F487015

General Info

Members Datasets Scaffolds Average Seq Length
967 472 881 312

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100556001|Ga0070665_1005560011
Length 291
Sequence MTSLDLRGLNPAPITPFTRDGAVDYDAIQRLGSWLGSIDGVKSLTVLGHAGEGTFLTQDEQVRVIGAFKESVDGKLPIGASAGLVYPSHGWLRFGYQDGAPQDRYRALHEGSGLPLILFQYPDVTKATYNLDTQLEIAAQDGVFATKNGVRNMRRWDREIPVLRKENPDLQILSCHDEYLLHTMFDVDGLLVGYGGLAPEPLVELIAAGKARDYPAARALHDRLLPVTATVYHRGSHMEGTVALKEGLVHRGILEHATVRSPLLPLAPGAHEEIAAALDSAGLGSVVPALV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501050 Microvirga lupini Lut6 Isolate Nodule
3 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
4 2511231022 Pseudomonas sp. GM79 Isolate Nodule
5 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
6 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
7 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
8 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
9 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
10 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
11 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
12 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
13 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
14 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
15 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
16 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
17 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
18 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
19 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
20 2636415599 Klebsiella variicola DX120E Isolate Unclassified
21 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
22 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
23 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
24 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
25 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
26 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
27 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
28 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
29 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
30 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
31 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
32 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
33 2775507074 Klebsiella sp. D5A Isolate Unclassified
34 2791355267 Rhizobium sp. L18 Isolate Nodule
35 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
36 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
37 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
38 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
39 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
40 2818991452 Burkholderia cepacia 561 Isolate Unclassified
41 2818991457 Xanthomonas translucens 569 Isolate Unclassified
42 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
43 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
44 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
45 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
46 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
47 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
48 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
49 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
50 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
51 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
52 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
53 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
54 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
55 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
56 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
57 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
58 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
59 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
60 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
61 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
62 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
63 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
64 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
65 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
66 2928170801 Burkholderia sp. 572 Isolate Unclassified
67 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
68 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
69 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
70 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
71 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
72 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
73 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
74 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
75 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
76 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
77 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
78 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
79 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
80 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
81 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
83 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
84 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
85 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
86 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
87 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
88 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
89 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
90 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
91 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
92 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
93 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
94 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
95 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
96 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
97 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
98 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
99 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
100 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
101 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
102 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
103 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
104 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
105 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
106 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
107 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
108 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
109 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
110 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
111 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
112 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
113 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
114 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
115 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
116 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
117 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
118 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
119 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
120 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
121 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
122 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
123 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
124 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
125 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
126 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
127 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
128 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
129 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
130 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
131 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
132 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
133 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
134 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
135 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
136 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
137 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
138 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
139 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
140 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
141 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
142 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
143 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
144 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
145 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
146 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
147 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
148 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
149 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
150 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
151 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
152 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
153 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
154 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
155 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
156 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
157 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
