F487048

General Info

Members Datasets Scaffolds Average Seq Length
968 404 1936 121

Family's Representative Sequence

Representative Sequence 3300035113|Ga0373936_0001882|Ga0373936_0001882_3353_3808
Length 146
Sequence VPASSEQGPKTFPASRDNRRESGNKKREQHMPRVKRGTKKKILERASGYFLTKSKLYRAAKESVERGLKFAYSGRKQKKRQYRSIWIVRIGAASRAQGISYNQFISGLKKAGVELDRKILADIATNDSAGFIALCETAKRANSKAA

Samples

Sample ID Description Type Environment
1 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
100 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
115 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
131 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
137 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
144 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
145 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
147 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
220 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
221 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
222 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
227 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
228 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
229 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
230 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
231 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
232 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
233 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
234 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
235 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
236 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
237 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
238 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
239 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
240 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
241 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
242 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
243 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
244 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
245 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
246 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
247 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
248 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
249 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
250 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
251 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
252 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
253 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
254 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
255 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
256 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
257 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
258 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
259 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
260 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
261 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
262 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
263 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
264 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
265 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
266 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
267 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
268 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
269 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
271 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
272 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
273 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
274 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
275 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
276 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
277 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
278 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
279 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
280 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
281 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
282 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
283 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
284 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
285 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
286 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
287 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
288 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
289 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
290 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
291 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
292 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
293 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
294 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
295 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
296 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
297 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
298 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
299 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
300 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
301 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
302 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
303 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
304 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
305 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
306 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
307 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
308 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
309 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
310 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
311 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
312 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
313 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
314 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
315 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
316 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
317 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
318 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
319 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
320 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
321 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
322 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
323 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
324 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
325 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
326 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
327 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
328 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
329 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
330 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
331 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
332 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
333 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
334 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
335 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
336 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
337 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
338 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
341 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
342 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
343 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
344 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
345 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
346 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
347 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
348 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
349 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
350 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
351 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
352 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
353 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
354 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
357 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
358 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
362 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
363 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
364 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
365 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
366 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
367 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
368 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
369 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
370 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
371 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
372 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
373 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
374 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
375 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
376 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
377 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
378 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
379 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
380 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.39
Metatranscriptomes 6.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 5.89
Rhizosphere 92.56
Stem 0
Stem Tuber 0
Unclassified 9.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373936_0001882 3300035113 Bacteria 7748
2 MBSR1b_contig_6423676 2162886012 Unclassified 979
3 LJNas_1004295 3300000546 Bacteria 1584
4 JGI24752J21851_1006989 3300001976 Bacteria 1474
5 JGI24747J21853_1000334 3300001978 Unclassified 2732
6 JGI24740J21852_10163331 3300001979 Unclassified 552
7 JGI24737J22298_10057670 3300001990 Unclassified 1172
8 JGI24743J22301_10004884 3300001991 Bacteria 2209
