327 Ga0070658_10275481 Ga0070658_102754812 235
284 3300005331 Ga0070670_100025864 Ga0070670_1000258644 235
285 3300005335 Ga0070666_10001598 Ga0070666_100015984 235
286 3300005335 Ga0070666_10005216 Ga0070666_100052164 235
287 3300005339 Ga0070660_100173063 Ga0070660_1001730632 235
288 3300005344 Ga0070661_100248303 Ga0070661_1002483031 235
289 3300005347 Ga0070668_100000050 Ga0070668_10000005038 235
290 3300005353 Ga0070669_100000048 Ga0070669_10000004891 235
291 3300005353 Ga0070669_100007602 Ga0070669_1000076028 235
292 3300005355 Ga0070671_100000119 Ga0070671_1000001193 235
293 3300005366 Ga0070659_100017500 Ga0070659_1000175007 235
294 3300005367 Ga0070667_100000025 Ga0070667_100000025168 235
295 3300005367 Ga0070667_100045962 Ga0070667_1000459622 235
296 3300005440 Ga0070705_100076287 Ga0070705_1000762872 235
297 3300005445 Ga0070708_100019346 Ga0070708_1000193463 235
298 3300005455 Ga0070663_100329408 Ga0070663_1003294081 235
299 3300005564 Ga0070664_100119593 Ga0070664_1001195932 235
300 3300005614 Ga0068856_100009259 Ga0068856_1000092596 235
301 3300005616 Ga0068852_100349433 Ga0068852_1003494332 235
302 3300005617 Ga0068859_100015185 Ga0068859_1000151857 235
303 3300005618 Ga0068864_100002231 Ga0068864_1000022313 235
304 3300005834 Ga0068851_10018950 Ga0068851_100189502 235
305 3300005841 Ga0068863_100000187 Ga0068863_10000018748 235
306 3300005841 Ga0068863_100035369 Ga0068863_1000353692 235
307 3300005842 Ga0068858_100602663 Ga0068858_1006026631 235
308 3300005843 Ga0068860_100003627 Ga0068860_10000362715 235
309 3300005843 Ga0068860_100058249 Ga0068860_1000582492 235
310 3300005844 Ga0068862_100054582 Ga0068862_1000545824 235
311 3300006042 Ga0075368_10000565 Ga0075368_100005657 235
312 3300006178 Ga0075367_10007298 Ga0075367_100072982 235
313 3300006353 Ga0075370_10175836 Ga0075370_101758362 235
314 3300006880 Ga0075429_100105775 Ga0075429_1001057752 235
315 3300006931 Ga0097620_100015185 Ga0097620_1000151857 235
316 3300009011 Ga0105251_10008893 Ga0105251_100088934 235
317 3300009011 Ga0105251_10035720 Ga0105251_100357202 235
318 3300009093 Ga0105240_10010858 Ga0105240_100108588 235
319 3300009093 Ga0105240_10269265 Ga0105240_102692652 235
320 3300009147 Ga0114129_10441353 Ga0114129_104413532 235
321 3300009148 Ga0105243_10094543 Ga0105243_100945433 235
322 3300009174 Ga0105241_10002141 Ga0105241_100021419 235
323 3300009545 Ga0105237_10017714 Ga0105237_100177142 235
324 3300009551 Ga0105238_10370976 Ga0105238_103709762 235
325 3300009553 Ga0105249_10101485 Ga0105249_101014853 235
326 3300009978 Ga0105148_100452 Ga0105148_1004523 235
327 3300010375 Ga0105239_10002472 Ga0105239_1000247212 235
328 3300013100 Ga0157373_10109959 Ga0157373_101099592 235
329 3300013102 Ga0157371_10021083 Ga0157371_100210834 235
330 3300013104 Ga0157370_10051227 Ga0157370_100512272 235
331 3300013307 Ga0157372_10357253 Ga0157372_103572532 235
332 3300014968 Ga0157379_10150015 Ga0157379_101500152 235
333 3300017792 Ga0163161_10117356 Ga0163161_101173562 235
334 3300025229 Ga0209147_100882 Ga0209147_1008824 235
335 3300025900 Ga0207710_10003855 Ga0207710_100038554 235
336 3300025903 Ga0207680_10000817 Ga0207680_1000081714 235
337 3300025903 Ga0207680_10003518 Ga0207680_100035186 235
338 3300025909 Ga0207705_10047290 Ga0207705_100472902 235
339 3300025911 Ga0207654_10080212 Ga0207654_100802122 235
340 3300025913 Ga0207695_10018738 Ga0207695_100187387 235
341 3300025914 Ga0207671_10034313 Ga0207671_100343133 235
342 3300025919 Ga0207657_10020085 Ga0207657_100200852 235
343 3300025920 Ga0207649_10312493 Ga0207649_103124932 235
344 3300025923 Ga0207681_10000050 Ga0207681_1000005091 235
345 3300025923 Ga0207681_10005654 Ga0207681_100056543 235
346 3300025924 Ga0207694_10131777 Ga0207694_101317772 235
347 3300025925 Ga0207650_10067376 Ga0207650_100673762 235
348 3300025931 Ga0207644_10000134 Ga0207644_100001345 235
349 3300025944 Ga0207661_10674760 Ga0207661_106747601 235
350 3300025961 Ga0207712_10007474 Ga0207712_100074745 235
351 3300025961 Ga0207712_10011280 Ga0207712_100112803 235
352 3300025972 Ga0207668_10000094 Ga0207668_1000009449 235
353 3300025972 Ga0207668_10000436 Ga0207668_1000043631 235
354 3300025981 Ga0207640_10268623 Ga0207640_102686232 235
355 3300025986 Ga0207658_10000023 Ga0207658_10000023166 235
356 3300025986 Ga0207658_10008354 Ga0207658_100083545 235
357 3300026035 Ga0207703_10002369 Ga0207703_1000236918 235
358 3300026041 Ga0207639_10003214 Ga0207639_100032149 235
359 3300026067 Ga0207678_10000079 Ga0207678_1000007949 235
360 3300026078 Ga0207702_10001332 Ga0207702_1000133226 235
361 3300026088 Ga0207641_10000269 Ga0207641_1000026929 235
362 3300026088 Ga0207641_10017468 Ga0207641_100174682 235
363 3300026095 Ga0207676_10001569 Ga0207676_100015692 235
364 3300026118 Ga0207675_100009530 Ga0207675_1000095306 235
365 3300026142 Ga0207698_10028185 Ga0207698_100281852 235
366 3300027866 Ga0209813_10001114 Ga0209813_100011147 235
367 3300028380 Ga0268265_10000102 Ga0268265_1000010223 235
368 3300028380 Ga0268265_10054272 Ga0268265_100542722 235
369 3300028381 Ga0268264_10000180 Ga0268264_1000018052 235
370 3300028381 Ga0268264_10004368 Ga0268264_1000436814 235
371 3300031731 Ga0307405_10413462 Ga0307405_104134621 235
372 3300031852 Ga0307410_10035115 Ga0307410_100351153 235
373 3300031911 Ga0307412_10000126 Ga0307412_1000012613 235
374 3300031995 Ga0307409_100519028 Ga0307409_1005190282 235
375 3300032002 Ga0307416_100122197 Ga0307416_1001221972 235