158 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
159 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
160 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
161 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
162 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
163 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
164 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
165 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
166 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
167 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
168 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
169 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
170 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
171 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
172 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
173 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
174 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
175 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
176 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
177 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
178 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
179 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
180 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
181 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
182 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
183 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
184 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
185 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
186 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
187 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
188 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
189 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
190 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
191 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
192 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
193 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
194 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
200 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
202 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
203 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
204 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
206 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
257 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
263 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
264 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
265 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
266 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
267 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
268 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
269 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
270 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
271 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
272 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
273 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
274 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
275 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
276 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
277 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
278 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
283 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
284 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
285 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
286 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
287 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
288 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
289 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
290 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
291 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
292 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
293 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
294 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
295 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
296 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
297 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
298 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
299 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
300 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
301 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
302 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
303 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
304 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
305 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
306 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
307 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
308 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
309 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
310 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
311 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
312 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
313 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
314 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
315 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
316 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
317 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
318 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
319 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
320 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
321 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
322 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
323 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
324 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
325 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
326 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
327 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
328 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
329 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
330 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
331 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
332 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
333 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
334 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
335 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
336 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
337 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
338 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
339 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
340 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
341 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
342 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
343 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
344 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
345 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
346 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
347 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
348 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
349 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
350 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
351 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
352 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
353 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
354 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
355 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
356 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
357 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
358 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
359 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
360 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
361 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
362 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
363 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
364 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
365 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
366 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
367 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
368 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
369 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
370 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
371 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
372 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
373 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
374 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
375 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
376 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
377 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
378 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
379 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
380 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
381 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
382 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
383 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
384 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
385 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
386 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