9 JGI24748J21848_1003696 3300002074 Bacteria 1748
10 JGI24034J26672_10000300 3300002239 Bacteria 6538
11 JGI24751J29686_10022314 3300002459 Bacteria 1313
12 Ga0058863_11849724 3300004799 Bacteria 768
13 Ga0058861_10039244 3300004800 Unclassified 738
14 Ga0058861_11331319 3300004800 Bacteria 843
15 Ga0058862_10027191 3300004803 Bacteria 2039
16 Ga0058862_12865494 3300004803 Bacteria 732
17 Ga0065712_10002796 3300005290 Bacteria 5908
18 Ga0065715_10014238 3300005293 Bacteria 3019
19 Ga0070658_10030803 3300005327 Bacteria 4309
20 Ga0070658_10081977 3300005327 Bacteria 2650
21 Ga0070658_10161650 3300005327 Bacteria 1879
22 Ga0070658_10777073 3300005327 Bacteria 832
23 Ga0070676_10003407 3300005328 Bacteria 8277
24 Ga0070676_10032048 3300005328 Bacteria 3008
25 Ga0070676_10629736 3300005328 Unclassified 776
26 Ga0070683_100002453 3300005329 Bacteria 14754
27 Ga0070683_100303138 3300005329 Bacteria 1520
28 Ga0070683_100466988 3300005329 Bacteria 1205
29 Ga0070683_101029858 3300005329 Bacteria 790
30 Ga0070690_100235094 3300005330 Bacteria 1290
31 Ga0070690_101076658 3300005330 Bacteria 637
32 Ga0070670_100005793 3300005331 Bacteria 10441
33 Ga0070677_10007787 3300005333 Bacteria 3588
34 Ga0068869_100010958 3300005334 Bacteria 5935
35 Ga0068869_100040153 3300005334 Unclassified 3345
36 Ga0068869_100867264 3300005334 Bacteria 779
37 Ga0070666_10013820 3300005335 Bacteria 5130
38 Ga0070666_10285489 3300005335 Bacteria 1174
39 Ga0070666_10426632 3300005335 Bacteria 956
40 Ga0070680_100181803 3300005336 Bacteria 1771
41 Ga0070680_100217906 3300005336 Bacteria 1610
42 Ga0070680_100323947 3300005336 Unclassified 1308
43 Ga0070680_100558249 3300005336 Bacteria 982
44 Ga0070680_100646764 3300005336 Bacteria 909
45 Ga0070682_100715102 3300005337 Bacteria 805
46 Ga0068868_100006740 3300005338 Bacteria 8156
47 Ga0068868_100043782 3300005338 Bacteria 3497
48 Ga0068868_100106212 3300005338 Bacteria 2277
49 Ga0068868_100166842 3300005338 Bacteria 1821
50 Ga0068868_100206219 3300005338 Bacteria 1641
51 Ga0070660_100001122 3300005339 Bacteria 18053
52 Ga0070660_100088455 3300005339 Bacteria 2439
53 Ga0070689_100201215 3300005340 Bacteria 1626
54 Ga0070691_10893583 3300005341 Bacteria 547
55 Ga0070687_100019471 3300005343 Unclassified 3158
56 Ga0070661_100000564 3300005344 Bacteria 28146
57 Ga0070668_100001144 3300005347 Bacteria 18673
58 Ga0070668_100144757 3300005347 Bacteria 1917
59 Ga0070669_101679109 3300005353 Unclassified 553
60 Ga0070675_100184220 3300005354 Bacteria 1806
61 Ga0070671_100075918 3300005355 Bacteria 2807
62 Ga0070671_100549278 3300005355 Bacteria 996
63 Ga0070671_100625169 3300005355 Unclassified 931
64 Ga0070674_100002008 3300005356 Bacteria 11143
65 Ga0070673_100930541 3300005364 Unclassified 807
66 Ga0070688_100019665 3300005365 Bacteria 3915
67 Ga0070659_100005729 3300005366 Bacteria 8945
68 Ga0070659_100427721 3300005366 Bacteria 1120
69 Ga0070659_100797223 3300005366 Bacteria 821
70 Ga0070667_100114921 3300005367 Bacteria 2337
71 Ga0070667_100150403 3300005367 Bacteria 2045
72 Ga0070667_100295138 3300005367 Bacteria 1458
73 Ga0070709_10009431 3300005434 Bacteria 5386
74 Ga0070709_10147042 3300005434 Bacteria 1625
75 Ga0070709_10194794 3300005434 Bacteria 1432
76 Ga0070709_10245832 3300005434 Bacteria 1287
77 Ga0070709_11125741 3300005434 Bacteria 629
78 Ga0070709_11276291 3300005434 Bacteria 592
79 Ga0070714_100026290 3300005435 Bacteria 4809
80 Ga0070714_100087113 3300005435 Bacteria 2731
81 Ga0070714_100178408 3300005435 Bacteria 1931
82 Ga0070714_100445325 3300005435 Unclassified 1230
83 Ga0070714_100536299 3300005435 Bacteria 1119
84 Ga0070714_100642940 3300005435 Bacteria 1021
85 Ga0070714_100675281 3300005435 Bacteria 996
86 Ga0070714_101776354 3300005435 Bacteria 602
87 Ga0070714_102084559 3300005435 Unclassified 553
88 Ga0070713_100000210 3300005436 Bacteria 38839
89 Ga0070713_100086548 3300005436 Bacteria 2687
90 Ga0070713_100160369 3300005436 Bacteria 2007
91 Ga0070713_100377029 3300005436 Bacteria 1321
92 Ga0070713_100489303 3300005436 Bacteria 1160
93 Ga0070713_100603795 3300005436 Bacteria 1043
94 Ga0070713_100884580 3300005436 Bacteria 859
95 Ga0070713_100922096 3300005436 Bacteria 841
96 Ga0070713_100948697 3300005436 Bacteria 828
97 Ga0070713_101153181 3300005436 Bacteria 750
98 Ga0070710_10018125 3300005437 Bacteria 3617
99 Ga0070710_10493877 3300005437 Bacteria 837
100 Ga0070710_10631741 3300005437 Unclassified 749
101 Ga0070701_10040945 3300005438 Unclassified 2358
102 Ga0070711_100294731 3300005439 Bacteria 1288
103 Ga0070711_100570637 3300005439 Bacteria 941
104 Ga0070711_100700850 3300005439 Bacteria 852
105 Ga0070711_101470826 3300005439 Bacteria 594
106 Ga0070700_100327769 3300005441 Unclassified 1127
107 Ga0070708_100044284 3300005445 Bacteria 3913
108 Ga0070708_100066850 3300005445 Unclassified 3226
109 Ga0070708_101804364 3300005445 Bacteria 568
110 Ga0070708_102105060 3300005445 Unclassified 522
111 Ga0070663_100002461 3300005455 Bacteria 10439
112 Ga0070663_101430017 3300005455 Bacteria 613
113 Ga0070678_100912489 3300005456 Bacteria 803
114 Ga0070662_100015050 3300005457 Bacteria 5175
115 Ga0070662_100041714 3300005457 Bacteria 3275
116 Ga0070681_10026540 3300005458 Bacteria 5822
117 Ga0070681_10034026 3300005458 Bacteria 5118
118 Ga0070681_10102481 3300005458 Bacteria 2807
119 Ga0070681_10917154 3300005458 Bacteria 795
120 Ga0068867_100001261 3300005459 Bacteria 17470
121 Ga0068867_100740585 3300005459 Bacteria 871
122 Ga0070685_10021659 3300005466 Unclassified 3496
123 Ga0070685_10168872 3300005466 Bacteria 1400
124 Ga0070685_10759406 3300005466 Unclassified 712
125 Ga0070706_100172653 3300005467 Bacteria 2018
126 Ga0070706_100183206 3300005467 Bacteria 1956
127 Ga0070707_100133174 3300005468 Bacteria 2417
128 Ga0070707_100397400 3300005468 Bacteria 1338
129 Ga0070698_100044545 3300005471 Bacteria 4543
130 Ga0070698_100506137 3300005471 Unclassified 1146
131 Ga0070699_100040014 3300005518 Bacteria 4060
132 Ga0070699_100114726 3300005518 Bacteria 2367
133 Ga0070699_100359343 3300005518 Bacteria 1313
134 Ga0070679_100018174 3300005530 Bacteria 6817
135 Ga0070679_100080687 3300005530 Bacteria 3243
136 Ga0070679_100204106 3300005530 Bacteria 1941
137 Ga0070679_100377190 3300005530 Unclassified 1365
138 Ga0070679_100871879 3300005530 Bacteria 844
139 Ga0070684_100005354 3300005535 Bacteria 9833
140 Ga0070684_100012659 3300005535 Bacteria 6767
141 Ga0070697_100177375 3300005536 Bacteria 1805
142 Ga0070697_100669477 3300005536 Bacteria 915
143 Ga0070697_100970793 3300005536 Bacteria 755
144 Ga0068853_100033720 3300005539 Bacteria 4344
145 Ga0068853_100096611 3300005539 Bacteria 2607
146 Ga0068853_100476407 3300005539 Bacteria 1176
147 Ga0068853_100987020 3300005539 Bacteria 810
148 Ga0070672_100005865 3300005543 Bacteria 8192
149 Ga0070672_100657684 3300005543 Bacteria 915
150 Ga0070695_100291544 3300005545 Unclassified 1203
151 Ga0070696_100026277 3300005546 Bacteria 3961
152 Ga0070696_100685307 3300005546 Bacteria 834
153 Ga0070693_100111078 3300005547 Bacteria 1686
154 Ga0070693_100380756 3300005547 Bacteria 973
155 Ga0070693_100645455 3300005547 Bacteria 769
156 Ga0070665_100184106 3300005548 Bacteria 2089
157 Ga0070665_100330253 3300005548 Bacteria 1529
158 Ga0070665_101094261 3300005548 Bacteria 808
159 Ga0068855_100014420 3300005563 Bacteria 9514
160 Ga0068855_100155676 3300005563 Bacteria 2596
161 Ga0068855_100188661 3300005563 Bacteria 2326
162 Ga0068855_102261250 3300005563 Bacteria 545
163 Ga0070664_100017825 3300005564 Bacteria 5831
164 Ga0070664_100723414 3300005564 Bacteria 928
165 Ga0068857_100001804 3300005577 Bacteria 17223
166 Ga0068857_100628756 3300005577 Bacteria 1016
167 Ga0068854_100011944 3300005578 Bacteria 5675
168 Ga0068854_100055189 3300005578 Bacteria 2859
169 Ga0068854_100091633 3300005578 Bacteria 2263
170 Ga0068854_100368744 3300005578 Bacteria 1180
171 Ga0068854_100457445 3300005578 Bacteria 1067
172 Ga0068856_100019441 3300005614 Bacteria 6592
173 Ga0068856_100129767 3300005614 Bacteria 2525
174 Ga0068856_100332771 3300005614 Bacteria 1536
175 Ga0070702_100010582 3300005615 Bacteria 4551
176 Ga0068852_100012326 3300005616 Bacteria 6485
177 Ga0068852_100013526 3300005616 Bacteria 6245
178 Ga0068852_100067475 3300005616 Bacteria 3127
179 Ga0068852_100590189 3300005616 Bacteria 1114
180 Ga0068852_100654167 3300005616 Bacteria 1059
181 Ga0068852_101708501 3300005616 Bacteria 652
182 Ga0068859_100046420 3300005617 Bacteria 4362
183 Ga0068859_100170098 3300005617 Bacteria 2260
184 Ga0068859_101743301 3300005617 Unclassified 688
185 Ga0068864_101303793 3300005618 Unclassified 726
186 Ga0068864_102119200 3300005618 Bacteria 569
187 Ga0068866_10000704 3300005718 Bacteria 15225
188 Ga0068861_100012795 3300005719 Bacteria 5859
189 Ga0068861_100344522 3300005719 Bacteria 1305
190 Ga0068851_10003100 3300005834 Bacteria 7362
191 Ga0068851_10042941 3300005834 Bacteria 2277
192 Ga0068870_10003817 3300005840 Bacteria 6417
193 Ga0068863_100129767 3300005841 Bacteria 2406
194 Ga0068863_100273051 3300005841 Bacteria 1637
195 Ga0068858_100011541 3300005842 Bacteria 8335
196 Ga0068858_100088156 3300005842 Bacteria 2887
197 Ga0068858_100420262 3300005842 Bacteria 1286
198 Ga0068858_100515139 3300005842 Bacteria 1156
199 Ga0068858_101831545 3300005842 Bacteria 600
200 Ga0068860_100209134 3300005843 Bacteria 1892
201 Ga0068860_100302269 3300005843 Bacteria 1568
202 Ga0068860_101266729 3300005843 Unclassified 758
203 Ga0068860_101377304 3300005843 Unclassified 726
204 Ga0068862_100006124 3300005844 Bacteria 10011
205 Ga0068862_100032502 3300005844 Bacteria 4409
206 Ga0068862_100353777 3300005844 Bacteria 1363
207 Ga0068862_102365671 3300005844 Unclassified 543
208 Ga0081540_1054160 3300005983 Bacteria 1962
209 Ga0070717_10001841 3300006028 Bacteria 14816
210 Ga0070717_10040224 3300006028 Bacteria 3807
211 Ga0070717_10166163 3300006028 Bacteria 1917
212 Ga0070717_10193502 3300006028 Bacteria 1778
213 Ga0070717_10209917 3300006028 Bacteria 1708
214 Ga0070717_10210373 3300006028 Bacteria 1707
215 Ga0070717_10318603 3300006028 Bacteria 1385
216 Ga0070717_10364152 3300006028 Bacteria 1295
