F487048
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 968 | 404 | 1936 | 121 |
Family's Representative Sequence
| Representative Sequence | 3300035113|Ga0373936_0001882|Ga0373936_0001882_3353_3808 |
| Length | 146 |
| Sequence | VPASSEQGPKTFPASRDNRRESGNKKREQHMPRVKRGTKKKILERASGYFLTKSKLYRAAKESVERGLKFAYSGRKQKKRQYRSIWIVRIGAASRAQGISYNQFISGLKKAGVELDRKILADIATNDSAGFIALCETAKRANSKAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 9 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 10 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 11 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 12 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 87 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 100 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 115 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 116 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 127 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 137 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 143 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 144 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 145 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 147 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 148 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 220 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 229 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 230 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 231 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 232 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 233 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 234 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 235 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 236 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 237 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 238 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 239 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 240 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 241 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 242 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 243 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 244 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 245 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 246 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 247 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 248 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 249 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 250 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 251 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 252 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 253 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 254 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 255 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 256 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 257 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 258 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 260 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 261 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 264 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 265 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 266 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 267 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 268 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 272 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 273 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 274 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 275 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 276 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 277 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 278 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 279 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 280 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 281 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 282 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 283 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 284 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 285 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 286 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 287 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 288 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 289 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 290 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 340 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 341 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 342 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 343 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 344 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 345 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 348 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 349 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 350 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 351 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 352 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 353 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 354 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 357 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 358 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 363 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 364 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 365 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 366 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 367 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 368 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 369 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 376 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 377 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 378 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 379 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.39 |
| Metatranscriptomes | 6.61 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.52 |
| Nodule | 0 |
| Rhizoplane | 5.89 |
| Rhizosphere | 92.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373936_0001882 | 3300035113 | Bacteria | 7748 |
| 2 | MBSR1b_contig_6423676 | 2162886012 | Unclassified | 979 |
| 3 | LJNas_1004295 | 3300000546 | Bacteria | 1584 |
| 4 | JGI24752J21851_1006989 | 3300001976 | Bacteria | 1474 |
| 5 | JGI24747J21853_1000334 | 3300001978 | Unclassified | 2732 |
| 6 | JGI24740J21852_10163331 | 3300001979 | Unclassified | 552 |
| 7 | JGI24737J22298_10057670 | 3300001990 | Unclassified | 1172 |
| 8 | JGI24743J22301_10004884 | 3300001991 | Bacteria | 2209 |
| 9 | JGI24748J21848_1003696 | 3300002074 | Bacteria | 1748 |
| 10 | JGI24034J26672_10000300 | 3300002239 | Bacteria | 6538 |
| 11 | JGI24751J29686_10022314 | 3300002459 | Bacteria | 1313 |
| 12 | Ga0058863_11849724 | 3300004799 | Bacteria | 768 |
| 13 | Ga0058861_10039244 | 3300004800 | Unclassified | 738 |
| 14 | Ga0058861_11331319 | 3300004800 | Bacteria | 843 |
| 15 | Ga0058862_10027191 | 3300004803 | Bacteria | 2039 |
| 16 | Ga0058862_12865494 | 3300004803 | Bacteria | 732 |
| 17 | Ga0065712_10002796 | 3300005290 | Bacteria | 5908 |
| 18 | Ga0065715_10014238 | 3300005293 | Bacteria | 3019 |
| 19 | Ga0070658_10030803 | 3300005327 | Bacteria | 4309 |
| 20 | Ga0070658_10081977 | 3300005327 | Bacteria | 2650 |
| 21 | Ga0070658_10161650 | 3300005327 | Bacteria | 1879 |
| 22 | Ga0070658_10777073 | 3300005327 | Bacteria | 832 |
| 23 | Ga0070676_10003407 | 3300005328 | Bacteria | 8277 |
| 24 | Ga0070676_10032048 | 3300005328 | Bacteria | 3008 |
| 25 | Ga0070676_10629736 | 3300005328 | Unclassified | 776 |
| 26 | Ga0070683_100002453 | 3300005329 | Bacteria | 14754 |
| 27 | Ga0070683_100303138 | 3300005329 | Bacteria | 1520 |
| 28 | Ga0070683_100466988 | 3300005329 | Bacteria | 1205 |
| 29 | Ga0070683_101029858 | 3300005329 | Bacteria | 790 |
| 30 | Ga0070690_100235094 | 3300005330 | Bacteria | 1290 |
| 31 | Ga0070690_101076658 | 3300005330 | Bacteria | 637 |
| 32 | Ga0070670_100005793 | 3300005331 | Bacteria | 10441 |
| 33 | Ga0070677_10007787 | 3300005333 | Bacteria | 3588 |
| 34 | Ga0068869_100010958 | 3300005334 | Bacteria | 5935 |
| 35 | Ga0068869_100040153 | 3300005334 | Unclassified | 3345 |
| 36 | Ga0068869_100867264 | 3300005334 | Bacteria | 779 |
| 37 | Ga0070666_10013820 | 3300005335 | Bacteria | 5130 |
| 38 | Ga0070666_10285489 | 3300005335 | Bacteria | 1174 |
| 39 | Ga0070666_10426632 | 3300005335 | Bacteria | 956 |
| 40 | Ga0070680_100181803 | 3300005336 | Bacteria | 1771 |
| 41 | Ga0070680_100217906 | 3300005336 | Bacteria | 1610 |
| 42 | Ga0070680_100323947 | 3300005336 | Unclassified | 1308 |
| 43 | Ga0070680_100558249 | 3300005336 | Bacteria | 982 |
| 44 | Ga0070680_100646764 | 3300005336 | Bacteria | 909 |
| 45 | Ga0070682_100715102 | 3300005337 | Bacteria | 805 |
| 46 | Ga0068868_100006740 | 3300005338 | Bacteria | 8156 |
| 47 | Ga0068868_100043782 | 3300005338 | Bacteria | 3497 |
| 48 | Ga0068868_100106212 | 3300005338 | Bacteria | 2277 |
| 49 | Ga0068868_100166842 | 3300005338 | Bacteria | 1821 |
| 50 | Ga0068868_100206219 | 3300005338 | Bacteria | 1641 |
| 51 | Ga0070660_100001122 | 3300005339 | Bacteria | 18053 |
| 52 | Ga0070660_100088455 | 3300005339 | Bacteria | 2439 |
| 53 | Ga0070689_100201215 | 3300005340 | Bacteria | 1626 |
| 54 | Ga0070691_10893583 | 3300005341 | Bacteria | 547 |
| 55 | Ga0070687_100019471 | 3300005343 | Unclassified | 3158 |
| 56 | Ga0070661_100000564 | 3300005344 | Bacteria | 28146 |
| 57 | Ga0070668_100001144 | 3300005347 | Bacteria | 18673 |
| 58 | Ga0070668_100144757 | 3300005347 | Bacteria | 1917 |
| 59 | Ga0070669_101679109 | 3300005353 | Unclassified | 553 |
| 60 | Ga0070675_100184220 | 3300005354 | Bacteria | 1806 |
| 61 | Ga0070671_100075918 | 3300005355 | Bacteria | 2807 |
| 62 | Ga0070671_100549278 | 3300005355 | Bacteria | 996 |
| 63 | Ga0070671_100625169 | 3300005355 | Unclassified | 931 |
| 64 | Ga0070674_100002008 | 3300005356 | Bacteria | 11143 |
| 65 | Ga0070673_100930541 | 3300005364 | Unclassified | 807 |
| 66 | Ga0070688_100019665 | 3300005365 | Bacteria | 3915 |
| 67 | Ga0070659_100005729 | 3300005366 | Bacteria | 8945 |
| 68 | Ga0070659_100427721 | 3300005366 | Bacteria | 1120 |
| 69 | Ga0070659_100797223 | 3300005366 | Bacteria | 821 |
| 70 | Ga0070667_100114921 | 3300005367 | Bacteria | 2337 |
| 71 | Ga0070667_100150403 | 3300005367 | Bacteria | 2045 |
| 72 | Ga0070667_100295138 | 3300005367 | Bacteria | 1458 |
| 73 | Ga0070709_10009431 | 3300005434 | Bacteria | 5386 |
| 74 | Ga0070709_10147042 | 3300005434 | Bacteria | 1625 |
| 75 | Ga0070709_10194794 | 3300005434 | Bacteria | 1432 |
| 76 | Ga0070709_10245832 | 3300005434 | Bacteria | 1287 |
| 77 | Ga0070709_11125741 | 3300005434 | Bacteria | 629 |
| 78 | Ga0070709_11276291 | 3300005434 | Bacteria | 592 |
| 79 | Ga0070714_100026290 | 3300005435 | Bacteria | 4809 |
| 80 | Ga0070714_100087113 | 3300005435 | Bacteria | 2731 |
| 81 | Ga0070714_100178408 | 3300005435 | Bacteria | 1931 |
| 82 | Ga0070714_100445325 | 3300005435 | Unclassified | 1230 |
| 83 | Ga0070714_100536299 | 3300005435 | Bacteria | 1119 |
| 84 | Ga0070714_100642940 | 3300005435 | Bacteria | 1021 |
| 85 | Ga0070714_100675281 | 3300005435 | Bacteria | 996 |
| 86 | Ga0070714_101776354 | 3300005435 | Bacteria | 602 |
| 87 | Ga0070714_102084559 | 3300005435 | Unclassified | 553 |
| 88 | Ga0070713_100000210 | 3300005436 | Bacteria | 38839 |
| 89 | Ga0070713_100086548 | 3300005436 | Bacteria | 2687 |
| 90 | Ga0070713_100160369 | 3300005436 | Bacteria | 2007 |
| 91 | Ga0070713_100377029 | 3300005436 | Bacteria | 1321 |
| 92 | Ga0070713_100489303 | 3300005436 | Bacteria | 1160 |
| 93 | Ga0070713_100603795 | 3300005436 | Bacteria | 1043 |
| 94 | Ga0070713_100884580 | 3300005436 | Bacteria | 859 |
| 95 | Ga0070713_100922096 | 3300005436 | Bacteria | 841 |
| 96 | Ga0070713_100948697 | 3300005436 | Bacteria | 828 |
| 97 | Ga0070713_101153181 | 3300005436 | Bacteria | 750 |
| 98 | Ga0070710_10018125 | 3300005437 | Bacteria | 3617 |
| 99 | Ga0070710_10493877 | 3300005437 | Bacteria | 837 |
| 100 | Ga0070710_10631741 | 3300005437 | Unclassified | 749 |
| 101 | Ga0070701_10040945 | 3300005438 | Unclassified | 2358 |