376 3300032002 Ga0307416_100212031 Ga0307416_1002120312 235
377 3300032004 Ga0307414_10000270 Ga0307414_100002707 235
378 3300032004 Ga0307414_10145329 Ga0307414_101453292 235
379 3300032005 Ga0307411_10119820 Ga0307411_101198202 235
380 3300032005 Ga0307411_10165095 Ga0307411_101650952 235
381 3300035695 Ga0373927_0232837 Ga0373927_0232837_291_1034 235
382 3300038705 Ga0237819_03911 Ga0237819_03911_667_1386 235
383 3300044735 Ga0466968_0004499 Ga0466968_0004499_2885_3598 235
384 3300046452 Ga0495617_010490 Ga0495617_010490_979_1689 235
385 3300046453 Ga0495627_000336 Ga0495627_000336_5773_6495 235
386 3300046460 Ga0495638_0000068 Ga0495638_0000068_65052_65762 235
387 3300046471 Ga0495650_0001420 Ga0495650_0001420_10582_11292 235
388 3300046471 Ga0495650_0051284 Ga0495650_0051284_56_766 235
389 3300046506 Ga0495583_0000269 Ga0495583_0000269_11390_12100 235
390 3300046513 Ga0495616_0000010 Ga0495616_0000010_111390_112100 235
391 3300046519 Ga0495632_0001120 Ga0495632_0001120_11589_12299 235
392 3300046524 Ga0495648_0000046 Ga0495648_0000046_65015_65725 235
393 3300046524 Ga0495648_0013048 Ga0495648_0013048_3371_4093 235
394 3300046558 Ga0495633_0000929 Ga0495633_0000929_11459_12169 235
395 3300046558 Ga0495633_0016576 Ga0495633_0016576_292_1002 235
396 3300046558 Ga0495633_0033973 Ga0495633_0033973_1404_2126 235
397 3300046692 Ga0495671_0000057 Ga0495671_0000057_11597_12307 235
398 3300047469 Ga0495673_0000110 Ga0495673_0000110_63615_64325 235
399 3300047469 Ga0495673_0052135 Ga0495673_0052135_21_743 235
400 3300047472 Ga0495686_0000273 Ga0495686_0000273_38476_39198 235
401 3300048913 Ga0496110_0018059 Ga0496110_0018059_3272_3982 235
402 3300048919 Ga0496116_0055889 Ga0496116_0055889_1261_1974 235
403 3300048920 Ga0496117_0016880 Ga0496117_0016880_5064_5777 235
404 3300048920 Ga0496117_0029232 Ga0496117_0029232_65_775 235
405 3300048921 Ga0496118_0018558 Ga0496118_0018558_3308_4018 235
406 3300048924 Ga0496121_0002348 Ga0496121_0002348_6741_7451 235
407 3300048925 Ga0496122_0012916 Ga0496122_0012916_2061_2771 235
408 3300048927 Ga0496124_0011818 Ga0496124_0011818_2490_3200 235
409 3300048927 Ga0496124_0019841 Ga0496124_0019841_4046_4759 235
410 3300048928 Ga0496125_0014467 Ga0496125_0014467_2937_3647 235
411 3300048929 Ga0496126_0016624 Ga0496126_0016624_5293_6003 235
412 3300049571 Ga0501034_0036153 Ga0501034_0036153_2178_2903 235
413 3300049663 Ga0501223_000135 Ga0501223_000135_19969_20694 235
414 3300049664 Ga0501224_000042 Ga0501224_000042_1674_2399 235
415 3300049668 Ga0501233_035122 Ga0501233_035122_95_820 235
416 3300049669 Ga0501235_010553 Ga0501235_010553_367_1092 235
417 3300049705 Ga0501225_0000134 Ga0501225_0000134_1674_2399 235
418 3300049705 Ga0501225_0005268 Ga0501225_0005268_2877_3593 235
419 3300049853 Ga0501226_000099 Ga0501226_000099_20004_20729 235
420 3300050494 nmdc:mga06z11_119_c1 nmdc:mga06z11_119_c1_4852_5562 235
421 3300050495 nmdc:mga04h51_37_c1 nmdc:mga04h51_37_c1_40380_41090 235
422 3300050496 nmdc:mga07m45_172015_c1 nmdc:mga07m45_172015_c1_203_913 235
423 3300050507 nmdc:mga05p37_847944_c1 nmdc:mga05p37_847944_c1_165_881 235
424 3300050508 nmdc:mga09592_111294_c1 nmdc:mga09592_111294_c1_1047_1757 235
425 3300053087 Ga0500643_000044 Ga0500643_000044_143540_144250 235
426 3300053087 Ga0500643_012451 Ga0500643_012451_1254_2024 235
427 3300053087 Ga0500643_021524 Ga0500643_021524_295_1014 235
428 3300053108 Ga0500562_003253 Ga0500562_003253_312_1022 235
429 3300053120 Ga0500597_000193 Ga0500597_000193_10872_11630 235
430 3300053136 Ga0500559_0065641 Ga0500559_0065641_563_1273 235
431 3300053157 Ga0500624_000003 Ga0500624_000003_119535_120293 235
432 3300053158 Ga0500627_0000204 Ga0500627_0000204_5541_6251 235
433 3300053178 Ga0500637_0000024 Ga0500637_0000024_27780_28538 235
434 iso_pu_bacteria 2818991438 2819554733 235
435 iso_pu_bacteria 2919138771 2919142568 235
436 iso_pu_bacteria 3000865235 3000867166 235
437 3300005289 Ga0065704_10075413 Ga0065704_100754136 236
438 3300005339 Ga0070660_100264924 Ga0070660_1002649242 236
439 3300005347 Ga0070668_100037299 Ga0070668_1000372994 236
440 3300005366 Ga0070659_100243779 Ga0070659_1002437791 236
441 3300005539 Ga0068853_100003449 Ga0068853_10000344911 236
442 3300005539 Ga0068853_100022626 Ga0068853_1000226264 236
443 3300005548 Ga0070665_100019960 Ga0070665_1000199604 236
444 3300005563 Ga0068855_100026517 Ga0068855_1000265177 236
445 3300005577 Ga0068857_100850541 Ga0068857_1008505411 236
446 3300005578 Ga0068854_100264331 Ga0068854_1002643312 236
447 3300005834 Ga0068851_10130618 Ga0068851_101306181 236
448 3300009093 Ga0105240_10003393 Ga0105240_100033933 236
449 3300025321 Ga0207656_10079668 Ga0207656_100796681 236
450 3300025912 Ga0207707_10342203 Ga0207707_103422032 236
451 3300025913 Ga0207695_10132032 Ga0207695_101320321 236
452 3300025919 Ga0207657_10088520 Ga0207657_100885203 236
453 3300025949 Ga0207667_10001089 Ga0207667_100010897 236
454 3300025972 Ga0207668_10093353 Ga0207668_100933532 236
455 3300025981 Ga0207640_10284912 Ga0207640_102849122 236
456 3300026041 Ga0207639_10007673 Ga0207639_100076735 236
457 3300026078 Ga0207702_10338539 Ga0207702_103385391 236
458 3300026116 Ga0207674_10124108 Ga0207674_101241083 236
459 3300028379 Ga0268266_10019026 Ga0268266_100190266 236
460 3300031824 Ga0307413_10005727 Ga0307413_100057273 236
461 3300031901 Ga0307406_10248438 Ga0307406_102484382 236
462 3300032004 Ga0307414_10044113 Ga0307414_100441132 236