217 Ga0070717_10779229 3300006028 Bacteria 870
218 Ga0070717_10893259 3300006028 Bacteria 809
219 Ga0070715_10403809 3300006163 Unclassified 760
220 Ga0070715_10404291 3300006163 Unclassified 760
221 Ga0070716_100000092 3300006173 Bacteria 35441
222 Ga0070716_100073852 3300006173 Bacteria 2013
223 Ga0070716_100168807 3300006173 Unclassified 1426
224 Ga0070716_100686568 3300006173 Bacteria 781
225 Ga0070716_101684484 3300006173 Bacteria 523
226 Ga0070712_100000378 3300006175 Bacteria 25332
227 Ga0070712_100012528 3300006175 Bacteria 5390
228 Ga0070712_100018289 3300006175 Bacteria 4549
229 Ga0070712_100614538 3300006175 Bacteria 921
230 Ga0070712_101115508 3300006175 Bacteria 685
231 Ga0097621_100021106 3300006237 Bacteria 5030
232 Ga0097621_100372777 3300006237 Bacteria 1273
233 Ga0097621_100803666 3300006237 Bacteria 871
234 Ga0097621_101823867 3300006237 Bacteria 580
235 Ga0097621_101843980 3300006237 Bacteria 577
236 Ga0068871_100002744 3300006358 Bacteria 12025
237 Ga0068871_100057567 3300006358 Bacteria 3162
238 Ga0068871_100245394 3300006358 Bacteria 1558
239 Ga0075433_10000043 3300006852 Bacteria 51513
240 Ga0075433_10009837 3300006852 Bacteria 7664
241 Ga0075434_100034730 3300006871 Bacteria 4982
242 Ga0075434_100071309 3300006871 Bacteria 3466
243 Ga0075434_100306995 3300006871 Bacteria 1607
244 Ga0075434_100687276 3300006871 Bacteria 1041
245 Ga0075434_100815238 3300006871 Bacteria 949
246 Ga0068865_100000360 3300006881 Bacteria 25145
247 Ga0068865_100039225 3300006881 Bacteria 3211
248 Ga0075436_100003096 3300006914 Bacteria 11404
249 Ga0075436_100017024 3300006914 Bacteria 4976
250 Ga0075436_100091013 3300006914 Bacteria 2121
251 Ga0075436_100213404 3300006914 Bacteria 1369
252 Ga0097620_100046419 3300006931 Bacteria 4362
253 Ga0097620_100170099 3300006931 Bacteria 2260
254 Ga0097620_101743152 3300006931 Unclassified 688
255 Ga0075435_100080968 3300007076 Bacteria 2667
256 Ga0075435_100471363 3300007076 Bacteria 1084
257 Ga0099795_10048287 3300007788 Bacteria 1540
258 Ga0105250_10030679 3300009092 Bacteria 2161
259 Ga0105240_10376751 3300009093 Bacteria 1603
260 Ga0105240_10432559 3300009093 Bacteria 1476
261 Ga0105240_10565920 3300009093 Bacteria 1256
262 Ga0105240_10685704 3300009093 Bacteria 1120
263 Ga0105240_12493166 3300009093 Bacteria 535
264 Ga0105245_10001223 3300009098 Bacteria 23189
265 Ga0105245_10001566 3300009098 Bacteria 20749
266 Ga0105245_10153860 3300009098 Bacteria 2177
267 Ga0105245_10751824 3300009098 Bacteria 1011
268 Ga0105247_10001727 3300009101 Bacteria 15386
269 Ga0105247_10104141 3300009101 Bacteria 1817
270 Ga0105247_10208705 3300009101 Bacteria 1316
271 Ga0105247_10822816 3300009101 Bacteria 710
272 Ga0114129_10000781 3300009147 Bacteria 40732
273 Ga0114129_11621587 3300009147 Unclassified 791
274 Ga0105243_10466088 3300009148 Bacteria 1189
275 Ga0105241_10000850 3300009174 Bacteria 23148
276 Ga0105241_10031446 3300009174 Bacteria 3975
277 Ga0105241_10321265 3300009174 Bacteria 1335
278 Ga0105241_10387727 3300009174 Bacteria 1222
279 Ga0105241_10803997 3300009174 Bacteria 866
280 Ga0105242_10017731 3300009176 Bacteria 5553
281 Ga0105242_10025494 3300009176 Bacteria 4679
282 Ga0105248_10000049 3300009177 Bacteria 153741
283 Ga0105248_10034758 3300009177 Bacteria 5639
284 Ga0105248_10068617 3300009177 Bacteria 3981
285 Ga0105248_10330802 3300009177 Bacteria 1716
286 Ga0105248_10565508 3300009177 Bacteria 1283
287 Ga0105237_10026777 3300009545 Bacteria 5892
288 Ga0105237_10256371 3300009545 Bacteria 1751
289 Ga0105237_10338234 3300009545 Bacteria 1510
290 Ga0105237_10484413 3300009545 Bacteria 1243
291 Ga0105237_11212380 3300009545 Bacteria 761
292 Ga0105238_10012857 3300009551 Bacteria 8447
293 Ga0105238_10023891 3300009551 Bacteria 6230
294 Ga0105238_10300523 3300009551 Bacteria 1589
295 Ga0105238_10394486 3300009551 Bacteria 1376
296 Ga0105249_10013666 3300009553 Bacteria 7169
297 Ga0105249_10527090 3300009553 Bacteria 1229
298 Ga0105249_11828601 3300009553 Bacteria 680
299 Ga0105239_10109917 3300010375 Bacteria 3056
300 Ga0105239_10140740 3300010375 Bacteria 2688
301 Ga0105239_10311904 3300010375 Bacteria 1773
302 Ga0105239_10998201 3300010375 Bacteria 962
303 Ga0105246_10000398 3300011119 Bacteria 23279
304 Ga0105246_10426778 3300011119 Bacteria 1108
305 Ga0157327_1037631 3300012512 Bacteria 636
306 Ga0157326_1072809 3300012513 Unclassified 548
307 Ga0157373_10001863 3300013100 Bacteria 15980
308 Ga0157373_10280777 3300013100 Bacteria 1180
309 Ga0157373_10982674 3300013100 Bacteria 629
310 Ga0157371_10013471 3300013102 Bacteria 6207
311 Ga0157371_10810508 3300013102 Bacteria 706
312 Ga0157370_10052832 3300013104 Bacteria 3877
313 Ga0157370_10742517 3300013104 Bacteria 894
314 Ga0157370_10769704 3300013104 Unclassified 877
315 Ga0157370_10810490 3300013104 Bacteria 852
316 Ga0157369_10025390 3300013105 Bacteria 6578
317 Ga0157369_10350755 3300013105 Bacteria 1532
318 Ga0157369_10423240 3300013105 Bacteria 1380
319 Ga0157369_10607285 3300013105 Bacteria 1129
320 Ga0157369_10759812 3300013105 Bacteria 997
321 Ga0157369_11453264 3300013105 Bacteria 698
322 Ga0157374_10003070 3300013296 Bacteria 14003
323 Ga0157374_10028082 3300013296 Bacteria 5081
324 Ga0157374_10100126 3300013296 Bacteria 2777
325 Ga0157374_10286755 3300013296 Bacteria 1626
326 Ga0157374_10292940 3300013296 Bacteria 1609
327 Ga0157374_10531639 3300013296 Unclassified 1182
328 Ga0157374_12332093 3300013296 Bacteria 562
329 Ga0157378_10000614 3300013297 Bacteria 33505
330 Ga0157378_10164067 3300013297 Bacteria 2080
331 Ga0157378_10435763 3300013297 Bacteria 1298
332 Ga0157378_10770601 3300013297 Bacteria 986
333 Ga0163162_10015784 3300013306 Bacteria 7381
334 Ga0163162_10412033 3300013306 Bacteria 1484
335 Ga0163162_11225099 3300013306 Bacteria 852
336 Ga0157372_10003527 3300013307 Bacteria 16855
337 Ga0157372_10071658 3300013307 Bacteria 3903
338 Ga0157372_10187027 3300013307 Bacteria 2398
339 Ga0157372_10199360 3300013307 Bacteria 2319
340 Ga0157372_10208329 3300013307 Bacteria 2265
341 Ga0157372_10298220 3300013307 Bacteria 1875
342 Ga0157372_10456562 3300013307 Bacteria 1489
343 Ga0157372_10721805 3300013307 Unclassified 1159
344 Ga0157372_11001051 3300013307 Bacteria 968
345 Ga0157375_10031801 3300013308 Bacteria 4996
346 Ga0157375_10066975 3300013308 Bacteria 3587
347 Ga0157375_11007410 3300013308 Bacteria 972
348 Ga0157375_11438227 3300013308 Unclassified 813
349 Ga0163163_10001132 3300014325 Bacteria 22642
350 Ga0163163_10074112 3300014325 Bacteria 3395
351 Ga0163163_10159276 3300014325 Bacteria 2302
352 Ga0163163_10211482 3300014325 Bacteria 1989
353 Ga0163163_10332405 3300014325 Bacteria 1574
354 Ga0163163_11487631 3300014325 Bacteria 738
355 Ga0182008_10031123 3300014497 Bacteria 2687
356 Ga0157377_10000687 3300014745 Bacteria 13986
357 Ga0157379_10011232 3300014968 Bacteria 7801
358 Ga0157379_10046061 3300014968 Bacteria 3893
359 Ga0157379_10070780 3300014968 Bacteria 3121
360 Ga0157379_10214800 3300014968 Bacteria 1742
361 Ga0157379_10514582 3300014968 Bacteria 1110
362 Ga0157379_11972907 3300014968 Bacteria 576
363 Ga0157376_10002306 3300014969 Bacteria 12892
364 Ga0157376_10151570 3300014969 Bacteria 2091
365 Ga0157376_10280266 3300014969 Bacteria 1570
366 Ga0157376_10981403 3300014969 Bacteria 866
367 Ga0157376_11142996 3300014969 Bacteria 805
368 Ga0182006_1187634 3300015261 Bacteria 688
369 Ga0182007_10008202 3300015262 Bacteria 4304
370 Ga0163161_10002007 3300017792 Bacteria 14719
371 Ga0163161_10099159 3300017792 Bacteria 2166
372 Ga0197907_10594095 3300020069 Bacteria 792
373 Ga0206356_10018591 3300020070 Bacteria 1403
374 Ga0206356_11176297 3300020070 Bacteria 791
375 Ga0206349_1107756 3300020075 Bacteria 852
376 Ga0206355_1478285 3300020076 Bacteria 902
377 Ga0206351_10222754 3300020077 Bacteria 1351
378 Ga0206351_10267943 3300020077 Bacteria 849
379 Ga0206352_10508850 3300020078 Bacteria 851
380 Ga0206352_11161229 3300020078 Unclassified 669
381 Ga0206350_10223250 3300020080 Bacteria 865
382 Ga0206354_11433773 3300020081 Bacteria 850
383 Ga0206353_11208826 3300020082 Bacteria 941
384 Ga0154015_1422066 3300020610 Bacteria 1190
385 Ga0154015_1591588 3300020610 Bacteria 1185
386 Ga0213872_10044302 3300021361 Bacteria 2025
387 Ga0213872_10169330 3300021361 Bacteria 947
388 Ga0213874_10006229 3300021377 Bacteria 2818
389 Ga0224712_10181959 3300022467 Bacteria 947
390 Ga0224572_1000022 3300024225 Bacteria 8822
391 Ga0224572_1003717 3300024225 Bacteria 2599
392 Ga0228598_1000081 3300024227 Bacteria 14853
393 Ga0228598_1002944 3300024227 Unclassified 3696
394 Ga0207697_10003550 3300025315 Bacteria 7681
395 Ga0207697_10258254 3300025315 Bacteria 771
396 Ga0207656_10032090 3300025321 Bacteria 2179
397 Ga0207656_10490471 3300025321 Bacteria 623
398 Ga0207696_1020727 3300025711 Bacteria 2113
399 Ga0207682_10009137 3300025893 Bacteria 3916
400 Ga0207692_10012753 3300025898 Bacteria 3620
401 Ga0207692_10200973 3300025898 Bacteria 1172
402 Ga0207692_10507706 3300025898 Unclassified 766
403 Ga0207692_10556092 3300025898 Bacteria 734
404 Ga0207642_10037831 3300025899 Unclassified 2082
405 Ga0207710_10110921 3300025900 Bacteria 1302
406 Ga0207688_10002004 3300025901 Bacteria 10920
407 Ga0207688_10549786 3300025901 Bacteria 725
408 Ga0207680_10022274 3300025903 Bacteria 3442
409 Ga0207680_10091523 3300025903 Bacteria 1936
410 Ga0207647_10002606 3300025904 Bacteria 13635
411 Ga0207647_10028343 3300025904 Bacteria 3638
412 Ga0207647_10215459 3300025904 Bacteria 1108
413 Ga0207685_10209937 3300025905 Bacteria 920
414 Ga0207685_10308544 3300025905 Unclassified 785
415 Ga0207699_10000693 3300025906 Bacteria 16122
416 Ga0207699_10067773 3300025906 Bacteria 2171
417 Ga0207699_10079232 3300025906 Bacteria 2032
418 Ga0207699_10428281 3300025906 Bacteria 946
419 Ga0207699_10553547 3300025906 Bacteria 834
420 Ga0207645_10001595 3300025907 Bacteria 18512
421 Ga0207645_10015447 3300025907 Bacteria 5071
422 Ga0207645_10494711 3300025907 Unclassified 828
423 Ga0207643_10000412 3300025908 Bacteria 28337
424 Ga0207705_10142771 3300025909 Unclassified 1789
425 Ga0207705_10761347 3300025909 Bacteria 752
426 Ga0207705_11030358 3300025909 Bacteria 635