387 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
388 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
389 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
390 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
391 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
392 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
393 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
394 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
395 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
396 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
397 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
398 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
399 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
400 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
401 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
402 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
403 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
404 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
405 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
406 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
407 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
408 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
409 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
410 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
411 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
412 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
413 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
414 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
415 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
416 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
417 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
418 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
419 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
420 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
425 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
429 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
432 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
433 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
434 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
435 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
436 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
437 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
438 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
439 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
440 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
441 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
442 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
443 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
444 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
445 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
446 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
447 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
448 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
449 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
450 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
451 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
452 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
453 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
454 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
455 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
456 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
457 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
461 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
462 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
463 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
464 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
465 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
466 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
467 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
468 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
469 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
470 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
471 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
472 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.83
Metatranscriptomes 2.28
Isolates 8.89

Biome Distribution

Category Percentage (%)
Aerial Root 0.41
Bulb 0
Endosphere 6.72
Nodule 1.24
Rhizoplane 6.31
Rhizosphere 74.25
Stem 0
Stem Tuber 0
Unclassified 11.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1024214 2162886007 Bacteria 6871
2 SwRhRL2b_contig_1448349 2162886007 Bacteria 21841
3 SwRhRL2b_contig_1845099 2162886007 Bacteria 4827
4 SwRhRL2b_contig_2237776 2162886007 Bacteria 72079
5 SwRhRL2b_contig_42532 2162886007 Bacteria 5384
6 JGI24739J22299_10000367 3300001989 Bacteria 15471
7 JGI24034J26672_10004338 3300002239 Bacteria 2006
8 JGI24751J29686_10007770 3300002459 Bacteria 2191
9 JGI25156J39149_1000365 3300002705 Bacteria 29267
10 JGI25406J46586_10017074 3300003203 Bacteria 3007
11 JGI25153J46596_10000751 3300003215 Bacteria 19822
12 rootL2_10000529 3300003322 Bacteria 63830
13 rootH1_10012306 3300003323 Bacteria 24318
14 Ga0055533_1000469 3300003756 Bacteria 15224
15 Ga0055532_1000577 3300003758 Bacteria 15091
16 Ga0055527_1000866 3300003760 Bacteria 7868
17 Ga0055535_1001178 3300003761 Bacteria 15112
18 Ga0055535_1011754 3300003761 Bacteria 1367
19 Ga0055542_1001170 3300003762 Bacteria 15112
20 Ga0055529_1000817 3300003763 Bacteria 18688
21 Ga0055524_1007666 3300003775 Bacteria 4561
22 Ga0055528_1003975 3300003790 Bacteria 7237
23 Ga0055528_1012987 3300003790 Eukaryota 3193
24 Ga0055528_1016714 3300003790 Bacteria 2579
25 Ga0055540_1000571 3300003792 Bacteria 27072
26 Ga0055531_10008799 3300003794 Bacteria 5260
27 Ga0058692_1000014 3300003856 Bacteria 313984
28 Ga0058692_1000028 3300003856 Bacteria 193757
29 Ga0058860_11916293 3300004801 Bacteria 1742
30 Ga0065703_1000280 3300005272 Bacteria 23631
31 Ga0065714_10002420 3300005288 Bacteria 27261
32 Ga0065704_10000243 3300005289 Bacteria 54713
33 Ga0065704_10000696 3300005289 Bacteria 13952
34 Ga0065704_10070144 3300005289 Bacteria 333223
35 Ga0065704_10070434 3300005289 Bacteria 25013
36 Ga0065704_10070457 3300005289 Bacteria 24058
37 Ga0070658_10015399 3300005327 Bacteria 6120
38 Ga0070670_100011500 3300005331 Bacteria 7571
39 Ga0070670_100019120 3300005331 Bacteria 5874
40 Ga0070670_100021935 3300005331 Bacteria 5494
41 Ga0070670_100074262 3300005331 Bacteria 2921
42 Ga0070670_100113107 3300005331 Bacteria 2340
43 Ga0070670_100117294 3300005331 Bacteria 2296
44 Ga0070670_100175692 3300005331 Bacteria 1859
45 Ga0068869_100174439 3300005334 Bacteria 1681
46 Ga0070682_100074703 3300005337 Bacteria 2177
47 Ga0068868_100022641 3300005338 Bacteria 4746
48 Ga0068868_100320528 3300005338 Bacteria 1320
49 Ga0070689_100015734 3300005340 Bacteria 5524
50 Ga0070689_100211342 3300005340 Bacteria 1588
51 Ga0070661_100127517 3300005344 Bacteria 1910
52 Ga0070692_10123958 3300005345 Bacteria 1444
53 Ga0070668_100004095 3300005347 Bacteria 10797
54 Ga0070668_100013153 3300005347 Bacteria 6169
55 Ga0070668_100014523 3300005347 Bacteria 5886
56 Ga0070668_100017328 3300005347 Bacteria 5394
57 Ga0070668_100017619 3300005347 Bacteria 5356
58 Ga0070668_100046278 3300005347 Bacteria 3340
59 Ga0070668_100062129 3300005347 Bacteria 2893
60 Ga0070668_100109911 3300005347 Bacteria 2193
61 Ga0070669_100000198 3300005353 Bacteria 52322
62 Ga0070669_100008875 3300005353 Bacteria 7170
63 Ga0070669_100010205 3300005353 Bacteria 6673
64 Ga0070669_100010538 3300005353 Bacteria 6564
65 Ga0070669_100020177 3300005353 Bacteria 4759
66 Ga0070669_100031025 3300005353 Bacteria 3859
67 Ga0070669_100137244 3300005353 Bacteria 1882
68 Ga0070669_100353720 3300005353 Bacteria 1193
69 Ga0070675_100035183 3300005354 Bacteria 4068
70 Ga0070675_100074071 3300005354 Bacteria 2828
71 Ga0070671_100000044 3300005355 Bacteria 86204
72 Ga0070671_100001152 3300005355 Bacteria 19660
73 Ga0070671_100014900 3300005355 Bacteria 6281
74 Ga0070671_100023842 3300005355 Bacteria 5008
75 Ga0070671_100053822 3300005355 Bacteria 3345
76 Ga0070673_100014750 3300005364 Bacteria 5460
77 Ga0070673_100108118 3300005364 Bacteria 2302
78 Ga0070667_100000485 3300005367 Bacteria 40311
79 Ga0070667_100004482 3300005367 Bacteria 11779
80 Ga0070709_10448100 3300005434 Bacteria 972
81 Ga0070713_100000289 3300005436 Bacteria 33226
82 Ga0070713_100072441 3300005436 Bacteria 2914
83 Ga0070713_100075934 3300005436 Bacteria 2852
84 Ga0070710_10027841 3300005437 Bacteria 3018
85 Ga0070711_100056576 3300005439 Bacteria 2713
86 Ga0070711_100058341 3300005439 Bacteria 2676
87 Ga0070711_100064195 3300005439 Bacteria 2565
88 Ga0070708_100066790 3300005445 Bacteria 3228
89 Ga0070663_100028759 3300005455 Bacteria 3788
90 Ga0070663_100100255 3300005455 Bacteria 2160
91 Ga0070663_100185400 3300005455 Bacteria 1617
92 Ga0070662_100128344 3300005457 Eukaryota 1952
93 Ga0070662_100198505 3300005457 Bacteria 1590
94 Ga0068867_100026629 3300005459 Bacteria 4153
95 Ga0070685_10072180 3300005466 Bacteria 2048
96 Ga0070685_10174814 3300005466 Bacteria 1378
97 Ga0070706_100025076 3300005467 Bacteria 5488
98 Ga0070699_100053313 3300005518 Bacteria 3500
99 Ga0070672_100036248 3300005543 Bacteria 3757
100 Ga0070672_100059975 3300005543 Bacteria 2995
101 Ga0070693_100119230 3300005547 Bacteria 1634