463 3300032126 Ga0307415_100064979 Ga0307415_1000649793 236
464 3300046530 Ga0495654_0094515 Ga0495654_0094515_387_1130 236
465 3300048911 Ga0496108_0000270 Ga0496108_0000270_4607_5320 236
466 3300048913 Ga0496110_0523614 Ga0496110_0523614_258_971 236
467 3300048919 Ga0496116_0031125 Ga0496116_0031125_2260_2973 236
468 3300048924 Ga0496121_0002098 Ga0496121_0002098_2506_3219 236
469 3300048925 Ga0496122_0045084 Ga0496122_0045084_1666_2379 236
470 3300048927 Ga0496124_0063899 Ga0496124_0063899_747_1460 236
471 3300048928 Ga0496125_0034865 Ga0496125_0034865_2059_2775 236
472 3300048928 Ga0496125_0087920 Ga0496125_0087920_374_1087 236
473 3300048929 Ga0496126_0054595 Ga0496126_0054595_71_784 236
474 3300048929 Ga0496126_0079211 Ga0496126_0079211_625_1347 236
475 iso_pu_bacteria 2643221588 2643951557 236
476 iso_pu_bacteria 2738541275 2738712804 236
477 iso_pu_bacteria 2738541301 2738851228 236
478 iso_pu_bacteria 2738541304 2738866958 236
479 iso_pu_bacteria 2738543022 2739299475 236
480 iso_pu_bacteria 2738543033 2739361154 236
481 iso_pu_bacteria 2739367664 2739649041 236
482 iso_pu_bacteria 2739367865 2740027514 236
483 iso_pu_bacteria 2896184354 2896185912 236
484 iso_pu_bacteria 2928100450 2928104539 236
485 iso_pu_bacteria 2928959182 2928963164 236
486 2162886007 SwRhRL2b_contig_3948926 SwRhRL2b_0218.00005210 237
487 3300005355 Ga0070671_100134440 Ga0070671_1001344403 237
488 3300005367 Ga0070667_100000390 Ga0070667_10000039042 237
489 3300005841 Ga0068863_100001079 Ga0068863_10000107925 237
490 3300005843 Ga0068860_100096730 Ga0068860_1000967303 237
491 3300020082 Ga0206353_11419480 Ga0206353_114194802 237
492 3300025986 Ga0207658_10002737 Ga0207658_1000273713 237
493 3300026088 Ga0207641_10002412 Ga0207641_100024126 237
494 3300028381 Ga0268264_10071817 Ga0268264_100718173 237
495 3300032004 Ga0307414_10253571 Ga0307414_102535712 237
496 3300046453 Ga0495627_001139 Ga0495627_001139_15887_16600 237
497 3300046471 Ga0495650_0001028 Ga0495650_0001028_14819_15532 237
498 3300046500 Ga0495596_0000267 Ga0495596_0000267_5505_6218 237
499 3300046501 Ga0495607_0030552 Ga0495607_0030552_1036_1749 237
500 3300046512 Ga0495610_0000015 Ga0495610_0000015_176797_177510 237
501 3300046515 Ga0495620_0029925 Ga0495620_0029925_1340_2053 237
502 3300046519 Ga0495632_0000351 Ga0495632_0000351_23437_24150 237
503 3300046519 Ga0495632_0029442 Ga0495632_0029442_1678_2391 237
504 3300046522 Ga0495643_0030194 Ga0495643_0030194_1334_2047 237
505 3300046522 Ga0495643_0044184 Ga0495643_0044184_464_1177 237
506 3300046522 Ga0495643_0048857 Ga0495643_0048857_156_869 237
507 3300046530 Ga0495654_0044137 Ga0495654_0044137_466_1179 237
508 3300046660 Ga0495625_0032785 Ga0495625_0032785_2561_3274 237
509 3300047470 Ga0495681_0000445 Ga0495681_0000445_15922_16635 237
510 3300048091 Ga0495626_0000808 Ga0495626_0000808_11462_12175 237
511 3300048929 Ga0496126_0034157 Ga0496126_0034157_972_1703 237
512 3300003794 Ga0055531_10022390 Ga0055531_100223903 238
513 3300005327 Ga0070658_10017808 Ga0070658_100178085 238
514 3300005336 Ga0070680_100002171 Ga0070680_10000217111 238
515 3300005339 Ga0070660_100003112 Ga0070660_10000311210 238
516 3300005344 Ga0070661_100006864 Ga0070661_1000068643 238
517 3300005366 Ga0070659_100014130 Ga0070659_1000141307 238
518 3300005457 Ga0070662_100000795 Ga0070662_10000079517 238
519 3300005458 Ga0070681_10044606 Ga0070681_100446062 238
520 3300005530 Ga0070679_100001927 Ga0070679_10000192716 238
521 3300005535 Ga0070684_100077170 Ga0070684_1000771701 238
522 3300005539 Ga0068853_100030617 Ga0068853_1000306175 238
523 3300005563 Ga0068855_100021313 Ga0068855_1000213134 238
524 3300005564 Ga0070664_100023476 Ga0070664_1000234764 238
525 3300005577 Ga0068857_100096790 Ga0068857_1000967902 238
526 3300005614 Ga0068856_100003976 Ga0068856_1000039768 238
527 3300013100 Ga0157373_10003673 Ga0157373_100036733 238
528 3300013102 Ga0157371_10002207 Ga0157371_1000220720 238
529 3300013104 Ga0157370_10005110 Ga0157370_1000511017 238
530 3300013307 Ga0157372_10007274 Ga0157372_100072745 238
531 3300014325 Ga0163163_10655296 Ga0163163_106552961 238
532 3300025294 Ga0209025_1103877 Ga0209025_11038771 238
533 3300025909 Ga0207705_10046649 Ga0207705_100466493 238
534 3300025912 Ga0207707_10023608 Ga0207707_100236085 238
535 3300025919 Ga0207657_10002937 Ga0207657_1000293719 238
536 3300025920 Ga0207649_10013635 Ga0207649_100136352 238
537 3300025921 Ga0207652_10029162 Ga0207652_100291623 238
538 3300025925 Ga0207650_10374090 Ga0207650_103740901 238
539 3300025932 Ga0207690_10002450 Ga0207690_1000245015 238
540 3300025933 Ga0207706_10002382 Ga0207706_1000238220 238
541 3300025944 Ga0207661_10030507 Ga0207661_100305074 238
542 3300025945 Ga0207679_10015535 Ga0207679_100155353 238
543 3300025949 Ga0207667_10108443 Ga0207667_101084432 238
544 3300025981 Ga0207640_10013210 Ga0207640_100132103 238
545 3300026041 Ga0207639_10001191 Ga0207639_1000119113 238
546 3300026041 Ga0207639_10097932 Ga0207639_100979322 238
547 3300026067 Ga0207678_10320248 Ga0207678_103202481 238
548 3300026078 Ga0207702_10013826 Ga0207702_100138265 238
549 3300026116 Ga0207674_10810575 Ga0207674_108105751 238
550 3300042005 Ga0439448_0035805 Ga0439448_0035805_255_977 238
551 3300048924 Ga0496121_0001713 Ga0496121_0001713_27177_27896 238
552 3300002459 JGI24751J29686_10000323 JGI24751J29686_1000032318 239
553 3300005331 Ga0070670_100059410 Ga0070670_1000594104 239
554 3300005335 Ga0070666_10025868 Ga0070666_100258684 239