| 102 | Ga0070711_100294731 | 3300005439 | Bacteria | 1288 |
| 103 | Ga0070711_100570637 | 3300005439 | Bacteria | 941 |
| 104 | Ga0070711_100700850 | 3300005439 | Bacteria | 852 |
| 105 | Ga0070711_101470826 | 3300005439 | Bacteria | 594 |
| 106 | Ga0070700_100327769 | 3300005441 | Unclassified | 1127 |
| 107 | Ga0070708_100044284 | 3300005445 | Bacteria | 3913 |
| 108 | Ga0070708_100066850 | 3300005445 | Unclassified | 3226 |
| 109 | Ga0070708_101804364 | 3300005445 | Bacteria | 568 |
| 110 | Ga0070708_102105060 | 3300005445 | Unclassified | 522 |
| 111 | Ga0070663_100002461 | 3300005455 | Bacteria | 10439 |
| 112 | Ga0070663_101430017 | 3300005455 | Bacteria | 613 |
| 113 | Ga0070678_100912489 | 3300005456 | Bacteria | 803 |
| 114 | Ga0070662_100015050 | 3300005457 | Bacteria | 5175 |
| 115 | Ga0070662_100041714 | 3300005457 | Bacteria | 3275 |
| 116 | Ga0070681_10026540 | 3300005458 | Bacteria | 5822 |
| 117 | Ga0070681_10034026 | 3300005458 | Bacteria | 5118 |
| 118 | Ga0070681_10102481 | 3300005458 | Bacteria | 2807 |
| 119 | Ga0070681_10917154 | 3300005458 | Bacteria | 795 |
| 120 | Ga0068867_100001261 | 3300005459 | Bacteria | 17470 |
| 121 | Ga0068867_100740585 | 3300005459 | Bacteria | 871 |
| 122 | Ga0070685_10021659 | 3300005466 | Unclassified | 3496 |
| 123 | Ga0070685_10168872 | 3300005466 | Bacteria | 1400 |
| 124 | Ga0070685_10759406 | 3300005466 | Unclassified | 712 |
| 125 | Ga0070706_100172653 | 3300005467 | Bacteria | 2018 |
| 126 | Ga0070706_100183206 | 3300005467 | Bacteria | 1956 |
| 127 | Ga0070707_100133174 | 3300005468 | Bacteria | 2417 |
| 128 | Ga0070707_100397400 | 3300005468 | Bacteria | 1338 |
| 129 | Ga0070698_100044545 | 3300005471 | Bacteria | 4543 |
| 130 | Ga0070698_100506137 | 3300005471 | Unclassified | 1146 |
| 131 | Ga0070699_100040014 | 3300005518 | Bacteria | 4060 |
| 132 | Ga0070699_100114726 | 3300005518 | Bacteria | 2367 |
| 133 | Ga0070699_100359343 | 3300005518 | Bacteria | 1313 |
| 134 | Ga0070679_100018174 | 3300005530 | Bacteria | 6817 |
| 135 | Ga0070679_100080687 | 3300005530 | Bacteria | 3243 |
| 136 | Ga0070679_100204106 | 3300005530 | Bacteria | 1941 |
| 137 | Ga0070679_100377190 | 3300005530 | Unclassified | 1365 |
| 138 | Ga0070679_100871879 | 3300005530 | Bacteria | 844 |
| 139 | Ga0070684_100005354 | 3300005535 | Bacteria | 9833 |
| 140 | Ga0070684_100012659 | 3300005535 | Bacteria | 6767 |
| 141 | Ga0070697_100177375 | 3300005536 | Bacteria | 1805 |
| 142 | Ga0070697_100669477 | 3300005536 | Bacteria | 915 |
| 143 | Ga0070697_100970793 | 3300005536 | Bacteria | 755 |
| 144 | Ga0068853_100033720 | 3300005539 | Bacteria | 4344 |
| 145 | Ga0068853_100096611 | 3300005539 | Bacteria | 2607 |
| 146 | Ga0068853_100476407 | 3300005539 | Bacteria | 1176 |
| 147 | Ga0068853_100987020 | 3300005539 | Bacteria | 810 |
| 148 | Ga0070672_100005865 | 3300005543 | Bacteria | 8192 |
| 149 | Ga0070672_100657684 | 3300005543 | Bacteria | 915 |
| 150 | Ga0070695_100291544 | 3300005545 | Unclassified | 1203 |
| 151 | Ga0070696_100026277 | 3300005546 | Bacteria | 3961 |
| 152 | Ga0070696_100685307 | 3300005546 | Bacteria | 834 |
| 153 | Ga0070693_100111078 | 3300005547 | Bacteria | 1686 |
| 154 | Ga0070693_100380756 | 3300005547 | Bacteria | 973 |
| 155 | Ga0070693_100645455 | 3300005547 | Bacteria | 769 |
| 156 | Ga0070665_100184106 | 3300005548 | Bacteria | 2089 |
| 157 | Ga0070665_100330253 | 3300005548 | Bacteria | 1529 |
| 158 | Ga0070665_101094261 | 3300005548 | Bacteria | 808 |
| 159 | Ga0068855_100014420 | 3300005563 | Bacteria | 9514 |
| 160 | Ga0068855_100155676 | 3300005563 | Bacteria | 2596 |
| 161 | Ga0068855_100188661 | 3300005563 | Bacteria | 2326 |
| 162 | Ga0068855_102261250 | 3300005563 | Bacteria | 545 |
| 163 | Ga0070664_100017825 | 3300005564 | Bacteria | 5831 |
| 164 | Ga0070664_100723414 | 3300005564 | Bacteria | 928 |
| 165 | Ga0068857_100001804 | 3300005577 | Bacteria | 17223 |
| 166 | Ga0068857_100628756 | 3300005577 | Bacteria | 1016 |
| 167 | Ga0068854_100011944 | 3300005578 | Bacteria | 5675 |
| 168 | Ga0068854_100055189 | 3300005578 | Bacteria | 2859 |
| 169 | Ga0068854_100091633 | 3300005578 | Bacteria | 2263 |
| 170 | Ga0068854_100368744 | 3300005578 | Bacteria | 1180 |
| 171 | Ga0068854_100457445 | 3300005578 | Bacteria | 1067 |
| 172 | Ga0068856_100019441 | 3300005614 | Bacteria | 6592 |
| 173 | Ga0068856_100129767 | 3300005614 | Bacteria | 2525 |
| 174 | Ga0068856_100332771 | 3300005614 | Bacteria | 1536 |
| 175 | Ga0070702_100010582 | 3300005615 | Bacteria | 4551 |
| 176 | Ga0068852_100012326 | 3300005616 | Bacteria | 6485 |
| 177 | Ga0068852_100013526 | 3300005616 | Bacteria | 6245 |
| 178 | Ga0068852_100067475 | 3300005616 | Bacteria | 3127 |
| 179 | Ga0068852_100590189 | 3300005616 | Bacteria | 1114 |
| 180 | Ga0068852_100654167 | 3300005616 | Bacteria | 1059 |
| 181 | Ga0068852_101708501 | 3300005616 | Bacteria | 652 |
| 182 | Ga0068859_100046420 | 3300005617 | Bacteria | 4362 |
| 183 | Ga0068859_100170098 | 3300005617 | Bacteria | 2260 |
| 184 | Ga0068859_101743301 | 3300005617 | Unclassified | 688 |
| 185 | Ga0068864_101303793 | 3300005618 | Unclassified | 726 |
| 186 | Ga0068864_102119200 | 3300005618 | Bacteria | 569 |
| 187 | Ga0068866_10000704 | 3300005718 | Bacteria | 15225 |
| 188 | Ga0068861_100012795 | 3300005719 | Bacteria | 5859 |
| 189 | Ga0068861_100344522 | 3300005719 | Bacteria | 1305 |
| 190 | Ga0068851_10003100 | 3300005834 | Bacteria | 7362 |
| 191 | Ga0068851_10042941 | 3300005834 | Bacteria | 2277 |
| 192 | Ga0068870_10003817 | 3300005840 | Bacteria | 6417 |
| 193 | Ga0068863_100129767 | 3300005841 | Bacteria | 2406 |
| 194 | Ga0068863_100273051 | 3300005841 | Bacteria | 1637 |
| 195 | Ga0068858_100011541 | 3300005842 | Bacteria | 8335 |
| 196 | Ga0068858_100088156 | 3300005842 | Bacteria | 2887 |
| 197 | Ga0068858_100420262 | 3300005842 | Bacteria | 1286 |
| 198 | Ga0068858_100515139 | 3300005842 | Bacteria | 1156 |
| 199 | Ga0068858_101831545 | 3300005842 | Bacteria | 600 |
| 200 | Ga0068860_100209134 | 3300005843 | Bacteria | 1892 |
| 201 | Ga0068860_100302269 | 3300005843 | Bacteria | 1568 |
| 202 | Ga0068860_101266729 | 3300005843 | Unclassified | 758 |
| 203 | Ga0068860_101377304 | 3300005843 | Unclassified | 726 |
| 204 | Ga0068862_100006124 | 3300005844 | Bacteria | 10011 |
| 205 | Ga0068862_100032502 | 3300005844 | Bacteria | 4409 |
| 206 | Ga0068862_100353777 | 3300005844 | Bacteria | 1363 |
| 207 | Ga0068862_102365671 | 3300005844 | Unclassified | 543 |
| 208 | Ga0081540_1054160 | 3300005983 | Bacteria | 1962 |
| 209 | Ga0070717_10001841 | 3300006028 | Bacteria | 14816 |
| 210 | Ga0070717_10040224 | 3300006028 | Bacteria | 3807 |
| 211 | Ga0070717_10166163 | 3300006028 | Bacteria | 1917 |
| 212 | Ga0070717_10193502 | 3300006028 | Bacteria | 1778 |
| 213 | Ga0070717_10209917 | 3300006028 | Bacteria | 1708 |
| 214 | Ga0070717_10210373 | 3300006028 | Bacteria | 1707 |
| 215 | Ga0070717_10318603 | 3300006028 | Bacteria | 1385 |
| 216 | Ga0070717_10364152 | 3300006028 | Bacteria | 1295 |
| 217 | Ga0070717_10779229 | 3300006028 | Bacteria | 870 |
| 218 | Ga0070717_10893259 | 3300006028 | Bacteria | 809 |
| 219 | Ga0070715_10403809 | 3300006163 | Unclassified | 760 |
| 220 | Ga0070715_10404291 | 3300006163 | Unclassified | 760 |
| 221 | Ga0070716_100000092 | 3300006173 | Bacteria | 35441 |
| 222 | Ga0070716_100073852 | 3300006173 | Bacteria | 2013 |
| 223 | Ga0070716_100168807 | 3300006173 | Unclassified | 1426 |
| 224 | Ga0070716_100686568 | 3300006173 | Bacteria | 781 |
| 225 | Ga0070716_101684484 | 3300006173 | Bacteria | 523 |
| 226 | Ga0070712_100000378 | 3300006175 | Bacteria | 25332 |
| 227 | Ga0070712_100012528 | 3300006175 | Bacteria | 5390 |
| 228 | Ga0070712_100018289 | 3300006175 | Bacteria | 4549 |
| 229 | Ga0070712_100614538 | 3300006175 | Bacteria | 921 |
| 230 | Ga0070712_101115508 | 3300006175 | Bacteria | 685 |
| 231 | Ga0097621_100021106 | 3300006237 | Bacteria | 5030 |
| 232 | Ga0097621_100372777 | 3300006237 | Bacteria | 1273 |
| 233 | Ga0097621_100803666 | 3300006237 | Bacteria | 871 |
| 234 | Ga0097621_101823867 | 3300006237 | Bacteria | 580 |
| 235 | Ga0097621_101843980 | 3300006237 | Bacteria | 577 |
| 236 | Ga0068871_100002744 | 3300006358 | Bacteria | 12025 |
| 237 | Ga0068871_100057567 | 3300006358 | Bacteria | 3162 |
| 238 | Ga0068871_100245394 | 3300006358 | Bacteria | 1558 |
| 239 | Ga0075433_10000043 | 3300006852 | Bacteria | 51513 |
| 240 | Ga0075433_10009837 | 3300006852 | Bacteria | 7664 |
| 241 | Ga0075434_100034730 | 3300006871 | Bacteria | 4982 |
| 242 | Ga0075434_100071309 | 3300006871 | Bacteria | 3466 |
| 243 | Ga0075434_100306995 | 3300006871 | Bacteria | 1607 |
| 244 | Ga0075434_100687276 | 3300006871 | Bacteria | 1041 |
| 245 | Ga0075434_100815238 | 3300006871 | Bacteria | 949 |
| 246 | Ga0068865_100000360 | 3300006881 | Bacteria | 25145 |
| 247 | Ga0068865_100039225 | 3300006881 | Bacteria | 3211 |
| 248 | Ga0075436_100003096 | 3300006914 | Bacteria | 11404 |
| 249 | Ga0075436_100017024 | 3300006914 | Bacteria | 4976 |
| 250 | Ga0075436_100091013 | 3300006914 | Bacteria | 2121 |
| 251 | Ga0075436_100213404 | 3300006914 | Bacteria | 1369 |
| 252 | Ga0097620_100046419 | 3300006931 | Bacteria | 4362 |
| 253 | Ga0097620_100170099 | 3300006931 | Bacteria | 2260 |
| 254 | Ga0097620_101743152 | 3300006931 | Unclassified | 688 |
| 255 | Ga0075435_100080968 | 3300007076 | Bacteria | 2667 |
| 256 | Ga0075435_100471363 | 3300007076 | Bacteria | 1084 |
| 257 | Ga0099795_10048287 | 3300007788 | Bacteria | 1540 |
| 258 | Ga0105250_10030679 | 3300009092 | Bacteria | 2161 |
| 259 | Ga0105240_10376751 | 3300009093 | Bacteria | 1603 |
| 260 | Ga0105240_10432559 | 3300009093 | Bacteria | 1476 |
| 261 | Ga0105240_10565920 | 3300009093 | Bacteria | 1256 |
| 262 | Ga0105240_10685704 | 3300009093 | Bacteria | 1120 |
| 263 | Ga0105240_12493166 | 3300009093 | Bacteria | 535 |
| 264 | Ga0105245_10001223 | 3300009098 | Bacteria | 23189 |
| 265 | Ga0105245_10001566 | 3300009098 | Bacteria | 20749 |
| 266 | Ga0105245_10153860 | 3300009098 | Bacteria | 2177 |
| 267 | Ga0105245_10751824 | 3300009098 | Bacteria | 1011 |
| 268 | Ga0105247_10001727 | 3300009101 | Bacteria | 15386 |
| 269 | Ga0105247_10104141 | 3300009101 | Bacteria | 1817 |
| 270 | Ga0105247_10208705 | 3300009101 | Bacteria | 1316 |
| 271 | Ga0105247_10822816 | 3300009101 | Bacteria | 710 |
| 272 | Ga0114129_10000781 | 3300009147 | Bacteria | 40732 |
| 273 | Ga0114129_11621587 | 3300009147 | Unclassified | 791 |
| 274 | Ga0105243_10466088 | 3300009148 | Bacteria | 1189 |
| 275 | Ga0105241_10000850 | 3300009174 | Bacteria | 23148 |
| 276 | Ga0105241_10031446 | 3300009174 | Bacteria | 3975 |
| 277 | Ga0105241_10321265 | 3300009174 | Bacteria | 1335 |
| 278 | Ga0105241_10387727 | 3300009174 | Bacteria | 1222 |
| 279 | Ga0105241_10803997 | 3300009174 | Bacteria | 866 |
| 280 | Ga0105242_10017731 | 3300009176 | Bacteria | 5553 |
| 281 | Ga0105242_10025494 | 3300009176 | Bacteria | 4679 |
| 282 | Ga0105248_10000049 | 3300009177 | Bacteria | 153741 |
| 283 | Ga0105248_10034758 | 3300009177 | Bacteria | 5639 |
| 284 | Ga0105248_10068617 | 3300009177 | Bacteria | 3981 |
| 285 | Ga0105248_10330802 | 3300009177 | Bacteria | 1716 |
| 286 | Ga0105248_10565508 | 3300009177 | Bacteria | 1283 |
| 287 | Ga0105237_10026777 | 3300009545 | Bacteria | 5892 |
| 288 | Ga0105237_10256371 | 3300009545 | Bacteria | 1751 |
| 289 | Ga0105237_10338234 | 3300009545 | Bacteria | 1510 |
| 290 | Ga0105237_10484413 | 3300009545 | Bacteria | 1243 |
| 291 | Ga0105237_11212380 | 3300009545 | Bacteria | 761 |
| 292 | Ga0105238_10012857 | 3300009551 | Bacteria | 8447 |
| 293 | Ga0105238_10023891 | 3300009551 | Bacteria | 6230 |
| 294 | Ga0105238_10300523 | 3300009551 | Bacteria | 1589 |
| 295 | Ga0105238_10394486 | 3300009551 | Bacteria | 1376 |
| 296 | Ga0105249_10013666 | 3300009553 | Bacteria | 7169 |
| 297 | Ga0105249_10527090 | 3300009553 | Bacteria | 1229 |
| 298 | Ga0105249_11828601 | 3300009553 | Bacteria | 680 |
| 299 | Ga0105239_10109917 | 3300010375 | Bacteria | 3056 |
| 300 | Ga0105239_10140740 | 3300010375 | Bacteria | 2688 |
| 301 | Ga0105239_10311904 | 3300010375 | Bacteria | 1773 |
| 302 | Ga0105239_10998201 | 3300010375 | Bacteria | 962 |
| 303 | Ga0105246_10000398 | 3300011119 | Bacteria | 23279 |
| 304 | Ga0105246_10426778 | 3300011119 | Bacteria | 1108 |