427 Ga0207684_10159432 3300025910 Bacteria 1942
428 Ga0207684_10278476 3300025910 Bacteria 1443
429 Ga0207684_11715167 3300025910 Unclassified 506
430 Ga0207654_10000452 3300025911 Bacteria 23472
431 Ga0207654_10090530 3300025911 Bacteria 1864
432 Ga0207654_10183713 3300025911 Bacteria 1366
433 Ga0207654_10978451 3300025911 Bacteria 615
434 Ga0207707_10178811 3300025912 Bacteria 1852
435 Ga0207707_10218250 3300025912 Bacteria 1660
436 Ga0207707_10218458 3300025912 Bacteria 1659
437 Ga0207695_10167991 3300025913 Bacteria 2121
438 Ga0207671_10036230 3300025914 Bacteria 3658
439 Ga0207671_10322948 3300025914 Unclassified 1222
440 Ga0207671_10549824 3300025914 Bacteria 920
441 Ga0207671_10660557 3300025914 Bacteria 832
442 Ga0207671_11179304 3300025914 Bacteria 600
443 Ga0207693_10000654 3300025915 Bacteria 31051
444 Ga0207693_10241516 3300025915 Bacteria 1418
445 Ga0207693_10855007 3300025915 Bacteria 699
446 Ga0207693_11347757 3300025915 Bacteria 532
447 Ga0207663_10003322 3300025916 Bacteria 7850
448 Ga0207663_10053435 3300025916 Bacteria 2524
449 Ga0207663_10251377 3300025916 Bacteria 1301
450 Ga0207663_10800120 3300025916 Bacteria 751
451 Ga0207663_10991688 3300025916 Bacteria 674
452 Ga0207663_11021111 3300025916 Bacteria 664
453 Ga0207660_10569943 3300025917 Bacteria 921
454 Ga0207662_10044181 3300025918 Unclassified 2630
455 Ga0207657_10016548 3300025919 Bacteria 7108
456 Ga0207657_10025075 3300025919 Bacteria 5507
457 Ga0207649_10018886 3300025920 Unclassified 3931
458 Ga0207652_10019824 3300025921 Bacteria 5536
459 Ga0207652_10036806 3300025921 Bacteria 4139
460 Ga0207652_10236516 3300025921 Bacteria 1646
461 Ga0207646_10045419 3300025922 Unclassified 3944
462 Ga0207646_10286980 3300025922 Bacteria 1487
463 Ga0207646_10407323 3300025922 Bacteria 1228
464 Ga0207681_10013517 3300025923 Bacteria 5054
465 Ga0207694_10045647 3300025924 Bacteria 3384
466 Ga0207694_10842611 3300025924 Bacteria 775
467 Ga0207694_10904581 3300025924 Bacteria 746
468 Ga0207650_10000024 3300025925 Bacteria 299184
469 Ga0207659_10097151 3300025926 Bacteria 2212
470 Ga0207687_10138749 3300025927 Bacteria 1842
471 Ga0207700_10000153 3300025928 Bacteria 41130
472 Ga0207700_10166872 3300025928 Bacteria 1833
473 Ga0207700_10288768 3300025928 Bacteria 1413
474 Ga0207700_10368248 3300025928 Bacteria 1254
475 Ga0207700_10388952 3300025928 Bacteria 1221
476 Ga0207700_10407955 3300025928 Bacteria 1192
477 Ga0207700_10685368 3300025928 Unclassified 914
478 Ga0207700_10917555 3300025928 Bacteria 784
479 Ga0207700_11103548 3300025928 Bacteria 709
480 Ga0207664_10048088 3300025929 Bacteria 3353
481 Ga0207664_10083602 3300025929 Bacteria 2602
482 Ga0207664_10124267 3300025929 Bacteria 2164
483 Ga0207664_10328608 3300025929 Bacteria 1350
484 Ga0207664_10502491 3300025929 Bacteria 1086
485 Ga0207664_10569478 3300025929 Bacteria 1017
486 Ga0207664_11191378 3300025929 Bacteria 679
487 Ga0207664_11516966 3300025929 Unclassified 592
488 Ga0207644_10018628 3300025931 Bacteria 4699
489 Ga0207644_11073756 3300025931 Bacteria 676
490 Ga0207690_10013645 3300025932 Bacteria 4887
491 Ga0207690_10305880 3300025932 Bacteria 1245
492 Ga0207706_10003335 3300025933 Bacteria 15361
493 Ga0207706_10013816 3300025933 Bacteria 7326
494 Ga0207686_10017600 3300025934 Bacteria 4030
495 Ga0207686_10088617 3300025934 Bacteria 2037
496 Ga0207669_10170532 3300025937 Unclassified 1548
497 Ga0207704_10007325 3300025938 Bacteria 5206
498 Ga0207704_10343747 3300025938 Bacteria 1159
499 Ga0207704_10974069 3300025938 Bacteria 716
500 Ga0207704_11377445 3300025938 Unclassified 604
501 Ga0207665_10000088 3300025939 Bacteria 60223
502 Ga0207665_10094231 3300025939 Bacteria 2079
503 Ga0207665_10242071 3300025939 Unclassified 1329
504 Ga0207665_10267491 3300025939 Bacteria 1268
505 Ga0207665_10546588 3300025939 Bacteria 899
506 Ga0207665_11048620 3300025939 Bacteria 649
507 Ga0207691_10000072 3300025940 Bacteria 83580
508 Ga0207691_10142711 3300025940 Bacteria 2109
509 Ga0207711_10000033 3300025941 Bacteria 193513
510 Ga0207711_10036610 3300025941 Bacteria 4164
511 Ga0207711_10037942 3300025941 Bacteria 4096
512 Ga0207711_10044186 3300025941 Bacteria 3803
513 Ga0207711_10331039 3300025941 Bacteria 1408
514 Ga0207711_10589651 3300025941 Bacteria 1037
515 Ga0207689_10001019 3300025942 Bacteria 26906
516 Ga0207689_10001565 3300025942 Bacteria 21697
517 Ga0207689_10142307 3300025942 Bacteria 1976
518 Ga0207661_10001629 3300025944 Bacteria 15283
519 Ga0207661_10367466 3300025944 Bacteria 1300
520 Ga0207679_10000040 3300025945 Bacteria 127317
521 Ga0207679_11592627 3300025945 Bacteria 599
522 Ga0207667_10001031 3300025949 Bacteria 35503
523 Ga0207667_10117659 3300025949 Bacteria 2739
524 Ga0207667_10140954 3300025949 Bacteria 2482
525 Ga0207667_10148825 3300025949 Unclassified 2410
526 Ga0207667_10513437 3300025949 Bacteria 1214
527 Ga0207651_10009325 3300025960 Bacteria 5363
528 Ga0207651_10116662 3300025960 Bacteria 2016
529 Ga0207651_11705709 3300025960 Bacteria 567
530 Ga0207712_10014438 3300025961 Bacteria 5083
531 Ga0207712_11665320 3300025961 Bacteria 572
532 Ga0207668_10064463 3300025972 Bacteria 2589
533 Ga0207640_10126199 3300025981 Bacteria 1842
534 Ga0207640_10128541 3300025981 Bacteria 1828
535 Ga0207640_10244915 3300025981 Bacteria 1388
536 Ga0207640_10665644 3300025981 Bacteria 889
537 Ga0207658_10003060 3300025986 Bacteria 11968
538 Ga0207658_10022176 3300025986 Bacteria 4419
539 Ga0207658_10079860 3300025986 Bacteria 2504
540 Ga0207658_10607130 3300025986 Bacteria 983
541 Ga0207677_10159804 3300026023 Bacteria 1749
542 Ga0207677_10191675 3300026023 Bacteria 1617
543 Ga0207677_11010385 3300026023 Bacteria 754
544 Ga0207677_11515726 3300026023 Bacteria 619
545 Ga0207677_12063834 3300026023 Bacteria 530
546 Ga0207703_10064276 3300026035 Unclassified 3011
547 Ga0207703_10121040 3300026035 Bacteria 2247
548 Ga0207703_11187777 3300026035 Bacteria 733
549 Ga0207703_11476475 3300026035 Bacteria 654
550 Ga0207639_10038333 3300026041 Bacteria 3564
551 Ga0207639_10051922 3300026041 Unclassified 3121
552 Ga0207639_10370821 3300026041 Bacteria 1283
553 Ga0207639_10474809 3300026041 Bacteria 1139
554 Ga0207639_11462238 3300026041 Bacteria 641
555 Ga0207678_10002689 3300026067 Bacteria 16127
556 Ga0207678_10981749 3300026067 Bacteria 747
557 Ga0207708_10186198 3300026075 Unclassified 1650
558 Ga0207702_10046122 3300026078 Bacteria 3668
559 Ga0207702_10955544 3300026078 Bacteria 850
560 Ga0207702_12086522 3300026078 Bacteria 557
561 Ga0207702_12132240 3300026078 Bacteria 550
562 Ga0207641_10000030 3300026088 Bacteria 224468
563 Ga0207641_10108830 3300026088 Bacteria 2454
564 Ga0207641_10726778 3300026088 Bacteria 979
565 Ga0207641_10727175 3300026088 Bacteria 979
566 Ga0207641_11268160 3300026088 Bacteria 737
567 Ga0207648_10001749 3300026089 Bacteria 23777
568 Ga0207648_10130465 3300026089 Bacteria 2212
569 Ga0207648_10136542 3300026089 Bacteria 2160
570 Ga0207676_10000256 3300026095 Bacteria 46055
571 Ga0207676_10080394 3300026095 Bacteria 2646
572 Ga0207676_10538470 3300026095 Bacteria 1114
573 Ga0207674_10002761 3300026116 Bacteria 21899
574 Ga0207674_10089173 3300026116 Bacteria 3077
575 Ga0207674_10213431 3300026116 Bacteria 1879
576 Ga0207675_100023344 3300026118 Bacteria 5752
577 Ga0207675_100214257 3300026118 Bacteria 1854
578 Ga0207683_10000662 3300026121 Bacteria 31638
579 Ga0207683_10007099 3300026121 Bacteria 9600
580 Ga0207698_10076142 3300026142 Bacteria 2684
581 Ga0207698_11364487 3300026142 Bacteria 724
582 Ga0207698_11690525 3300026142 Bacteria 648
583 Ga0207698_12366873 3300026142 Bacteria 542
584 Ga0209179_1057280 3300027512 Bacteria 842
585 Ga0209998_10010126 3300027717 Bacteria 1952
586 Ga0268266_10019872 3300028379 Bacteria 5724
587 Ga0268266_10056161 3300028379 Bacteria 3387
588 Ga0268266_11528394 3300028379 Bacteria 643
589 Ga0268266_12174480 3300028379 Unclassified 527
590 Ga0268265_10021245 3300028380 Bacteria 4543
591 Ga0268265_10438142 3300028380 Bacteria 1217
592 Ga0268265_12163399 3300028380 Unclassified 563
593 Ga0268264_10011416 3300028381 Bacteria 7337
594 Ga0268264_10245188 3300028381 Bacteria 1661
595 Ga0268264_10578701 3300028381 Bacteria 1104
596 Ga0268264_11139659 3300028381 Unclassified 789
597 Ga0268264_12623672 3300028381 Bacteria 508
598 Ga0265318_10302152 3300028577 Bacteria 584
599 Ga0265338_10004259 3300028800 Bacteria 19432
600 Ga0265338_10264831 3300028800 Unclassified 1262
601 Ga0265338_10460408 3300028800 Bacteria 899
602 Ga0265324_10053436 3300029957 Bacteria 1387
603 Ga0265762_1119499 3300030760 Bacteria 601
604 Ga0265770_1044778 3300030878 Bacteria 784
605 Ga0265765_1009707 3300030879 Bacteria 1063
606 Ga0265760_10001267 3300031090 Bacteria 7383
607 Ga0265760_10012359 3300031090 Bacteria 2441
608 Ga0265760_10030716 3300031090 Bacteria 1583
609 Ga0265760_10048857 3300031090 Bacteria 1271
610 Ga0265760_10052625 3300031090 Bacteria 1228
611 Ga0265760_10186138 3300031090 Bacteria 696
612 Ga0265330_10000346 3300031235 Bacteria 32953
613 Ga0265330_10007123 3300031235 Bacteria 5481
614 Ga0265330_10059264 3300031235 Bacteria 1667
615 Ga0265330_10073196 3300031235 Bacteria 1482
616 Ga0265330_10165942 3300031235 Bacteria 937
617 Ga0265330_10321276 3300031235 Bacteria 653
618 Ga0265332_10005285 3300031238 Bacteria 5972
619 Ga0265332_10040700 3300031238 Bacteria 2011
620 Ga0265328_10003354 3300031239 Bacteria 7081
621 Ga0265325_10000582 3300031241 Bacteria 26541
622 Ga0265325_10003036 3300031241 Bacteria 11108
623 Ga0265325_10049084 3300031241 Bacteria 2180
624 Ga0265329_10016146 3300031242 Bacteria 2595
625 Ga0265340_10001936 3300031247 Bacteria 11830
626 Ga0265340_10004114 3300031247 Bacteria 8169
627 Ga0265340_10324234 3300031247 Bacteria 682
628 Ga0265339_10006462 3300031249 Bacteria 7685
629 Ga0265339_10006757 3300031249 Bacteria 7486
630 Ga0265339_10017622 3300031249 Bacteria 4226
631 Ga0265339_10135945 3300031249 Bacteria 1254
632 Ga0265339_10264508 3300031249 Bacteria 829
633 Ga0265331_10025594 3300031250 Bacteria 2977
634 Ga0265331_10097360 3300031250 Bacteria 1356
635 Ga0265331_10333600 3300031250 Bacteria 679
636 Ga0265327_10214377 3300031251 Bacteria 868