555 3300005347 Ga0070668_100084213 Ga0070668_1000842132 239
556 3300005353 Ga0070669_100000094 Ga0070669_10000009415 239
557 3300005353 Ga0070669_100257216 Ga0070669_1002572162 239
558 3300005355 Ga0070671_100000243 Ga0070671_10000024316 239
559 3300005367 Ga0070667_100000660 Ga0070667_10000066032 239
560 3300005367 Ga0070667_100017834 Ga0070667_1000178346 239
561 3300005457 Ga0070662_100057763 Ga0070662_1000577632 239
562 3300005530 Ga0070679_100780336 Ga0070679_1007803361 239
563 3300005548 Ga0070665_100105251 Ga0070665_1001052512 239
564 3300005563 Ga0068855_100001435 Ga0068855_10000143518 239
565 3300005618 Ga0068864_100008568 Ga0068864_1000085684 239
566 3300005841 Ga0068863_100000058 Ga0068863_10000005895 239
567 3300005842 Ga0068858_100017541 Ga0068858_1000175416 239
568 3300005842 Ga0068858_100069896 Ga0068858_1000698962 239
569 3300005843 Ga0068860_100000057 Ga0068860_100000057191 239
570 3300005843 Ga0068860_100024116 Ga0068860_1000241166 239
571 3300005843 Ga0068860_100058391 Ga0068860_1000583914 239
572 3300005844 Ga0068862_100032566 Ga0068862_1000325665 239
573 3300009093 Ga0105240_10319237 Ga0105240_103192372 239
574 3300009101 Ga0105247_10033832 Ga0105247_100338322 239
575 3300009148 Ga0105243_10155385 Ga0105243_101553852 239
576 3300014968 Ga0157379_10323996 Ga0157379_103239961 239
577 3300017792 Ga0163161_10065480 Ga0163161_100654802 239
578 3300025900 Ga0207710_10050837 Ga0207710_100508372 239
579 3300025913 Ga0207695_10216992 Ga0207695_102169922 239
580 3300025923 Ga0207681_10001096 Ga0207681_1000109615 239
581 3300025923 Ga0207681_10159210 Ga0207681_101592102 239
582 3300025925 Ga0207650_10228576 Ga0207650_102285761 239
583 3300025931 Ga0207644_10000056 Ga0207644_1000005619 239
584 3300025931 Ga0207644_10027263 Ga0207644_100272634 239
585 3300025933 Ga0207706_10080509 Ga0207706_100805093 239
586 3300025935 Ga0207709_10253795 Ga0207709_102537952 239
587 3300025949 Ga0207667_10002432 Ga0207667_1000243216 239
588 3300025972 Ga0207668_10068584 Ga0207668_100685842 239
589 3300025986 Ga0207658_10010305 Ga0207658_100103056 239
590 3300025986 Ga0207658_10115529 Ga0207658_101155292 239
591 3300026035 Ga0207703_10003301 Ga0207703_100033019 239
592 3300026035 Ga0207703_10305518 Ga0207703_103055182 239
593 3300026088 Ga0207641_10003855 Ga0207641_100038557 239
594 3300026088 Ga0207641_10127064 Ga0207641_101270643 239
595 3300026095 Ga0207676_10027677 Ga0207676_100276772 239
596 3300026095 Ga0207676_10032111 Ga0207676_100321115 239
597 3300026095 Ga0207676_10111941 Ga0207676_101119413 239
598 3300028380 Ga0268265_10018322 Ga0268265_100183225 239
599 3300028380 Ga0268265_10040823 Ga0268265_100408233 239
600 3300028381 Ga0268264_10000078 Ga0268264_100000783 239
601 3300028381 Ga0268264_10017221 Ga0268264_100172217 239
602 3300031250 Ga0265331_10086685 Ga0265331_100866852 239
603 3300033180 Ga0307510_10356259 Ga0307510_103562591 239
604 3300036712 Ga0316584_0106575 Ga0316584_0106575_944_1663 239
605 3300042005 Ga0439448_0083156 Ga0439448_0083156_289_1035 239
606 3300042012 Ga0439455_0028443 Ga0439455_0028443_441_1187 239
607 3300045051 Ga0451576_0000017 Ga0451576_0000017_335827_336564 239
608 3300046522 Ga0495643_0052511 Ga0495643_0052511_590_1309 239
609 3300048903 Ga0496100_0221074 Ga0496100_0221074_480_1205 239
610 3300048905 Ga0496102_0139972 Ga0496102_0139972_148_873 239
611 3300048906 Ga0496103_0030200 Ga0496103_0030200_1331_2056 239
612 3300048907 Ga0496104_0025352 Ga0496104_0025352_3245_3970 239
613 3300048908 Ga0496105_0006155 Ga0496105_0006155_5937_6698 239
614 3300048908 Ga0496105_0017067 Ga0496105_0017067_2756_3481 239
615 3300048909 Ga0496106_0007027 Ga0496106_0007027_6667_7428 239
616 3300048910 Ga0496107_0000287 Ga0496107_0000287_25130_25891 239
617 3300048913 Ga0496110_0119140 Ga0496110_0119140_835_1596 239
618 3300048914 Ga0496111_0106914 Ga0496111_0106914_538_1299 239
619 3300048916 Ga0496113_0002636 Ga0496113_0002636_6945_7706 239
620 3300048921 Ga0496118_0013474 Ga0496118_0013474_6179_6898 239
621 3300048921 Ga0496118_0048476 Ga0496118_0048476_2221_2940 239
622 3300048924 Ga0496121_0003389 Ga0496121_0003389_10729_11448 239
623 3300048925 Ga0496122_0057644 Ga0496122_0057644_324_1043 239
624 3300048926 Ga0496123_0009892 Ga0496123_0009892_2724_3443 239
625 3300048927 Ga0496124_0001874 Ga0496124_0001874_1307_2026 239
626 3300048927 Ga0496124_0019879 Ga0496124_0019879_4672_5391 239
627 3300048928 Ga0496125_0020907 Ga0496125_0020907_2670_3389 239
628 3300048929 Ga0496126_0003395 Ga0496126_0003395_4216_4935 239
629 3300049571 Ga0501034_0021162 Ga0501034_0021162_1271_1990 239
630 3300049744 Ga0501083_0070382 Ga0501083_0070382_1274_2014 239
631 3300053087 Ga0500643_000001 Ga0500643_000001_108330_109049 239
632 3300053153 Ga0500616_0001142 Ga0500616_0001142_26413_27132 239
633 2162886007 SwRhRL2b_contig_1955283 SwRhRL2b_0566.00001990 240
634 3300001990 JGI24737J22298_10002657 JGI24737J22298_100026575 240
635 3300002074 JGI24748J21848_1001609 JGI24748J21848_10016093 240
636 3300005289 Ga0065704_10082534 Ga0065704_100825343 240
637 3300005327 Ga0070658_10004751 Ga0070658_1000475111 240
638 3300005327 Ga0070658_10044462 Ga0070658_100444623 240
639 3300005327 Ga0070658_10054793 Ga0070658_100547934 240
640 3300005327 Ga0070658_10102810 Ga0070658_101028102 240
641 3300005327 Ga0070658_10115593 Ga0070658_101155932 240
642 3300005334 Ga0068869_100126975 Ga0068869_1001269752 240
643 3300005336 Ga0070680_100512988 Ga0070680_1005129881 240