| 305 | Ga0157327_1037631 | 3300012512 | Bacteria | 636 |
| 306 | Ga0157326_1072809 | 3300012513 | Unclassified | 548 |
| 307 | Ga0157373_10001863 | 3300013100 | Bacteria | 15980 |
| 308 | Ga0157373_10280777 | 3300013100 | Bacteria | 1180 |
| 309 | Ga0157373_10982674 | 3300013100 | Bacteria | 629 |
| 310 | Ga0157371_10013471 | 3300013102 | Bacteria | 6207 |
| 311 | Ga0157371_10810508 | 3300013102 | Bacteria | 706 |
| 312 | Ga0157370_10052832 | 3300013104 | Bacteria | 3877 |
| 313 | Ga0157370_10742517 | 3300013104 | Bacteria | 894 |
| 314 | Ga0157370_10769704 | 3300013104 | Unclassified | 877 |
| 315 | Ga0157370_10810490 | 3300013104 | Bacteria | 852 |
| 316 | Ga0157369_10025390 | 3300013105 | Bacteria | 6578 |
| 317 | Ga0157369_10350755 | 3300013105 | Bacteria | 1532 |
| 318 | Ga0157369_10423240 | 3300013105 | Bacteria | 1380 |
| 319 | Ga0157369_10607285 | 3300013105 | Bacteria | 1129 |
| 320 | Ga0157369_10759812 | 3300013105 | Bacteria | 997 |
| 321 | Ga0157369_11453264 | 3300013105 | Bacteria | 698 |
| 322 | Ga0157374_10003070 | 3300013296 | Bacteria | 14003 |
| 323 | Ga0157374_10028082 | 3300013296 | Bacteria | 5081 |
| 324 | Ga0157374_10100126 | 3300013296 | Bacteria | 2777 |
| 325 | Ga0157374_10286755 | 3300013296 | Bacteria | 1626 |
| 326 | Ga0157374_10292940 | 3300013296 | Bacteria | 1609 |
| 327 | Ga0157374_10531639 | 3300013296 | Unclassified | 1182 |
| 328 | Ga0157374_12332093 | 3300013296 | Bacteria | 562 |
| 329 | Ga0157378_10000614 | 3300013297 | Bacteria | 33505 |
| 330 | Ga0157378_10164067 | 3300013297 | Bacteria | 2080 |
| 331 | Ga0157378_10435763 | 3300013297 | Bacteria | 1298 |
| 332 | Ga0157378_10770601 | 3300013297 | Bacteria | 986 |
| 333 | Ga0163162_10015784 | 3300013306 | Bacteria | 7381 |
| 334 | Ga0163162_10412033 | 3300013306 | Bacteria | 1484 |
| 335 | Ga0163162_11225099 | 3300013306 | Bacteria | 852 |
| 336 | Ga0157372_10003527 | 3300013307 | Bacteria | 16855 |
| 337 | Ga0157372_10071658 | 3300013307 | Bacteria | 3903 |
| 338 | Ga0157372_10187027 | 3300013307 | Bacteria | 2398 |
| 339 | Ga0157372_10199360 | 3300013307 | Bacteria | 2319 |
| 340 | Ga0157372_10208329 | 3300013307 | Bacteria | 2265 |
| 341 | Ga0157372_10298220 | 3300013307 | Bacteria | 1875 |
| 342 | Ga0157372_10456562 | 3300013307 | Bacteria | 1489 |
| 343 | Ga0157372_10721805 | 3300013307 | Unclassified | 1159 |
| 344 | Ga0157372_11001051 | 3300013307 | Bacteria | 968 |
| 345 | Ga0157375_10031801 | 3300013308 | Bacteria | 4996 |
| 346 | Ga0157375_10066975 | 3300013308 | Bacteria | 3587 |
| 347 | Ga0157375_11007410 | 3300013308 | Bacteria | 972 |
| 348 | Ga0157375_11438227 | 3300013308 | Unclassified | 813 |
| 349 | Ga0163163_10001132 | 3300014325 | Bacteria | 22642 |
| 350 | Ga0163163_10074112 | 3300014325 | Bacteria | 3395 |
| 351 | Ga0163163_10159276 | 3300014325 | Bacteria | 2302 |
| 352 | Ga0163163_10211482 | 3300014325 | Bacteria | 1989 |
| 353 | Ga0163163_10332405 | 3300014325 | Bacteria | 1574 |
| 354 | Ga0163163_11487631 | 3300014325 | Bacteria | 738 |
| 355 | Ga0182008_10031123 | 3300014497 | Bacteria | 2687 |
| 356 | Ga0157377_10000687 | 3300014745 | Bacteria | 13986 |
| 357 | Ga0157379_10011232 | 3300014968 | Bacteria | 7801 |
| 358 | Ga0157379_10046061 | 3300014968 | Bacteria | 3893 |
| 359 | Ga0157379_10070780 | 3300014968 | Bacteria | 3121 |
| 360 | Ga0157379_10214800 | 3300014968 | Bacteria | 1742 |
| 361 | Ga0157379_10514582 | 3300014968 | Bacteria | 1110 |
| 362 | Ga0157379_11972907 | 3300014968 | Bacteria | 576 |
| 363 | Ga0157376_10002306 | 3300014969 | Bacteria | 12892 |
| 364 | Ga0157376_10151570 | 3300014969 | Bacteria | 2091 |
| 365 | Ga0157376_10280266 | 3300014969 | Bacteria | 1570 |
| 366 | Ga0157376_10981403 | 3300014969 | Bacteria | 866 |
| 367 | Ga0157376_11142996 | 3300014969 | Bacteria | 805 |
| 368 | Ga0182006_1187634 | 3300015261 | Bacteria | 688 |
| 369 | Ga0182007_10008202 | 3300015262 | Bacteria | 4304 |
| 370 | Ga0163161_10002007 | 3300017792 | Bacteria | 14719 |
| 371 | Ga0163161_10099159 | 3300017792 | Bacteria | 2166 |
| 372 | Ga0197907_10594095 | 3300020069 | Bacteria | 792 |
| 373 | Ga0206356_10018591 | 3300020070 | Bacteria | 1403 |
| 374 | Ga0206356_11176297 | 3300020070 | Bacteria | 791 |
| 375 | Ga0206349_1107756 | 3300020075 | Bacteria | 852 |
| 376 | Ga0206355_1478285 | 3300020076 | Bacteria | 902 |
| 377 | Ga0206351_10222754 | 3300020077 | Bacteria | 1351 |
| 378 | Ga0206351_10267943 | 3300020077 | Bacteria | 849 |
| 379 | Ga0206352_10508850 | 3300020078 | Bacteria | 851 |
| 380 | Ga0206352_11161229 | 3300020078 | Unclassified | 669 |
| 381 | Ga0206350_10223250 | 3300020080 | Bacteria | 865 |
| 382 | Ga0206354_11433773 | 3300020081 | Bacteria | 850 |
| 383 | Ga0206353_11208826 | 3300020082 | Bacteria | 941 |
| 384 | Ga0154015_1422066 | 3300020610 | Bacteria | 1190 |
| 385 | Ga0154015_1591588 | 3300020610 | Bacteria | 1185 |
| 386 | Ga0213872_10044302 | 3300021361 | Bacteria | 2025 |
| 387 | Ga0213872_10169330 | 3300021361 | Bacteria | 947 |
| 388 | Ga0213874_10006229 | 3300021377 | Bacteria | 2818 |
| 389 | Ga0224712_10181959 | 3300022467 | Bacteria | 947 |
| 390 | Ga0224572_1000022 | 3300024225 | Bacteria | 8822 |
| 391 | Ga0224572_1003717 | 3300024225 | Bacteria | 2599 |
| 392 | Ga0228598_1000081 | 3300024227 | Bacteria | 14853 |
| 393 | Ga0228598_1002944 | 3300024227 | Unclassified | 3696 |
| 394 | Ga0207697_10003550 | 3300025315 | Bacteria | 7681 |
| 395 | Ga0207697_10258254 | 3300025315 | Bacteria | 771 |
| 396 | Ga0207656_10032090 | 3300025321 | Bacteria | 2179 |
| 397 | Ga0207656_10490471 | 3300025321 | Bacteria | 623 |
| 398 | Ga0207696_1020727 | 3300025711 | Bacteria | 2113 |
| 399 | Ga0207682_10009137 | 3300025893 | Bacteria | 3916 |
| 400 | Ga0207692_10012753 | 3300025898 | Bacteria | 3620 |
| 401 | Ga0207692_10200973 | 3300025898 | Bacteria | 1172 |
| 402 | Ga0207692_10507706 | 3300025898 | Unclassified | 766 |
| 403 | Ga0207692_10556092 | 3300025898 | Bacteria | 734 |
| 404 | Ga0207642_10037831 | 3300025899 | Unclassified | 2082 |
| 405 | Ga0207710_10110921 | 3300025900 | Bacteria | 1302 |
| 406 | Ga0207688_10002004 | 3300025901 | Bacteria | 10920 |
| 407 | Ga0207688_10549786 | 3300025901 | Bacteria | 725 |
| 408 | Ga0207680_10022274 | 3300025903 | Bacteria | 3442 |
| 409 | Ga0207680_10091523 | 3300025903 | Bacteria | 1936 |
| 410 | Ga0207647_10002606 | 3300025904 | Bacteria | 13635 |
| 411 | Ga0207647_10028343 | 3300025904 | Bacteria | 3638 |
| 412 | Ga0207647_10215459 | 3300025904 | Bacteria | 1108 |
| 413 | Ga0207685_10209937 | 3300025905 | Bacteria | 920 |
| 414 | Ga0207685_10308544 | 3300025905 | Unclassified | 785 |
| 415 | Ga0207699_10000693 | 3300025906 | Bacteria | 16122 |
| 416 | Ga0207699_10067773 | 3300025906 | Bacteria | 2171 |
| 417 | Ga0207699_10079232 | 3300025906 | Bacteria | 2032 |
| 418 | Ga0207699_10428281 | 3300025906 | Bacteria | 946 |
| 419 | Ga0207699_10553547 | 3300025906 | Bacteria | 834 |
| 420 | Ga0207645_10001595 | 3300025907 | Bacteria | 18512 |
| 421 | Ga0207645_10015447 | 3300025907 | Bacteria | 5071 |
| 422 | Ga0207645_10494711 | 3300025907 | Unclassified | 828 |
| 423 | Ga0207643_10000412 | 3300025908 | Bacteria | 28337 |
| 424 | Ga0207705_10142771 | 3300025909 | Unclassified | 1789 |
| 425 | Ga0207705_10761347 | 3300025909 | Bacteria | 752 |
| 426 | Ga0207705_11030358 | 3300025909 | Bacteria | 635 |
| 427 | Ga0207684_10159432 | 3300025910 | Bacteria | 1942 |
| 428 | Ga0207684_10278476 | 3300025910 | Bacteria | 1443 |
| 429 | Ga0207684_11715167 | 3300025910 | Unclassified | 506 |
| 430 | Ga0207654_10000452 | 3300025911 | Bacteria | 23472 |
| 431 | Ga0207654_10090530 | 3300025911 | Bacteria | 1864 |
| 432 | Ga0207654_10183713 | 3300025911 | Bacteria | 1366 |
| 433 | Ga0207654_10978451 | 3300025911 | Bacteria | 615 |
| 434 | Ga0207707_10178811 | 3300025912 | Bacteria | 1852 |
| 435 | Ga0207707_10218250 | 3300025912 | Bacteria | 1660 |
| 436 | Ga0207707_10218458 | 3300025912 | Bacteria | 1659 |
| 437 | Ga0207695_10167991 | 3300025913 | Bacteria | 2121 |
| 438 | Ga0207671_10036230 | 3300025914 | Bacteria | 3658 |
| 439 | Ga0207671_10322948 | 3300025914 | Unclassified | 1222 |
| 440 | Ga0207671_10549824 | 3300025914 | Bacteria | 920 |
| 441 | Ga0207671_10660557 | 3300025914 | Bacteria | 832 |
| 442 | Ga0207671_11179304 | 3300025914 | Bacteria | 600 |
| 443 | Ga0207693_10000654 | 3300025915 | Bacteria | 31051 |
| 444 | Ga0207693_10241516 | 3300025915 | Bacteria | 1418 |
| 445 | Ga0207693_10855007 | 3300025915 | Bacteria | 699 |
| 446 | Ga0207693_11347757 | 3300025915 | Bacteria | 532 |
| 447 | Ga0207663_10003322 | 3300025916 | Bacteria | 7850 |
| 448 | Ga0207663_10053435 | 3300025916 | Bacteria | 2524 |
| 449 | Ga0207663_10251377 | 3300025916 | Bacteria | 1301 |
| 450 | Ga0207663_10800120 | 3300025916 | Bacteria | 751 |
| 451 | Ga0207663_10991688 | 3300025916 | Bacteria | 674 |
| 452 | Ga0207663_11021111 | 3300025916 | Bacteria | 664 |
| 453 | Ga0207660_10569943 | 3300025917 | Bacteria | 921 |
| 454 | Ga0207662_10044181 | 3300025918 | Unclassified | 2630 |
| 455 | Ga0207657_10016548 | 3300025919 | Bacteria | 7108 |
| 456 | Ga0207657_10025075 | 3300025919 | Bacteria | 5507 |
| 457 | Ga0207649_10018886 | 3300025920 | Unclassified | 3931 |
| 458 | Ga0207652_10019824 | 3300025921 | Bacteria | 5536 |
| 459 | Ga0207652_10036806 | 3300025921 | Bacteria | 4139 |
| 460 | Ga0207652_10236516 | 3300025921 | Bacteria | 1646 |
| 461 | Ga0207646_10045419 | 3300025922 | Unclassified | 3944 |
| 462 | Ga0207646_10286980 | 3300025922 | Bacteria | 1487 |
| 463 | Ga0207646_10407323 | 3300025922 | Bacteria | 1228 |
| 464 | Ga0207681_10013517 | 3300025923 | Bacteria | 5054 |
| 465 | Ga0207694_10045647 | 3300025924 | Bacteria | 3384 |
| 466 | Ga0207694_10842611 | 3300025924 | Bacteria | 775 |
| 467 | Ga0207694_10904581 | 3300025924 | Bacteria | 746 |
| 468 | Ga0207650_10000024 | 3300025925 | Bacteria | 299184 |
| 469 | Ga0207659_10097151 | 3300025926 | Bacteria | 2212 |
| 470 | Ga0207687_10138749 | 3300025927 | Bacteria | 1842 |
| 471 | Ga0207700_10000153 | 3300025928 | Bacteria | 41130 |
| 472 | Ga0207700_10166872 | 3300025928 | Bacteria | 1833 |
| 473 | Ga0207700_10288768 | 3300025928 | Bacteria | 1413 |
| 474 | Ga0207700_10368248 | 3300025928 | Bacteria | 1254 |
| 475 | Ga0207700_10388952 | 3300025928 | Bacteria | 1221 |
| 476 | Ga0207700_10407955 | 3300025928 | Bacteria | 1192 |
| 477 | Ga0207700_10685368 | 3300025928 | Unclassified | 914 |
| 478 | Ga0207700_10917555 | 3300025928 | Bacteria | 784 |
| 479 | Ga0207700_11103548 | 3300025928 | Bacteria | 709 |
| 480 | Ga0207664_10048088 | 3300025929 | Bacteria | 3353 |
| 481 | Ga0207664_10083602 | 3300025929 | Bacteria | 2602 |
| 482 | Ga0207664_10124267 | 3300025929 | Bacteria | 2164 |
| 483 | Ga0207664_10328608 | 3300025929 | Bacteria | 1350 |
| 484 | Ga0207664_10502491 | 3300025929 | Bacteria | 1086 |
| 485 | Ga0207664_10569478 | 3300025929 | Bacteria | 1017 |
| 486 | Ga0207664_11191378 | 3300025929 | Bacteria | 679 |
| 487 | Ga0207664_11516966 | 3300025929 | Unclassified | 592 |
| 488 | Ga0207644_10018628 | 3300025931 | Bacteria | 4699 |
| 489 | Ga0207644_11073756 | 3300025931 | Bacteria | 676 |
| 490 | Ga0207690_10013645 | 3300025932 | Bacteria | 4887 |
| 491 | Ga0207690_10305880 | 3300025932 | Bacteria | 1245 |
| 492 | Ga0207706_10003335 | 3300025933 | Bacteria | 15361 |
| 493 | Ga0207706_10013816 | 3300025933 | Bacteria | 7326 |
| 494 | Ga0207686_10017600 | 3300025934 | Bacteria | 4030 |
| 495 | Ga0207686_10088617 | 3300025934 | Bacteria | 2037 |
| 496 | Ga0207669_10170532 | 3300025937 | Unclassified | 1548 |
| 497 | Ga0207704_10007325 | 3300025938 | Bacteria | 5206 |
| 498 | Ga0207704_10343747 | 3300025938 | Bacteria | 1159 |
| 499 | Ga0207704_10974069 | 3300025938 | Bacteria | 716 |
| 500 | Ga0207704_11377445 | 3300025938 | Unclassified | 604 |
| 501 | Ga0207665_10000088 | 3300025939 | Bacteria | 60223 |
| 502 | Ga0207665_10094231 | 3300025939 | Bacteria | 2079 |
| 503 | Ga0207665_10242071 | 3300025939 | Unclassified | 1329 |
| 504 | Ga0207665_10267491 | 3300025939 | Bacteria | 1268 |
| 505 | Ga0207665_10546588 | 3300025939 | Bacteria | 899 |
| 506 | Ga0207665_11048620 | 3300025939 | Bacteria | 649 |
| 507 | Ga0207691_10000072 | 3300025940 | Bacteria | 83580 |
| 508 | Ga0207691_10142711 | 3300025940 | Bacteria | 2109 |
| 509 | Ga0207711_10000033 | 3300025941 | Bacteria | 193513 |
| 510 | Ga0207711_10036610 | 3300025941 | Bacteria | 4164 |