637 Ga0265316_10000726 3300031344 Bacteria 36285
638 Ga0265316_10002223 3300031344 Bacteria 20359
639 Ga0265316_10006636 3300031344 Bacteria 11022
640 Ga0265316_10012858 3300031344 Bacteria 7475
641 Ga0265316_10032480 3300031344 Bacteria 4260
642 Ga0265316_10271618 3300031344 Bacteria 1240
643 Ga0265316_10401878 3300031344 Bacteria 986
644 Ga0265316_10910827 3300031344 Bacteria 614
645 Ga0307408_100213448 3300031548 Bacteria 1570
646 Ga0307408_100552336 3300031548 Bacteria 1016
647 Ga0307408_100654930 3300031548 Bacteria 939
648 Ga0265313_10001185 3300031595 Bacteria 24932
649 Ga0265313_10019287 3300031595 Bacteria 3801
650 Ga0265314_10000067 3300031711 Bacteria 156225
651 Ga0265314_10033014 3300031711 Bacteria 3801
652 Ga0265314_10198517 3300031711 Bacteria 1188
653 Ga0265314_10582410 3300031711 Bacteria 578
654 Ga0265342_10000741 3300031712 Bacteria 33577
655 Ga0265342_10001898 3300031712 Bacteria 18803
656 Ga0265342_10071874 3300031712 Bacteria 2015
657 Ga0265342_10119373 3300031712 Bacteria 1486
658 Ga0265342_10263251 3300031712 Bacteria 917
659 Ga0307405_11192648 3300031731 Bacteria 658
660 Ga0307413_10115937 3300031824 Bacteria 1803
661 Ga0307413_10473606 3300031824 Bacteria 999
662 Ga0307410_10005772 3300031852 Bacteria 6598
663 Ga0307410_10301095 3300031852 Bacteria 1265
664 Ga0307406_10083797 3300031901 Bacteria 2127
665 Ga0307406_10834678 3300031901 Bacteria 780
666 Ga0307412_11444174 3300031911 Bacteria 624
667 Ga0307412_11718984 3300031911 Bacteria 575
668 Ga0307412_11953179 3300031911 Bacteria 542
669 Ga0307409_100202555 3300031995 Bacteria 1777
670 Ga0307416_100071903 3300032002 Bacteria 2876
671 Ga0307416_100318418 3300032002 Bacteria 1556
672 Ga0307414_10638328 3300032004 Bacteria 959
673 Ga0307414_11545170 3300032004 Bacteria 618
674 Ga0307411_10167045 3300032005 Bacteria 1655
675 Ga0307411_12086309 3300032005 Bacteria 530
676 Ga0307415_100134954 3300032126 Bacteria 1875
677 Ga0307415_100943882 3300032126 Bacteria 798
678 Ga0316583_10031683 3300032133 Bacteria 1882
679 Ga0373926_0294953 3300035083 Bacteria 632
680 Ga0373934_0041735 3300035086 Bacteria 1812
681 Ga0373934_0168632 3300035086 Bacteria 899
682 Ga0373944_0124707 3300035089 Bacteria 890
683 Ga0373923_0236351 3300035111 Bacteria 852
684 Ga0373923_0360056 3300035111 Bacteria 696
685 Ga0373945_0002364 3300035116 Bacteria 5919
686 Ga0373953_0278638 3300035117 Bacteria 729
687 Ga0373953_0471555 3300035117 Bacteria 555
688 Ga0373954_0178100 3300035118 Bacteria 1042
689 Ga0373954_0465906 3300035118 Bacteria 626
690 Ga0373956_0090837 3300035119 Bacteria 1409
691 Ga0373957_0117008 3300035120 Bacteria 1077
692 Ga0373943_0002553 3300035170 Bacteria 8276
693 Ga0373946_0004426 3300035171 Bacteria 5030
694 Ga0373946_0075254 3300035171 Bacteria 1467
695 Ga0373955_0014255 3300035172 Bacteria 3862
696 Ga0373955_0577905 3300035172 Bacteria 688
697 Ga0373931_0684838 3300035691 Bacteria 676
698 Ga0373931_1190547 3300035691 Bacteria 521
699 Ga0373935_0250334 3300035692 Bacteria 1239
700 Ga0373927_0065639 3300035695 Bacteria 2347
701 Ga0373927_0167471 3300035695 Bacteria 1440
702 Ga0373933_0173428 3300035724 Bacteria 1373
703 Ga0373933_0451592 3300035724 Bacteria 841
704 Ga0373947_0599801 3300035725 Unclassified 750
705 Ga0373947_0637450 3300035725 Bacteria 726
706 Ga0373937_0009655 3300036401 Bacteria 8403
707 Ga0373937_0158038 3300036401 Bacteria 2125
708 Ga0373937_0230610 3300036401 Bacteria 1744
709 Ga0373937_0292867 3300036401 Bacteria 1538
710 Ga0373937_0367956 3300036401 Bacteria 1363
711 Ga0373937_1144338 3300036401 Unclassified 727
712 Ga0373937_1510246 3300036401 Bacteria 619
713 Ga0265778_003161 3300036457 Bacteria 1647
714 Ga0373925_0024161 3300037068 Bacteria 4436
715 Ga0373925_0026433 3300037068 Bacteria 4246
716 Ga0373925_0216397 3300037068 Bacteria 1528
717 Ga0373925_0281961 3300037068 Unclassified 1338
718 Ga0373925_0613969 3300037068 Bacteria 896
719 Ga0395900_1075301 3300037418 Bacteria 722
720 Ga0395905_0625910 3300037471 Bacteria 978
721 Ga0395905_1705552 3300037471 Bacteria 535
722 Ga0395901_0500645 3300038443 Bacteria 1237
723 Ga0395901_0700807 3300038443 Bacteria 1010
724 Ga0436365_0624994 3300039437 Bacteria 503
725 Ga0436365_0837639 3300039437 Unclassified 1326
726 Ga0436365_0903852 3300039437 Bacteria 3286
727 Ga0436360_0139949 3300039438 Bacteria 2118
728 Ga0436360_0152286 3300039438 Bacteria 501
729 Ga0436360_0792118 3300039438 Bacteria 1272
730 Ga0436360_0943434 3300039438 Bacteria 2695
731 Ga0436360_1258478 3300039438 Bacteria 1224
732 Ga0436361_0258027 3300039447 Bacteria 747
733 Ga0436361_0887686 3300039447 Bacteria 1241
734 Ga0436361_1169155 3300039447 Bacteria 3378
735 Ga0436363_0267088 3300039450 Bacteria 821
736 Ga0436363_0276301 3300039450 Bacteria 909
737 Ga0436363_0491074 3300039450 Bacteria 749
738 Ga0436363_0614486 3300039450 Bacteria 785
739 Ga0436363_1376765 3300039450 Bacteria 8238
740 Ga0436362_1122765 3300039453 Unclassified 1455
741 Ga0451577_2025560 3300042876 Bacteria 503
742 Ga0453683_0755309 3300044673 Unclassified 639
743 Ga0466965_0219124 3300044683 Bacteria 1014
744 Ga0466966_0183609 3300044684 Bacteria 1269
745 Ga0466966_0761941 3300044684 Bacteria 583
746 Ga0466961_0654972 3300044693 Bacteria 630
747 Ga0466963_0028800 3300044694 Bacteria 3570
748 Ga0466963_0111333 3300044694 Bacteria 1880
749 Ga0466964_0158339 3300044706 Unclassified 1056
750 Ga0466957_0169608 3300044842 Bacteria 1421
751 Ga0466957_0320173 3300044842 Unclassified 1046
752 Ga0466959_0055610 3300045049 Bacteria 2889
753 Ga0466959_0079482 3300045049 Bacteria 2364
754 Ga0466958_1007715 3300045836 Bacteria 543
755 Ga0466967_0082587 3300045976 Bacteria 2904
756 Ga0466967_0108084 3300045976 Bacteria 2552
757 Ga0466967_0224412 3300045976 Bacteria 1787
758 Ga0466967_0834407 3300045976 Bacteria 916
759 Ga0466967_1767194 3300045976 Bacteria 616
760 Ga0466967_2268097 3300045976 Unclassified 539
761 Ga0495603_0163158 3300046455 Unclassified 1292
762 Ga0495629_0031645 3300046459 Bacteria 3745
763 Ga0495629_0767031 3300046459 Unclassified 638
764 Ga0495651_0076691 3300046462 Bacteria 2532
765 Ga0495651_0554501 3300046462 Bacteria 730
766 Ga0495580_0003281 3300046472 Bacteria 13830
767 Ga0495580_0012850 3300046472 Bacteria 6416
768 Ga0495580_0023629 3300046472 Bacteria 4510
769 Ga0495580_0180506 3300046472 Bacteria 1458
770 Ga0495580_0226616 3300046472 Bacteria 1283
771 Ga0495580_0290944 3300046472 Bacteria 1113
772 Ga0495580_0572150 3300046472 Bacteria 749
773 Ga0495582_0225831 3300046473 Bacteria 1072
774 Ga0495582_0472795 3300046473 Bacteria 724
775 Ga0495582_0575605 3300046473 Bacteria 651
776 Ga0495639_0086970 3300046475 Bacteria 1462
777 Ga0495662_0141645 3300046476 Bacteria 1184
778 Ga0495585_0441717 3300046492 Bacteria 623
779 Ga0495594_0049707 3300046499 Bacteria 2305
780 Ga0495594_0106110 3300046499 Bacteria 1582
781 Ga0495594_0176039 3300046499 Bacteria 1217
782 Ga0495608_0114226 3300046511 Bacteria 1734
783 Ga0495608_0563620 3300046511 Bacteria 686
784 Ga0495628_0061195 3300046516 Bacteria 2953
785 Ga0495628_0441342 3300046516 Bacteria 946
786 Ga0495630_0027742 3300046517 Bacteria 4204
787 Ga0495630_0784447 3300046517 Bacteria 728
788 Ga0495637_0057017 3300046520 Bacteria 1615
789 Ga0495643_0058243 3300046522 Bacteria 2056
790 Ga0495666_0100021 3300046526 Bacteria 1367
791 Ga0495666_0320855 3300046526 Bacteria 699
792 Ga0495666_0358655 3300046526 Unclassified 656
793 Ga0495666_0467349 3300046526 Bacteria 565
794 Ga0495642_0042339 3300046528 Bacteria 1855
795 Ga0495652_0504419 3300046529 Bacteria 838
796 Ga0495652_0881563 3300046529 Bacteria 591
797 Ga0495652_1067392 3300046529 Unclassified 526
798 Ga0495665_0006124 3300046531 Bacteria 6495
799 Ga0495665_0103002 3300046531 Bacteria 1498
800 Ga0495665_0641397 3300046531 Bacteria 529
801 Ga0495665_0655455 3300046531 Bacteria 522
802 Ga0495640_0764151 3300046533 Bacteria 577
803 Ga0495587_0060996 3300046536 Bacteria 2210
804 Ga0495667_0149102 3300046559 Bacteria 1506
805 Ga0495667_0625144 3300046559 Bacteria 670
806 Ga0495668_0079030 3300046616 Bacteria 1806
807 Ga0495668_0139089 3300046616 Bacteria 1329
808 Ga0495635_0111022 3300046663 Bacteria 1873
809 Ga0495635_0116768 3300046663 Bacteria 1821
810 Ga0495659_0009637 3300046664 Bacteria 3087
811 Ga0495588_0436728 3300046674 Unclassified 687
812 Ga0495657_0070739 3300046675 Bacteria 2280
813 Ga0495657_0086843 3300046675 Bacteria 2014
814 Ga0495599_0799814 3300046678 Bacteria 539
815 Ga0495623_0058258 3300046679 Bacteria 2429
816 Ga0495623_0202188 3300046679 Bacteria 1141
817 Ga0495647_0094220 3300046681 Bacteria 1232
818 Ga0495647_0415076 3300046681 Bacteria 620
819 Ga0495658_0608099 3300046683 Bacteria 700
820 Ga0495658_0968633 3300046683 Bacteria 543
821 Ga0495669_0009776 3300046684 Bacteria 4050
822 Ga0495669_0149170 3300046684 Bacteria 1106
823 Ga0495669_0396906 3300046684 Bacteria 668
824 Ga0495613_0095361 3300046689 Bacteria 2152
825 Ga0495613_0113907 3300046689 Bacteria 1947
826 Ga0495624_0548330 3300046690 Bacteria 690
827 Ga0495670_0069129 3300046691 Bacteria 1785
828 Ga0495671_0610553 3300046692 Unclassified 519
829 Ga0495649_0012376 3300046694 Bacteria 4967
830 Ga0495600_0031618 3300046809 Bacteria 3430
831 Ga0495581_0023841 3300047315 Bacteria 3546
832 Ga0495581_0159704 3300047315 Bacteria 1318
833 Ga0495581_0339089 3300047315 Bacteria 878
834 Ga0495581_0595781 3300047315 Bacteria 640
835 Ga0495604_0035889 3300047317 Bacteria 3912
836 Ga0495604_0832749 3300047317 Unclassified 580
837 Ga0495636_0115522 3300047318 Bacteria 1184
838 Ga0495674_0152527 3300047319 Bacteria 1937
839 Ga0495674_0173918 3300047319 Bacteria 1796
840 Ga0495687_112896 3300047443 Bacteria 995
841 Ga0495675_0251329 3300047444 Bacteria 1062
842 Ga0495677_0117725 3300047445 Bacteria 1012
843 Ga0495684_0588764 3300047471 Bacteria 752
844 Ga0495593_0011360 3300047673 Bacteria 5117
845 Ga0495602_0185388 3300048088 Bacteria 1601
846 Ga0495602_0251961 3300048088 Bacteria 1315
847 Ga0496100_0056286 3300048903 Bacteria 2572
848 Ga0496100_0310274 3300048903 Bacteria 1183
849 Ga0496100_0791186 3300048903 Bacteria 743
850 Ga0496100_0890180 3300048903 Bacteria 699