644 3300005339 Ga0070660_100182926 Ga0070660_1001829262 240
645 3300005343 Ga0070687_100219985 Ga0070687_1002199852 240
646 3300005344 Ga0070661_100006660 Ga0070661_1000066606 240
647 3300005344 Ga0070661_100097671 Ga0070661_1000976712 240
648 3300005347 Ga0070668_100001905 Ga0070668_1000019056 240
649 3300005353 Ga0070669_100000039 Ga0070669_10000003985 240
650 3300005353 Ga0070669_100105111 Ga0070669_1001051112 240
651 3300005355 Ga0070671_100007867 Ga0070671_1000078675 240
652 3300005355 Ga0070671_100119854 Ga0070671_1001198543 240
653 3300005366 Ga0070659_100251963 Ga0070659_1002519632 240
654 3300005367 Ga0070667_100070472 Ga0070667_1000704723 240
655 3300005455 Ga0070663_100012592 Ga0070663_1000125922 240
656 3300005455 Ga0070663_100094978 Ga0070663_1000949782 240
657 3300005455 Ga0070663_100151440 Ga0070663_1001514402 240
658 3300005457 Ga0070662_100004642 Ga0070662_1000046426 240
659 3300005457 Ga0070662_100034298 Ga0070662_1000342984 240
660 3300005471 Ga0070698_100134563 Ga0070698_1001345632 240
661 3300005530 Ga0070679_100032968 Ga0070679_1000329685 240
662 3300005535 Ga0070684_100302988 Ga0070684_1003029882 240
663 3300005539 Ga0068853_100359093 Ga0068853_1003590932 240
664 3300005543 Ga0070672_100150810 Ga0070672_1001508102 240
665 3300005544 Ga0070686_100000191 Ga0070686_10000019118 240
666 3300005548 Ga0070665_100000168 Ga0070665_10000016836 240
667 3300005548 Ga0070665_100001278 Ga0070665_1000012786 240
668 3300005548 Ga0070665_100090309 Ga0070665_1000903093 240
669 3300005563 Ga0068855_100037627 Ga0068855_1000376272 240
670 3300005564 Ga0070664_100019373 Ga0070664_1000193735 240
671 3300005577 Ga0068857_100273925 Ga0068857_1002739252 240
672 3300005577 Ga0068857_100288371 Ga0068857_1002883712 240
673 3300005578 Ga0068854_100311138 Ga0068854_1003111382 240
674 3300005616 Ga0068852_100769502 Ga0068852_1007695021 240
675 3300005834 Ga0068851_10121208 Ga0068851_101212082 240
676 3300005841 Ga0068863_100097701 Ga0068863_1000977012 240
677 3300005843 Ga0068860_100021480 Ga0068860_1000214807 240
678 3300006051 Ga0075364_10040053 Ga0075364_100400534 240
679 3300006051 Ga0075364_10079961 Ga0075364_100799612 240
680 3300006177 Ga0075362_10000029 Ga0075362_1000002912 240
681 3300006177 Ga0075362_10058309 Ga0075362_100583092 240
682 3300006186 Ga0075369_10015041 Ga0075369_100150414 240
683 3300006195 Ga0075366_10052037 Ga0075366_100520372 240
684 3300006353 Ga0075370_10000011 Ga0075370_1000001134 240
685 3300006353 Ga0075370_10218609 Ga0075370_102186091 240
686 3300006871 Ga0075434_100248156 Ga0075434_1002481562 240
687 3300009092 Ga0105250_10009073 Ga0105250_100090734 240
688 3300009148 Ga0105243_10326533 Ga0105243_103265332 240
689 3300009177 Ga0105248_10068994 Ga0105248_100689945 240
690 3300009553 Ga0105249_10057499 Ga0105249_100574993 240
691 3300009553 Ga0105249_10398377 Ga0105249_103983772 240
692 3300011119 Ga0105246_10001372 Ga0105246_1000137213 240
693 3300013104 Ga0157370_10074081 Ga0157370_100740813 240
694 3300013105 Ga0157369_10240104 Ga0157369_102401042 240
695 3300013306 Ga0163162_10010482 Ga0163162_100104825 240
696 3300013307 Ga0157372_10137500 Ga0157372_101375003 240
697 3300013308 Ga0157375_10107516 Ga0157375_101075162 240
698 3300013308 Ga0157375_10548635 Ga0157375_105486352 240
699 3300014969 Ga0157376_11034093 Ga0157376_110340931 240
700 3300020070 Ga0206356_10967351 Ga0206356_109673512 240
701 3300021384 Ga0213876_10012241 Ga0213876_100122413 240
702 3300025226 Ga0209674_104378 Ga0209674_1043782 240
703 3300025258 Ga0209129_1003496 Ga0209129_10034963 240
704 3300025294 Ga0209025_1000993 Ga0209025_100099330 240
705 3300025297 Ga0209758_1000002 Ga0209758_1000002649 240
706 3300025321 Ga0207656_10009546 Ga0207656_100095462 240
707 3300025321 Ga0207656_10090765 Ga0207656_100907652 240
708 3300025711 Ga0207696_1005122 Ga0207696_10051226 240
709 3300025909 Ga0207705_10000103 Ga0207705_1000010318 240
710 3300025909 Ga0207705_10089732 Ga0207705_100897323 240
711 3300025909 Ga0207705_10146704 Ga0207705_101467042 240
712 3300025911 Ga0207654_10000150 Ga0207654_1000015032 240
713 3300025914 Ga0207671_10007737 Ga0207671_100077377 240
714 3300025917 Ga0207660_10463219 Ga0207660_104632191 240
715 3300025920 Ga0207649_10003386 Ga0207649_100033864 240
716 3300025921 Ga0207652_10000489 Ga0207652_1000048930 240
717 3300025921 Ga0207652_10095574 Ga0207652_100955743 240
718 3300025921 Ga0207652_10612319 Ga0207652_106123192 240
719 3300025923 Ga0207681_10000144 Ga0207681_1000014426 240
720 3300025923 Ga0207681_10133717 Ga0207681_101337172 240
721 3300025925 Ga0207650_10268151 Ga0207650_102681512 240
722 3300025931 Ga0207644_10123750 Ga0207644_101237503 240
723 3300025931 Ga0207644_10174712 Ga0207644_101747122 240
724 3300025932 Ga0207690_10001516 Ga0207690_100015164 240
725 3300025932 Ga0207690_10228960 Ga0207690_102289602 240
726 3300025933 Ga0207706_10030470 Ga0207706_100304706 240
727 3300025933 Ga0207706_10048453 Ga0207706_100484533 240
728 3300025940 Ga0207691_10268079 Ga0207691_102680792 240
729 3300025944 Ga0207661_10032877 Ga0207661_100328771 240
730 3300025945 Ga0207679_10053837 Ga0207679_100538373 240
731 3300025949 Ga0207667_10000001 Ga0207667_100000011028 240
732 3300025949 Ga0207667_10043432 Ga0207667_100434326 240
733 3300025949 Ga0207667_10105863 Ga0207667_101058632 240
734 3300025961 Ga0207712_10071925 Ga0207712_100719253 240
735 3300025981 Ga0207640_10004898 Ga0207640_100048983 240
736 3300025981 Ga0207640_10070550 Ga0207640_100705502 240