| 511 | Ga0207711_10037942 | 3300025941 | Bacteria | 4096 |
| 512 | Ga0207711_10044186 | 3300025941 | Bacteria | 3803 |
| 513 | Ga0207711_10331039 | 3300025941 | Bacteria | 1408 |
| 514 | Ga0207711_10589651 | 3300025941 | Bacteria | 1037 |
| 515 | Ga0207689_10001019 | 3300025942 | Bacteria | 26906 |
| 516 | Ga0207689_10001565 | 3300025942 | Bacteria | 21697 |
| 517 | Ga0207689_10142307 | 3300025942 | Bacteria | 1976 |
| 518 | Ga0207661_10001629 | 3300025944 | Bacteria | 15283 |
| 519 | Ga0207661_10367466 | 3300025944 | Bacteria | 1300 |
| 520 | Ga0207679_10000040 | 3300025945 | Bacteria | 127317 |
| 521 | Ga0207679_11592627 | 3300025945 | Bacteria | 599 |
| 522 | Ga0207667_10001031 | 3300025949 | Bacteria | 35503 |
| 523 | Ga0207667_10117659 | 3300025949 | Bacteria | 2739 |
| 524 | Ga0207667_10140954 | 3300025949 | Bacteria | 2482 |
| 525 | Ga0207667_10148825 | 3300025949 | Unclassified | 2410 |
| 526 | Ga0207667_10513437 | 3300025949 | Bacteria | 1214 |
| 527 | Ga0207651_10009325 | 3300025960 | Bacteria | 5363 |
| 528 | Ga0207651_10116662 | 3300025960 | Bacteria | 2016 |
| 529 | Ga0207651_11705709 | 3300025960 | Bacteria | 567 |
| 530 | Ga0207712_10014438 | 3300025961 | Bacteria | 5083 |
| 531 | Ga0207712_11665320 | 3300025961 | Bacteria | 572 |
| 532 | Ga0207668_10064463 | 3300025972 | Bacteria | 2589 |
| 533 | Ga0207640_10126199 | 3300025981 | Bacteria | 1842 |
| 534 | Ga0207640_10128541 | 3300025981 | Bacteria | 1828 |
| 535 | Ga0207640_10244915 | 3300025981 | Bacteria | 1388 |
| 536 | Ga0207640_10665644 | 3300025981 | Bacteria | 889 |
| 537 | Ga0207658_10003060 | 3300025986 | Bacteria | 11968 |
| 538 | Ga0207658_10022176 | 3300025986 | Bacteria | 4419 |
| 539 | Ga0207658_10079860 | 3300025986 | Bacteria | 2504 |
| 540 | Ga0207658_10607130 | 3300025986 | Bacteria | 983 |
| 541 | Ga0207677_10159804 | 3300026023 | Bacteria | 1749 |
| 542 | Ga0207677_10191675 | 3300026023 | Bacteria | 1617 |
| 543 | Ga0207677_11010385 | 3300026023 | Bacteria | 754 |
| 544 | Ga0207677_11515726 | 3300026023 | Bacteria | 619 |
| 545 | Ga0207677_12063834 | 3300026023 | Bacteria | 530 |
| 546 | Ga0207703_10064276 | 3300026035 | Unclassified | 3011 |
| 547 | Ga0207703_10121040 | 3300026035 | Bacteria | 2247 |
| 548 | Ga0207703_11187777 | 3300026035 | Bacteria | 733 |
| 549 | Ga0207703_11476475 | 3300026035 | Bacteria | 654 |
| 550 | Ga0207639_10038333 | 3300026041 | Bacteria | 3564 |
| 551 | Ga0207639_10051922 | 3300026041 | Unclassified | 3121 |
| 552 | Ga0207639_10370821 | 3300026041 | Bacteria | 1283 |
| 553 | Ga0207639_10474809 | 3300026041 | Bacteria | 1139 |
| 554 | Ga0207639_11462238 | 3300026041 | Bacteria | 641 |
| 555 | Ga0207678_10002689 | 3300026067 | Bacteria | 16127 |
| 556 | Ga0207678_10981749 | 3300026067 | Bacteria | 747 |
| 557 | Ga0207708_10186198 | 3300026075 | Unclassified | 1650 |
| 558 | Ga0207702_10046122 | 3300026078 | Bacteria | 3668 |
| 559 | Ga0207702_10955544 | 3300026078 | Bacteria | 850 |
| 560 | Ga0207702_12086522 | 3300026078 | Bacteria | 557 |
| 561 | Ga0207702_12132240 | 3300026078 | Bacteria | 550 |
| 562 | Ga0207641_10000030 | 3300026088 | Bacteria | 224468 |
| 563 | Ga0207641_10108830 | 3300026088 | Bacteria | 2454 |
| 564 | Ga0207641_10726778 | 3300026088 | Bacteria | 979 |
| 565 | Ga0207641_10727175 | 3300026088 | Bacteria | 979 |
| 566 | Ga0207641_11268160 | 3300026088 | Bacteria | 737 |
| 567 | Ga0207648_10001749 | 3300026089 | Bacteria | 23777 |
| 568 | Ga0207648_10130465 | 3300026089 | Bacteria | 2212 |
| 569 | Ga0207648_10136542 | 3300026089 | Bacteria | 2160 |
| 570 | Ga0207676_10000256 | 3300026095 | Bacteria | 46055 |
| 571 | Ga0207676_10080394 | 3300026095 | Bacteria | 2646 |
| 572 | Ga0207676_10538470 | 3300026095 | Bacteria | 1114 |
| 573 | Ga0207674_10002761 | 3300026116 | Bacteria | 21899 |
| 574 | Ga0207674_10089173 | 3300026116 | Bacteria | 3077 |
| 575 | Ga0207674_10213431 | 3300026116 | Bacteria | 1879 |
| 576 | Ga0207675_100023344 | 3300026118 | Bacteria | 5752 |
| 577 | Ga0207675_100214257 | 3300026118 | Bacteria | 1854 |
| 578 | Ga0207683_10000662 | 3300026121 | Bacteria | 31638 |
| 579 | Ga0207683_10007099 | 3300026121 | Bacteria | 9600 |
| 580 | Ga0207698_10076142 | 3300026142 | Bacteria | 2684 |
| 581 | Ga0207698_11364487 | 3300026142 | Bacteria | 724 |
| 582 | Ga0207698_11690525 | 3300026142 | Bacteria | 648 |
| 583 | Ga0207698_12366873 | 3300026142 | Bacteria | 542 |
| 584 | Ga0209179_1057280 | 3300027512 | Bacteria | 842 |
| 585 | Ga0209998_10010126 | 3300027717 | Bacteria | 1952 |
| 586 | Ga0268266_10019872 | 3300028379 | Bacteria | 5724 |
| 587 | Ga0268266_10056161 | 3300028379 | Bacteria | 3387 |
| 588 | Ga0268266_11528394 | 3300028379 | Bacteria | 643 |
| 589 | Ga0268266_12174480 | 3300028379 | Unclassified | 527 |
| 590 | Ga0268265_10021245 | 3300028380 | Bacteria | 4543 |
| 591 | Ga0268265_10438142 | 3300028380 | Bacteria | 1217 |
| 592 | Ga0268265_12163399 | 3300028380 | Unclassified | 563 |
| 593 | Ga0268264_10011416 | 3300028381 | Bacteria | 7337 |
| 594 | Ga0268264_10245188 | 3300028381 | Bacteria | 1661 |
| 595 | Ga0268264_10578701 | 3300028381 | Bacteria | 1104 |
| 596 | Ga0268264_11139659 | 3300028381 | Unclassified | 789 |
| 597 | Ga0268264_12623672 | 3300028381 | Bacteria | 508 |
| 598 | Ga0265318_10302152 | 3300028577 | Bacteria | 584 |
| 599 | Ga0265338_10004259 | 3300028800 | Bacteria | 19432 |
| 600 | Ga0265338_10264831 | 3300028800 | Unclassified | 1262 |
| 601 | Ga0265338_10460408 | 3300028800 | Bacteria | 899 |
| 602 | Ga0265324_10053436 | 3300029957 | Bacteria | 1387 |
| 603 | Ga0265762_1119499 | 3300030760 | Bacteria | 601 |
| 604 | Ga0265770_1044778 | 3300030878 | Bacteria | 784 |
| 605 | Ga0265765_1009707 | 3300030879 | Bacteria | 1063 |
| 606 | Ga0265760_10001267 | 3300031090 | Bacteria | 7383 |
| 607 | Ga0265760_10012359 | 3300031090 | Bacteria | 2441 |
| 608 | Ga0265760_10030716 | 3300031090 | Bacteria | 1583 |
| 609 | Ga0265760_10048857 | 3300031090 | Bacteria | 1271 |
| 610 | Ga0265760_10052625 | 3300031090 | Bacteria | 1228 |
| 611 | Ga0265760_10186138 | 3300031090 | Bacteria | 696 |
| 612 | Ga0265330_10000346 | 3300031235 | Bacteria | 32953 |
| 613 | Ga0265330_10007123 | 3300031235 | Bacteria | 5481 |
| 614 | Ga0265330_10059264 | 3300031235 | Bacteria | 1667 |
| 615 | Ga0265330_10073196 | 3300031235 | Bacteria | 1482 |
| 616 | Ga0265330_10165942 | 3300031235 | Bacteria | 937 |
| 617 | Ga0265330_10321276 | 3300031235 | Bacteria | 653 |
| 618 | Ga0265332_10005285 | 3300031238 | Bacteria | 5972 |
| 619 | Ga0265332_10040700 | 3300031238 | Bacteria | 2011 |
| 620 | Ga0265328_10003354 | 3300031239 | Bacteria | 7081 |
| 621 | Ga0265325_10000582 | 3300031241 | Bacteria | 26541 |
| 622 | Ga0265325_10003036 | 3300031241 | Bacteria | 11108 |
| 623 | Ga0265325_10049084 | 3300031241 | Bacteria | 2180 |
| 624 | Ga0265329_10016146 | 3300031242 | Bacteria | 2595 |
| 625 | Ga0265340_10001936 | 3300031247 | Bacteria | 11830 |
| 626 | Ga0265340_10004114 | 3300031247 | Bacteria | 8169 |
| 627 | Ga0265340_10324234 | 3300031247 | Bacteria | 682 |
| 628 | Ga0265339_10006462 | 3300031249 | Bacteria | 7685 |
| 629 | Ga0265339_10006757 | 3300031249 | Bacteria | 7486 |
| 630 | Ga0265339_10017622 | 3300031249 | Bacteria | 4226 |
| 631 | Ga0265339_10135945 | 3300031249 | Bacteria | 1254 |
| 632 | Ga0265339_10264508 | 3300031249 | Bacteria | 829 |
| 633 | Ga0265331_10025594 | 3300031250 | Bacteria | 2977 |
| 634 | Ga0265331_10097360 | 3300031250 | Bacteria | 1356 |
| 635 | Ga0265331_10333600 | 3300031250 | Bacteria | 679 |
| 636 | Ga0265327_10214377 | 3300031251 | Bacteria | 868 |
| 637 | Ga0265316_10000726 | 3300031344 | Bacteria | 36285 |
| 638 | Ga0265316_10002223 | 3300031344 | Bacteria | 20359 |
| 639 | Ga0265316_10006636 | 3300031344 | Bacteria | 11022 |
| 640 | Ga0265316_10012858 | 3300031344 | Bacteria | 7475 |
| 641 | Ga0265316_10032480 | 3300031344 | Bacteria | 4260 |
| 642 | Ga0265316_10271618 | 3300031344 | Bacteria | 1240 |
| 643 | Ga0265316_10401878 | 3300031344 | Bacteria | 986 |
| 644 | Ga0265316_10910827 | 3300031344 | Bacteria | 614 |
| 645 | Ga0307408_100213448 | 3300031548 | Bacteria | 1570 |
| 646 | Ga0307408_100552336 | 3300031548 | Bacteria | 1016 |
| 647 | Ga0307408_100654930 | 3300031548 | Bacteria | 939 |
| 648 | Ga0265313_10001185 | 3300031595 | Bacteria | 24932 |
| 649 | Ga0265313_10019287 | 3300031595 | Bacteria | 3801 |
| 650 | Ga0265314_10000067 | 3300031711 | Bacteria | 156225 |
| 651 | Ga0265314_10033014 | 3300031711 | Bacteria | 3801 |
| 652 | Ga0265314_10198517 | 3300031711 | Bacteria | 1188 |
| 653 | Ga0265314_10582410 | 3300031711 | Bacteria | 578 |
| 654 | Ga0265342_10000741 | 3300031712 | Bacteria | 33577 |
| 655 | Ga0265342_10001898 | 3300031712 | Bacteria | 18803 |
| 656 | Ga0265342_10071874 | 3300031712 | Bacteria | 2015 |
| 657 | Ga0265342_10119373 | 3300031712 | Bacteria | 1486 |
| 658 | Ga0265342_10263251 | 3300031712 | Bacteria | 917 |
| 659 | Ga0307405_11192648 | 3300031731 | Bacteria | 658 |
| 660 | Ga0307413_10115937 | 3300031824 | Bacteria | 1803 |
| 661 | Ga0307413_10473606 | 3300031824 | Bacteria | 999 |
| 662 | Ga0307410_10005772 | 3300031852 | Bacteria | 6598 |
| 663 | Ga0307410_10301095 | 3300031852 | Bacteria | 1265 |
| 664 | Ga0307406_10083797 | 3300031901 | Bacteria | 2127 |
| 665 | Ga0307406_10834678 | 3300031901 | Bacteria | 780 |
| 666 | Ga0307412_11444174 | 3300031911 | Bacteria | 624 |
| 667 | Ga0307412_11718984 | 3300031911 | Bacteria | 575 |
| 668 | Ga0307412_11953179 | 3300031911 | Bacteria | 542 |
| 669 | Ga0307409_100202555 | 3300031995 | Bacteria | 1777 |
| 670 | Ga0307416_100071903 | 3300032002 | Bacteria | 2876 |
| 671 | Ga0307416_100318418 | 3300032002 | Bacteria | 1556 |
| 672 | Ga0307414_10638328 | 3300032004 | Bacteria | 959 |
| 673 | Ga0307414_11545170 | 3300032004 | Bacteria | 618 |
| 674 | Ga0307411_10167045 | 3300032005 | Bacteria | 1655 |
| 675 | Ga0307411_12086309 | 3300032005 | Bacteria | 530 |
| 676 | Ga0307415_100134954 | 3300032126 | Bacteria | 1875 |
| 677 | Ga0307415_100943882 | 3300032126 | Bacteria | 798 |
| 678 | Ga0316583_10031683 | 3300032133 | Bacteria | 1882 |
| 679 | Ga0373926_0294953 | 3300035083 | Bacteria | 632 |
| 680 | Ga0373934_0041735 | 3300035086 | Bacteria | 1812 |
| 681 | Ga0373934_0168632 | 3300035086 | Bacteria | 899 |
| 682 | Ga0373944_0124707 | 3300035089 | Bacteria | 890 |
| 683 | Ga0373923_0236351 | 3300035111 | Bacteria | 852 |
| 684 | Ga0373923_0360056 | 3300035111 | Bacteria | 696 |
| 685 | Ga0373945_0002364 | 3300035116 | Bacteria | 5919 |
| 686 | Ga0373953_0278638 | 3300035117 | Bacteria | 729 |
| 687 | Ga0373953_0471555 | 3300035117 | Bacteria | 555 |
| 688 | Ga0373954_0178100 | 3300035118 | Bacteria | 1042 |
| 689 | Ga0373954_0465906 | 3300035118 | Bacteria | 626 |
| 690 | Ga0373956_0090837 | 3300035119 | Bacteria | 1409 |
| 691 | Ga0373957_0117008 | 3300035120 | Bacteria | 1077 |
| 692 | Ga0373943_0002553 | 3300035170 | Bacteria | 8276 |
| 693 | Ga0373946_0004426 | 3300035171 | Bacteria | 5030 |
| 694 | Ga0373946_0075254 | 3300035171 | Bacteria | 1467 |
| 695 | Ga0373955_0014255 | 3300035172 | Bacteria | 3862 |
| 696 | Ga0373955_0577905 | 3300035172 | Bacteria | 688 |
| 697 | Ga0373931_0684838 | 3300035691 | Bacteria | 676 |
| 698 | Ga0373931_1190547 | 3300035691 | Bacteria | 521 |
| 699 | Ga0373935_0250334 | 3300035692 | Bacteria | 1239 |
| 700 | Ga0373927_0065639 | 3300035695 | Bacteria | 2347 |
| 701 | Ga0373927_0167471 | 3300035695 | Bacteria | 1440 |
| 702 | Ga0373933_0173428 | 3300035724 | Bacteria | 1373 |
| 703 | Ga0373933_0451592 | 3300035724 | Bacteria | 841 |
| 704 | Ga0373947_0599801 | 3300035725 | Unclassified | 750 |
| 705 | Ga0373947_0637450 | 3300035725 | Bacteria | 726 |
| 706 | Ga0373937_0009655 | 3300036401 | Bacteria | 8403 |
| 707 | Ga0373937_0158038 | 3300036401 | Bacteria | 2125 |
| 708 | Ga0373937_0230610 | 3300036401 | Bacteria | 1744 |
| 709 | Ga0373937_0292867 | 3300036401 | Bacteria | 1538 |
| 710 | Ga0373937_0367956 | 3300036401 | Bacteria | 1363 |
| 711 | Ga0373937_1144338 | 3300036401 | Unclassified | 727 |
| 712 | Ga0373937_1510246 | 3300036401 | Bacteria | 619 |
| 713 | Ga0265778_003161 | 3300036457 | Bacteria | 1647 |
| 714 | Ga0373925_0024161 | 3300037068 | Bacteria | 4436 |
| 715 | Ga0373925_0026433 | 3300037068 | Bacteria | 4246 |
| 716 | Ga0373925_0216397 | 3300037068 | Bacteria | 1528 |