851 Ga0496101_0455312 3300048904 Bacteria 1010
852 Ga0496101_0699344 3300048904 Unclassified 800
853 Ga0496102_0181938 3300048905 Bacteria 1981
854 Ga0496102_0205700 3300048905 Bacteria 1856
855 Ga0496102_0302201 3300048905 Bacteria 1508
856 Ga0496102_0831019 3300048905 Unclassified 846
857 Ga0496102_1290278 3300048905 Bacteria 649
858 Ga0496102_1487496 3300048905 Bacteria 596
859 Ga0496103_0071604 3300048906 Bacteria 2170
860 Ga0496103_0259852 3300048906 Bacteria 1117
861 Ga0496104_0020022 3300048907 Bacteria 6128
862 Ga0496104_0180671 3300048907 Bacteria 2020
863 Ga0496104_0338337 3300048907 Unclassified 1418
864 Ga0496104_0448091 3300048907 Bacteria 1203
865 Ga0496104_0466708 3300048907 Bacteria 1174
866 Ga0496104_1168611 3300048907 Unclassified 673
867 Ga0496105_0012923 3300048908 Bacteria 6617
868 Ga0496105_0514581 3300048908 Bacteria 938
869 Ga0496105_0827181 3300048908 Bacteria 702
870 Ga0496106_0043194 3300048909 Bacteria 3382
871 Ga0496106_0640928 3300048909 Bacteria 849
872 Ga0496107_0314144 3300048910 Bacteria 1166
873 Ga0496108_0000567 3300048911 Bacteria 28950
874 Ga0496109_0000381 3300048912 Bacteria 40340
875 Ga0496109_0558674 3300048912 Bacteria 1080
876 Ga0496110_0001459 3300048913 Bacteria 17151
877 Ga0496110_0109144 3300048913 Bacteria 2485
878 Ga0496110_0245694 3300048913 Bacteria 1629
879 Ga0496111_0000626 3300048914 Bacteria 18709
880 Ga0496111_0146424 3300048914 Unclassified 1751
881 Ga0496111_0233297 3300048914 Bacteria 1367
882 Ga0496111_0866651 3300048914 Bacteria 651
883 Ga0496111_0885950 3300048914 Bacteria 643
884 Ga0496112_0000155 3300048915 Bacteria 43076
885 Ga0496112_0047757 3300048915 Bacteria 4199
886 Ga0496112_0053991 3300048915 Bacteria 3947
887 Ga0496112_0093961 3300048915 Bacteria 2969
888 Ga0496112_0233773 3300048915 Bacteria 1792
889 Ga0496112_0292064 3300048915 Bacteria 1576
890 Ga0496112_0300787 3300048915 Bacteria 1550
891 Ga0496112_0449708 3300048915 Bacteria 1226
892 Ga0496112_1009339 3300048915 Bacteria 752
893 Ga0496113_0006644 3300048916 Bacteria 7356
894 Ga0496113_0011591 3300048916 Bacteria 5890
895 Ga0496113_0372393 3300048916 Bacteria 1146
896 Ga0496114_0033318 3300048917 Bacteria 4244
897 Ga0496114_1353977 3300048917 Bacteria 599
898 Ga0496115_0027960 3300048918 Bacteria 4415
899 Ga0496115_0048017 3300048918 Unclassified 3415
900 Ga0496115_0152540 3300048918 Bacteria 1908
901 Ga0496115_0234718 3300048918 Unclassified 1512
902 Ga0496115_0275109 3300048918 Bacteria 1383
903 Ga0496115_1439676 3300048918 Bacteria 507
904 Ga0496126_0065061 3300048929 Bacteria 3264
905 Ga0501309_022129 3300049129 Unclassified 898
906 Ga0501305_050524 3300049161 Bacteria 697
907 Ga0501296_027458 3300049519 Bacteria 753
908 Ga0501299_139178 3300049522 Bacteria 602
909 Ga0501315_051465 3300049531 Bacteria 648
910 Ga0501333_017290 3300049549 Bacteria 557
911 Ga0501335_016370 3300049551 Bacteria 763
912 Ga0501073_0046676 3300049589 Unclassified 3045
913 Ga0501206_026679 3300049653 Bacteria 845
914 Ga0501235_071200 3300049669 Bacteria 823
915 Ga0501235_175055 3300049669 Bacteria 569
916 Ga0501249_029994 3300049679 Bacteria 1210
917 Ga0501225_0160251 3300049705 Bacteria 691
918 Ga0501229_016991 3300049706 Bacteria 948
919 Ga0501263_051199 3300049760 Bacteria 629
920 Ga0501273_096940 3300049770 Bacteria 507
921 nmdc:mga05p37_10115_c1 3300050507 Bacteria 11197
922 nmdc:mga0n895_18558_c1 3300050512 Bacteria 6440
923 nmdc:mga0n895_68383_c1 3300050512 Bacteria 3519
924 nmdc:mga0rr50_49336_c1 3300050513 Bacteria 2688
925 nmdc:mga0rr50_508392_c1 3300050513 Bacteria 1025
926 nmdc:mga08x19_168954_c1 3300050514 Bacteria 1489
927 nmdc:mga08x19_370563_c1 3300050514 Bacteria 1002
928 nmdc:mga08x19_3986_c1 3300050514 Bacteria 8783
929 nmdc:mga08x19_98778_c1 3300050514 Bacteria 1934
930 nmdc:mga0a205_12673_c1 3300050515 Bacteria 7809
931 nmdc:mga0a205_138_c1 3300050515 Bacteria 46090
932 Ga0495601_0189113 3300053077 Bacteria 1346
933 Ga0500644_0023663 3300053088 Bacteria 1868
934 Ga0500595_006210 3300053119 Bacteria 5103
935 Ga0500595_128648 3300053119 Bacteria 713
936 Ga0500590_121154 3300053148 Bacteria 1226
937 Ga0500552_126184 3300053733 Bacteria 502
938 Ga0501084_0004391 3300054114 Bacteria 11498
939 Ga0587084_012021 3300059477 Bacteria 1164
940 Ga0587066_012508 3300059490 Bacteria 1268
941 Ga0587066_170406 3300059490 Bacteria 553
942 Ga0587070_024361 3300059491 Bacteria 1047
943 Ga0587070_098262 3300059491 Unclassified 669
944 Ga0587073_0008143 3300059492 Bacteria 1685
945 Ga0587077_029543 3300059493 Bacteria 1034
946 Ga0587080_028561 3300059503 Bacteria 958
947 Ga0587082_026454 3300059504 Unclassified 982
948 Ga0587082_099490 3300059504 Bacteria 632
949 Ga0587083_0006122 3300059505 Bacteria 1776
950 Ga0587085_036869 3300059506 Bacteria 833
951 Ga0587088_004104 3300059508 Bacteria 1818
952 Ga0587090_034722 3300059510 Bacteria 861
953 Ga0587091_036843 3300059511 Bacteria 946
954 Ga0587092_006993 3300059512 Bacteria 1447
955 Ga0587094_006626 3300059513 Bacteria 1394
956 Ga0587106_104813 3300059605 Bacteria 582
957 Ga0587099_065632 3300059622 Bacteria 508
958 Ga0587109_153064 3300059624 Bacteria 571
959 Ga0587117_025146 3300059627 Bacteria 860
960 Ga0587128_006746 3300059630 Bacteria 1425
961 Ga0587067_005061 3300059640 Bacteria 1760
962 Ga0587068_015366 3300059641 Bacteria 1203
963 Ga0587076_131193 3300059645 Bacteria 591
964 Ga0587078_067149 3300059646 Bacteria 554
965 Ga0587107_002951 3300059652 Bacteria 1598
966 Ga0587107_032118 3300059652 Bacteria 805
967 Ga0587107_097518 3300059652 Bacteria 577
968 Ga0466962_0640818 3300061719 Bacteria 543
969 Ga0373936_0001882
970 MBSR1b_contig_6423676
971 LJNas_1004295
972 JGI24752J21851_1006989
973 JGI24747J21853_1000334
974 JGI24740J21852_10163331
975 JGI24737J22298_10057670
976 JGI24743J22301_10004884
977 JGI24748J21848_1003696
978 JGI24034J26672_10000300
979 JGI24751J29686_10022314
980 Ga0058863_11849724
981 Ga0058861_10039244
982 Ga0058861_11331319
983 Ga0058862_10027191
984 Ga0058862_12865494
985 Ga0065712_10002796
986 Ga0065715_10014238
987 Ga0070658_10030803
988 Ga0070658_10081977
989 Ga0070658_10161650
990 Ga0070658_10777073
991 Ga0070676_10003407
992 Ga0070676_10032048
993 Ga0070676_10629736
994 Ga0070683_100002453
995 Ga0070683_100303138
996 Ga0070683_100466988
997 Ga0070683_101029858
998 Ga0070690_100235094
999 Ga0070690_101076658
1000 Ga0070670_100005793
1001 Ga0070677_10007787
1002 Ga0068869_100010958
1003 Ga0068869_100040153
1004 Ga0068869_100867264
1005 Ga0070666_10013820
1006 Ga0070666_10285489
1007 Ga0070666_10426632
1008 Ga0070680_100181803
1009 Ga0070680_100217906
1010 Ga0070680_100323947
1011 Ga0070680_100558249
1012 Ga0070680_100646764
1013 Ga0070682_100715102
1014 Ga0068868_100006740
1015 Ga0068868_100043782
1016 Ga0068868_100106212
1017 Ga0068868_100166842
1018 Ga0068868_100206219
1019 Ga0070660_100001122
1020 Ga0070660_100088455
1021 Ga0070689_100201215
1022 Ga0070691_10893583
1023 Ga0070687_100019471
1024 Ga0070661_100000564
1025 Ga0070668_100001144
1026 Ga0070668_100144757
1027 Ga0070669_101679109
1028 Ga0070675_100184220
1029 Ga0070671_100075918
1030 Ga0070671_100549278
1031 Ga0070671_100625169
1032 Ga0070674_100002008
1033 Ga0070673_100930541
1034 Ga0070688_100019665
1035 Ga0070659_100005729
1036 Ga0070659_100427721
1037 Ga0070659_100797223
1038 Ga0070667_100114921
1039 Ga0070667_100150403
1040 Ga0070667_100295138
1041 Ga0070709_10009431
1042 Ga0070709_10147042
1043 Ga0070709_10194794
1044 Ga0070709_10245832
1045 Ga0070709_11125741
1046 Ga0070709_11276291
1047 Ga0070714_100026290
1048 Ga0070714_100087113
1049 Ga0070714_100178408
1050 Ga0070714_100445325
1051 Ga0070714_100536299
1052 Ga0070714_100642940
1053 Ga0070714_100675281
1054 Ga0070714_101776354
1055 Ga0070714_102084559
1056 Ga0070713_100000210
1057 Ga0070713_100086548
1058 Ga0070713_100160369
1059 Ga0070713_100377029
1060 Ga0070713_100489303
1061 Ga0070713_100603795
1062 Ga0070713_100884580
1063 Ga0070713_100922096
1064 Ga0070713_100948697
1065 Ga0070713_101153181
1066 Ga0070710_10018125
1067 Ga0070710_10493877
1068 Ga0070710_10631741
1069 Ga0070701_10040945
1070 Ga0070711_100294731
1071 Ga0070711_100570637
1072 Ga0070711_100700850
1073 Ga0070711_101470826
1074 Ga0070700_100327769
1075 Ga0070708_100044284
1076 Ga0070708_100066850
1077 Ga0070708_101804364
1078 Ga0070708_102105060
1079 Ga0070663_100002461
1080 Ga0070663_101430017
1081 Ga0070678_100912489
1082 Ga0070662_100015050
1083 Ga0070662_100041714
1084 Ga0070681_10026540
1085 Ga0070681_10034026
1086 Ga0070681_10102481
1087 Ga0070681_10917154
1088 Ga0068867_100001261
1089 Ga0068867_100740585
1090 Ga0070685_10021659
1091 Ga0070685_10168872
1092 Ga0070685_10759406
1093 Ga0070706_100172653
1094 Ga0070706_100183206
1095 Ga0070707_100133174
1096 Ga0070707_100397400
1097 Ga0070698_100044545
1098 Ga0070698_100506137
1099 Ga0070699_100040014
1100 Ga0070699_100114726
1101 Ga0070699_100359343
1102 Ga0070679_100018174
1103 Ga0070679_100080687
1104 Ga0070679_100204106
1105 Ga0070679_100377190
1106 Ga0070679_100871879
1107 Ga0070684_100005354
1108 Ga0070684_100012659
1109 Ga0070697_100177375
1110 Ga0070697_100669477
1111 Ga0070697_100970793
1112 Ga0068853_100033720
1113 Ga0068853_100096611
1114 Ga0068853_100476407
1115 Ga0068853_100987020
1116 Ga0070672_100005865
1117 Ga0070672_100657684
1118 Ga0070695_100291544
1119 Ga0070696_100026277
1120 Ga0070696_100685307
1121 Ga0070693_100111078
1122 Ga0070693_100380756
1123 Ga0070693_100645455
1124 Ga0070665_100184106
1125 Ga0070665_100330253
1126 Ga0070665_101094261
1127 Ga0068855_100014420
1128 Ga0068855_100155676
1129 Ga0068855_100188661
1130 Ga0068855_102261250
1131 Ga0070664_100017825
1132 Ga0070664_100723414
1133 Ga0068857_100001804
1134 Ga0068857_100628756
1135 Ga0068854_100011944
1136 Ga0068854_100055189
1137 Ga0068854_100091633
1138 Ga0068854_100368744
1139 Ga0068854_100457445
1140 Ga0068856_100019441
1141 Ga0068856_100129767
1142 Ga0068856_100332771
1143 Ga0070702_100010582
1144 Ga0068852_100012326
1145 Ga0068852_100013526
1146 Ga0068852_100067475
1147 Ga0068852_100590189
1148 Ga0068852_100654167
1149 Ga0068852_101708501
1150 Ga0068859_100046420
1151 Ga0068859_100170098
1152 Ga0068859_101743301