737 3300025986 Ga0207658_10000216 Ga0207658_1000021618 240
738 3300026041 Ga0207639_10041254 Ga0207639_100412542 240
739 3300026041 Ga0207639_10182258 Ga0207639_101822582 240
740 3300026067 Ga0207678_10013240 Ga0207678_100132403 240
741 3300026067 Ga0207678_10091516 Ga0207678_100915163 240
742 3300026078 Ga0207702_10041221 Ga0207702_100412212 240
743 3300026088 Ga0207641_10089951 Ga0207641_100899513 240
744 3300026116 Ga0207674_10016564 Ga0207674_100165643 240
745 3300026116 Ga0207674_10124747 Ga0207674_101247472 240
746 3300026142 Ga0207698_10788321 Ga0207698_107883212 240
747 3300028379 Ga0268266_10000130 Ga0268266_1000013087 240
748 3300028379 Ga0268266_10002447 Ga0268266_1000244714 240
749 3300028379 Ga0268266_10416723 Ga0268266_104167232 240
750 3300030731 Ga0316177_1051669 Ga0316177_10516692 240
751 3300031548 Ga0307408_100055244 Ga0307408_1000552442 240
752 3300031548 Ga0307408_100078202 Ga0307408_1000782022 240
753 3300031548 Ga0307408_100150390 Ga0307408_1001503902 240
754 3300031548 Ga0307408_100575655 Ga0307408_1005756552 240
755 3300031731 Ga0307405_10003177 Ga0307405_100031778 240
756 3300031824 Ga0307413_10009668 Ga0307413_100096685 240
757 3300031824 Ga0307413_10327094 Ga0307413_103270941 240
758 3300031852 Ga0307410_10005363 Ga0307410_100053636 240
759 3300031852 Ga0307410_10096682 Ga0307410_100966823 240
760 3300031852 Ga0307410_10120342 Ga0307410_101203422 240
761 3300031903 Ga0307407_10208043 Ga0307407_102080432 240
762 3300031911 Ga0307412_10005327 Ga0307412_100053278 240
763 3300031995 Ga0307409_100231919 Ga0307409_1002319192 240
764 3300031995 Ga0307409_100331238 Ga0307409_1003312381 240
765 3300032002 Ga0307416_100370836 Ga0307416_1003708361 240
766 3300032002 Ga0307416_100451249 Ga0307416_1004512491 240
767 3300032004 Ga0307414_10103634 Ga0307414_101036342 240
768 3300032004 Ga0307414_10467753 Ga0307414_104677532 240
769 3300032005 Ga0307411_10074514 Ga0307411_100745142 240
770 3300032005 Ga0307411_10234898 Ga0307411_102348982 240
771 3300032133 Ga0316583_10007557 Ga0316583_100075572 240
772 3300035242 Ga0373962_0068779 Ga0373962_0068779_62_802 240
773 3300035691 Ga0373931_0003323 Ga0373931_0003323_5050_5790 240
774 3300036647 Ga0316582_0030777 Ga0316582_0030777_1020_1775 240
775 3300036712 Ga0316584_0345309 Ga0316584_0345309_301_1056 240
776 3300036712 Ga0316584_0556861 Ga0316584_0556861_25_771 240
777 3300042015 Ga0439462_0000552 Ga0439462_0000552_112_837 240
778 3300046530 Ga0495654_0074574 Ga0495654_0074574_575_1321 240
779 3300048903 Ga0496100_0002118 Ga0496100_0002118_7181_7963 240
780 3300048905 Ga0496102_0001244 Ga0496102_0001244_5357_6139 240
781 3300048906 Ga0496103_0000648 Ga0496103_0000648_5352_6134 240
782 3300048907 Ga0496104_0000882 Ga0496104_0000882_883_1665 240
783 3300048908 Ga0496105_0000447 Ga0496105_0000447_20408_21190 240
784 3300048913 Ga0496110_0583010 Ga0496110_0583010_214_1005 240
785 3300048914 Ga0496111_0054137 Ga0496111_0054137_307_1086 240
786 3300048915 Ga0496112_0014916 Ga0496112_0014916_6115_6897 240
787 3300048916 Ga0496113_0000442 Ga0496113_0000442_18978_19760 240
788 3300048920 Ga0496117_0000566 Ga0496117_0000566_2315_3097 240
789 3300048921 Ga0496118_0009583 Ga0496118_0009583_3613_4392 240
790 3300048921 Ga0496118_0016400 Ga0496118_0016400_5879_6646 240
791 3300048922 Ga0496119_0002088 Ga0496119_0002088_20316_21098 240
792 3300048923 Ga0496120_0001454 Ga0496120_0001454_7157_7939 240
793 3300048924 Ga0496121_0001144 Ga0496121_0001144_12416_13183 240
794 3300048924 Ga0496121_0022572 Ga0496121_0022572_4102_4884 240
795 3300048925 Ga0496122_0003064 Ga0496122_0003064_20488_21270 240
796 3300048926 Ga0496123_0002028 Ga0496123_0002028_1209_1991 240
797 3300048927 Ga0496124_0008780 Ga0496124_0008780_8504_9283 240
798 3300048928 Ga0496125_0009478 Ga0496125_0009478_1209_1991 240
799 3300048929 Ga0496126_0000158 Ga0496126_0000158_20275_21057 240
800 3300049459 Ga0495678_027194 Ga0495678_027194_641_1492 240
801 3300049570 Ga0501033_0340072 Ga0501033_0340072_192_929 240
802 3300049571 Ga0501034_0079638 Ga0501034_0079638_2388_3125 240
803 3300049571 Ga0501034_0555334 Ga0501034_0555334_212_958 240
804 3300049572 Ga0501036_0151941 Ga0501036_0151941_756_1493 240
805 3300049573 Ga0501037_0099976 Ga0501037_0099976_844_1581 240
806 3300049581 Ga0501047_0241651 Ga0501047_0241651_297_1034 240
807 3300049581 Ga0501047_0305110 Ga0501047_0305110_552_1304 240
808 3300049742 Ga0501080_0604152 Ga0501080_0604152_75_812 240
809 3300049822 Ga0501035_0376890 Ga0501035_0376890_216_956 240
810 3300049823 Ga0501044_0237619 Ga0501044_0237619_747_1487 240
811 3300049823 Ga0501044_0338903 Ga0501044_0338903_115_861 240
812 3300050489 nmdc:mga03683_52_c1 nmdc:mga03683_52_c1_32814_33554 240
813 3300050490 nmdc:mga03n38_1944_c1 nmdc:mga03n38_1944_c1_2266_3006 240
814 3300050491 nmdc:mga00v17_205795_c1 nmdc:mga00v17_205795_c1_243_983 240
815 3300050493 nmdc:mga0k408_12_c1 nmdc:mga0k408_12_c1_123400_124140 240
816 3300050496 nmdc:mga07m45_11_c1 nmdc:mga07m45_11_c1_36147_36887 240
817 3300050512 nmdc:mga0n895_28520_c1 nmdc:mga0n895_28520_c1_3144_3896 240
818 3300050516 nmdc:mga0sz30_1423_c1 nmdc:mga0sz30_1423_c1_482_1222 240
819 3300053118 Ga0500594_0027135 Ga0500594_0027135_299_1045 240
820 3300053122 Ga0500608_000042 Ga0500608_000042_15644_16390 240
821 3300053136 Ga0500559_0027208 Ga0500559_0027208_1306_2046 240
822 3300053136 Ga0500559_0135001 Ga0500559_0135001_143_889 240
823 3300053138 Ga0500564_005997 Ga0500564_005997_3994_4740 240