| 717 | Ga0373925_0281961 | 3300037068 | Unclassified | 1338 |
| 718 | Ga0373925_0613969 | 3300037068 | Bacteria | 896 |
| 719 | Ga0395900_1075301 | 3300037418 | Bacteria | 722 |
| 720 | Ga0395905_0625910 | 3300037471 | Bacteria | 978 |
| 721 | Ga0395905_1705552 | 3300037471 | Bacteria | 535 |
| 722 | Ga0395901_0500645 | 3300038443 | Bacteria | 1237 |
| 723 | Ga0395901_0700807 | 3300038443 | Bacteria | 1010 |
| 724 | Ga0436365_0624994 | 3300039437 | Bacteria | 503 |
| 725 | Ga0436365_0837639 | 3300039437 | Unclassified | 1326 |
| 726 | Ga0436365_0903852 | 3300039437 | Bacteria | 3286 |
| 727 | Ga0436360_0139949 | 3300039438 | Bacteria | 2118 |
| 728 | Ga0436360_0152286 | 3300039438 | Bacteria | 501 |
| 729 | Ga0436360_0792118 | 3300039438 | Bacteria | 1272 |
| 730 | Ga0436360_0943434 | 3300039438 | Bacteria | 2695 |
| 731 | Ga0436360_1258478 | 3300039438 | Bacteria | 1224 |
| 732 | Ga0436361_0258027 | 3300039447 | Bacteria | 747 |
| 733 | Ga0436361_0887686 | 3300039447 | Bacteria | 1241 |
| 734 | Ga0436361_1169155 | 3300039447 | Bacteria | 3378 |
| 735 | Ga0436363_0267088 | 3300039450 | Bacteria | 821 |
| 736 | Ga0436363_0276301 | 3300039450 | Bacteria | 909 |
| 737 | Ga0436363_0491074 | 3300039450 | Bacteria | 749 |
| 738 | Ga0436363_0614486 | 3300039450 | Bacteria | 785 |
| 739 | Ga0436363_1376765 | 3300039450 | Bacteria | 8238 |
| 740 | Ga0436362_1122765 | 3300039453 | Unclassified | 1455 |
| 741 | Ga0451577_2025560 | 3300042876 | Bacteria | 503 |
| 742 | Ga0453683_0755309 | 3300044673 | Unclassified | 639 |
| 743 | Ga0466965_0219124 | 3300044683 | Bacteria | 1014 |
| 744 | Ga0466966_0183609 | 3300044684 | Bacteria | 1269 |
| 745 | Ga0466966_0761941 | 3300044684 | Bacteria | 583 |
| 746 | Ga0466961_0654972 | 3300044693 | Bacteria | 630 |
| 747 | Ga0466963_0028800 | 3300044694 | Bacteria | 3570 |
| 748 | Ga0466963_0111333 | 3300044694 | Bacteria | 1880 |
| 749 | Ga0466964_0158339 | 3300044706 | Unclassified | 1056 |
| 750 | Ga0466957_0169608 | 3300044842 | Bacteria | 1421 |
| 751 | Ga0466957_0320173 | 3300044842 | Unclassified | 1046 |
| 752 | Ga0466959_0055610 | 3300045049 | Bacteria | 2889 |
| 753 | Ga0466959_0079482 | 3300045049 | Bacteria | 2364 |
| 754 | Ga0466958_1007715 | 3300045836 | Bacteria | 543 |
| 755 | Ga0466967_0082587 | 3300045976 | Bacteria | 2904 |
| 756 | Ga0466967_0108084 | 3300045976 | Bacteria | 2552 |
| 757 | Ga0466967_0224412 | 3300045976 | Bacteria | 1787 |
| 758 | Ga0466967_0834407 | 3300045976 | Bacteria | 916 |
| 759 | Ga0466967_1767194 | 3300045976 | Bacteria | 616 |
| 760 | Ga0466967_2268097 | 3300045976 | Unclassified | 539 |
| 761 | Ga0495603_0163158 | 3300046455 | Unclassified | 1292 |
| 762 | Ga0495629_0031645 | 3300046459 | Bacteria | 3745 |
| 763 | Ga0495629_0767031 | 3300046459 | Unclassified | 638 |
| 764 | Ga0495651_0076691 | 3300046462 | Bacteria | 2532 |
| 765 | Ga0495651_0554501 | 3300046462 | Bacteria | 730 |
| 766 | Ga0495580_0003281 | 3300046472 | Bacteria | 13830 |
| 767 | Ga0495580_0012850 | 3300046472 | Bacteria | 6416 |
| 768 | Ga0495580_0023629 | 3300046472 | Bacteria | 4510 |
| 769 | Ga0495580_0180506 | 3300046472 | Bacteria | 1458 |
| 770 | Ga0495580_0226616 | 3300046472 | Bacteria | 1283 |
| 771 | Ga0495580_0290944 | 3300046472 | Bacteria | 1113 |
| 772 | Ga0495580_0572150 | 3300046472 | Bacteria | 749 |
| 773 | Ga0495582_0225831 | 3300046473 | Bacteria | 1072 |
| 774 | Ga0495582_0472795 | 3300046473 | Bacteria | 724 |
| 775 | Ga0495582_0575605 | 3300046473 | Bacteria | 651 |
| 776 | Ga0495639_0086970 | 3300046475 | Bacteria | 1462 |
| 777 | Ga0495662_0141645 | 3300046476 | Bacteria | 1184 |
| 778 | Ga0495585_0441717 | 3300046492 | Bacteria | 623 |
| 779 | Ga0495594_0049707 | 3300046499 | Bacteria | 2305 |
| 780 | Ga0495594_0106110 | 3300046499 | Bacteria | 1582 |
| 781 | Ga0495594_0176039 | 3300046499 | Bacteria | 1217 |
| 782 | Ga0495608_0114226 | 3300046511 | Bacteria | 1734 |
| 783 | Ga0495608_0563620 | 3300046511 | Bacteria | 686 |
| 784 | Ga0495628_0061195 | 3300046516 | Bacteria | 2953 |
| 785 | Ga0495628_0441342 | 3300046516 | Bacteria | 946 |
| 786 | Ga0495630_0027742 | 3300046517 | Bacteria | 4204 |
| 787 | Ga0495630_0784447 | 3300046517 | Bacteria | 728 |
| 788 | Ga0495637_0057017 | 3300046520 | Bacteria | 1615 |
| 789 | Ga0495643_0058243 | 3300046522 | Bacteria | 2056 |
| 790 | Ga0495666_0100021 | 3300046526 | Bacteria | 1367 |
| 791 | Ga0495666_0320855 | 3300046526 | Bacteria | 699 |
| 792 | Ga0495666_0358655 | 3300046526 | Unclassified | 656 |
| 793 | Ga0495666_0467349 | 3300046526 | Bacteria | 565 |
| 794 | Ga0495642_0042339 | 3300046528 | Bacteria | 1855 |
| 795 | Ga0495652_0504419 | 3300046529 | Bacteria | 838 |
| 796 | Ga0495652_0881563 | 3300046529 | Bacteria | 591 |
| 797 | Ga0495652_1067392 | 3300046529 | Unclassified | 526 |
| 798 | Ga0495665_0006124 | 3300046531 | Bacteria | 6495 |
| 799 | Ga0495665_0103002 | 3300046531 | Bacteria | 1498 |
| 800 | Ga0495665_0641397 | 3300046531 | Bacteria | 529 |
| 801 | Ga0495665_0655455 | 3300046531 | Bacteria | 522 |
| 802 | Ga0495640_0764151 | 3300046533 | Bacteria | 577 |
| 803 | Ga0495587_0060996 | 3300046536 | Bacteria | 2210 |
| 804 | Ga0495667_0149102 | 3300046559 | Bacteria | 1506 |
| 805 | Ga0495667_0625144 | 3300046559 | Bacteria | 670 |
| 806 | Ga0495668_0079030 | 3300046616 | Bacteria | 1806 |
| 807 | Ga0495668_0139089 | 3300046616 | Bacteria | 1329 |
| 808 | Ga0495635_0111022 | 3300046663 | Bacteria | 1873 |
| 809 | Ga0495635_0116768 | 3300046663 | Bacteria | 1821 |
| 810 | Ga0495659_0009637 | 3300046664 | Bacteria | 3087 |
| 811 | Ga0495588_0436728 | 3300046674 | Unclassified | 687 |
| 812 | Ga0495657_0070739 | 3300046675 | Bacteria | 2280 |
| 813 | Ga0495657_0086843 | 3300046675 | Bacteria | 2014 |
| 814 | Ga0495599_0799814 | 3300046678 | Bacteria | 539 |
| 815 | Ga0495623_0058258 | 3300046679 | Bacteria | 2429 |
| 816 | Ga0495623_0202188 | 3300046679 | Bacteria | 1141 |
| 817 | Ga0495647_0094220 | 3300046681 | Bacteria | 1232 |
| 818 | Ga0495647_0415076 | 3300046681 | Bacteria | 620 |
| 819 | Ga0495658_0608099 | 3300046683 | Bacteria | 700 |
| 820 | Ga0495658_0968633 | 3300046683 | Bacteria | 543 |
| 821 | Ga0495669_0009776 | 3300046684 | Bacteria | 4050 |
| 822 | Ga0495669_0149170 | 3300046684 | Bacteria | 1106 |
| 823 | Ga0495669_0396906 | 3300046684 | Bacteria | 668 |
| 824 | Ga0495613_0095361 | 3300046689 | Bacteria | 2152 |
| 825 | Ga0495613_0113907 | 3300046689 | Bacteria | 1947 |
| 826 | Ga0495624_0548330 | 3300046690 | Bacteria | 690 |
| 827 | Ga0495670_0069129 | 3300046691 | Bacteria | 1785 |
| 828 | Ga0495671_0610553 | 3300046692 | Unclassified | 519 |
| 829 | Ga0495649_0012376 | 3300046694 | Bacteria | 4967 |
| 830 | Ga0495600_0031618 | 3300046809 | Bacteria | 3430 |
| 831 | Ga0495581_0023841 | 3300047315 | Bacteria | 3546 |
| 832 | Ga0495581_0159704 | 3300047315 | Bacteria | 1318 |
| 833 | Ga0495581_0339089 | 3300047315 | Bacteria | 878 |
| 834 | Ga0495581_0595781 | 3300047315 | Bacteria | 640 |
| 835 | Ga0495604_0035889 | 3300047317 | Bacteria | 3912 |
| 836 | Ga0495604_0832749 | 3300047317 | Unclassified | 580 |
| 837 | Ga0495636_0115522 | 3300047318 | Bacteria | 1184 |
| 838 | Ga0495674_0152527 | 3300047319 | Bacteria | 1937 |
| 839 | Ga0495674_0173918 | 3300047319 | Bacteria | 1796 |
| 840 | Ga0495687_112896 | 3300047443 | Bacteria | 995 |
| 841 | Ga0495675_0251329 | 3300047444 | Bacteria | 1062 |
| 842 | Ga0495677_0117725 | 3300047445 | Bacteria | 1012 |
| 843 | Ga0495684_0588764 | 3300047471 | Bacteria | 752 |
| 844 | Ga0495593_0011360 | 3300047673 | Bacteria | 5117 |
| 845 | Ga0495602_0185388 | 3300048088 | Bacteria | 1601 |
| 846 | Ga0495602_0251961 | 3300048088 | Bacteria | 1315 |
| 847 | Ga0496100_0056286 | 3300048903 | Bacteria | 2572 |
| 848 | Ga0496100_0310274 | 3300048903 | Bacteria | 1183 |
| 849 | Ga0496100_0791186 | 3300048903 | Bacteria | 743 |
| 850 | Ga0496100_0890180 | 3300048903 | Bacteria | 699 |
| 851 | Ga0496101_0455312 | 3300048904 | Bacteria | 1010 |
| 852 | Ga0496101_0699344 | 3300048904 | Unclassified | 800 |
| 853 | Ga0496102_0181938 | 3300048905 | Bacteria | 1981 |
| 854 | Ga0496102_0205700 | 3300048905 | Bacteria | 1856 |
| 855 | Ga0496102_0302201 | 3300048905 | Bacteria | 1508 |
| 856 | Ga0496102_0831019 | 3300048905 | Unclassified | 846 |
| 857 | Ga0496102_1290278 | 3300048905 | Bacteria | 649 |
| 858 | Ga0496102_1487496 | 3300048905 | Bacteria | 596 |
| 859 | Ga0496103_0071604 | 3300048906 | Bacteria | 2170 |
| 860 | Ga0496103_0259852 | 3300048906 | Bacteria | 1117 |
| 861 | Ga0496104_0020022 | 3300048907 | Bacteria | 6128 |
| 862 | Ga0496104_0180671 | 3300048907 | Bacteria | 2020 |
| 863 | Ga0496104_0338337 | 3300048907 | Unclassified | 1418 |
| 864 | Ga0496104_0448091 | 3300048907 | Bacteria | 1203 |
| 865 | Ga0496104_0466708 | 3300048907 | Bacteria | 1174 |
| 866 | Ga0496104_1168611 | 3300048907 | Unclassified | 673 |
| 867 | Ga0496105_0012923 | 3300048908 | Bacteria | 6617 |
| 868 | Ga0496105_0514581 | 3300048908 | Bacteria | 938 |
| 869 | Ga0496105_0827181 | 3300048908 | Bacteria | 702 |
| 870 | Ga0496106_0043194 | 3300048909 | Bacteria | 3382 |
| 871 | Ga0496106_0640928 | 3300048909 | Bacteria | 849 |
| 872 | Ga0496107_0314144 | 3300048910 | Bacteria | 1166 |
| 873 | Ga0496108_0000567 | 3300048911 | Bacteria | 28950 |
| 874 | Ga0496109_0000381 | 3300048912 | Bacteria | 40340 |
| 875 | Ga0496109_0558674 | 3300048912 | Bacteria | 1080 |
| 876 | Ga0496110_0001459 | 3300048913 | Bacteria | 17151 |
| 877 | Ga0496110_0109144 | 3300048913 | Bacteria | 2485 |
| 878 | Ga0496110_0245694 | 3300048913 | Bacteria | 1629 |
| 879 | Ga0496111_0000626 | 3300048914 | Bacteria | 18709 |
| 880 | Ga0496111_0146424 | 3300048914 | Unclassified | 1751 |
| 881 | Ga0496111_0233297 | 3300048914 | Bacteria | 1367 |
| 882 | Ga0496111_0866651 | 3300048914 | Bacteria | 651 |
| 883 | Ga0496111_0885950 | 3300048914 | Bacteria | 643 |
| 884 | Ga0496112_0000155 | 3300048915 | Bacteria | 43076 |
| 885 | Ga0496112_0047757 | 3300048915 | Bacteria | 4199 |
| 886 | Ga0496112_0053991 | 3300048915 | Bacteria | 3947 |
| 887 | Ga0496112_0093961 | 3300048915 | Bacteria | 2969 |
| 888 | Ga0496112_0233773 | 3300048915 | Bacteria | 1792 |
| 889 | Ga0496112_0292064 | 3300048915 | Bacteria | 1576 |
| 890 | Ga0496112_0300787 | 3300048915 | Bacteria | 1550 |
| 891 | Ga0496112_0449708 | 3300048915 | Bacteria | 1226 |
| 892 | Ga0496112_1009339 | 3300048915 | Bacteria | 752 |
| 893 | Ga0496113_0006644 | 3300048916 | Bacteria | 7356 |
| 894 | Ga0496113_0011591 | 3300048916 | Bacteria | 5890 |
| 895 | Ga0496113_0372393 | 3300048916 | Bacteria | 1146 |
| 896 | Ga0496114_0033318 | 3300048917 | Bacteria | 4244 |
| 897 | Ga0496114_1353977 | 3300048917 | Bacteria | 599 |
| 898 | Ga0496115_0027960 | 3300048918 | Bacteria | 4415 |
| 899 | Ga0496115_0048017 | 3300048918 | Unclassified | 3415 |
| 900 | Ga0496115_0152540 | 3300048918 | Bacteria | 1908 |
| 901 | Ga0496115_0234718 | 3300048918 | Unclassified | 1512 |
| 902 | Ga0496115_0275109 | 3300048918 | Bacteria | 1383 |
| 903 | Ga0496115_1439676 | 3300048918 | Bacteria | 507 |
| 904 | Ga0496126_0065061 | 3300048929 | Bacteria | 3264 |
| 905 | Ga0501309_022129 | 3300049129 | Unclassified | 898 |
| 906 | Ga0501305_050524 | 3300049161 | Bacteria | 697 |
| 907 | Ga0501296_027458 | 3300049519 | Bacteria | 753 |
| 908 | Ga0501299_139178 | 3300049522 | Bacteria | 602 |
| 909 | Ga0501315_051465 | 3300049531 | Bacteria | 648 |
| 910 | Ga0501333_017290 | 3300049549 | Bacteria | 557 |
| 911 | Ga0501335_016370 | 3300049551 | Bacteria | 763 |
| 912 | Ga0501073_0046676 | 3300049589 | Unclassified | 3045 |
| 913 | Ga0501206_026679 | 3300049653 | Bacteria | 845 |
| 914 | Ga0501235_071200 | 3300049669 | Bacteria | 823 |
| 915 | Ga0501235_175055 | 3300049669 | Bacteria | 569 |
| 916 | Ga0501249_029994 | 3300049679 | Bacteria | 1210 |
| 917 | Ga0501225_0160251 | 3300049705 | Bacteria | 691 |
| 918 | Ga0501229_016991 | 3300049706 | Bacteria | 948 |
| 919 | Ga0501263_051199 | 3300049760 | Bacteria | 629 |
| 920 | Ga0501273_096940 | 3300049770 | Bacteria | 507 |
| 921 | nmdc:mga05p37_10115_c1 | 3300050507 | Bacteria | 11197 |
| 922 | nmdc:mga0n895_18558_c1 | 3300050512 | Bacteria | 6440 |
| 923 | nmdc:mga0n895_68383_c1 | 3300050512 | Bacteria | 3519 |
| 924 | nmdc:mga0rr50_49336_c1 | 3300050513 | Bacteria | 2688 |
| 925 | nmdc:mga0rr50_508392_c1 | 3300050513 | Bacteria | 1025 |