102 Ga0070665_100000878 3300005548 Bacteria 38691
103 Ga0070665_100003594 3300005548 Bacteria 16417
104 Ga0070665_100034401 3300005548 Bacteria 5096
105 Ga0070665_100097495 3300005548 Bacteria 2945
106 Ga0070665_100141383 3300005548 Bacteria 2410
107 Ga0070665_100191133 3300005548 Bacteria 2048
108 Ga0070665_100205038 3300005548 Bacteria 1972
109 Ga0070665_100299023 3300005548 Bacteria 1612
110 Ga0070665_100556001 3300005548 Bacteria 1160
111 Ga0068855_100000037 3300005563 Bacteria 158161
112 Ga0068855_100020370 3300005563 Bacteria 7956
113 Ga0070664_100032779 3300005564 Bacteria 4346
114 Ga0068857_100002837 3300005577 Bacteria 14244
115 Ga0068854_100357091 3300005578 Bacteria 1198
116 Ga0068856_100154509 3300005614 Bacteria 2304
117 Ga0068852_100273399 3300005616 Bacteria 1626
118 Ga0068859_100042732 3300005617 Bacteria 4553
119 Ga0068859_100098143 3300005617 Bacteria 2983
120 Ga0068859_100251484 3300005617 Bacteria 1858
121 Ga0068859_100411617 3300005617 Bacteria 1448
122 Ga0068864_100010805 3300005618 Bacteria 7543
123 Ga0068864_100083125 3300005618 Bacteria 2811
124 Ga0068864_100169922 3300005618 Bacteria 1987
125 Ga0068861_100269451 3300005719 Bacteria 1461
126 Ga0068861_100341983 3300005719 Bacteria 1310
127 Ga0068870_10023888 3300005840 Bacteria 3020
128 Ga0068863_100009249 3300005841 Bacteria 9610
129 Ga0068863_100010052 3300005841 Bacteria 9209
130 Ga0068863_100040210 3300005841 Bacteria 4447
131 Ga0068863_100065603 3300005841 Bacteria 3435
132 Ga0068858_100006378 3300005842 Bacteria 11490
133 Ga0068858_100038154 3300005842 Bacteria 4456
134 Ga0068858_100063792 3300005842 Bacteria 3408
135 Ga0068860_100004982 3300005843 Bacteria 13534
136 Ga0068860_100007867 3300005843 Bacteria 10642
137 Ga0068860_100050953 3300005843 Bacteria 3940
138 Ga0068860_100151415 3300005843 Bacteria 2234
139 Ga0068860_100251985 3300005843 Bacteria 1720
140 Ga0068860_100467543 3300005843 Bacteria 1256
141 Ga0068862_100011964 3300005844 Bacteria 7167
142 Ga0068862_100012903 3300005844 Bacteria 6911
143 Ga0068862_100030283 3300005844 Bacteria 4560
144 Ga0068862_100073070 3300005844 Bacteria 2964
145 Ga0068862_100076885 3300005844 Bacteria 2889
146 Ga0068862_100084915 3300005844 Bacteria 2750
147 Ga0081455_10015596 3300005937 Bacteria 7374
148 Ga0081540_1000175 3300005983 Bacteria 67078
149 Ga0081540_1022037 3300005983 Bacteria 3770
150 Ga0081539_10004485 3300005985 Bacteria 15365
151 Ga0081539_10073243 3300005985 Bacteria 1828
152 Ga0075363_100014851 3300006048 Bacteria 3817
153 Ga0075363_100040205 3300006048 Bacteria 2464
154 Ga0075363_100125773 3300006048 Bacteria 1435
155 Ga0075364_10050785 3300006051 Bacteria 2707
156 Ga0075432_10009478 3300006058 Bacteria 3315
157 Ga0075432_10010009 3300006058 Bacteria 3221
158 Ga0070716_100035078 3300006173 Bacteria 2756
159 Ga0075362_10017169 3300006177 Bacteria 2978
160 Ga0075367_10020906 3300006178 Bacteria 3651
161 Ga0075367_10053954 3300006178 Bacteria 2383
162 Ga0075369_10016219 3300006186 Bacteria 3003
163 Ga0075369_10019958 3300006186 Bacteria 2741
164 Ga0075366_10000419 3300006195 Bacteria 19896
165 Ga0075366_10011020 3300006195 Bacteria 5090
166 Ga0075366_10015917 3300006195 Bacteria 4317
167 Ga0075366_10054373 3300006195 Bacteria 2378
168 Ga0075370_10035756 3300006353 Bacteria 2789
169 Ga0075370_10211532 3300006353 Bacteria 1145
170 Ga0075428_100068666 3300006844 Bacteria 3877
171 Ga0075430_100011408 3300006846 Bacteria 7543
172 Ga0075430_100129615 3300006846 Bacteria 2102
173 Ga0075430_100138678 3300006846 Bacteria 2025
174 Ga0075431_100300468 3300006847 Bacteria 1622
175 Ga0075433_10016630 3300006852 Bacteria 6070
176 Ga0075434_100001356 3300006871 Bacteria 20544
177 Ga0075434_100296667 3300006871 Bacteria 1636
178 Ga0075429_100016836 3300006880 Bacteria 6326
179 Ga0097620_100042731 3300006931 Bacteria 4553
180 Ga0097620_100098144 3300006931 Bacteria 2983
181 Ga0097620_100251475 3300006931 Bacteria 1858
182 Ga0097620_100411614 3300006931 Bacteria 1448
183 Ga0099823_1000033 3300006944 Bacteria 68228
184 Ga0099794_10002464 3300007265 Bacteria 6823
185 Ga0105251_10000075 3300009011 Bacteria 94904
186 Ga0105251_10000239 3300009011 Bacteria 54956
187 Ga0105251_10001294 3300009011 Bacteria 21632
188 Ga0105251_10001422 3300009011 Bacteria 20620
189 Ga0105251_10001607 3300009011 Bacteria 19211
190 Ga0105251_10002112 3300009011 Bacteria 16005
191 Ga0105251_10013543 3300009011 Bacteria 4558
192 Ga0105251_10024951 3300009011 Bacteria 3064
193 Ga0105251_10025991 3300009011 Bacteria 2986
194 Ga0105251_10032576 3300009011 Bacteria 2596
195 Ga0105244_10005583 3300009036 Bacteria 8324
196 Ga0105250_10002874 3300009092 Bacteria 8414
197 Ga0105250_10003656 3300009092 Bacteria 7239
198 Ga0105240_10023443 3300009093 Bacteria 8160
199 Ga0111539_10562013 3300009094 Bacteria 1329
200 Ga0105245_10037563 3300009098 Bacteria 4306
201 Ga0105247_10004686 3300009101 Bacteria 8713
202 Ga0105247_10034631 3300009101 Bacteria 3076
203 Ga0105243_10000249 3300009148 Bacteria 61872
204 Ga0105243_10015538 3300009148 Bacteria 5754
205 Ga0105243_10023100 3300009148 Bacteria 4730
206 Ga0105243_10023311 3300009148 Bacteria 4711
207 Ga0105248_10003673 3300009177 Bacteria 16996
208 Ga0105248_10014957 3300009177 Bacteria 8542
209 Ga0105248_10042429 3300009177 Bacteria 5102
210 Ga0105248_10126471 3300009177 Bacteria 2883
211 Ga0105248_10156962 3300009177 Bacteria 2567
212 Ga0105248_10157398 3300009177 Bacteria 2563
213 Ga0105248_10403316 3300009177 Bacteria 1539
214 Ga0105237_10024655 3300009545 Bacteria 6152
215 Ga0105237_10509750 3300009545 Bacteria 1210
216 Ga0105238_10028042 3300009551 Bacteria 5737
217 Ga0105249_10010654 3300009553 Bacteria 8076
218 Ga0105249_10226790 3300009553 Bacteria 1841
219 Ga0105148_100125 3300009978 Bacteria 11767
220 Ga0105148_102481 3300009978 Bacteria 1299
221 Ga0099796_10021889 3300010159 Bacteria 1976
222 Ga0105239_10001024 3300010375 Eukaryota 39022
223 Ga0105239_10200367 3300010375 Bacteria 2236
224 Ga0105239_10339797 3300010375 Bacteria 1694
225 Ga0105246_10019597 3300011119 Bacteria 4326
226 Ga0157370_10007312 3300013104 Bacteria 12048
227 Ga0157369_10196540 3300013105 Eukaryota 2118
228 Ga0157369_10405814 3300013105 Bacteria 1413
229 Ga0157374_10159694 3300013296 Bacteria 2195
230 Ga0157374_10431268 3300013296 Bacteria 1318
231 Ga0157374_10626342 3300013296 Bacteria 1087
232 Ga0163162_10000398 3300013306 Bacteria 39865
233 Ga0163162_10014417 3300013306 Bacteria 7724
234 Ga0163162_10037551 3300013306 Bacteria 4834
235 Ga0163162_10107352 3300013306 Bacteria 2887
236 Ga0163162_10172008 3300013306 Bacteria 2291
237 Ga0163162_10340260 3300013306 Bacteria 1633
238 Ga0157372_10274997 3300013307 Bacteria 1958
239 Ga0157375_10039196 3300013308 Bacteria 4558
240 Ga0163163_10026334 3300014325 Bacteria 5558
241 Ga0163163_10096555 3300014325 Bacteria 2976
242 Ga0157380_10000081 3300014326 Bacteria 53155
243 Ga0157380_10114610 3300014326 Bacteria 2272
244 Ga0157377_10195811 3300014745 Bacteria 1280
245 Ga0157379_10140333 3300014968 Bacteria 2178
246 Ga0157379_10194644 3300014968 Bacteria 1832
247 Ga0182007_10004297 3300015262 Bacteria 6489
248 Ga0163161_10000427 3300017792 Bacteria 35484
249 Ga0163161_10011170 3300017792 Bacteria 6221
250 Ga0163161_10028287 3300017792 Bacteria 3980
251 Ga0163161_10181101 3300017792 Bacteria 1616
252 Ga0163161_10213310 3300017792 Bacteria 1492
253 Ga0206355_1050631 3300020076 Bacteria 1024
254 Ga0206354_11554051 3300020081 Bacteria 1043
255 Ga0224712_10150079 3300022467 Eukaryota 1032
256 Ga0209674_100049 3300025226 Bacteria 346969
257 Ga0209672_100097 3300025228 Bacteria 110837
258 Ga0209147_100106 3300025229 Bacteria 156899
259 Ga0209258_100157 3300025242 Bacteria 156898
260 Ga0209258_101138 3300025242 Bacteria 10991
261 Ga0209258_107071 3300025242 Bacteria 1695
262 Ga0209148_1000150 3300025254 Bacteria 156898
263 Ga0209759_1000041 3300025256 Bacteria 252893
264 Ga0209455_1000132 3300025272 Bacteria 156899
265 Ga0209673_1000324 3300025273 Eukaryota 87582
266 Ga0209673_1001616 3300025273 Bacteria 19667
267 Ga0209673_1003540 3300025273 Bacteria 9118
268 Ga0209673_1003939 3300025273 Bacteria 8301
269 Ga0209564_1011053 3300025295 Bacteria 4082
270 Ga0209758_1000382 3300025297 Bacteria 76653
271 Ga0209758_1004836 3300025297 Bacteria 10869
272 Ga0209050_1002396 3300025298 Bacteria 16244
273 Ga0209050_1021597 3300025298 Bacteria 2340
274 Ga0209256_1001786 3300025299 Bacteria 20365
275 Ga0209051_1000462 3300025303 Bacteria 53349
276 Ga0209051_1002774 3300025303 Bacteria 12094
277 Ga0209257_1001143 3300025304 Bacteria 33909
278 Ga0209257_1009675 3300025304 Bacteria 5092
279 Ga0207696_1001489 3300025711 Bacteria 12622
280 Ga0207696_1002726 3300025711 Bacteria 8415
281 Ga0207696_1025010 3300025711 Bacteria 1867
282 Ga0207655_1000327 3300025728 Bacteria 70037
283 Ga0207655_1000339 3300025728 Bacteria 68128
284 Ga0207713_1000038 3300025735 Bacteria 247609
285 Ga0207713_1001016 3300025735 Bacteria 24447
286 Ga0207713_1003536 3300025735 Bacteria 10585
287 Ga0207713_1006052 3300025735 Bacteria 7460
288 Ga0207713_1007177 3300025735 Bacteria 6639
289 Ga0207713_1007672 3300025735 Bacteria 6314
290 Ga0207713_1010855 3300025735 Bacteria 5007
291 Ga0207710_10001632 3300025900 Bacteria 10954
292 Ga0207710_10052925 3300025900 Bacteria 1826
293 Ga0207680_10057312 3300025903 Bacteria 2357
294 Ga0207680_10315771 3300025903 Bacteria 1092
295 Ga0207685_10018230 3300025905 Bacteria 2287