824 3300053723 Ga0500567_000588 Ga0500567_000588_6119_6865 240
825 3300053729 Ga0500625_000157 Ga0500625_000157_6154_6900 240
826 2162886007 SwRhRL2b_contig_2752641 SwRhRL2b_0809.00003280 241
827 3300005289 Ga0065704_10173451 Ga0065704_101734512 241
828 3300005327 Ga0070658_10000003 Ga0070658_10000003247 241
829 3300005327 Ga0070658_10000167 Ga0070658_1000016722 241
830 3300005333 Ga0070677_10000114 Ga0070677_1000011426 241
831 3300005339 Ga0070660_100001813 Ga0070660_1000018133 241
832 3300005339 Ga0070660_100007024 Ga0070660_1000070247 241
833 3300005345 Ga0070692_10000469 Ga0070692_100004692 241
834 3300005347 Ga0070668_100010145 Ga0070668_1000101454 241
835 3300005353 Ga0070669_100002467 Ga0070669_10000246714 241
836 3300005354 Ga0070675_100142897 Ga0070675_1001428973 241
837 3300005366 Ga0070659_100000005 Ga0070659_100000005166 241
838 3300005366 Ga0070659_100157208 Ga0070659_1001572083 241
839 3300005367 Ga0070667_100049302 Ga0070667_1000493023 241
840 3300005539 Ga0068853_100455372 Ga0068853_1004553721 241
841 3300005548 Ga0070665_100003938 Ga0070665_10000393814 241
842 3300005564 Ga0070664_100611300 Ga0070664_1006113001 241
843 3300005578 Ga0068854_100001399 Ga0068854_1000013995 241
844 3300005578 Ga0068854_100215264 Ga0068854_1002152642 241
845 3300005614 Ga0068856_100369712 Ga0068856_1003697121 241
846 3300005616 Ga0068852_100000919 Ga0068852_10000091912 241
847 3300005616 Ga0068852_100264633 Ga0068852_1002646332 241
848 3300005841 Ga0068863_100039107 Ga0068863_1000391075 241
849 3300006058 Ga0075432_10002220 Ga0075432_100022208 241
850 3300006186 Ga0075369_10040936 Ga0075369_100409362 241
851 3300006353 Ga0075370_10002340 Ga0075370_1000234018 241
852 3300009011 Ga0105251_10000276 Ga0105251_1000027633 241
853 3300009093 Ga0105240_10252079 Ga0105240_102520792 241
854 3300009177 Ga0105248_10026581 Ga0105248_100265816 241
855 3300009545 Ga0105237_10512954 Ga0105237_105129542 241
856 3300013105 Ga0157369_10167954 Ga0157369_101679542 241
857 3300021358 Ga0213873_10000026 Ga0213873_1000002611 241
858 3300021384 Ga0213876_10000149 Ga0213876_1000014965 241
859 3300021384 Ga0213876_10000371 Ga0213876_1000037141 241
860 3300025735 Ga0207713_1002506 Ga0207713_10025068 241
861 3300025893 Ga0207682_10002396 Ga0207682_100023966 241
862 3300025904 Ga0207647_10040920 Ga0207647_100409202 241
863 3300025904 Ga0207647_10169648 Ga0207647_101696482 241
864 3300025909 Ga0207705_10000004 Ga0207705_10000004229 241
865 3300025909 Ga0207705_10000005 Ga0207705_10000005249 241
866 3300025913 Ga0207695_10028019 Ga0207695_100280195 241
867 3300025919 Ga0207657_10003198 Ga0207657_1000319810 241
868 3300025919 Ga0207657_10008473 Ga0207657_100084734 241
869 3300025923 Ga0207681_10003059 Ga0207681_100030598 241
870 3300025926 Ga0207659_10115202 Ga0207659_101152022 241
871 3300025931 Ga0207644_10000367 Ga0207644_1000036724 241
872 3300025932 Ga0207690_10000002 Ga0207690_10000002811 241
873 3300025932 Ga0207690_10022186 Ga0207690_100221863 241
874 3300025941 Ga0207711_10021765 Ga0207711_100217652 241
875 3300025981 Ga0207640_10007874 Ga0207640_100078744 241
876 3300025981 Ga0207640_10092308 Ga0207640_100923082 241
877 3300025986 Ga0207658_10003041 Ga0207658_100030412 241
878 3300026023 Ga0207677_10000100 Ga0207677_1000010012 241
879 3300026035 Ga0207703_10105257 Ga0207703_101052572 241
880 3300026041 Ga0207639_10287754 Ga0207639_102877542 241
881 3300026078 Ga0207702_10187154 Ga0207702_101871543 241
882 3300026088 Ga0207641_10004669 Ga0207641_100046694 241
883 3300026142 Ga0207698_10000019 Ga0207698_1000001928 241
884 3300027907 Ga0207428_10069745 Ga0207428_100697451 241
885 3300028379 Ga0268266_10001691 Ga0268266_1000169115 241
886 3300028379 Ga0268266_10002428 Ga0268266_1000242822 241
887 3300028380 Ga0268265_10273429 Ga0268265_102734292 241
888 3300028381 Ga0268264_10007758 Ga0268264_100077588 241
889 3300028381 Ga0268264_10046311 Ga0268264_100463112 241
890 3300031616 Ga0307508_10218068 Ga0307508_102180682 241
891 3300039437 Ga0436365_0083543 Ga0436365_0083543_17540_18295 241
892 3300039437 Ga0436365_0124207 Ga0436365_0124207_35050_35832 241
893 3300039437 Ga0436365_0922968 Ga0436365_0922968_805_1620 241
894 3300039437 Ga0436365_1272877 Ga0436365_1272877_271_1026 241
895 3300039450 Ga0436363_0832933 Ga0436363_0832933_232_987 241
896 3300039453 Ga0436362_0376260 Ga0436362_0376260_8384_9166 241
897 3300046460 Ga0495638_0046222 Ga0495638_0046222_257_1099 241
898 3300046530 Ga0495654_0061539 Ga0495654_0061539_480_1322 241
899 3300046616 Ga0495668_0087011 Ga0495668_0087011_708_1472 241
900 3300046660 Ga0495625_0047750 Ga0495625_0047750_1900_2742 241
901 3300047673 Ga0495593_0198735 Ga0495593_0198735_147_989 241
902 3300048906 Ga0496103_0001474 Ga0496103_0001474_10795_11529 241
903 3300048920 Ga0496117_0090680 Ga0496117_0090680_299_1033 241
904 3300048921 Ga0496118_0019153 Ga0496118_0019153_3244_3978 241
905 3300048924 Ga0496121_0014109 Ga0496121_0014109_5602_6336 241
906 3300048925 Ga0496122_0066300 Ga0496122_0066300_739_1473 241
907 3300048926 Ga0496123_0173308 Ga0496123_0173308_347_1108 241
908 3300048927 Ga0496124_0105055 Ga0496124_0105055_917_1678 241
909 3300048927 Ga0496124_0118901 Ga0496124_0118901_342_1076 241
910 3300048928 Ga0496125_0062742 Ga0496125_0062742_687_1451 241
911 3300048928 Ga0496125_0066007 Ga0496125_0066007_630_1364 241
912 3300050489 nmdc:mga03683_757_c1 nmdc:mga03683_757_c1_50_799 241
913 3300050496 nmdc:mga07m45_9729_c1 nmdc:mga07m45_9729_c1_319_1164 241