| 926 | nmdc:mga08x19_168954_c1 | 3300050514 | Bacteria | 1489 |
| 927 | nmdc:mga08x19_370563_c1 | 3300050514 | Bacteria | 1002 |
| 928 | nmdc:mga08x19_3986_c1 | 3300050514 | Bacteria | 8783 |
| 929 | nmdc:mga08x19_98778_c1 | 3300050514 | Bacteria | 1934 |
| 930 | nmdc:mga0a205_12673_c1 | 3300050515 | Bacteria | 7809 |
| 931 | nmdc:mga0a205_138_c1 | 3300050515 | Bacteria | 46090 |
| 932 | Ga0495601_0189113 | 3300053077 | Bacteria | 1346 |
| 933 | Ga0500644_0023663 | 3300053088 | Bacteria | 1868 |
| 934 | Ga0500595_006210 | 3300053119 | Bacteria | 5103 |
| 935 | Ga0500595_128648 | 3300053119 | Bacteria | 713 |
| 936 | Ga0500590_121154 | 3300053148 | Bacteria | 1226 |
| 937 | Ga0500552_126184 | 3300053733 | Bacteria | 502 |
| 938 | Ga0501084_0004391 | 3300054114 | Bacteria | 11498 |
| 939 | Ga0587084_012021 | 3300059477 | Bacteria | 1164 |
| 940 | Ga0587066_012508 | 3300059490 | Bacteria | 1268 |
| 941 | Ga0587066_170406 | 3300059490 | Bacteria | 553 |
| 942 | Ga0587070_024361 | 3300059491 | Bacteria | 1047 |
| 943 | Ga0587070_098262 | 3300059491 | Unclassified | 669 |
| 944 | Ga0587073_0008143 | 3300059492 | Bacteria | 1685 |
| 945 | Ga0587077_029543 | 3300059493 | Bacteria | 1034 |
| 946 | Ga0587080_028561 | 3300059503 | Bacteria | 958 |
| 947 | Ga0587082_026454 | 3300059504 | Unclassified | 982 |
| 948 | Ga0587082_099490 | 3300059504 | Bacteria | 632 |
| 949 | Ga0587083_0006122 | 3300059505 | Bacteria | 1776 |
| 950 | Ga0587085_036869 | 3300059506 | Bacteria | 833 |
| 951 | Ga0587088_004104 | 3300059508 | Bacteria | 1818 |
| 952 | Ga0587090_034722 | 3300059510 | Bacteria | 861 |
| 953 | Ga0587091_036843 | 3300059511 | Bacteria | 946 |
| 954 | Ga0587092_006993 | 3300059512 | Bacteria | 1447 |
| 955 | Ga0587094_006626 | 3300059513 | Bacteria | 1394 |
| 956 | Ga0587106_104813 | 3300059605 | Bacteria | 582 |
| 957 | Ga0587099_065632 | 3300059622 | Bacteria | 508 |
| 958 | Ga0587109_153064 | 3300059624 | Bacteria | 571 |
| 959 | Ga0587117_025146 | 3300059627 | Bacteria | 860 |
| 960 | Ga0587128_006746 | 3300059630 | Bacteria | 1425 |
| 961 | Ga0587067_005061 | 3300059640 | Bacteria | 1760 |
| 962 | Ga0587068_015366 | 3300059641 | Bacteria | 1203 |
| 963 | Ga0587076_131193 | 3300059645 | Bacteria | 591 |
| 964 | Ga0587078_067149 | 3300059646 | Bacteria | 554 |
| 965 | Ga0587107_002951 | 3300059652 | Bacteria | 1598 |
| 966 | Ga0587107_032118 | 3300059652 | Bacteria | 805 |
| 967 | Ga0587107_097518 | 3300059652 | Bacteria | 577 |
| 968 | Ga0466962_0640818 | 3300061719 | Bacteria | 543 |
| 969 | Ga0373936_0001882 | |||
| 970 | MBSR1b_contig_6423676 | |||
| 971 | LJNas_1004295 | |||
| 972 | JGI24752J21851_1006989 | |||
| 973 | JGI24747J21853_1000334 | |||
| 974 | JGI24740J21852_10163331 | |||
| 975 | JGI24737J22298_10057670 | |||
| 976 | JGI24743J22301_10004884 | |||
| 977 | JGI24748J21848_1003696 | |||
| 978 | JGI24034J26672_10000300 | |||
| 979 | JGI24751J29686_10022314 | |||
| 980 | Ga0058863_11849724 | |||
| 981 | Ga0058861_10039244 | |||
| 982 | Ga0058861_11331319 | |||
| 983 | Ga0058862_10027191 | |||
| 984 | Ga0058862_12865494 | |||
| 985 | Ga0065712_10002796 | |||
| 986 | Ga0065715_10014238 | |||
| 987 | Ga0070658_10030803 | |||
| 988 | Ga0070658_10081977 | |||
| 989 | Ga0070658_10161650 | |||
| 990 | Ga0070658_10777073 | |||
| 991 | Ga0070676_10003407 | |||
| 992 | Ga0070676_10032048 | |||
| 993 | Ga0070676_10629736 | |||
| 994 | Ga0070683_100002453 | |||
| 995 | Ga0070683_100303138 | |||
| 996 | Ga0070683_100466988 | |||
| 997 | Ga0070683_101029858 | |||
| 998 | Ga0070690_100235094 | |||
| 999 | Ga0070690_101076658 | |||
| 1000 | Ga0070670_100005793 | |||
| 1001 | Ga0070677_10007787 | |||
| 1002 | Ga0068869_100010958 | |||
| 1003 | Ga0068869_100040153 | |||
| 1004 | Ga0068869_100867264 | |||
| 1005 | Ga0070666_10013820 | |||
| 1006 | Ga0070666_10285489 | |||
| 1007 | Ga0070666_10426632 | |||
| 1008 | Ga0070680_100181803 | |||
| 1009 | Ga0070680_100217906 | |||
| 1010 | Ga0070680_100323947 | |||
| 1011 | Ga0070680_100558249 | |||
| 1012 | Ga0070680_100646764 | |||
| 1013 | Ga0070682_100715102 | |||
| 1014 | Ga0068868_100006740 | |||
| 1015 | Ga0068868_100043782 | |||
| 1016 | Ga0068868_100106212 | |||
| 1017 | Ga0068868_100166842 | |||
| 1018 | Ga0068868_100206219 | |||
| 1019 | Ga0070660_100001122 | |||
| 1020 | Ga0070660_100088455 | |||
| 1021 | Ga0070689_100201215 | |||
| 1022 | Ga0070691_10893583 | |||
| 1023 | Ga0070687_100019471 | |||
| 1024 | Ga0070661_100000564 | |||
| 1025 | Ga0070668_100001144 | |||
| 1026 | Ga0070668_100144757 | |||
| 1027 | Ga0070669_101679109 | |||
| 1028 | Ga0070675_100184220 | |||
| 1029 | Ga0070671_100075918 | |||
| 1030 | Ga0070671_100549278 | |||
| 1031 | Ga0070671_100625169 | |||
| 1032 | Ga0070674_100002008 | |||
| 1033 | Ga0070673_100930541 | |||
| 1034 | Ga0070688_100019665 | |||
| 1035 | Ga0070659_100005729 | |||
| 1036 | Ga0070659_100427721 | |||
| 1037 | Ga0070659_100797223 | |||
| 1038 | Ga0070667_100114921 | |||
| 1039 | Ga0070667_100150403 | |||
| 1040 | Ga0070667_100295138 | |||
| 1041 | Ga0070709_10009431 | |||
| 1042 | Ga0070709_10147042 | |||
| 1043 | Ga0070709_10194794 | |||
| 1044 | Ga0070709_10245832 | |||
| 1045 | Ga0070709_11125741 | |||
| 1046 | Ga0070709_11276291 | |||
| 1047 | Ga0070714_100026290 | |||
| 1048 | Ga0070714_100087113 | |||
| 1049 | Ga0070714_100178408 | |||
| 1050 | Ga0070714_100445325 | |||
| 1051 | Ga0070714_100536299 | |||
| 1052 | Ga0070714_100642940 | |||
| 1053 | Ga0070714_100675281 | |||
| 1054 | Ga0070714_101776354 | |||
| 1055 | Ga0070714_102084559 | |||
| 1056 | Ga0070713_100000210 | |||
| 1057 | Ga0070713_100086548 | |||
| 1058 | Ga0070713_100160369 | |||
| 1059 | Ga0070713_100377029 | |||
| 1060 | Ga0070713_100489303 | |||
| 1061 | Ga0070713_100603795 | |||
| 1062 | Ga0070713_100884580 | |||
| 1063 | Ga0070713_100922096 | |||
| 1064 | Ga0070713_100948697 | |||
| 1065 | Ga0070713_101153181 | |||
| 1066 | Ga0070710_10018125 | |||
| 1067 | Ga0070710_10493877 | |||
| 1068 | Ga0070710_10631741 | |||
| 1069 | Ga0070701_10040945 | |||
| 1070 | Ga0070711_100294731 | |||
| 1071 | Ga0070711_100570637 | |||
| 1072 | Ga0070711_100700850 | |||
| 1073 | Ga0070711_101470826 | |||
| 1074 | Ga0070700_100327769 | |||
| 1075 | Ga0070708_100044284 | |||
| 1076 | Ga0070708_100066850 | |||
| 1077 | Ga0070708_101804364 | |||
| 1078 | Ga0070708_102105060 | |||
| 1079 | Ga0070663_100002461 | |||
| 1080 | Ga0070663_101430017 | |||
| 1081 | Ga0070678_100912489 | |||
| 1082 | Ga0070662_100015050 | |||
| 1083 | Ga0070662_100041714 | |||
| 1084 | Ga0070681_10026540 | |||
| 1085 | Ga0070681_10034026 | |||
| 1086 | Ga0070681_10102481 | |||
| 1087 | Ga0070681_10917154 | |||
| 1088 | Ga0068867_100001261 | |||
| 1089 | Ga0068867_100740585 | |||
| 1090 | Ga0070685_10021659 | |||
| 1091 | Ga0070685_10168872 | |||
| 1092 | Ga0070685_10759406 | |||
| 1093 | Ga0070706_100172653 | |||
| 1094 | Ga0070706_100183206 | |||
| 1095 | Ga0070707_100133174 | |||
| 1096 | Ga0070707_100397400 | |||
| 1097 | Ga0070698_100044545 | |||
| 1098 | Ga0070698_100506137 | |||
| 1099 | Ga0070699_100040014 | |||
| 1100 | Ga0070699_100114726 | |||
| 1101 | Ga0070699_100359343 | |||
| 1102 | Ga0070679_100018174 | |||
| 1103 | Ga0070679_100080687 | |||
| 1104 | Ga0070679_100204106 | |||
| 1105 | Ga0070679_100377190 | |||
| 1106 | Ga0070679_100871879 | |||
| 1107 | Ga0070684_100005354 | |||
| 1108 | Ga0070684_100012659 | |||
| 1109 | Ga0070697_100177375 | |||
| 1110 | Ga0070697_100669477 | |||
| 1111 | Ga0070697_100970793 | |||
| 1112 | Ga0068853_100033720 | |||
| 1113 | Ga0068853_100096611 | |||
| 1114 | Ga0068853_100476407 | |||
| 1115 | Ga0068853_100987020 | |||
| 1116 | Ga0070672_100005865 | |||
| 1117 | Ga0070672_100657684 | |||
| 1118 | Ga0070695_100291544 | |||
| 1119 | Ga0070696_100026277 | |||
| 1120 | Ga0070696_100685307 | |||
| 1121 | Ga0070693_100111078 | |||
| 1122 | Ga0070693_100380756 | |||
| 1123 | Ga0070693_100645455 | |||
| 1124 | Ga0070665_100184106 | |||
| 1125 | Ga0070665_100330253 | |||
| 1126 | Ga0070665_101094261 | |||
| 1127 | Ga0068855_100014420 | |||
| 1128 | Ga0068855_100155676 | |||
| 1129 | Ga0068855_100188661 | |||
| 1130 | Ga0068855_102261250 | |||
| 1131 | Ga0070664_100017825 | |||
| 1132 | Ga0070664_100723414 | |||
| 1133 | Ga0068857_100001804 | |||
| 1134 | Ga0068857_100628756 | |||
| 1135 | Ga0068854_100011944 | |||
| 1136 | Ga0068854_100055189 | |||
| 1137 | Ga0068854_100091633 | |||
| 1138 | Ga0068854_100368744 | |||
| 1139 | Ga0068854_100457445 | |||
| 1140 | Ga0068856_100019441 | |||
| 1141 | Ga0068856_100129767 | |||
| 1142 | Ga0068856_100332771 | |||
| 1143 | Ga0070702_100010582 | |||
| 1144 | Ga0068852_100012326 | |||
| 1145 | Ga0068852_100013526 | |||
| 1146 | Ga0068852_100067475 | |||
| 1147 | Ga0068852_100590189 | |||
| 1148 | Ga0068852_100654167 | |||
| 1149 | Ga0068852_101708501 | |||
| 1150 | Ga0068859_100046420 | |||
| 1151 | Ga0068859_100170098 | |||
| 1152 | Ga0068859_101743301 | |||
| 1153 | Ga0068864_101303793 | |||
| 1154 | Ga0068864_102119200 | |||
| 1155 | Ga0068866_10000704 | |||
| 1156 | Ga0068861_100012795 | |||
| 1157 | Ga0068861_100344522 | |||
| 1158 | Ga0068851_10003100 | |||
| 1159 | Ga0068851_10042941 | |||
| 1160 | Ga0068870_10003817 | |||
| 1161 | Ga0068863_100129767 | |||
| 1162 | Ga0068863_100273051 | |||
| 1163 | Ga0068858_100011541 | |||
| 1164 | Ga0068858_100088156 | |||
| 1165 | Ga0068858_100420262 | |||
| 1166 | Ga0068858_100515139 | |||
| 1167 | Ga0068858_101831545 | |||
| 1168 | Ga0068860_100209134 | |||
| 1169 | Ga0068860_100302269 | |||
| 1170 | Ga0068860_101266729 | |||
| 1171 | Ga0068860_101377304 | |||
| 1172 | Ga0068862_100006124 | |||
| 1173 | Ga0068862_100032502 | |||
| 1174 | Ga0068862_100353777 | |||
| 1175 | Ga0068862_102365671 | |||
| 1176 | Ga0081540_1054160 | |||
| 1177 | Ga0070717_10001841 | |||
| 1178 | Ga0070717_10040224 | |||
| 1179 | Ga0070717_10166163 | |||
| 1180 | Ga0070717_10193502 | |||
| 1181 | Ga0070717_10209917 | |||
| 1182 | Ga0070717_10210373 | |||
| 1183 | Ga0070717_10318603 | |||
| 1184 | Ga0070717_10364152 | |||
| 1185 | Ga0070717_10779229 | |||
| 1186 | Ga0070717_10893259 | |||
| 1187 | Ga0070715_10403809 | |||
| 1188 | Ga0070715_10404291 | |||
| 1189 | Ga0070716_100000092 | |||
| 1190 | Ga0070716_100073852 | |||
| 1191 | Ga0070716_100168807 | |||
| 1192 | Ga0070716_100686568 | |||
| 1193 | Ga0070716_101684484 | |||
| 1194 | Ga0070712_100000378 | |||
| 1195 | Ga0070712_100012528 | |||
| 1196 | Ga0070712_100018289 | |||
| 1197 | Ga0070712_100614538 | |||
| 1198 | Ga0070712_101115508 | |||
| 1199 | Ga0097621_100021106 | |||
| 1200 | Ga0097621_100372777 | |||
| 1201 | Ga0097621_100803666 | |||
| 1202 | Ga0097621_101823867 | |||
| 1203 | Ga0097621_101843980 | |||
| 1204 | Ga0068871_100002744 | |||
| 1205 | Ga0068871_100057567 | |||
| 1206 | Ga0068871_100245394 | |||
| 1207 | Ga0075433_10000043 | |||
| 1208 | Ga0075433_10009837 | |||
| 1209 | Ga0075434_100034730 | |||
| 1210 | Ga0075434_100071309 | |||
| 1211 | Ga0075434_100306995 | |||
| 1212 | Ga0075434_100687276 | |||
| 1213 | Ga0075434_100815238 | |||
| 1214 | Ga0068865_100000360 | |||
| 1215 | Ga0068865_100039225 | |||
| 1216 | Ga0075436_100003096 | |||
| 1217 | Ga0075436_100017024 | |||
| 1218 | Ga0075436_100091013 | |||
| 1219 | Ga0075436_100213404 | |||
| 1220 | Ga0097620_100046419 | |||
| 1221 | Ga0097620_100170099 | |||
| 1222 | Ga0097620_101743152 | |||
| 1223 | Ga0075435_100080968 | |||
| 1224 | Ga0075435_100471363 | |||
| 1225 | Ga0099795_10048287 | |||
| 1226 | Ga0105250_10030679 | |||
| 1227 | Ga0105240_10376751 | |||
| 1228 | Ga0105240_10432559 | |||
| 1229 | Ga0105240_10565920 | |||
| 1230 | Ga0105240_10685704 | |||
| 1231 | Ga0105240_12493166 | |||
| 1232 | Ga0105245_10001223 | |||
| 1233 | Ga0105245_10001566 | |||
| 1234 | Ga0105245_10153860 | |||
| 1235 | Ga0105245_10751824 | |||
| 1236 | Ga0105247_10001727 | |||
| 1237 | Ga0105247_10104141 | |||
| 1238 | Ga0105247_10208705 | |||
| 1239 | Ga0105247_10822816 | |||
| 1240 | Ga0114129_10000781 | |||
| 1241 | Ga0114129_11621587 | |||
| 1242 | Ga0105243_10466088 | |||
| 1243 | Ga0105241_10000850 | |||
| 1244 | Ga0105241_10031446 | |||
| 1245 | Ga0105241_10321265 | |||
| 1246 | Ga0105241_10387727 | |||
| 1247 | Ga0105241_10803997 | |||
| 1248 | Ga0105242_10017731 | |||
| 1249 | Ga0105242_10025494 | |||
| 1250 | Ga0105248_10000049 | |||
| 1251 | Ga0105248_10034758 | |||
| 1252 | Ga0105248_10068617 | |||
| 1253 | Ga0105248_10330802 | |||