296 Ga0207645_10089515 3300025907 Bacteria 1979
297 Ga0207645_10131205 3300025907 Bacteria 1631
298 Ga0207643_10031355 3300025908 Bacteria 2963
299 Ga0207705_10005976 3300025909 Bacteria 9055
300 Ga0207705_10249496 3300025909 Bacteria 1353
301 Ga0207695_10014875 3300025913 Bacteria 9185
302 Ga0207695_10064490 3300025913 Bacteria 3771
303 Ga0207671_10017485 3300025914 Bacteria 5526
304 Ga0207671_10133716 3300025914 Eukaryota 1906
305 Ga0207671_10366936 3300025914 Bacteria 1143
306 Ga0207693_10033688 3300025915 Bacteria 4041
307 Ga0207693_10058144 3300025915 Bacteria 3029
308 Ga0207693_10351693 3300025915 Bacteria 1153
309 Ga0207663_10074208 3300025916 Bacteria 2204
310 Ga0207663_10205893 3300025916 Bacteria 1422
311 Ga0207662_10018677 3300025918 Bacteria 3938
312 Ga0207657_10088952 3300025919 Bacteria 2580
313 Ga0207649_10301479 3300025920 Bacteria 1171
314 Ga0207681_10000177 3300025923 Bacteria 52335
315 Ga0207681_10010161 3300025923 Bacteria 5763
316 Ga0207681_10036366 3300025923 Bacteria 3248
317 Ga0207681_10052906 3300025923 Bacteria 2755
318 Ga0207694_10202000 3300025924 Bacteria 1617
319 Ga0207694_10329011 3300025924 Bacteria 1262
320 Ga0207650_10002502 3300025925 Bacteria 12761
321 Ga0207650_10011955 3300025925 Bacteria 5984
322 Ga0207650_10012392 3300025925 Bacteria 5886
323 Ga0207650_10038911 3300025925 Bacteria 3475
324 Ga0207650_10208193 3300025925 Bacteria 1570
325 Ga0207659_10011480 3300025926 Bacteria 5597
326 Ga0207659_10138200 3300025926 Bacteria 1888
327 Ga0207687_10017974 3300025927 Bacteria 4665
328 Ga0207700_10000071 3300025928 Bacteria 62757
329 Ga0207700_10057725 3300025928 Bacteria 2928
330 Ga0207644_10000080 3300025931 Bacteria 70312
331 Ga0207644_10000766 3300025931 Bacteria 20334
332 Ga0207644_10002305 3300025931 Bacteria 12382
333 Ga0207644_10017094 3300025931 Bacteria 4892
334 Ga0207644_10040520 3300025931 Bacteria 3292
335 Ga0207644_10056327 3300025931 Bacteria 2837
336 Ga0207690_10225262 3300025932 Bacteria 1437
337 Ga0207706_10022990 3300025933 Bacteria 5598
338 Ga0207706_10081730 3300025933 Bacteria 2839
339 Ga0207706_10379492 3300025933 Eukaryota 1227
340 Ga0207709_10000001 3300025935 Bacteria 2228154
341 Ga0207709_10003040 3300025935 Bacteria 10173
342 Ga0207709_10032763 3300025935 Bacteria 3045
343 Ga0207709_10034026 3300025935 Bacteria 2999
344 Ga0207670_10074057 3300025936 Bacteria 2363
345 Ga0207670_10113520 3300025936 Bacteria 1957
346 Ga0207669_10035112 3300025937 Bacteria 2849
347 Ga0207669_10084002 3300025937 Bacteria 2050
348 Ga0207691_10070957 3300025940 Bacteria 3145
349 Ga0207691_10407052 3300025940 Bacteria 1160
350 Ga0207711_10003533 3300025941 Bacteria 13532
351 Ga0207711_10009758 3300025941 Bacteria 7986
352 Ga0207711_10020446 3300025941 Bacteria 5518
353 Ga0207711_10282102 3300025941 Bacteria 1530
354 Ga0207689_10138058 3300025942 Bacteria 2007
355 Ga0207689_10373778 3300025942 Bacteria 1186
356 Ga0207679_10077238 3300025945 Bacteria 2532
357 Ga0207679_10536605 3300025945 Bacteria 1048
358 Ga0207667_10000053 3300025949 Bacteria 226712
359 Ga0207667_10001176 3300025949 Bacteria 32896
360 Ga0207651_10038654 3300025960 Bacteria 3139
361 Ga0207651_10070979 3300025960 Bacteria 2466
362 Ga0207651_10233357 3300025960 Bacteria 1495
363 Ga0207712_10005748 3300025961 Bacteria 7818
364 Ga0207712_10101710 3300025961 Bacteria 2138
365 Ga0207668_10004844 3300025972 Bacteria 7922
366 Ga0207668_10021228 3300025972 Bacteria 4139
367 Ga0207668_10021701 3300025972 Bacteria 4098
368 Ga0207668_10034036 3300025972 Bacteria 3380
369 Ga0207668_10082720 3300025972 Bacteria 2333
370 Ga0207640_10246346 3300025981 Bacteria 1384
371 Ga0207658_10000213 3300025986 Bacteria 60739
372 Ga0207658_10003133 3300025986 Bacteria 11830
373 Ga0207703_10035852 3300026035 Bacteria 3944
374 Ga0207703_10052382 3300026035 Bacteria 3314
375 Ga0207639_10274664 3300026041 Bacteria 1480
376 Ga0207678_10124403 3300026067 Bacteria 2200
377 Ga0207678_10130582 3300026067 Bacteria 2143
378 Ga0207678_10210463 3300026067 Bacteria 1663
379 Ga0207641_10003981 3300026088 Bacteria 12894
380 Ga0207641_10020272 3300026088 Bacteria 5460
381 Ga0207641_10032484 3300026088 Bacteria 4333
382 Ga0207641_10050190 3300026088 Bacteria 3529
383 Ga0207648_10093070 3300026089 Bacteria 2636
384 Ga0207648_10477397 3300026089 Bacteria 1138
385 Ga0207676_10014487 3300026095 Bacteria 5675
386 Ga0207676_10068794 3300026095 Bacteria 2833
387 Ga0207674_10022818 3300026116 Bacteria 6715
388 Ga0207674_10179237 3300026116 Bacteria 2070
389 Ga0207675_100001472 3300026118 Bacteria 23626
390 Ga0207675_100052226 3300026118 Bacteria 3814
391 Ga0207675_100126177 3300026118 Bacteria 2424
392 Ga0207675_100245502 3300026118 Bacteria 1731
393 Ga0207683_10221060 3300026121 Bacteria 1726
394 Ga0207683_10259477 3300026121 Bacteria 1587
395 Ga0207698_10200048 3300026142 Bacteria 1788
396 Ga0207698_10256724 3300026142 Bacteria 1603
397 Ga0209389_1005072 3300027296 Bacteria 11128
398 Ga0209371_1000025 3300027312 Bacteria 450640
399 Ga0209371_1000040 3300027312 Bacteria 340804
400 Ga0209371_1000259 3300027312 Bacteria 64107
401 Ga0209371_1000604 3300027312 Bacteria 32202
402 Ga0209588_1000642 3300027671 Bacteria 8805
403 Ga0268266_10001045 3300028379 Bacteria 34723
404 Ga0268266_10002815 3300028379 Bacteria 18142
405 Ga0268266_10042995 3300028379 Bacteria 3860
406 Ga0268266_10074285 3300028379 Bacteria 2952
407 Ga0268266_10211819 3300028379 Bacteria 1777
408 Ga0268266_10258706 3300028379 Bacteria 1612
409 Ga0268266_10418653 3300028379 Bacteria 1269
410 Ga0268265_10000218 3300028380 Bacteria 66258
411 Ga0268265_10026965 3300028380 Bacteria 4094
412 Ga0268265_10045029 3300028380 Bacteria 3289
413 Ga0268265_10047013 3300028380 Bacteria 3230
414 Ga0268265_10058166 3300028380 Bacteria 2950
415 Ga0268265_10080942 3300028380 Bacteria 2563
416 Ga0268265_10309660 3300028380 Bacteria 1425
417 Ga0268264_10002221 3300028381 Bacteria 17217
418 Ga0268264_10003005 3300028381 Bacteria 14622
419 Ga0268264_10028441 3300028381 Bacteria 4573
420 Ga0268264_10546447 3300028381 Bacteria 1136
421 Ga0307515_10001534 3300028794 Bacteria 51647
422 Ga0268256_1000027 3300030500 Bacteria 450640
423 Ga0268256_1000041 3300030500 Bacteria 340725
424 Ga0268256_1000233 3300030500 Bacteria 58915
425 Ga0268256_1000510 3300030500 Bacteria 32695
426 Ga0265330_10051485 3300031235 Bacteria 1805
427 Ga0265332_10011181 3300031238 Bacteria 3988
428 Ga0307513_10440403 3300031456 Bacteria 1029
429 Ga0307408_100002383 3300031548 Bacteria 13264
430 Ga0307408_100016611 3300031548 Bacteria 4916
431 Ga0307408_100057979 3300031548 Bacteria 2813
432 Ga0307408_100071439 3300031548 Bacteria 2566
433 Ga0307408_100132766 3300031548 Bacteria 1944
434 Ga0307408_100268014 3300031548 Bacteria 1416
435 Ga0307405_10051184 3300031731 Bacteria 2561
436 Ga0307405_10134869 3300031731 Bacteria 1712
437 Ga0307413_10030443 3300031824 Bacteria 3032
438 Ga0307413_10058751 3300031824 Bacteria 2359
439 Ga0307413_10076889 3300031824 Bacteria 2123
440 Ga0307413_10386825 3300031824 Bacteria 1092
441 Ga0307410_10008484 3300031852 Bacteria 5699
442 Ga0307410_10028554 3300031852 Bacteria 3541
443 Ga0307410_10085192 3300031852 Bacteria 2229
444 Ga0307410_10223043 3300031852 Bacteria 1451
445 Ga0307410_10264875 3300031852 Bacteria 1342
446 Ga0307410_10287293 3300031852 Bacteria 1293
447 Ga0307406_10232960 3300031901 Bacteria 1376
448 Ga0307406_10461950 3300031901 Bacteria 1021
449 Ga0307407_10008019 3300031903 Bacteria 4819
450 Ga0307407_10031390 3300031903 Bacteria 2877
451 Ga0307407_10354241 3300031903 Bacteria 1040
452 Ga0307412_10000015 3300031911 Bacteria 333589
453 Ga0307412_10017164 3300031911 Bacteria 4329
454 Ga0307412_10104590 3300031911 Bacteria 2009
455 Ga0307412_10257455 3300031911 Bacteria 1358
456 Ga0307409_100026764 3300031995 Bacteria 4074
457 Ga0307409_100176283 3300031995 Bacteria 1887
458 Ga0307409_100339081 3300031995 Bacteria 1414
459 Ga0307409_100417644 3300031995 Bacteria 1286
460 Ga0307416_100013635 3300032002 Bacteria 5534
461 Ga0307416_100091117 3300032002 Bacteria 2617
462 Ga0307414_10544612 3300032004 Bacteria 1033
463 Ga0307415_100009223 3300032126 Bacteria 5516
464 Ga0316593_10002636 3300032168 Bacteria 4302
465 Ga0316593_10012634 3300032168 Bacteria 2482
466 Ga0316593_10094855 3300032168 Unclassified 1053
467 Ga0316592_1001937 3300033524 Bacteria 3488
468 Ga0316592_1007064 3300033524 Bacteria 2181
469 Ga0316592_1008227 3300033524 Bacteria 2054
470 Ga0316588_1015147 3300033528 Bacteria 1695
471 Ga0316596_1011671 3300033541 Bacteria 2152
472 Ga0373926_0048813 3300035083 Bacteria 1523
473 Ga0373926_0101378 3300035083 Bacteria 1077
474 Ga0373923_0027239 3300035111 Bacteria 2279
475 Ga0373936_0019183 3300035113 Bacteria 2649
476 Ga0373945_0011383 3300035116 Bacteria 2942
477 Ga0373953_0009240 3300035117 Bacteria 3383
478 Ga0373954_0003072 3300035118 Bacteria 7049
479 Ga0373954_0067827 3300035118 Bacteria 1691
480 Ga0373943_0016830 3300035170 Bacteria 3340
481 Ga0373946_0011243 3300035171 Bacteria 3334
482 Ga0373946_0034050 3300035171 Bacteria 2054
483 Ga0373955_0004841 3300035172 Bacteria 6000
484 Ga0316574_0002172 3300035398 Bacteria 9728
485 Ga0316574_0058353 3300035398 Bacteria 2418
486 Ga0373935_0027481 3300035692 Bacteria 3516
487 Ga0373935_0045369 3300035692 Bacteria 2773
488 Ga0373935_0128848 3300035692 Bacteria 1698
489 Ga0373927_0018924 3300035695 Bacteria 4518
490 Ga0373927_0024801 3300035695 Bacteria 3919
491 Ga0373927_0185870 3300035695 Bacteria 1363