1153 Ga0068864_101303793
1154 Ga0068864_102119200
1155 Ga0068866_10000704
1156 Ga0068861_100012795
1157 Ga0068861_100344522
1158 Ga0068851_10003100
1159 Ga0068851_10042941
1160 Ga0068870_10003817
1161 Ga0068863_100129767
1162 Ga0068863_100273051
1163 Ga0068858_100011541
1164 Ga0068858_100088156
1165 Ga0068858_100420262
1166 Ga0068858_100515139
1167 Ga0068858_101831545
1168 Ga0068860_100209134
1169 Ga0068860_100302269
1170 Ga0068860_101266729
1171 Ga0068860_101377304
1172 Ga0068862_100006124
1173 Ga0068862_100032502
1174 Ga0068862_100353777
1175 Ga0068862_102365671
1176 Ga0081540_1054160
1177 Ga0070717_10001841
1178 Ga0070717_10040224
1179 Ga0070717_10166163
1180 Ga0070717_10193502
1181 Ga0070717_10209917
1182 Ga0070717_10210373
1183 Ga0070717_10318603
1184 Ga0070717_10364152
1185 Ga0070717_10779229
1186 Ga0070717_10893259
1187 Ga0070715_10403809
1188 Ga0070715_10404291
1189 Ga0070716_100000092
1190 Ga0070716_100073852
1191 Ga0070716_100168807
1192 Ga0070716_100686568
1193 Ga0070716_101684484
1194 Ga0070712_100000378
1195 Ga0070712_100012528
1196 Ga0070712_100018289
1197 Ga0070712_100614538
1198 Ga0070712_101115508
1199 Ga0097621_100021106
1200 Ga0097621_100372777
1201 Ga0097621_100803666
1202 Ga0097621_101823867
1203 Ga0097621_101843980
1204 Ga0068871_100002744
1205 Ga0068871_100057567
1206 Ga0068871_100245394
1207 Ga0075433_10000043
1208 Ga0075433_10009837
1209 Ga0075434_100034730
1210 Ga0075434_100071309
1211 Ga0075434_100306995
1212 Ga0075434_100687276
1213 Ga0075434_100815238
1214 Ga0068865_100000360
1215 Ga0068865_100039225
1216 Ga0075436_100003096
1217 Ga0075436_100017024
1218 Ga0075436_100091013
1219 Ga0075436_100213404
1220 Ga0097620_100046419
1221 Ga0097620_100170099
1222 Ga0097620_101743152
1223 Ga0075435_100080968
1224 Ga0075435_100471363
1225 Ga0099795_10048287
1226 Ga0105250_10030679
1227 Ga0105240_10376751
1228 Ga0105240_10432559
1229 Ga0105240_10565920
1230 Ga0105240_10685704
1231 Ga0105240_12493166
1232 Ga0105245_10001223
1233 Ga0105245_10001566
1234 Ga0105245_10153860
1235 Ga0105245_10751824
1236 Ga0105247_10001727
1237 Ga0105247_10104141
1238 Ga0105247_10208705
1239 Ga0105247_10822816
1240 Ga0114129_10000781
1241 Ga0114129_11621587
1242 Ga0105243_10466088
1243 Ga0105241_10000850
1244 Ga0105241_10031446
1245 Ga0105241_10321265
1246 Ga0105241_10387727
1247 Ga0105241_10803997
1248 Ga0105242_10017731
1249 Ga0105242_10025494
1250 Ga0105248_10000049
1251 Ga0105248_10034758
1252 Ga0105248_10068617
1253 Ga0105248_10330802
1254 Ga0105248_10565508
1255 Ga0105237_10026777
1256 Ga0105237_10256371
1257 Ga0105237_10338234
1258 Ga0105237_10484413
1259 Ga0105237_11212380
1260 Ga0105238_10012857
1261 Ga0105238_10023891
1262 Ga0105238_10300523
1263 Ga0105238_10394486
1264 Ga0105249_10013666
1265 Ga0105249_10527090
1266 Ga0105249_11828601
1267 Ga0105239_10109917
1268 Ga0105239_10140740
1269 Ga0105239_10311904
1270 Ga0105239_10998201
1271 Ga0105246_10000398
1272 Ga0105246_10426778
1273 Ga0157327_1037631
1274 Ga0157326_1072809
1275 Ga0157373_10001863
1276 Ga0157373_10280777
1277 Ga0157373_10982674
1278 Ga0157371_10013471
1279 Ga0157371_10810508
1280 Ga0157370_10052832
1281 Ga0157370_10742517
1282 Ga0157370_10769704
1283 Ga0157370_10810490
1284 Ga0157369_10025390
1285 Ga0157369_10350755
1286 Ga0157369_10423240
1287 Ga0157369_10607285
1288 Ga0157369_10759812
1289 Ga0157369_11453264
1290 Ga0157374_10003070
1291 Ga0157374_10028082
1292 Ga0157374_10100126
1293 Ga0157374_10286755
1294 Ga0157374_10292940
1295 Ga0157374_10531639
1296 Ga0157374_12332093
1297 Ga0157378_10000614
1298 Ga0157378_10164067
1299 Ga0157378_10435763
1300 Ga0157378_10770601
1301 Ga0163162_10015784
1302 Ga0163162_10412033
1303 Ga0163162_11225099
1304 Ga0157372_10003527
1305 Ga0157372_10071658
1306 Ga0157372_10187027
1307 Ga0157372_10199360
1308 Ga0157372_10208329
1309 Ga0157372_10298220
1310 Ga0157372_10456562
1311 Ga0157372_10721805
1312 Ga0157372_11001051
1313 Ga0157375_10031801
1314 Ga0157375_10066975
1315 Ga0157375_11007410
1316 Ga0157375_11438227
1317 Ga0163163_10001132
1318 Ga0163163_10074112
1319 Ga0163163_10159276
1320 Ga0163163_10211482
1321 Ga0163163_10332405
1322 Ga0163163_11487631
1323 Ga0182008_10031123
1324 Ga0157377_10000687
1325 Ga0157379_10011232
1326 Ga0157379_10046061
1327 Ga0157379_10070780
1328 Ga0157379_10214800
1329 Ga0157379_10514582
1330 Ga0157379_11972907
1331 Ga0157376_10002306
1332 Ga0157376_10151570
1333 Ga0157376_10280266
1334 Ga0157376_10981403
1335 Ga0157376_11142996
1336 Ga0182006_1187634
1337 Ga0182007_10008202
1338 Ga0163161_10002007
1339 Ga0163161_10099159
1340 Ga0197907_10594095
1341 Ga0206356_10018591
1342 Ga0206356_11176297
1343 Ga0206349_1107756
1344 Ga0206355_1478285
1345 Ga0206351_10222754
1346 Ga0206351_10267943
1347 Ga0206352_10508850
1348 Ga0206352_11161229
1349 Ga0206350_10223250
1350 Ga0206354_11433773
1351 Ga0206353_11208826
1352 Ga0154015_1422066
1353 Ga0154015_1591588
1354 Ga0213872_10044302
1355 Ga0213872_10169330
1356 Ga0213874_10006229
1357 Ga0224712_10181959
1358 Ga0224572_1000022
1359 Ga0224572_1003717
1360 Ga0228598_1000081
1361 Ga0228598_1002944
1362 Ga0207697_10003550
1363 Ga0207697_10258254
1364 Ga0207656_10032090
1365 Ga0207656_10490471
1366 Ga0207696_1020727
1367 Ga0207682_10009137
1368 Ga0207692_10012753
1369 Ga0207692_10200973
1370 Ga0207692_10507706
1371 Ga0207692_10556092
1372 Ga0207642_10037831
1373 Ga0207710_10110921
1374 Ga0207688_10002004
1375 Ga0207688_10549786
1376 Ga0207680_10022274
1377 Ga0207680_10091523
1378 Ga0207647_10002606
1379 Ga0207647_10028343
1380 Ga0207647_10215459
1381 Ga0207685_10209937
1382 Ga0207685_10308544
1383 Ga0207699_10000693
1384 Ga0207699_10067773
1385 Ga0207699_10079232
1386 Ga0207699_10428281
1387 Ga0207699_10553547
1388 Ga0207645_10001595
1389 Ga0207645_10015447
1390 Ga0207645_10494711
1391 Ga0207643_10000412
1392 Ga0207705_10142771
1393 Ga0207705_10761347
1394 Ga0207705_11030358
1395 Ga0207684_10159432
1396 Ga0207684_10278476
1397 Ga0207684_11715167
1398 Ga0207654_10000452
1399 Ga0207654_10090530
1400 Ga0207654_10183713
1401 Ga0207654_10978451
1402 Ga0207707_10178811
1403 Ga0207707_10218250
1404 Ga0207707_10218458
1405 Ga0207695_10167991
1406 Ga0207671_10036230
1407 Ga0207671_10322948
1408 Ga0207671_10549824
1409 Ga0207671_10660557
1410 Ga0207671_11179304
1411 Ga0207693_10000654
1412 Ga0207693_10241516
1413 Ga0207693_10855007
1414 Ga0207693_11347757
1415 Ga0207663_10003322
1416 Ga0207663_10053435
1417 Ga0207663_10251377
1418 Ga0207663_10800120
1419 Ga0207663_10991688
1420 Ga0207663_11021111
1421 Ga0207660_10569943
1422 Ga0207662_10044181
1423 Ga0207657_10016548
1424 Ga0207657_10025075
1425 Ga0207649_10018886
1426 Ga0207652_10019824
1427 Ga0207652_10036806
1428 Ga0207652_10236516
1429 Ga0207646_10045419
1430 Ga0207646_10286980
1431 Ga0207646_10407323
1432 Ga0207681_10013517
1433 Ga0207694_10045647
1434 Ga0207694_10842611
1435 Ga0207694_10904581
1436 Ga0207650_10000024
1437 Ga0207659_10097151
1438 Ga0207687_10138749
1439 Ga0207700_10000153
1440 Ga0207700_10166872
1441 Ga0207700_10288768
1442 Ga0207700_10368248
1443 Ga0207700_10388952
1444 Ga0207700_10407955
1445 Ga0207700_10685368
1446 Ga0207700_10917555
1447 Ga0207700_11103548
1448 Ga0207664_10048088
1449 Ga0207664_10083602
1450 Ga0207664_10124267
1451 Ga0207664_10328608
1452 Ga0207664_10502491
1453 Ga0207664_10569478
1454 Ga0207664_11191378
1455 Ga0207664_11516966
1456 Ga0207644_10018628
1457 Ga0207644_11073756
1458 Ga0207690_10013645
1459 Ga0207690_10305880
1460 Ga0207706_10003335
1461 Ga0207706_10013816
1462 Ga0207686_10017600
1463 Ga0207686_10088617
1464 Ga0207669_10170532
1465 Ga0207704_10007325
1466 Ga0207704_10343747
1467 Ga0207704_10974069
1468 Ga0207704_11377445
1469 Ga0207665_10000088
1470 Ga0207665_10094231
1471 Ga0207665_10242071
1472 Ga0207665_10267491
1473 Ga0207665_10546588
1474 Ga0207665_11048620
1475 Ga0207691_10000072
1476 Ga0207691_10142711
1477 Ga0207711_10000033
1478 Ga0207711_10036610
1479 Ga0207711_10037942
1480 Ga0207711_10044186
1481 Ga0207711_10331039
1482 Ga0207711_10589651
1483 Ga0207689_10001019
1484 Ga0207689_10001565
1485 Ga0207689_10142307
1486 Ga0207661_10001629
1487 Ga0207661_10367466
1488 Ga0207679_10000040
1489 Ga0207679_11592627
1490 Ga0207667_10001031
1491 Ga0207667_10117659
1492 Ga0207667_10140954
1493 Ga0207667_10148825
1494 Ga0207667_10513437
1495 Ga0207651_10009325
1496 Ga0207651_10116662
1497 Ga0207651_11705709
1498 Ga0207712_10014438
1499 Ga0207712_11665320
1500 Ga0207668_10064463
1501 Ga0207640_10126199
1502 Ga0207640_10128541
1503 Ga0207640_10244915
1504 Ga0207640_10665644
1505 Ga0207658_10003060
1506 Ga0207658_10022176
1507 Ga0207658_10079860
1508 Ga0207658_10607130
1509 Ga0207677_10159804
1510 Ga0207677_10191675
1511 Ga0207677_11010385
1512 Ga0207677_11515726
1513 Ga0207677_12063834
1514 Ga0207703_10064276
1515 Ga0207703_10121040
1516 Ga0207703_11187777
1517 Ga0207703_11476475
1518 Ga0207639_10038333
1519 Ga0207639_10051922
1520 Ga0207639_10370821
1521 Ga0207639_10474809
1522 Ga0207639_11462238
1523 Ga0207678_10002689
1524 Ga0207678_10981749
1525 Ga0207708_10186198
1526 Ga0207702_10046122
1527 Ga0207702_10955544
1528 Ga0207702_12086522
1529 Ga0207702_12132240
1530 Ga0207641_10000030
1531 Ga0207641_10108830
1532 Ga0207641_10726778
1533 Ga0207641_10727175
1534 Ga0207641_11268160
1535 Ga0207648_10001749
1536 Ga0207648_10130465
1537 Ga0207648_10136542
1538 Ga0207676_10000256
1539 Ga0207676_10080394
1540 Ga0207676_10538470
1541 Ga0207674_10002761
1542 Ga0207674_10089173
1543 Ga0207674_10213431
1544 Ga0207675_100023344
1545 Ga0207675_100214257
1546 Ga0207683_10000662
1547 Ga0207683_10007099
1548 Ga0207698_10076142
1549 Ga0207698_11364487
1550 Ga0207698_11690525
1551 Ga0207698_12366873
1552 Ga0209179_1057280
1553 Ga0209998_10010126
1554 Ga0268266_10019872
1555 Ga0268266_10056161
1556 Ga0268266_11528394
1557 Ga0268266_12174480
1558 Ga0268265_10021245
1559 Ga0268265_10438142
1560 Ga0268265_12163399
1561 Ga0268264_10011416
1562 Ga0268264_10245188
1563 Ga0268264_10578701
1564 Ga0268264_11139659
1565 Ga0268264_12623672
1566 Ga0265318_10302152
1567 Ga0265338_10004259
1568 Ga0265338_10264831
1569 Ga0265338_10460408
1570 Ga0265324_10053436
1571 Ga0265762_1119499
1572 Ga0265770_1044778