| 1254 | Ga0105248_10565508 | |||
| 1255 | Ga0105237_10026777 | |||
| 1256 | Ga0105237_10256371 | |||
| 1257 | Ga0105237_10338234 | |||
| 1258 | Ga0105237_10484413 | |||
| 1259 | Ga0105237_11212380 | |||
| 1260 | Ga0105238_10012857 | |||
| 1261 | Ga0105238_10023891 | |||
| 1262 | Ga0105238_10300523 | |||
| 1263 | Ga0105238_10394486 | |||
| 1264 | Ga0105249_10013666 | |||
| 1265 | Ga0105249_10527090 | |||
| 1266 | Ga0105249_11828601 | |||
| 1267 | Ga0105239_10109917 | |||
| 1268 | Ga0105239_10140740 | |||
| 1269 | Ga0105239_10311904 | |||
| 1270 | Ga0105239_10998201 | |||
| 1271 | Ga0105246_10000398 | |||
| 1272 | Ga0105246_10426778 | |||
| 1273 | Ga0157327_1037631 | |||
| 1274 | Ga0157326_1072809 | |||
| 1275 | Ga0157373_10001863 | |||
| 1276 | Ga0157373_10280777 | |||
| 1277 | Ga0157373_10982674 | |||
| 1278 | Ga0157371_10013471 | |||
| 1279 | Ga0157371_10810508 | |||
| 1280 | Ga0157370_10052832 | |||
| 1281 | Ga0157370_10742517 | |||
| 1282 | Ga0157370_10769704 | |||
| 1283 | Ga0157370_10810490 | |||
| 1284 | Ga0157369_10025390 | |||
| 1285 | Ga0157369_10350755 | |||
| 1286 | Ga0157369_10423240 | |||
| 1287 | Ga0157369_10607285 | |||
| 1288 | Ga0157369_10759812 | |||
| 1289 | Ga0157369_11453264 | |||
| 1290 | Ga0157374_10003070 | |||
| 1291 | Ga0157374_10028082 | |||
| 1292 | Ga0157374_10100126 | |||
| 1293 | Ga0157374_10286755 | |||
| 1294 | Ga0157374_10292940 | |||
| 1295 | Ga0157374_10531639 | |||
| 1296 | Ga0157374_12332093 | |||
| 1297 | Ga0157378_10000614 | |||
| 1298 | Ga0157378_10164067 | |||
| 1299 | Ga0157378_10435763 | |||
| 1300 | Ga0157378_10770601 | |||
| 1301 | Ga0163162_10015784 | |||
| 1302 | Ga0163162_10412033 | |||
| 1303 | Ga0163162_11225099 | |||
| 1304 | Ga0157372_10003527 | |||
| 1305 | Ga0157372_10071658 | |||
| 1306 | Ga0157372_10187027 | |||
| 1307 | Ga0157372_10199360 | |||
| 1308 | Ga0157372_10208329 | |||
| 1309 | Ga0157372_10298220 | |||
| 1310 | Ga0157372_10456562 | |||
| 1311 | Ga0157372_10721805 | |||
| 1312 | Ga0157372_11001051 | |||
| 1313 | Ga0157375_10031801 | |||
| 1314 | Ga0157375_10066975 | |||
| 1315 | Ga0157375_11007410 | |||
| 1316 | Ga0157375_11438227 | |||
| 1317 | Ga0163163_10001132 | |||
| 1318 | Ga0163163_10074112 | |||
| 1319 | Ga0163163_10159276 | |||
| 1320 | Ga0163163_10211482 | |||
| 1321 | Ga0163163_10332405 | |||
| 1322 | Ga0163163_11487631 | |||
| 1323 | Ga0182008_10031123 | |||
| 1324 | Ga0157377_10000687 | |||
| 1325 | Ga0157379_10011232 | |||
| 1326 | Ga0157379_10046061 | |||
| 1327 | Ga0157379_10070780 | |||
| 1328 | Ga0157379_10214800 | |||
| 1329 | Ga0157379_10514582 | |||
| 1330 | Ga0157379_11972907 | |||
| 1331 | Ga0157376_10002306 | |||
| 1332 | Ga0157376_10151570 | |||
| 1333 | Ga0157376_10280266 | |||
| 1334 | Ga0157376_10981403 | |||
| 1335 | Ga0157376_11142996 | |||
| 1336 | Ga0182006_1187634 | |||
| 1337 | Ga0182007_10008202 | |||
| 1338 | Ga0163161_10002007 | |||
| 1339 | Ga0163161_10099159 | |||
| 1340 | Ga0197907_10594095 | |||
| 1341 | Ga0206356_10018591 | |||
| 1342 | Ga0206356_11176297 | |||
| 1343 | Ga0206349_1107756 | |||
| 1344 | Ga0206355_1478285 | |||
| 1345 | Ga0206351_10222754 | |||
| 1346 | Ga0206351_10267943 | |||
| 1347 | Ga0206352_10508850 | |||
| 1348 | Ga0206352_11161229 | |||
| 1349 | Ga0206350_10223250 | |||
| 1350 | Ga0206354_11433773 | |||
| 1351 | Ga0206353_11208826 | |||
| 1352 | Ga0154015_1422066 | |||
| 1353 | Ga0154015_1591588 | |||
| 1354 | Ga0213872_10044302 | |||
| 1355 | Ga0213872_10169330 | |||
| 1356 | Ga0213874_10006229 | |||
| 1357 | Ga0224712_10181959 | |||
| 1358 | Ga0224572_1000022 | |||
| 1359 | Ga0224572_1003717 | |||
| 1360 | Ga0228598_1000081 | |||
| 1361 | Ga0228598_1002944 | |||
| 1362 | Ga0207697_10003550 | |||
| 1363 | Ga0207697_10258254 | |||
| 1364 | Ga0207656_10032090 | |||
| 1365 | Ga0207656_10490471 | |||
| 1366 | Ga0207696_1020727 | |||
| 1367 | Ga0207682_10009137 | |||
| 1368 | Ga0207692_10012753 | |||
| 1369 | Ga0207692_10200973 | |||
| 1370 | Ga0207692_10507706 | |||
| 1371 | Ga0207692_10556092 | |||
| 1372 | Ga0207642_10037831 | |||
| 1373 | Ga0207710_10110921 | |||
| 1374 | Ga0207688_10002004 | |||
| 1375 | Ga0207688_10549786 | |||
| 1376 | Ga0207680_10022274 | |||
| 1377 | Ga0207680_10091523 | |||
| 1378 | Ga0207647_10002606 | |||
| 1379 | Ga0207647_10028343 | |||
| 1380 | Ga0207647_10215459 | |||
| 1381 | Ga0207685_10209937 | |||
| 1382 | Ga0207685_10308544 | |||
| 1383 | Ga0207699_10000693 | |||
| 1384 | Ga0207699_10067773 | |||
| 1385 | Ga0207699_10079232 | |||
| 1386 | Ga0207699_10428281 | |||
| 1387 | Ga0207699_10553547 | |||
| 1388 | Ga0207645_10001595 | |||
| 1389 | Ga0207645_10015447 | |||
| 1390 | Ga0207645_10494711 | |||
| 1391 | Ga0207643_10000412 | |||
| 1392 | Ga0207705_10142771 | |||
| 1393 | Ga0207705_10761347 | |||
| 1394 | Ga0207705_11030358 | |||
| 1395 | Ga0207684_10159432 | |||
| 1396 | Ga0207684_10278476 | |||
| 1397 | Ga0207684_11715167 | |||
| 1398 | Ga0207654_10000452 | |||
| 1399 | Ga0207654_10090530 | |||
| 1400 | Ga0207654_10183713 | |||
| 1401 | Ga0207654_10978451 | |||
| 1402 | Ga0207707_10178811 | |||
| 1403 | Ga0207707_10218250 | |||
| 1404 | Ga0207707_10218458 | |||
| 1405 | Ga0207695_10167991 | |||
| 1406 | Ga0207671_10036230 | |||
| 1407 | Ga0207671_10322948 | |||
| 1408 | Ga0207671_10549824 | |||
| 1409 | Ga0207671_10660557 | |||
| 1410 | Ga0207671_11179304 | |||
| 1411 | Ga0207693_10000654 | |||
| 1412 | Ga0207693_10241516 | |||
| 1413 | Ga0207693_10855007 | |||
| 1414 | Ga0207693_11347757 | |||
| 1415 | Ga0207663_10003322 | |||
| 1416 | Ga0207663_10053435 | |||
| 1417 | Ga0207663_10251377 | |||
| 1418 | Ga0207663_10800120 | |||
| 1419 | Ga0207663_10991688 | |||
| 1420 | Ga0207663_11021111 | |||
| 1421 | Ga0207660_10569943 | |||
| 1422 | Ga0207662_10044181 | |||
| 1423 | Ga0207657_10016548 | |||
| 1424 | Ga0207657_10025075 | |||
| 1425 | Ga0207649_10018886 | |||
| 1426 | Ga0207652_10019824 | |||
| 1427 | Ga0207652_10036806 | |||
| 1428 | Ga0207652_10236516 | |||
| 1429 | Ga0207646_10045419 | |||
| 1430 | Ga0207646_10286980 | |||
| 1431 | Ga0207646_10407323 | |||
| 1432 | Ga0207681_10013517 | |||
| 1433 | Ga0207694_10045647 | |||
| 1434 | Ga0207694_10842611 | |||
| 1435 | Ga0207694_10904581 | |||
| 1436 | Ga0207650_10000024 | |||
| 1437 | Ga0207659_10097151 | |||
| 1438 | Ga0207687_10138749 | |||
| 1439 | Ga0207700_10000153 | |||
| 1440 | Ga0207700_10166872 | |||
| 1441 | Ga0207700_10288768 | |||
| 1442 | Ga0207700_10368248 | |||
| 1443 | Ga0207700_10388952 | |||
| 1444 | Ga0207700_10407955 | |||
| 1445 | Ga0207700_10685368 | |||
| 1446 | Ga0207700_10917555 | |||
| 1447 | Ga0207700_11103548 | |||
| 1448 | Ga0207664_10048088 | |||
| 1449 | Ga0207664_10083602 | |||
| 1450 | Ga0207664_10124267 | |||
| 1451 | Ga0207664_10328608 | |||
| 1452 | Ga0207664_10502491 | |||
| 1453 | Ga0207664_10569478 | |||
| 1454 | Ga0207664_11191378 | |||
| 1455 | Ga0207664_11516966 | |||
| 1456 | Ga0207644_10018628 | |||
| 1457 | Ga0207644_11073756 | |||
| 1458 | Ga0207690_10013645 | |||
| 1459 | Ga0207690_10305880 | |||
| 1460 | Ga0207706_10003335 | |||
| 1461 | Ga0207706_10013816 | |||
| 1462 | Ga0207686_10017600 | |||
| 1463 | Ga0207686_10088617 | |||
| 1464 | Ga0207669_10170532 | |||
| 1465 | Ga0207704_10007325 | |||
| 1466 | Ga0207704_10343747 | |||
| 1467 | Ga0207704_10974069 | |||
| 1468 | Ga0207704_11377445 | |||
| 1469 | Ga0207665_10000088 | |||
| 1470 | Ga0207665_10094231 | |||
| 1471 | Ga0207665_10242071 | |||
| 1472 | Ga0207665_10267491 | |||
| 1473 | Ga0207665_10546588 | |||
| 1474 | Ga0207665_11048620 | |||
| 1475 | Ga0207691_10000072 | |||
| 1476 | Ga0207691_10142711 | |||
| 1477 | Ga0207711_10000033 | |||
| 1478 | Ga0207711_10036610 | |||
| 1479 | Ga0207711_10037942 | |||
| 1480 | Ga0207711_10044186 | |||
| 1481 | Ga0207711_10331039 | |||
| 1482 | Ga0207711_10589651 | |||
| 1483 | Ga0207689_10001019 | |||
| 1484 | Ga0207689_10001565 | |||
| 1485 | Ga0207689_10142307 | |||
| 1486 | Ga0207661_10001629 | |||
| 1487 | Ga0207661_10367466 | |||
| 1488 | Ga0207679_10000040 | |||
| 1489 | Ga0207679_11592627 | |||
| 1490 | Ga0207667_10001031 | |||
| 1491 | Ga0207667_10117659 | |||
| 1492 | Ga0207667_10140954 | |||
| 1493 | Ga0207667_10148825 | |||
| 1494 | Ga0207667_10513437 | |||
| 1495 | Ga0207651_10009325 | |||
| 1496 | Ga0207651_10116662 | |||
| 1497 | Ga0207651_11705709 | |||
| 1498 | Ga0207712_10014438 | |||
| 1499 | Ga0207712_11665320 | |||
| 1500 | Ga0207668_10064463 | |||
| 1501 | Ga0207640_10126199 | |||
| 1502 | Ga0207640_10128541 | |||
| 1503 | Ga0207640_10244915 | |||
| 1504 | Ga0207640_10665644 | |||
| 1505 | Ga0207658_10003060 | |||
| 1506 | Ga0207658_10022176 | |||
| 1507 | Ga0207658_10079860 | |||
| 1508 | Ga0207658_10607130 | |||
| 1509 | Ga0207677_10159804 | |||
| 1510 | Ga0207677_10191675 | |||
| 1511 | Ga0207677_11010385 | |||
| 1512 | Ga0207677_11515726 | |||
| 1513 | Ga0207677_12063834 | |||
| 1514 | Ga0207703_10064276 | |||
| 1515 | Ga0207703_10121040 | |||
| 1516 | Ga0207703_11187777 | |||
| 1517 | Ga0207703_11476475 | |||
| 1518 | Ga0207639_10038333 | |||
| 1519 | Ga0207639_10051922 | |||
| 1520 | Ga0207639_10370821 | |||
| 1521 | Ga0207639_10474809 | |||
| 1522 | Ga0207639_11462238 | |||
| 1523 | Ga0207678_10002689 | |||
| 1524 | Ga0207678_10981749 | |||
| 1525 | Ga0207708_10186198 | |||
| 1526 | Ga0207702_10046122 | |||
| 1527 | Ga0207702_10955544 | |||
| 1528 | Ga0207702_12086522 | |||
| 1529 | Ga0207702_12132240 | |||
| 1530 | Ga0207641_10000030 | |||
| 1531 | Ga0207641_10108830 | |||
| 1532 | Ga0207641_10726778 | |||
| 1533 | Ga0207641_10727175 | |||
| 1534 | Ga0207641_11268160 | |||
| 1535 | Ga0207648_10001749 | |||
| 1536 | Ga0207648_10130465 | |||
| 1537 | Ga0207648_10136542 | |||
| 1538 | Ga0207676_10000256 | |||
| 1539 | Ga0207676_10080394 | |||
| 1540 | Ga0207676_10538470 | |||
| 1541 | Ga0207674_10002761 | |||
| 1542 | Ga0207674_10089173 | |||
| 1543 | Ga0207674_10213431 | |||
| 1544 | Ga0207675_100023344 | |||
| 1545 | Ga0207675_100214257 | |||
| 1546 | Ga0207683_10000662 | |||
| 1547 | Ga0207683_10007099 | |||
| 1548 | Ga0207698_10076142 | |||
| 1549 | Ga0207698_11364487 | |||
| 1550 | Ga0207698_11690525 | |||
| 1551 | Ga0207698_12366873 | |||
| 1552 | Ga0209179_1057280 | |||
| 1553 | Ga0209998_10010126 | |||
| 1554 | Ga0268266_10019872 | |||
| 1555 | Ga0268266_10056161 | |||
| 1556 | Ga0268266_11528394 | |||
| 1557 | Ga0268266_12174480 | |||
| 1558 | Ga0268265_10021245 | |||
| 1559 | Ga0268265_10438142 | |||
| 1560 | Ga0268265_12163399 | |||
| 1561 | Ga0268264_10011416 | |||
| 1562 | Ga0268264_10245188 | |||
| 1563 | Ga0268264_10578701 | |||
| 1564 | Ga0268264_11139659 | |||
| 1565 | Ga0268264_12623672 | |||
| 1566 | Ga0265318_10302152 | |||
| 1567 | Ga0265338_10004259 | |||
| 1568 | Ga0265338_10264831 | |||
| 1569 | Ga0265338_10460408 | |||
| 1570 | Ga0265324_10053436 | |||
| 1571 | Ga0265762_1119499 | |||
| 1572 | Ga0265770_1044778 | |||
| 1573 | Ga0265765_1009707 | |||
| 1574 | Ga0265760_10001267 | |||
| 1575 | Ga0265760_10012359 | |||
| 1576 | Ga0265760_10030716 | |||
| 1577 | Ga0265760_10048857 | |||
| 1578 | Ga0265760_10052625 | |||
| 1579 | Ga0265760_10186138 | |||
| 1580 | Ga0265330_10000346 | |||
| 1581 | Ga0265330_10007123 | |||
| 1582 | Ga0265330_10059264 | |||
| 1583 | Ga0265330_10073196 | |||
| 1584 | Ga0265330_10165942 | |||
| 1585 | Ga0265330_10321276 | |||
| 1586 | Ga0265332_10005285 | |||
| 1587 | Ga0265332_10040700 | |||
| 1588 | Ga0265328_10003354 | |||
| 1589 | Ga0265325_10000582 | |||
| 1590 | Ga0265325_10003036 | |||
| 1591 | Ga0265325_10049084 | |||
| 1592 | Ga0265329_10016146 | |||
| 1593 | Ga0265340_10001936 | |||
| 1594 | Ga0265340_10004114 | |||
| 1595 | Ga0265340_10324234 | |||
| 1596 | Ga0265339_10006462 | |||
| 1597 | Ga0265339_10006757 | |||
| 1598 | Ga0265339_10017622 | |||
| 1599 | Ga0265339_10135945 | |||
| 1600 | Ga0265339_10264508 | |||
| 1601 | Ga0265331_10025594 | |||
| 1602 | Ga0265331_10097360 | |||
| 1603 | Ga0265331_10333600 | |||
| 1604 | Ga0265327_10214377 | |||
| 1605 | Ga0265316_10000726 | |||
| 1606 | Ga0265316_10002223 | |||
| 1607 | Ga0265316_10006636 | |||
| 1608 | Ga0265316_10012858 | |||
| 1609 | Ga0265316_10032480 | |||
| 1610 | Ga0265316_10271618 | |||
| 1611 | Ga0265316_10401878 | |||
| 1612 | Ga0265316_10910827 | |||
| 1613 | Ga0307408_100213448 | |||
| 1614 | Ga0307408_100552336 | |||
| 1615 | Ga0307408_100654930 | |||
| 1616 | Ga0265313_10001185 | |||
| 1617 | Ga0265313_10019287 | |||