492 Ga0373933_0058601 3300035724 Bacteria 2317
493 Ga0373947_0011648 3300035725 Bacteria 5044
494 Ga0373947_0045708 3300035725 Bacteria 2620
495 Ga0373937_0022427 3300036401 Bacteria 5676
496 Ga0373937_0040021 3300036401 Bacteria 4273
497 Ga0373937_0316220 3300036401 Bacteria 1477
498 Ga0395899_0002992 3300037312 Bacteria 13497
499 Ga0395899_0024573 3300037312 Bacteria 4555
500 Ga0395899_0047828 3300037312 Bacteria 3184
501 Ga0395899_0057145 3300037312 Bacteria 2881
502 Ga0395899_0218317 3300037312 Bacteria 1322
503 Ga0395900_0008700 3300037418 Bacteria 10428
504 Ga0395900_0017614 3300037418 Bacteria 7289
505 Ga0395900_0072067 3300037418 Bacteria 3552
506 Ga0395900_0173016 3300037418 Bacteria 2197
507 Ga0395900_0254885 3300037418 Bacteria 1754
508 Ga0395898_0006782 3300037466 Bacteria 12189
509 Ga0395898_0014126 3300037466 Bacteria 8208
510 Ga0395898_0083465 3300037466 Bacteria 3079
511 Ga0395898_0181688 3300037466 Bacteria 2010
512 Ga0395898_0390286 3300037466 Bacteria 1327
513 Ga0395905_0002322 3300037471 Bacteria 21290
514 Ga0395905_0003918 3300037471 Bacteria 15668
515 Ga0395905_0009494 3300037471 Bacteria 9509
516 Ga0395905_0109828 3300037471 Bacteria 2589
517 Ga0395901_0005411 3300038443 Bacteria 12918
518 Ga0395901_0066588 3300038443 Bacteria 3751
519 Ga0395901_0347415 3300038443 Bacteria 1531
520 Ga0436361_0370358 3300039447 Bacteria 2121
521 Ga0436363_0686554 3300039450 Bacteria 3209
522 Ga0439436_0005519 3300041404 Bacteria 3874
523 Ga0439436_0005596 3300041404 Bacteria 3852
524 Ga0439436_0051288 3300041404 Bacteria 1165
525 Ga0439436_0056261 3300041404 Bacteria 1105
526 Ga0439438_005139 3300041405 Bacteria 4871
527 Ga0439438_022614 3300041405 Bacteria 1742
528 Ga0439439_0000787 3300041406 Bacteria 5749
529 Ga0439439_0010348 3300041406 Bacteria 2227
530 Ga0439466_0007836 3300041411 Bacteria 4034
531 Ga0439466_0009017 3300041411 Bacteria 3745
532 Ga0451793_1176449 3300041452 Bacteria 1613
533 Ga0451795_1559355 3300041456 Bacteria 1463
534 Ga0451839_0004112 3300041496 Bacteria 1670
535 Ga0439433_0002116 3300041999 Bacteria 4176
536 Ga0439433_0004175 3300041999 Bacteria 3104
537 Ga0439433_0013928 3300041999 Bacteria 1769
538 Ga0439432_000130 3300042006 Bacteria 24966
539 Ga0439449_0010688 3300042007 Bacteria 3468
540 Ga0439449_0069846 3300042007 Bacteria 1294
541 Ga0439451_000493 3300042009 Bacteria 7615
542 Ga0439451_004046 3300042009 Bacteria 2982
543 Ga0439452_000001 3300042010 Bacteria 1725439
544 Ga0439452_042071 3300042010 Bacteria 1072
545 Ga0439456_000597 3300042013 Bacteria 7573
546 Ga0439456_001303 3300042013 Bacteria 4969
547 Ga0439457_003680 3300042014 Bacteria 4137
548 Ga0439463_000469 3300042016 Bacteria 11233
549 Ga0439463_001793 3300042016 Bacteria 5585
550 Ga0450919_000409 3300042121 Bacteria 5261
551 Ga0450920_000642 3300042122 Bacteria 5570
552 Ga0450898_017965 3300042134 Bacteria 1221
553 Ga0450906_002930 3300042145 Bacteria 3707
554 Ga0450908_008554 3300042184 Bacteria 1917
555 Ga0450909_001461 3300042185 Bacteria 3291
556 Ga0439434_0002748 3300042435 Bacteria 5128
557 Ga0439434_0010454 3300042435 Bacteria 2735
558 Ga0439434_0017534 3300042435 Bacteria 2143
559 Ga0439459_0018379 3300042438 Bacteria 1313
560 Ga0450918_000078 3300042531 Bacteria 20466
561 Ga0450918_006741 3300042531 Bacteria 2044
562 Ga0450893_0012673 3300042532 Bacteria 1400
563 Ga0466986_0000518 3300044650 Bacteria 13232
564 Ga0466972_0000427 3300044658 Bacteria 21891
565 Ga0466972_0011719 3300044658 Bacteria 4403
566 Ga0466965_0177323 3300044683 Bacteria 1123
567 Ga0466966_0026078 3300044684 Bacteria 3816
568 Ga0466966_0113509 3300044684 Bacteria 1669
569 Ga0466961_0000053 3300044693 Bacteria 69359
570 Ga0466961_0021527 3300044693 Bacteria 4149
571 Ga0466963_0035631 3300044694 Bacteria 3243
572 Ga0466968_0003097 3300044735 Bacteria 6135
573 Ga0466970_0000057 3300044765 Bacteria 43168
574 Ga0466970_0007989 3300044765 Bacteria 5314
575 Ga0466959_0001715 3300045049 Bacteria 13626
576 Ga0466959_0164799 3300045049 Eukaryota 1557
577 Ga0466967_0016266 3300045976 Bacteria 5859
578 Ga0495592_0009546 3300046454 Eukaryota 7301
579 Ga0495592_0012268 3300046454 Eukaryota 6505
580 Ga0495592_0031919 3300046454 Bacteria 3978
581 Ga0495592_0059500 3300046454 Bacteria 2813
582 Ga0495592_0233704 3300046454 Bacteria 1223
583 Ga0495603_0012824 3300046455 Bacteria 5068
584 Ga0495603_0059203 3300046455 Bacteria 2264
585 Ga0495590_0060064 3300046457 Bacteria 1331
586 Ga0495629_0018239 3300046459 Bacteria 5026
587 Ga0495629_0034343 3300046459 Bacteria 3586
588 Ga0495641_0003517 3300046461 Eukaryota 11659
589 Ga0495641_0014889 3300046461 Bacteria 4188
590 Ga0495651_0023866 3300046462 Bacteria 4756
591 Ga0495651_0050593 3300046462 Bacteria 3205
592 Ga0495651_0172312 3300046462 Bacteria 1540
593 Ga0495651_0197068 3300046462 Bacteria 1413
594 Ga0495653_0011267 3300046463 Bacteria 7308
595 Ga0495653_0028059 3300046463 Eukaryota 4505
596 Ga0495653_0035346 3300046463 Bacteria 3944
597 Ga0495653_0050594 3300046463 Bacteria 3195
598 Ga0495580_0010680 3300046472 Bacteria 7133
599 Ga0495580_0034339 3300046472 Bacteria 3652
600 Ga0495580_0099894 3300046472 Bacteria 2019
601 Ga0495582_0049291 3300046473 Bacteria 2319
602 Ga0495605_0140857 3300046474 Bacteria 1082
603 Ga0495639_0014797 3300046475 Bacteria 3380
604 Ga0495639_0015417 3300046475 Bacteria 3315
605 Ga0495662_0030700 3300046476 Bacteria 2594
606 Ga0495664_0268527 3300046477 Bacteria 1031
607 Ga0495594_0014756 3300046499 Bacteria 4101
608 Ga0495608_0014921 3300046511 Bacteria 5392
609 Ga0495608_0021592 3300046511 Bacteria 4418
610 Ga0495618_0009337 3300046514 Bacteria 5920
611 Ga0495628_0026376 3300046516 Bacteria 4739
612 Ga0495628_0066603 3300046516 Eukaryota 2815
613 Ga0495628_0123729 3300046516 Bacteria 1982
614 Ga0495630_0096720 3300046517 Eukaryota 2232
615 Ga0495630_0202698 3300046517 Bacteria 1514
616 Ga0495643_0019784 3300046522 Bacteria 3892
617 Ga0495666_0028998 3300046526 Bacteria 2723
618 Ga0495642_0006593 3300046528 Bacteria 4456
619 Ga0495652_0016270 3300046529 Eukaryota 6653
620 Ga0495652_0024838 3300046529 Bacteria 5302
621 Ga0495652_0036216 3300046529 Bacteria 4292
622 Ga0495652_0095683 3300046529 Eukaryota 2420
623 Ga0495665_0060245 3300046531 Bacteria 2004
624 Ga0495665_0119539 3300046531 Bacteria 1380
625 Ga0495640_0013821 3300046533 Bacteria 6131
626 Ga0495640_0019133 3300046533 Bacteria 5060
627 Ga0495587_0024465 3300046536 Bacteria 3700
628 Ga0495587_0030508 3300046536 Bacteria 3269
629 Ga0495597_0000102 3300046542 Bacteria 76204
630 Ga0495645_0019292 3300046543 Bacteria 4909
631 Ga0495667_0015567 3300046559 Bacteria 5141
632 Ga0495667_0021890 3300046559 Bacteria 4309
633 Ga0495656_0097898 3300046615 Bacteria 1352
634 Ga0495656_0213869 3300046615 Bacteria 962
635 Ga0495668_0000020 3300046616 Bacteria 411641
636 Ga0495668_0011692 3300046616 Bacteria 5243
637 Ga0495634_0012821 3300046642 Bacteria 6066
638 Ga0495634_0019336 3300046642 Bacteria 4841
639 Ga0495634_0024572 3300046642 Eukaryota 4226
640 Ga0495634_0067823 3300046642 Bacteria 2358
641 Ga0495635_0012490 3300046663 Bacteria 5949
642 Ga0495635_0030818 3300046663 Eukaryota 3726
643 Ga0495635_0042929 3300046663 Bacteria 3121
644 Ga0495661_0009296 3300046665 Bacteria 6748
645 Ga0495657_0007494 3300046675 Eukaryota 8433
646 Ga0495657_0025296 3300046675 Bacteria 4218
647 Ga0495657_0071180 3300046675 Bacteria 2271
648 Ga0495657_0168811 3300046675 Bacteria 1349
649 Ga0495599_0006520 3300046678 Bacteria 7041
650 Ga0495599_0039811 3300046678 Bacteria 2953
651 Ga0495623_0006249 3300046679 Bacteria 7746
652 Ga0495646_0027875 3300046680 Bacteria 3541
653 Ga0495646_0062282 3300046680 Bacteria 2218
654 Ga0495646_0084386 3300046680 Eukaryota 1844
655 Ga0495647_0016556 3300046681 Bacteria 2596
656 Ga0495658_0006869 3300046683 Bacteria 5609
657 Ga0495658_0092091 3300046683 Bacteria 1796
658 Ga0495613_0069830 3300046689 Bacteria 2561
659 Ga0495613_0149215 3300046689 Bacteria 1668
660 Ga0495613_0180350 3300046689 Bacteria 1496
661 Ga0495624_0001476 3300046690 Eukaryota 18250
662 Ga0495624_0002969 3300046690 Eukaryota 12676
663 Ga0495624_0024218 3300046690 Bacteria 3996
664 Ga0495624_0042860 3300046690 Bacteria 2890
665 Ga0495589_0000091 3300046794 Bacteria 85670
666 Ga0495600_0010245 3300046809 Bacteria 5811
667 Ga0495600_0071471 3300046809 Eukaryota 2267
668 Ga0495581_0041039 3300047315 Bacteria 2677
669 Ga0495604_0006471 3300047317 Bacteria 9289
670 Ga0495604_0013652 3300047317 Eukaryota 6478
671 Ga0495604_0018787 3300047317 Bacteria 5535
672 Ga0495604_0028182 3300047317 Bacteria 4467
673 Ga0495674_0009452 3300047319 Eukaryota 9263
674 Ga0495674_0011849 3300047319 Bacteria 8220
675 Ga0495674_0014791 3300047319 Bacteria 7300
676 Ga0495674_0032997 3300047319 Bacteria 4693
677 Ga0495674_0315848 3300047319 Bacteria 1274
678 Ga0495676_0002631 3300047321 Eukaryota 16055
679 Ga0495676_0007948 3300047321 Eukaryota 9724
680 Ga0495676_0042145 3300047321 Bacteria 3750
681 Ga0495680_0024592 3300047322 Bacteria 4995
682 Ga0495680_0046045 3300047322 Bacteria 3441
683 Ga0495680_0070688 3300047322 Bacteria 2660
684 Ga0495680_0117713 3300047322 Eukaryota 1964
685 Ga0495687_014386 3300047443 Bacteria 4077
686 Ga0495675_0016865 3300047444 Bacteria 4620
687 Ga0495684_0005133 3300047471 Bacteria 10214
688 Ga0495684_0006871 3300047471 Bacteria 8835
689 Ga0495684_0020155 3300047471 Bacteria 5136
690 Ga0495684_0023268 3300047471 Bacteria 4763
691 Ga0495684_0024746 3300047471 Bacteria 4617