914 3300050516 nmdc:mga0sz30_39425_c1 nmdc:mga0sz30_39425_c1_549_1298 241
915 3300053087 Ga0500643_007423 Ga0500643_007423_2328_3170 241
916 3300053119 Ga0500595_050618 Ga0500595_050618_54_896 241
917 3300053148 Ga0500590_102144 Ga0500590_102144_391_1140 241
918 3300053151 Ga0500604_0000108 Ga0500604_0000108_3382_4140 241
919 3300053153 Ga0500616_0000161 Ga0500616_0000161_92281_93039 241
920 3300053156 Ga0500622_0011523 Ga0500622_0011523_2749_3591 241
921 3300005355 Ga0070671_100129126 Ga0070671_1001291262 242
922 3300005367 Ga0070667_100313234 Ga0070667_1003132341 242
923 3300005563 Ga0068855_100039611 Ga0068855_1000396115 242
924 3300005563 Ga0068855_100188948 Ga0068855_1001889482 242
925 3300005578 Ga0068854_100173017 Ga0068854_1001730172 242
926 3300005616 Ga0068852_100050975 Ga0068852_1000509754 242
927 3300005617 Ga0068859_100033051 Ga0068859_1000330515 242
928 3300005842 Ga0068858_100027896 Ga0068858_1000278966 242
929 3300006931 Ga0097620_100033051 Ga0097620_1000330513 242
930 3300025903 Ga0207680_10092063 Ga0207680_100920632 242
931 3300025913 Ga0207695_10013603 Ga0207695_100136035 242
932 3300025931 Ga0207644_10097687 Ga0207644_100976872 242
933 3300025949 Ga0207667_10009256 Ga0207667_1000925610 242
934 3300025949 Ga0207667_10484163 Ga0207667_104841632 242
935 3300025972 Ga0207668_10171525 Ga0207668_101715252 242
936 3300025981 Ga0207640_10038253 Ga0207640_100382532 242
937 3300026035 Ga0207703_10019876 Ga0207703_100198762 242
938 3300026142 Ga0207698_10041197 Ga0207698_100411973 242
939 3300046616 Ga0495668_0031988 Ga0495668_0031988_942_1733 242
940 3300048912 Ga0496109_0537217 Ga0496109_0537217_234_995 242
941 3300048914 Ga0496111_0020176 Ga0496111_0020176_2794_3555 242
942 3300048917 Ga0496114_0023598 Ga0496114_0023598_615_1376 242
943 3300048929 Ga0496126_0018513 Ga0496126_0018513_4854_5615 242
944 3300053136 Ga0500559_0001036 Ga0500559_0001036_11086_11865 242
945 3300053151 Ga0500604_0004017 Ga0500604_0004017_1026_1817 242
946 3300055283 Ga0500661_013092 Ga0500661_013092_597_1376 242
947 3300005841 Ga0068863_100006943 Ga0068863_1000069435 243
948 3300005844 Ga0068862_100000191 Ga0068862_10000019124 243
949 3300006931 Ga0097620_100023748 Ga0097620_1000237486 243
950 3300009553 Ga0105249_10002820 Ga0105249_100028208 243
951 3300009553 Ga0105249_10007484 Ga0105249_100074844 243
952 3300013306 Ga0163162_10000232 Ga0163162_1000023252 243
953 3300013306 Ga0163162_10002528 Ga0163162_100025282 243
954 3300014325 Ga0163163_10028485 Ga0163163_100284852 243
955 3300025961 Ga0207712_10001292 Ga0207712_1000129210 243
956 3300026088 Ga0207641_10004972 Ga0207641_100049724 243
957 3300028380 Ga0268265_10000271 Ga0268265_1000027134 243
958 3300028381 Ga0268264_10008451 Ga0268264_100084513 243
959 3300031456 Ga0307513_10132909 Ga0307513_101329092 243
960 3300046460 Ga0495638_0016810 Ga0495638_0016810_2780_3595 243
961 3300032004 Ga0307414_10628695 Ga0307414_106286951 244
962 3300046512 Ga0495610_0000083 Ga0495610_0000083_40153_41019 244
963 3300046519 Ga0495632_0052897 Ga0495632_0052897_278_1144 244
964 3300046665 Ga0495661_0027151 Ga0495661_0027151_2634_3500 244
965 3300047470 Ga0495681_0000036 Ga0495681_0000036_108645_109511 244
966 3300032126 Ga0307415_100315582 Ga0307415_1003155822 245
967 2162886007 SwRhRL2b_contig_1117632 SwRhRL2b_0318.00000820 246
968 3300005289 Ga0065704_10129257 Ga0065704_101292572 246
969 3300032005 Ga0307411_10299278 Ga0307411_102992782 246
970 3300046539 Ga0495621_0004419 Ga0495621_0004419_2991_3821 246
971 3300048090 Ga0495615_0001607 Ga0495615_0001607_1120_1950 246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

70

218

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8w6j-assembly1.cif.gz_B cryo-em structure of escherichia coli str k12 ftse(e163q)x/envc complex with atp in peptidisc 0.9569 15 230
7v8i-assembly1.cif.gz_F lolcd(e171q)e with bound amppnp in nanodiscs 0.9544 13 230
6cvl-assembly1.cif.gz_D crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein 0.954 14 229
6cvl-assembly1.cif.gz_C crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein 0.9494 14 229
8w6j-assembly1.cif.gz_B cryo-em structure of escherichia coli str k12 ftse(e163q)x/envc complex with atp in peptidisc 0.9483 15 230
ID Description Score Start End Superfamily
af_P16679_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9363 15 224 3.40.50.300
af_P0A9R7_1_220_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.932 15 230 3.40.50.300
af_Q55EH8_3_247_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9252 13 229 3.40.50.300
af_Q9VRG3_1356_1574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9245 13 231 3.40.50.300
af_A4HRM7_2286_2560_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9232 13 230 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2E0G8E7-F1-model_v4 Cell division ATP-binding protein FtsE 0.9834 13 230 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0051301
AF-A0A2H0MND8-F1-model_v4 ABC transporter ATP-binding protein 0.9512 13 229 GO:0005524
GO:0016887
AF-A0A1M6SP75-F1-model_v4 Putative ABC transport system ATP-binding protein 0.9499 13 231 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A2E0G8E7-F1-model_v4 Cell division ATP-binding protein FtsE 0.9489 13 230 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0051301
AF-A0A037US35-F1-model_v4 deleted 0.9438 13 224

Feature Viewer

pLDDT pTM Quality
84.5 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map