| 1618 | Ga0265314_10000067 | |||
| 1619 | Ga0265314_10033014 | |||
| 1620 | Ga0265314_10198517 | |||
| 1621 | Ga0265314_10582410 | |||
| 1622 | Ga0265342_10000741 | |||
| 1623 | Ga0265342_10001898 | |||
| 1624 | Ga0265342_10071874 | |||
| 1625 | Ga0265342_10119373 | |||
| 1626 | Ga0265342_10263251 | |||
| 1627 | Ga0307405_11192648 | |||
| 1628 | Ga0307413_10115937 | |||
| 1629 | Ga0307413_10473606 | |||
| 1630 | Ga0307410_10005772 | |||
| 1631 | Ga0307410_10301095 | |||
| 1632 | Ga0307406_10083797 | |||
| 1633 | Ga0307406_10834678 | |||
| 1634 | Ga0307412_11444174 | |||
| 1635 | Ga0307412_11718984 | |||
| 1636 | Ga0307412_11953179 | |||
| 1637 | Ga0307409_100202555 | |||
| 1638 | Ga0307416_100071903 | |||
| 1639 | Ga0307416_100318418 | |||
| 1640 | Ga0307414_10638328 | |||
| 1641 | Ga0307414_11545170 | |||
| 1642 | Ga0307411_10167045 | |||
| 1643 | Ga0307411_12086309 | |||
| 1644 | Ga0307415_100134954 | |||
| 1645 | Ga0307415_100943882 | |||
| 1646 | Ga0316583_10031683 | |||
| 1647 | Ga0373926_0294953 | |||
| 1648 | Ga0373934_0041735 | |||
| 1649 | Ga0373934_0168632 | |||
| 1650 | Ga0373944_0124707 | |||
| 1651 | Ga0373923_0236351 | |||
| 1652 | Ga0373923_0360056 | |||
| 1653 | Ga0373945_0002364 | |||
| 1654 | Ga0373953_0278638 | |||
| 1655 | Ga0373953_0471555 | |||
| 1656 | Ga0373954_0178100 | |||
| 1657 | Ga0373954_0465906 | |||
| 1658 | Ga0373956_0090837 | |||
| 1659 | Ga0373957_0117008 | |||
| 1660 | Ga0373943_0002553 | |||
| 1661 | Ga0373946_0004426 | |||
| 1662 | Ga0373946_0075254 | |||
| 1663 | Ga0373955_0014255 | |||
| 1664 | Ga0373955_0577905 | |||
| 1665 | Ga0373931_0684838 | |||
| 1666 | Ga0373931_1190547 | |||
| 1667 | Ga0373935_0250334 | |||
| 1668 | Ga0373927_0065639 | |||
| 1669 | Ga0373927_0167471 | |||
| 1670 | Ga0373933_0173428 | |||
| 1671 | Ga0373933_0451592 | |||
| 1672 | Ga0373947_0599801 | |||
| 1673 | Ga0373947_0637450 | |||
| 1674 | Ga0373937_0009655 | |||
| 1675 | Ga0373937_0158038 | |||
| 1676 | Ga0373937_0230610 | |||
| 1677 | Ga0373937_0292867 | |||
| 1678 | Ga0373937_0367956 | |||
| 1679 | Ga0373937_1144338 | |||
| 1680 | Ga0373937_1510246 | |||
| 1681 | Ga0265778_003161 | |||
| 1682 | Ga0373925_0024161 | |||
| 1683 | Ga0373925_0026433 | |||
| 1684 | Ga0373925_0216397 | |||
| 1685 | Ga0373925_0281961 | |||
| 1686 | Ga0373925_0613969 | |||
| 1687 | Ga0395900_1075301 | |||
| 1688 | Ga0395905_0625910 | |||
| 1689 | Ga0395905_1705552 | |||
| 1690 | Ga0395901_0500645 | |||
| 1691 | Ga0395901_0700807 | |||
| 1692 | Ga0436365_0624994 | |||
| 1693 | Ga0436365_0837639 | |||
| 1694 | Ga0436365_0903852 | |||
| 1695 | Ga0436360_0139949 | |||
| 1696 | Ga0436360_0152286 | |||
| 1697 | Ga0436360_0792118 | |||
| 1698 | Ga0436360_0943434 | |||
| 1699 | Ga0436360_1258478 | |||
| 1700 | Ga0436361_0258027 | |||
| 1701 | Ga0436361_0887686 | |||
| 1702 | Ga0436361_1169155 | |||
| 1703 | Ga0436363_0267088 | |||
| 1704 | Ga0436363_0276301 | |||
| 1705 | Ga0436363_0491074 | |||
| 1706 | Ga0436363_0614486 | |||
| 1707 | Ga0436363_1376765 | |||
| 1708 | Ga0436362_1122765 | |||
| 1709 | Ga0451577_2025560 | |||
| 1710 | Ga0453683_0755309 | |||
| 1711 | Ga0466965_0219124 | |||
| 1712 | Ga0466966_0183609 | |||
| 1713 | Ga0466966_0761941 | |||
| 1714 | Ga0466961_0654972 | |||
| 1715 | Ga0466963_0028800 | |||
| 1716 | Ga0466963_0111333 | |||
| 1717 | Ga0466964_0158339 | |||
| 1718 | Ga0466957_0169608 | |||
| 1719 | Ga0466957_0320173 | |||
| 1720 | Ga0466959_0055610 | |||
| 1721 | Ga0466959_0079482 | |||
| 1722 | Ga0466958_1007715 | |||
| 1723 | Ga0466967_0082587 | |||
| 1724 | Ga0466967_0108084 | |||
| 1725 | Ga0466967_0224412 | |||
| 1726 | Ga0466967_0834407 | |||
| 1727 | Ga0466967_1767194 | |||
| 1728 | Ga0466967_2268097 | |||
| 1729 | Ga0495603_0163158 | |||
| 1730 | Ga0495629_0031645 | |||
| 1731 | Ga0495629_0767031 | |||
| 1732 | Ga0495651_0076691 | |||
| 1733 | Ga0495651_0554501 | |||
| 1734 | Ga0495580_0003281 | |||
| 1735 | Ga0495580_0012850 | |||
| 1736 | Ga0495580_0023629 | |||
| 1737 | Ga0495580_0180506 | |||
| 1738 | Ga0495580_0226616 | |||
| 1739 | Ga0495580_0290944 | |||
| 1740 | Ga0495580_0572150 | |||
| 1741 | Ga0495582_0225831 | |||
| 1742 | Ga0495582_0472795 | |||
| 1743 | Ga0495582_0575605 | |||
| 1744 | Ga0495639_0086970 | |||
| 1745 | Ga0495662_0141645 | |||
| 1746 | Ga0495585_0441717 | |||
| 1747 | Ga0495594_0049707 | |||
| 1748 | Ga0495594_0106110 | |||
| 1749 | Ga0495594_0176039 | |||
| 1750 | Ga0495608_0114226 | |||
| 1751 | Ga0495608_0563620 | |||
| 1752 | Ga0495628_0061195 | |||
| 1753 | Ga0495628_0441342 | |||
| 1754 | Ga0495630_0027742 | |||
| 1755 | Ga0495630_0784447 | |||
| 1756 | Ga0495637_0057017 | |||
| 1757 | Ga0495643_0058243 | |||
| 1758 | Ga0495666_0100021 | |||
| 1759 | Ga0495666_0320855 | |||
| 1760 | Ga0495666_0358655 | |||
| 1761 | Ga0495666_0467349 | |||
| 1762 | Ga0495642_0042339 | |||
| 1763 | Ga0495652_0504419 | |||
| 1764 | Ga0495652_0881563 | |||
| 1765 | Ga0495652_1067392 | |||
| 1766 | Ga0495665_0006124 | |||
| 1767 | Ga0495665_0103002 | |||
| 1768 | Ga0495665_0641397 | |||
| 1769 | Ga0495665_0655455 | |||
| 1770 | Ga0495640_0764151 | |||
| 1771 | Ga0495587_0060996 | |||
| 1772 | Ga0495667_0149102 | |||
| 1773 | Ga0495667_0625144 | |||
| 1774 | Ga0495668_0079030 | |||
| 1775 | Ga0495668_0139089 | |||
| 1776 | Ga0495635_0111022 | |||
| 1777 | Ga0495635_0116768 | |||
| 1778 | Ga0495659_0009637 | |||
| 1779 | Ga0495588_0436728 | |||
| 1780 | Ga0495657_0070739 | |||
| 1781 | Ga0495657_0086843 | |||
| 1782 | Ga0495599_0799814 | |||
| 1783 | Ga0495623_0058258 | |||
| 1784 | Ga0495623_0202188 | |||
| 1785 | Ga0495647_0094220 | |||
| 1786 | Ga0495647_0415076 | |||
| 1787 | Ga0495658_0608099 | |||
| 1788 | Ga0495658_0968633 | |||
| 1789 | Ga0495669_0009776 | |||
| 1790 | Ga0495669_0149170 | |||
| 1791 | Ga0495669_0396906 | |||
| 1792 | Ga0495613_0095361 | |||
| 1793 | Ga0495613_0113907 | |||
| 1794 | Ga0495624_0548330 | |||
| 1795 | Ga0495670_0069129 | |||
| 1796 | Ga0495671_0610553 | |||
| 1797 | Ga0495649_0012376 | |||
| 1798 | Ga0495600_0031618 | |||
| 1799 | Ga0495581_0023841 | |||
| 1800 | Ga0495581_0159704 | |||
| 1801 | Ga0495581_0339089 | |||
| 1802 | Ga0495581_0595781 | |||
| 1803 | Ga0495604_0035889 | |||
| 1804 | Ga0495604_0832749 | |||
| 1805 | Ga0495636_0115522 | |||
| 1806 | Ga0495674_0152527 | |||
| 1807 | Ga0495674_0173918 | |||
| 1808 | Ga0495687_112896 | |||
| 1809 | Ga0495675_0251329 | |||
| 1810 | Ga0495677_0117725 | |||
| 1811 | Ga0495684_0588764 | |||
| 1812 | Ga0495593_0011360 | |||
| 1813 | Ga0495602_0185388 | |||
| 1814 | Ga0495602_0251961 | |||
| 1815 | Ga0496100_0056286 | |||
| 1816 | Ga0496100_0310274 | |||
| 1817 | Ga0496100_0791186 | |||
| 1818 | Ga0496100_0890180 | |||
| 1819 | Ga0496101_0455312 | |||
| 1820 | Ga0496101_0699344 | |||
| 1821 | Ga0496102_0181938 | |||
| 1822 | Ga0496102_0205700 | |||
| 1823 | Ga0496102_0302201 | |||
| 1824 | Ga0496102_0831019 | |||
| 1825 | Ga0496102_1290278 | |||
| 1826 | Ga0496102_1487496 | |||
| 1827 | Ga0496103_0071604 | |||
| 1828 | Ga0496103_0259852 | |||
| 1829 | Ga0496104_0020022 | |||
| 1830 | Ga0496104_0180671 | |||
| 1831 | Ga0496104_0338337 | |||
| 1832 | Ga0496104_0448091 | |||
| 1833 | Ga0496104_0466708 | |||
| 1834 | Ga0496104_1168611 | |||
| 1835 | Ga0496105_0012923 | |||
| 1836 | Ga0496105_0514581 | |||
| 1837 | Ga0496105_0827181 | |||
| 1838 | Ga0496106_0043194 | |||
| 1839 | Ga0496106_0640928 | |||
| 1840 | Ga0496107_0314144 | |||
| 1841 | Ga0496108_0000567 | |||
| 1842 | Ga0496109_0000381 | |||
| 1843 | Ga0496109_0558674 | |||
| 1844 | Ga0496110_0001459 | |||
| 1845 | Ga0496110_0109144 | |||
| 1846 | Ga0496110_0245694 | |||
| 1847 | Ga0496111_0000626 | |||
| 1848 | Ga0496111_0146424 | |||
| 1849 | Ga0496111_0233297 | |||
| 1850 | Ga0496111_0866651 | |||
| 1851 | Ga0496111_0885950 | |||
| 1852 | Ga0496112_0000155 | |||
| 1853 | Ga0496112_0047757 | |||
| 1854 | Ga0496112_0053991 | |||
| 1855 | Ga0496112_0093961 | |||
| 1856 | Ga0496112_0233773 | |||
| 1857 | Ga0496112_0292064 | |||
| 1858 | Ga0496112_0300787 | |||
| 1859 | Ga0496112_0449708 | |||
| 1860 | Ga0496112_1009339 | |||
| 1861 | Ga0496113_0006644 | |||
| 1862 | Ga0496113_0011591 | |||
| 1863 | Ga0496113_0372393 | |||
| 1864 | Ga0496114_0033318 | |||
| 1865 | Ga0496114_1353977 | |||
| 1866 | Ga0496115_0027960 | |||
| 1867 | Ga0496115_0048017 | |||
| 1868 | Ga0496115_0152540 | |||
| 1869 | Ga0496115_0234718 | |||
| 1870 | Ga0496115_0275109 | |||
| 1871 | Ga0496115_1439676 | |||
| 1872 | Ga0496126_0065061 | |||
| 1873 | Ga0501309_022129 | |||
| 1874 | Ga0501305_050524 | |||
| 1875 | Ga0501296_027458 | |||
| 1876 | Ga0501299_139178 | |||
| 1877 | Ga0501315_051465 | |||
| 1878 | Ga0501333_017290 | |||
| 1879 | Ga0501335_016370 | |||
| 1880 | Ga0501073_0046676 | |||
| 1881 | Ga0501206_026679 | |||
| 1882 | Ga0501235_071200 | |||
| 1883 | Ga0501235_175055 | |||
| 1884 | Ga0501249_029994 | |||
| 1885 | Ga0501225_0160251 | |||
| 1886 | Ga0501229_016991 | |||
| 1887 | Ga0501263_051199 | |||
| 1888 | Ga0501273_096940 | |||
| 1889 | nmdc:mga05p37_10115_c1 | |||
| 1890 | nmdc:mga0n895_18558_c1 | |||
| 1891 | nmdc:mga0n895_68383_c1 | |||
| 1892 | nmdc:mga0rr50_49336_c1 | |||
| 1893 | nmdc:mga0rr50_508392_c1 | |||
| 1894 | nmdc:mga08x19_168954_c1 | |||
| 1895 | nmdc:mga08x19_370563_c1 | |||
| 1896 | nmdc:mga08x19_3986_c1 | |||
| 1897 | nmdc:mga08x19_98778_c1 | |||
| 1898 | nmdc:mga0a205_12673_c1 | |||
| 1899 | nmdc:mga0a205_138_c1 | |||
| 1900 | Ga0495601_0189113 | |||
| 1901 | Ga0500644_0023663 | |||
| 1902 | Ga0500595_006210 | |||
| 1903 | Ga0500595_128648 | |||
| 1904 | Ga0500590_121154 | |||
| 1905 | Ga0500552_126184 | |||
| 1906 | Ga0501084_0004391 | |||
| 1907 | Ga0587084_012021 | |||
| 1908 | Ga0587066_012508 | |||
| 1909 | Ga0587066_170406 | |||
| 1910 | Ga0587070_024361 | |||
| 1911 | Ga0587070_098262 | |||
| 1912 | Ga0587073_0008143 | |||
| 1913 | Ga0587077_029543 | |||
| 1914 | Ga0587080_028561 | |||
| 1915 | Ga0587082_026454 | |||
| 1916 | Ga0587082_099490 | |||
| 1917 | Ga0587083_0006122 | |||
| 1918 | Ga0587085_036869 | |||
| 1919 | Ga0587088_004104 | |||
| 1920 | Ga0587090_034722 | |||
| 1921 | Ga0587091_036843 | |||
| 1922 | Ga0587092_006993 | |||
| 1923 | Ga0587094_006626 | |||
| 1924 | Ga0587106_104813 | |||
| 1925 | Ga0587099_065632 | |||
| 1926 | Ga0587109_153064 | |||
| 1927 | Ga0587117_025146 | |||
| 1928 | Ga0587128_006746 | |||
| 1929 | Ga0587067_005061 | |||
| 1930 | Ga0587068_015366 | |||
| 1931 | Ga0587076_131193 | |||
| 1932 | Ga0587078_067149 | |||
| 1933 | Ga0587107_002951 | |||
| 1934 | Ga0587107_032118 | |||
| 1935 | Ga0587107_097518 | |||
| 1936 | Ga0466962_0640818 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v48-assembly1.cif.gz_AO | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.8751 | 51 | 116 |
| 1gyz-assembly1.cif.gz_A | bacterial ribosomal protein l20 from aquifex aeolicus | 0.8637 | 61 | 117 |
| 2ghj-assembly1.cif.gz_A | crystal structure of folded and partially unfolded forms of aquifex aeolicus ribosomal protein l20 | 0.8539 | 21 | 117 |
| 6z1p-assembly1.cif.gz_Au | structure of the mitochondrial ribosome from tetrahymena thermophila | 0.8435 | 33 | 117 |
| 4v48-assembly1.cif.gz_AO | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.8413 | 51 | 116 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ghjD02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.9622 | 53 | 118 | 1.10.1900.20 |
| 2ghjD02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.9084 | 53 | 118 | 1.10.1900.20 |
| 2ghjB02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.9026 | 58 | 117 | 1.10.1900.20 |
| 1gyzA00 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.8637 | 61 | 117 | 1.10.1900.20 |
| 1gyzA00 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.8145 | 61 | 117 | 1.10.1900.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A357L7L9-F1-model_v4 | Large ribosomal subunit protein bL20 (50S ribosomal protein L20) | 1.009 | 61 | 117 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1G9GV44-F1-model_v4 | deleted | 1.009 | 64 | 117 |
|
| AF-A0A354QTS7-F1-model_v4 | Large ribosomal subunit protein bL20 (50S ribosomal protein L20) | 1.008 | 53 | 117 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A7Y7CN64-F1-model_v4 | Large ribosomal subunit protein bL20 (50S ribosomal protein L20) | 1.008 | 64 | 117 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-G6EM08-F1-model_v4 | deleted | 1.007 | 57 | 117 |
|