692 Ga0495593_0012276 3300047673 Bacteria 4896
693 Ga0495593_0035643 3300047673 Bacteria 2700
694 Ga0495602_0004743 3300048088 Eukaryota 14212
695 Ga0495602_0014752 3300048088 Eukaryota 7920
696 Ga0495602_0030617 3300048088 Eukaryota 5102
697 Ga0495602_0037302 3300048088 Bacteria 4513
698 Ga0495602_0039196 3300048088 Eukaryota 4367
699 Ga0495602_0312836 3300048088 Bacteria 1145
700 Ga0495602_0349409 3300048088 Bacteria 1068
701 Ga0495614_0058969 3300048089 Bacteria 1648
702 Ga0495614_0179865 3300048089 Eukaryota 951
703 Ga0496100_0035948 3300048903 Bacteria 3120
704 Ga0496100_0110286 3300048903 Bacteria 1910
705 Ga0496101_0000731 3300048904 Bacteria 19558
706 Ga0496101_0030130 3300048904 Bacteria 3801
707 Ga0496102_0000056 3300048905 Bacteria 172707
708 Ga0496102_0000174 3300048905 Bacteria 87691
709 Ga0496102_0000484 3300048905 Bacteria 44164
710 Ga0496102_0037136 3300048905 Bacteria 4393
711 Ga0496102_0252967 3300048905 Bacteria 1661
712 Ga0496102_0274076 3300048905 Bacteria 1591
713 Ga0496102_0563993 3300048905 Bacteria 1061
714 Ga0496103_0000040 3300048906 Bacteria 172148
715 Ga0496103_0000320 3300048906 Bacteria 43999
716 Ga0496103_0158216 3300048906 Bacteria 1452
717 Ga0496104_0000282 3300048907 Bacteria 45161
718 Ga0496104_0052036 3300048907 Bacteria 3867
719 Ga0496104_0254514 3300048907 Bacteria 1669
720 Ga0496104_0389821 3300048907 Bacteria 1305
721 Ga0496105_0000136 3300048908 Bacteria 49541
722 Ga0496105_0000423 3300048908 Bacteria 27810
723 Ga0496105_0002210 3300048908 Bacteria 14097
724 Ga0496105_0076506 3300048908 Bacteria 2763
725 Ga0496105_0104763 3300048908 Bacteria 2335
726 Ga0496106_0020159 3300048909 Bacteria 4947
727 Ga0496106_0124626 3300048909 Bacteria 2016
728 Ga0496106_0519628 3300048909 Bacteria 956
729 Ga0496107_0017622 3300048910 Bacteria 5023
730 Ga0496107_0139725 3300048910 Bacteria 1790
731 Ga0496107_0367450 3300048910 Bacteria 1070
732 Ga0496108_0003089 3300048911 Bacteria 13382
733 Ga0496108_0030847 3300048911 Bacteria 4443
734 Ga0496108_0121995 3300048911 Bacteria 2236
735 Ga0496108_0170890 3300048911 Bacteria 1880
736 Ga0496108_0216249 3300048911 Bacteria 1664
737 Ga0496109_0042830 3300048912 Bacteria 4103
738 Ga0496110_0036175 3300048913 Bacteria 4287
739 Ga0496110_0092722 3300048913 Bacteria 2703
740 Ga0496111_0015171 3300048914 Bacteria 5281
741 Ga0496112_0005743 3300048915 Bacteria 10786
742 Ga0496112_0039026 3300048915 Bacteria 4638
743 Ga0496112_0039083 3300048915 Bacteria 4635
744 Ga0496112_0269203 3300048915 Bacteria 1652
745 Ga0496113_0000119 3300048916 Bacteria 33821
746 Ga0496113_0028553 3300048916 Bacteria 4014
747 Ga0496114_0014125 3300048917 Bacteria 6403
748 Ga0496114_0441263 3300048917 Bacteria 1153
749 Ga0496115_0000009 3300048918 Bacteria 234372
750 Ga0496115_0110909 3300048918 Bacteria 2254
751 Ga0496115_0153409 3300048918 Bacteria 1902
752 Ga0496115_0179409 3300048918 Bacteria 1751
753 Ga0496116_0000056 3300048919 Bacteria 282554
754 Ga0496116_0000110 3300048919 Bacteria 185668
755 Ga0496116_0008516 3300048919 Bacteria 8889
756 Ga0496116_0014709 3300048919 Bacteria 6233
757 Ga0496116_0051874 3300048919 Bacteria 2721
758 Ga0496117_0000003 3300048920 Bacteria 1881097
759 Ga0496117_0000354 3300048920 Bacteria 80757
760 Ga0496117_0000802 3300048920 Bacteria 48832
761 Ga0496117_0005072 3300048920 Bacteria 14101
762 Ga0496117_0008930 3300048920 Bacteria 9437
763 Ga0496117_0019332 3300048920 Bacteria 5601
764 Ga0496117_0052166 3300048920 Bacteria 2883
765 Ga0496118_0000001 3300048921 Bacteria 1881100
766 Ga0496118_0000077 3300048921 Bacteria 192298
767 Ga0496118_0000310 3300048921 Bacteria 84607
768 Ga0496118_0006305 3300048921 Bacteria 13110
769 Ga0496118_0008850 3300048921 Bacteria 10301
770 Ga0496118_0009737 3300048921 Bacteria 9643
771 Ga0496118_0011094 3300048921 Bacteria 8844
772 Ga0496118_0017185 3300048921 Bacteria 6599
773 Ga0496119_0000263 3300048922 Bacteria 74497
774 Ga0496119_0000648 3300048922 Bacteria 46947
775 Ga0496119_0000754 3300048922 Bacteria 43423
776 Ga0496119_0086342 3300048922 Bacteria 1793
777 Ga0496120_0000318 3300048923 Bacteria 79637
778 Ga0496120_0000689 3300048923 Bacteria 49521
779 Ga0496120_0000749 3300048923 Bacteria 47044
780 Ga0496120_0090099 3300048923 Eukaryota 1641
781 Ga0496121_0000121 3300048924 Bacteria 172480
782 Ga0496121_0000432 3300048924 Bacteria 82444
783 Ga0496121_0000984 3300048924 Bacteria 51021
784 Ga0496121_0002135 3300048924 Bacteria 31064
785 Ga0496121_0005637 3300048924 Bacteria 15932
786 Ga0496121_0005718 3300048924 Bacteria 15795
787 Ga0496121_0007340 3300048924 Bacteria 13328
788 Ga0496121_0012058 3300048924 Bacteria 9496
789 Ga0496122_0001087 3300048925 Bacteria 47227
790 Ga0496122_0001497 3300048925 Bacteria 37328
791 Ga0496122_0008986 3300048925 Bacteria 10623
792 Ga0496122_0090011 3300048925 Bacteria 2096
793 Ga0496122_0197494 3300048925 Bacteria 1180
794 Ga0496123_0000889 3300048926 Bacteria 47309
795 Ga0496123_0001632 3300048926 Bacteria 30225
796 Ga0496124_0000050 3300048927 Bacteria 258041
797 Ga0496124_0000219 3300048927 Bacteria 111562
798 Ga0496124_0001992 3300048927 Bacteria 27833
799 Ga0496124_0003260 3300048927 Bacteria 20044
800 Ga0496124_0006361 3300048927 Bacteria 12884
801 Ga0496124_0012220 3300048927 Bacteria 8493
802 Ga0496124_0036067 3300048927 Bacteria 4318
803 Ga0496124_0062622 3300048927 Bacteria 3112
804 Ga0496124_0080025 3300048927 Bacteria 2690
805 Ga0496125_0000114 3300048928 Bacteria 182012
806 Ga0496125_0000796 3300048928 Bacteria 51436
807 Ga0496125_0001252 3300048928 Bacteria 37872
808 Ga0496125_0005292 3300048928 Bacteria 14432
809 Ga0496125_0006057 3300048928 Bacteria 13218
810 Ga0496125_0025241 3300048928 Bacteria 5447
811 Ga0496125_0030371 3300048928 Bacteria 4836
812 Ga0496125_0089350 3300048928 Bacteria 2317
813 Ga0496125_0156461 3300048928 Bacteria 1556
814 Ga0496126_0000113 3300048929 Bacteria 192212
815 Ga0496126_0000837 3300048929 Bacteria 54604
816 Ga0496126_0001389 3300048929 Bacteria 38297
817 Ga0496126_0001447 3300048929 Bacteria 37214
818 Ga0496126_0063154 3300048929 Bacteria 3320
819 Ga0496126_0093310 3300048929 Bacteria 2643
820 Ga0496126_0141114 3300048929 Bacteria 2074
821 Ga0496126_0379222 3300048929 Bacteria 1151
822 Ga0501306_011306 3300049127 Bacteria 1137
823 Ga0501310_008254 3300049130 Bacteria 1128
824 Ga0501304_004913 3300049160 Bacteria 1031
825 Ga0501307_011885 3300049162 Bacteria 1028
826 Ga0495682_0002192 3300049460 Bacteria 9453
827 Ga0501315_016195 3300049531 Bacteria 963
828 Ga0501324_002633 3300049540 Bacteria 1314
829 Ga0501324_003666 3300049540 Bacteria 1189
830 Ga0501036_0064815 3300049572 Bacteria 3092
831 Ga0501039_0221374 3300049575 Bacteria 1488
832 Ga0501042_0110916 3300049578 Bacteria 1975
833 Ga0501046_0060300 3300049580 Bacteria 2969
834 Ga0501075_0012498 3300049591 Bacteria 6036
835 Ga0501076_0002231 3300049592 Bacteria 13277
836 Ga0501077_0044776 3300049593 Bacteria 2811
837 Ga0501079_0005429 3300049741 Bacteria 9499
838 Ga0501080_0334394 3300049742 Bacteria 1369
839 nmdc:mga03n38_24630_c1 3300050490 Bacteria 2462
840 nmdc:mga00v17_231581_c1 3300050491 Bacteria 1197
841 nmdc:mga0k408_23202_c1 3300050493 Bacteria 3498
842 nmdc:mga0k408_2991_c1 3300050493 Bacteria 8962
843 nmdc:mga0k408_35008_c1 3300050493 Bacteria 2878
844 nmdc:mga06z11_17720_c1 3300050494 Bacteria 3239
845 nmdc:mga07m45_23200_c1 3300050496 Bacteria 3390
846 nmdc:mga05p37_559607_c1 3300050507 Bacteria 1300
847 nmdc:mga09592_11987_c1 3300050508 Bacteria 7051
848 nmdc:mga09592_70455_c1 3300050508 Bacteria 2967
849 nmdc:mga0qj67_106602_c1 3300050509 Bacteria 2261
850 nmdc:mga06r32_138352_c1 3300050510 Bacteria 2410
851 nmdc:mga08y16_493360_c1 3300050511 Bacteria 1245
852 nmdc:mga08y16_63983_c1 3300050511 Bacteria 3841
853 nmdc:mga0rr50_212668_c1 3300050513 Bacteria 1594
854 nmdc:mga0a205_10045_c1 3300050515 Bacteria 8686
855 nmdc:mga0a205_353408_c1 3300050515 Bacteria 1337
856 nmdc:mga0sz30_15904_c1 3300050516 Bacteria 2978
857 nmdc:mga0sz30_24420_c2 3300050516 Bacteria 1528
858 Ga0495601_0012010 3300053077 Bacteria 5189
859 Ga0495601_0013485 3300053077 Bacteria 4915
860 Ga0495601_0029907 3300053077 Bacteria 3381
861 Ga0495601_0041517 3300053077 Bacteria 2884
862 Ga0495601_0189851 3300053077 Bacteria 1343
863 Ga0495612_0008448 3300053078 Bacteria 4176
864 Ga0495595_0022118 3300053084 Bacteria 2787
865 Ga0495619_0004470 3300053085 Bacteria 8926
866 Ga0495619_0005558 3300053085 Bacteria 7999
867 Ga0495619_0007982 3300053085 Bacteria 6697
868 Ga0495619_0015724 3300053085 Bacteria 4791
869 Ga0495619_0124124 3300053085 Bacteria 1771
870 Ga0500595_000176 3300053119 Bacteria 42910
871 Ga0500595_000351 3300053119 Bacteria 30073
872 Ga0500616_0000002 3300053153 Bacteria 1611257
873 Ga0500616_0003816 3300053153 Bacteria 11177
874 Ga0500636_0024960 3300053177 Bacteria 3533
875 Ga0501084_0011217 3300054114 Bacteria 7421
876 Ga0501084_0457518 3300054114 Bacteria 1079
877 Ga0587093_001988 3300059478 Bacteria 1832
878 Ga0587090_005294 3300059510 Bacteria 1611
879 Ga0587071_001577 3300060344 Bacteria 2890
880 Ga0501082_0002439 3300060353 Bacteria 16314
881 Ga0530510_0000677 3300061734 Bacteria 21951

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053119 Ga0500595_000176 Ga0500595_000176_13619_14551 259
2 3300053177 Ga0500636_0024960 Ga0500636_0024960_729_1661 261
3 3300001989 JGI24739J22299_10000367 JGI24739J22299_100003673 267
4 3300046675 Ga0495657_0071180 Ga0495657_0071180_280_1161 270