1573 Ga0265765_1009707
1574 Ga0265760_10001267
1575 Ga0265760_10012359
1576 Ga0265760_10030716
1577 Ga0265760_10048857
1578 Ga0265760_10052625
1579 Ga0265760_10186138
1580 Ga0265330_10000346
1581 Ga0265330_10007123
1582 Ga0265330_10059264
1583 Ga0265330_10073196
1584 Ga0265330_10165942
1585 Ga0265330_10321276
1586 Ga0265332_10005285
1587 Ga0265332_10040700
1588 Ga0265328_10003354
1589 Ga0265325_10000582
1590 Ga0265325_10003036
1591 Ga0265325_10049084
1592 Ga0265329_10016146
1593 Ga0265340_10001936
1594 Ga0265340_10004114
1595 Ga0265340_10324234
1596 Ga0265339_10006462
1597 Ga0265339_10006757
1598 Ga0265339_10017622
1599 Ga0265339_10135945
1600 Ga0265339_10264508
1601 Ga0265331_10025594
1602 Ga0265331_10097360
1603 Ga0265331_10333600
1604 Ga0265327_10214377
1605 Ga0265316_10000726
1606 Ga0265316_10002223
1607 Ga0265316_10006636
1608 Ga0265316_10012858
1609 Ga0265316_10032480
1610 Ga0265316_10271618
1611 Ga0265316_10401878
1612 Ga0265316_10910827
1613 Ga0307408_100213448
1614 Ga0307408_100552336
1615 Ga0307408_100654930
1616 Ga0265313_10001185
1617 Ga0265313_10019287
1618 Ga0265314_10000067
1619 Ga0265314_10033014
1620 Ga0265314_10198517
1621 Ga0265314_10582410
1622 Ga0265342_10000741
1623 Ga0265342_10001898
1624 Ga0265342_10071874
1625 Ga0265342_10119373
1626 Ga0265342_10263251
1627 Ga0307405_11192648
1628 Ga0307413_10115937
1629 Ga0307413_10473606
1630 Ga0307410_10005772
1631 Ga0307410_10301095
1632 Ga0307406_10083797
1633 Ga0307406_10834678
1634 Ga0307412_11444174
1635 Ga0307412_11718984
1636 Ga0307412_11953179
1637 Ga0307409_100202555
1638 Ga0307416_100071903
1639 Ga0307416_100318418
1640 Ga0307414_10638328
1641 Ga0307414_11545170
1642 Ga0307411_10167045
1643 Ga0307411_12086309
1644 Ga0307415_100134954
1645 Ga0307415_100943882
1646 Ga0316583_10031683
1647 Ga0373926_0294953
1648 Ga0373934_0041735
1649 Ga0373934_0168632
1650 Ga0373944_0124707
1651 Ga0373923_0236351
1652 Ga0373923_0360056
1653 Ga0373945_0002364
1654 Ga0373953_0278638
1655 Ga0373953_0471555
1656 Ga0373954_0178100
1657 Ga0373954_0465906
1658 Ga0373956_0090837
1659 Ga0373957_0117008
1660 Ga0373943_0002553
1661 Ga0373946_0004426
1662 Ga0373946_0075254
1663 Ga0373955_0014255
1664 Ga0373955_0577905
1665 Ga0373931_0684838
1666 Ga0373931_1190547
1667 Ga0373935_0250334
1668 Ga0373927_0065639
1669 Ga0373927_0167471
1670 Ga0373933_0173428
1671 Ga0373933_0451592
1672 Ga0373947_0599801
1673 Ga0373947_0637450
1674 Ga0373937_0009655
1675 Ga0373937_0158038
1676 Ga0373937_0230610
1677 Ga0373937_0292867
1678 Ga0373937_0367956
1679 Ga0373937_1144338
1680 Ga0373937_1510246
1681 Ga0265778_003161
1682 Ga0373925_0024161
1683 Ga0373925_0026433
1684 Ga0373925_0216397
1685 Ga0373925_0281961
1686 Ga0373925_0613969
1687 Ga0395900_1075301
1688 Ga0395905_0625910
1689 Ga0395905_1705552
1690 Ga0395901_0500645
1691 Ga0395901_0700807
1692 Ga0436365_0624994
1693 Ga0436365_0837639
1694 Ga0436365_0903852
1695 Ga0436360_0139949
1696 Ga0436360_0152286
1697 Ga0436360_0792118
1698 Ga0436360_0943434
1699 Ga0436360_1258478
1700 Ga0436361_0258027
1701 Ga0436361_0887686
1702 Ga0436361_1169155
1703 Ga0436363_0267088
1704 Ga0436363_0276301
1705 Ga0436363_0491074
1706 Ga0436363_0614486
1707 Ga0436363_1376765
1708 Ga0436362_1122765
1709 Ga0451577_2025560
1710 Ga0453683_0755309
1711 Ga0466965_0219124
1712 Ga0466966_0183609
1713 Ga0466966_0761941
1714 Ga0466961_0654972
1715 Ga0466963_0028800
1716 Ga0466963_0111333
1717 Ga0466964_0158339
1718 Ga0466957_0169608
1719 Ga0466957_0320173
1720 Ga0466959_0055610
1721 Ga0466959_0079482
1722 Ga0466958_1007715
1723 Ga0466967_0082587
1724 Ga0466967_0108084
1725 Ga0466967_0224412
1726 Ga0466967_0834407
1727 Ga0466967_1767194
1728 Ga0466967_2268097
1729 Ga0495603_0163158
1730 Ga0495629_0031645
1731 Ga0495629_0767031
1732 Ga0495651_0076691
1733 Ga0495651_0554501
1734 Ga0495580_0003281
1735 Ga0495580_0012850
1736 Ga0495580_0023629
1737 Ga0495580_0180506
1738 Ga0495580_0226616
1739 Ga0495580_0290944
1740 Ga0495580_0572150
1741 Ga0495582_0225831
1742 Ga0495582_0472795
1743 Ga0495582_0575605
1744 Ga0495639_0086970
1745 Ga0495662_0141645
1746 Ga0495585_0441717
1747 Ga0495594_0049707
1748 Ga0495594_0106110
1749 Ga0495594_0176039
1750 Ga0495608_0114226
1751 Ga0495608_0563620
1752 Ga0495628_0061195
1753 Ga0495628_0441342
1754 Ga0495630_0027742
1755 Ga0495630_0784447
1756 Ga0495637_0057017
1757 Ga0495643_0058243
1758 Ga0495666_0100021
1759 Ga0495666_0320855
1760 Ga0495666_0358655
1761 Ga0495666_0467349
1762 Ga0495642_0042339
1763 Ga0495652_0504419
1764 Ga0495652_0881563
1765 Ga0495652_1067392
1766 Ga0495665_0006124
1767 Ga0495665_0103002
1768 Ga0495665_0641397
1769 Ga0495665_0655455
1770 Ga0495640_0764151
1771 Ga0495587_0060996
1772 Ga0495667_0149102
1773 Ga0495667_0625144
1774 Ga0495668_0079030
1775 Ga0495668_0139089
1776 Ga0495635_0111022
1777 Ga0495635_0116768
1778 Ga0495659_0009637
1779 Ga0495588_0436728
1780 Ga0495657_0070739
1781 Ga0495657_0086843
1782 Ga0495599_0799814
1783 Ga0495623_0058258
1784 Ga0495623_0202188
1785 Ga0495647_0094220
1786 Ga0495647_0415076
1787 Ga0495658_0608099
1788 Ga0495658_0968633
1789 Ga0495669_0009776
1790 Ga0495669_0149170
1791 Ga0495669_0396906
1792 Ga0495613_0095361
1793 Ga0495613_0113907
1794 Ga0495624_0548330
1795 Ga0495670_0069129
1796 Ga0495671_0610553
1797 Ga0495649_0012376
1798 Ga0495600_0031618
1799 Ga0495581_0023841
1800 Ga0495581_0159704
1801 Ga0495581_0339089
1802 Ga0495581_0595781
1803 Ga0495604_0035889
1804 Ga0495604_0832749
1805 Ga0495636_0115522
1806 Ga0495674_0152527
1807 Ga0495674_0173918
1808 Ga0495687_112896
1809 Ga0495675_0251329
1810 Ga0495677_0117725
1811 Ga0495684_0588764
1812 Ga0495593_0011360
1813 Ga0495602_0185388
1814 Ga0495602_0251961
1815 Ga0496100_0056286
1816 Ga0496100_0310274
1817 Ga0496100_0791186
1818 Ga0496100_0890180
1819 Ga0496101_0455312
1820 Ga0496101_0699344
1821 Ga0496102_0181938
1822 Ga0496102_0205700
1823 Ga0496102_0302201
1824 Ga0496102_0831019
1825 Ga0496102_1290278
1826 Ga0496102_1487496
1827 Ga0496103_0071604
1828 Ga0496103_0259852
1829 Ga0496104_0020022
1830 Ga0496104_0180671
1831 Ga0496104_0338337
1832 Ga0496104_0448091
1833 Ga0496104_0466708
1834 Ga0496104_1168611
1835 Ga0496105_0012923
1836 Ga0496105_0514581
1837 Ga0496105_0827181
1838 Ga0496106_0043194
1839 Ga0496106_0640928
1840 Ga0496107_0314144
1841 Ga0496108_0000567
1842 Ga0496109_0000381
1843 Ga0496109_0558674
1844 Ga0496110_0001459
1845 Ga0496110_0109144
1846 Ga0496110_0245694
1847 Ga0496111_0000626
1848 Ga0496111_0146424
1849 Ga0496111_0233297
1850 Ga0496111_0866651
1851 Ga0496111_0885950
1852 Ga0496112_0000155
1853 Ga0496112_0047757
1854 Ga0496112_0053991
1855 Ga0496112_0093961
1856 Ga0496112_0233773
1857 Ga0496112_0292064
1858 Ga0496112_0300787
1859 Ga0496112_0449708
1860 Ga0496112_1009339
1861 Ga0496113_0006644
1862 Ga0496113_0011591
1863 Ga0496113_0372393
1864 Ga0496114_0033318
1865 Ga0496114_1353977
1866 Ga0496115_0027960
1867 Ga0496115_0048017
1868 Ga0496115_0152540
1869 Ga0496115_0234718
1870 Ga0496115_0275109
1871 Ga0496115_1439676
1872 Ga0496126_0065061
1873 Ga0501309_022129
1874 Ga0501305_050524
1875 Ga0501296_027458
1876 Ga0501299_139178
1877 Ga0501315_051465
1878 Ga0501333_017290
1879 Ga0501335_016370
1880 Ga0501073_0046676
1881 Ga0501206_026679
1882 Ga0501235_071200
1883 Ga0501235_175055
1884 Ga0501249_029994
1885 Ga0501225_0160251
1886 Ga0501229_016991
1887 Ga0501263_051199
1888 Ga0501273_096940
1889 nmdc:mga05p37_10115_c1
1890 nmdc:mga0n895_18558_c1
1891 nmdc:mga0n895_68383_c1
1892 nmdc:mga0rr50_49336_c1
1893 nmdc:mga0rr50_508392_c1
1894 nmdc:mga08x19_168954_c1
1895 nmdc:mga08x19_370563_c1
1896 nmdc:mga08x19_3986_c1
1897 nmdc:mga08x19_98778_c1
1898 nmdc:mga0a205_12673_c1
1899 nmdc:mga0a205_138_c1
1900 Ga0495601_0189113
1901 Ga0500644_0023663
1902 Ga0500595_006210
1903 Ga0500595_128648
1904 Ga0500590_121154
1905 Ga0500552_126184
1906 Ga0501084_0004391
1907 Ga0587084_012021
1908 Ga0587066_012508
1909 Ga0587066_170406
1910 Ga0587070_024361
1911 Ga0587070_098262
1912 Ga0587073_0008143
1913 Ga0587077_029543
1914 Ga0587080_028561
1915 Ga0587082_026454
1916 Ga0587082_099490
1917 Ga0587083_0006122
1918 Ga0587085_036869
1919 Ga0587088_004104
1920 Ga0587090_034722
1921 Ga0587091_036843
1922 Ga0587092_006993
1923 Ga0587094_006626
1924 Ga0587106_104813
1925 Ga0587099_065632
1926 Ga0587109_153064
1927 Ga0587117_025146
1928 Ga0587128_006746
1929 Ga0587067_005061
1930 Ga0587068_015366
1931 Ga0587076_131193
1932 Ga0587078_067149
1933 Ga0587107_002951
1934 Ga0587107_032118
1935 Ga0587107_097518
1936 Ga0466962_0640818

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00453

Ribosomal_L20

Ribosomal protein L20

18

134

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v48-assembly1.cif.gz_AO real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.8751 51 116
1gyz-assembly1.cif.gz_A bacterial ribosomal protein l20 from aquifex aeolicus 0.8637 61 117
2ghj-assembly1.cif.gz_A crystal structure of folded and partially unfolded forms of aquifex aeolicus ribosomal protein l20 0.8539 21 117
6z1p-assembly1.cif.gz_Au structure of the mitochondrial ribosome from tetrahymena thermophila 0.8435 33 117
4v48-assembly1.cif.gz_AO real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.8413 51 116
ID Description Score Start End Superfamily
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9622 53 118 1.10.1900.20
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9084 53 118 1.10.1900.20
2ghjB02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9026 58 117 1.10.1900.20
1gyzA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8637 61 117 1.10.1900.20
1gyzA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8145 61 117 1.10.1900.20
ID Description Score Start End GO Terms
AF-A0A357L7L9-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1.009 61 117 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1G9GV44-F1-model_v4 deleted 1.009 64 117
AF-A0A354QTS7-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1.008 53 117 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7Y7CN64-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1.008 64 117 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-G6EM08-F1-model_v4 deleted 1.007 57 117

Map