5 3300047322 Ga0495680_0070688 Ga0495680_0070688_1647_2528 270
6 3300047471 Ga0495684_0024746 Ga0495684_0024746_363_1244 270
7 3300048088 Ga0495602_0030617 Ga0495602_0030617_4146_5027 270
8 3300048089 Ga0495614_0179865 Ga0495614_0179865_11_901 270
9 3300049540 Ga0501324_003666 Ga0501324_003666_117_1025 270
10 3300046615 Ga0495656_0213869 Ga0495656_0213869_29_952 271
11 3300049531 Ga0501315_016195 Ga0501315_016195_46_948 271
12 iso_pu_bacteria 2811994878 2812349100 274
13 iso_pu_bacteria 2891968417 2891973150 274
14 3300013105 Ga0157369_10405814 Ga0157369_104058141 275
15 3300022467 Ga0224712_10150079 Ga0224712_101500791 275
16 iso_pu_bacteria 2551306352 2552746356 275
17 iso_pu_bacteria 2554235227 2555230674 275
18 iso_pu_bacteria 2639762793 2640733298 275
19 iso_pu_bacteria 2675903507 2678230339 275
20 iso_pu_bacteria 2690315906 2691515519 275
21 iso_pu_bacteria 2773857761 2774389113 275
22 iso_pu_bacteria 2773857770 2774439304 275
23 iso_pu_bacteria 2919182534 2919185376 275
24 iso_pu_bacteria 8057160832 8057161172 275
25 3300005548 Ga0070665_100556001 Ga0070665_1005560011 276
26 iso_pu_bacteria 2508501050 2508725853 276
27 iso_pu_bacteria 2554235234 2555259590 276
28 iso_pu_bacteria 2585427634 2586004351 276
29 iso_pu_bacteria 2599185178 2599448446 276
30 iso_pu_bacteria 2599185299 2599926441 276
31 iso_pu_bacteria 2602042109 2603865580 276
32 iso_pu_bacteria 2615840624 2616293067 276
33 iso_pu_bacteria 2636415599 2637227415 276
34 iso_pu_bacteria 2648501693 2650897185 276
35 iso_pu_bacteria 2684622997 2686354093 276
36 iso_pu_bacteria 2775506901 2776264921 276
37 iso_pu_bacteria 2775507074 2777021785 276
38 iso_pu_bacteria 2791355267 2793367600 276
39 iso_pu_bacteria 2808606414 2809125646 276
40 iso_pu_bacteria 2808606418 2809146961 276
41 iso_pu_bacteria 2818991452 2819637267 276
42 iso_pu_bacteria 2818991457 2819661446 276
43 iso_pu_bacteria 2840764183 2840768215 276
44 iso_pu_bacteria 2847797336 2847799052 276
45 iso_pu_bacteria 2852684882 2852687308 276
46 iso_pu_bacteria 2863421361 2863428056 276
47 iso_pu_bacteria 2894232714 2894235509 276
48 iso_pu_bacteria 2900577576 2900580474 276
49 iso_pu_bacteria 2902792274 2902796426 276
50 iso_pu_bacteria 2904434214 2904437097 276
51 iso_pu_bacteria 2904513164 2904515755 276
52 iso_pu_bacteria 2904615490 2904616196 276
53 iso_pu_bacteria 2904765812 2904767151 276
54 iso_pu_bacteria 2904770941 2904773903 276
55 iso_pu_bacteria 2919108558 2919110088 276
56 iso_pu_bacteria 2919130084 2919130925 276
57 iso_pu_bacteria 2919420072 2919420407 276
58 iso_pu_bacteria 2919432681 2919433835 276
59 iso_pu_bacteria 2919501602 2919505036 276
60 iso_pu_bacteria 2926063275 2926066713 276
61 iso_pu_bacteria 2928521798 2928526439 276
62 iso_pu_bacteria 2929195423 2929196162 276
63 iso_pu_bacteria 2945934425 2945938975 276
64 iso_pu_bacteria 2969079654 2969084454 276
65 iso_pu_bacteria 2971820967 2971825381 276
66 iso_pu_bacteria 2984494565 2984497456 276
67 iso_pu_bacteria 2984559226 2984561569 276
68 iso_pu_bacteria 2984595703 2984599634 276
69 iso_pu_bacteria 2990261002 2990261407 276
70 iso_pu_bacteria 2990703756 2990708975 276
71 iso_pu_bacteria 8002745576 8002747519 276
72 iso_pu_bacteria 8018127388 8018127435 276
73 iso_pu_bacteria 8021622325 8021623681 276
74 iso_pu_bacteria 8021626552 8021628705 276
75 iso_pu_bacteria 8021648035 8021651535 276
76 iso_pu_bacteria 8055266321 8055273068 276
77 iso_pu_bacteria 8056375014 8056377545 276
78 3300005338 Ga0068868_100022641 Ga0068868_1000226414 277
79 3300005347 Ga0070668_100017619 Ga0070668_1000176192 277
80 3300005455 Ga0070663_100100255 Ga0070663_1001002552 277
81 3300005548 Ga0070665_100034401 Ga0070665_1000344012 277
82 3300005614 Ga0068856_100154509 Ga0068856_1001545092 277
83 3300005842 Ga0068858_100063792 Ga0068858_1000637923 277
84 3300005843 Ga0068860_100251985 Ga0068860_1002519852 277
85 3300006186 Ga0075369_10019958 Ga0075369_100199582 277
86 3300009177 Ga0105248_10156962 Ga0105248_101569622 277
87 3300009553 Ga0105249_10226790 Ga0105249_102267902 277
88 3300010375 Ga0105239_10339797 Ga0105239_103397972 277
89 3300013306 Ga0163162_10340260 Ga0163162_103402602 277
90 3300025909 Ga0207705_10249496 Ga0207705_102494961 277
91 3300025919 Ga0207657_10088952 Ga0207657_100889522 277
92 3300025920 Ga0207649_10301479 Ga0207649_103014791 277
93 3300025932 Ga0207690_10225262 Ga0207690_102252622 277
94 3300025933 Ga0207706_10081730 Ga0207706_100817302 277
95 3300025935 Ga0207709_10034026 Ga0207709_100340262 277
96 3300025937 Ga0207669_10084002 Ga0207669_100840022 277
97 3300026142 Ga0207698_10200048 Ga0207698_102000482 277
98 3300028379 Ga0268266_10042995 Ga0268266_100429953 277
99 3300028380 Ga0268265_10026965 Ga0268265_100269652 277
100 3300028381 Ga0268264_10546447 Ga0268264_105464471 277
101 3300035398 Ga0316574_0058353 Ga0316574_0058353_586_1521 277
102 3300048905 Ga0496102_0563993 Ga0496102_0563993_131_1042 277
103 3300048917 Ga0496114_0441263 Ga0496114_0441263_67_978 277
104 3300048922 Ga0496119_0086342 Ga0496119_0086342_20_931 277
105 3300048929 Ga0496126_0379222 Ga0496126_0379222_190_1101 277
106 3300005338 Ga0068868_100320528 Ga0068868_1003205282 278
107 3300010375 Ga0105239_10001024 Ga0105239_100010245 278
108 3300013296 Ga0157374_10159694 Ga0157374_101596942 278
109 3300025914 Ga0207671_10133716 Ga0207671_101337161 278
110 3300025936 Ga0207670_10113520 Ga0207670_101135202 278
111 3300026116 Ga0207674_10179237 Ga0207674_101792371 278
112 iso_pu_bacteria 2643221644 2644244039 278
113 iso_pu_bacteria 2706794495 2707098147 278
114 3300003856 Ga0058692_1000014 Ga0058692_1000014234 279
115 3300005272 Ga0065703_1000280 Ga0065703_100028018 279
116 3300005353 Ga0070669_100010205 Ga0070669_1000102053 279
117 3300005364 Ga0070673_100014750 Ga0070673_1000147503 279
118 3300005548 Ga0070665_100299023 Ga0070665_1002990232 279
119 3300005563 Ga0068855_100000037 Ga0068855_100000037123 279
120 3300006058 Ga0075432_10009478 Ga0075432_100094783 279
121 3300006177 Ga0075362_10017169 Ga0075362_100171692 279
122 3300006186 Ga0075369_10016219 Ga0075369_100162192 279
123 3300009011 Ga0105251_10032576 Ga0105251_100325762 279
124 3300009093 Ga0105240_10023443 Ga0105240_100234432 279
125 3300009148 Ga0105243_10000249 Ga0105243_100002493 279
126 3300025728 Ga0207655_1000327 Ga0207655_100032749 279
127 3300025728 Ga0207655_1000339 Ga0207655_100033942 279
128 3300025735 Ga0207713_1010855 Ga0207713_10108551 279
129 3300025913 Ga0207695_10014875 Ga0207695_100148757 279
130 3300025923 Ga0207681_10010161 Ga0207681_100101614 279
131 3300025935 Ga0207709_10000001 Ga0207709_100000012062 279
132 3300025949 Ga0207667_10000053 Ga0207667_1000005367 279
133 3300025960 Ga0207651_10070979 Ga0207651_100709791 279
134 3300027312 Ga0209371_1000040 Ga0209371_100004056 279
135 3300028379 Ga0268266_10258706 Ga0268266_102587061 279
136 3300030500 Ga0268256_1000041 Ga0268256_1000041259 279
137 3300031238 Ga0265332_10011181 Ga0265332_100111815 279
138 3300031548 Ga0307408_100057979 Ga0307408_1000579792 279
139 3300031548 Ga0307408_100071439 Ga0307408_1000714392 279
140 3300031548 Ga0307408_100132766 Ga0307408_1001327662 279
141 3300031548 Ga0307408_100268014 Ga0307408_1002680142 279
142 3300031731 Ga0307405_10051184 Ga0307405_100511842 279
143 3300031824 Ga0307413_10058751 Ga0307413_100587512 279
144 3300031852 Ga0307410_10028554 Ga0307410_100285542 279
145 3300031852 Ga0307410_10085192 Ga0307410_100851921 279
146 3300031852 Ga0307410_10223043 Ga0307410_102230431 279
147 3300031852 Ga0307410_10264875 Ga0307410_102648752 279
148 3300031901 Ga0307406_10461950 Ga0307406_104619501 279
149 3300031903 Ga0307407_10031390 Ga0307407_100313902 279
150 3300031903 Ga0307407_10354241 Ga0307407_103542411 279
151 3300031911 Ga0307412_10104590 Ga0307412_101045901 279
152 3300031995 Ga0307409_100176283 Ga0307409_1001762832 279
153 3300032002 Ga0307416_100091117 Ga0307416_1000911173 279
154 3300032004 Ga0307414_10544612 Ga0307414_105446121 279
155 3300037312 Ga0395899_0002992 Ga0395899_0002992_8365_9306 279
156 3300037312 Ga0395899_0057145 Ga0395899_0057145_406_1326 279
157 3300037312 Ga0395899_0218317 Ga0395899_0218317_58_978 279
158 3300037418 Ga0395900_0008700 Ga0395900_0008700_564_1484 279
159 3300037418 Ga0395900_0017614 Ga0395900_0017614_2155_3096 279
160 3300037466 Ga0395898_0006782 Ga0395898_0006782_3898_4839 279
161 3300037471 Ga0395905_0009494 Ga0395905_0009494_6655_7575 279
162 3300038443 Ga0395901_0005411 Ga0395901_0005411_7791_8732 279
163 3300041404 Ga0439436_0005596 Ga0439436_0005596_934_1875 279
164 3300041404 Ga0439436_0051288 Ga0439436_0051288_181_1116 279
165 3300041404 Ga0439436_0056261 Ga0439436_0056261_56_991 279
166 3300041405 Ga0439438_005139 Ga0439438_005139_1388_2329 279
167 3300041405 Ga0439438_022614 Ga0439438_022614_22_957 279
168 3300041406 Ga0439439_0000787 Ga0439439_0000787_2016_2957 279
169 3300041406 Ga0439439_0010348 Ga0439439_0010348_534_1469 279
170 3300041411 Ga0439466_0007836 Ga0439466_0007836_1463_2398 279
171 3300041411 Ga0439466_0009017 Ga0439466_0009017_1689_2630 279
172 3300041999 Ga0439433_0002116 Ga0439433_0002116_1985_2926 279
173 3300041999 Ga0439433_0004175 Ga0439433_0004175_989_1924 279
174 3300042007 Ga0439449_0010688 Ga0439449_0010688_1001_1936 279
175 3300042007 Ga0439449_0069846 Ga0439449_0069846_311_1252 279
176 3300042010 Ga0439452_042071 Ga0439452_042071_39_974 279
177 3300042014 Ga0439457_003680 Ga0439457_003680_2614_3555 279
178 3300042122 Ga0450920_000642 Ga0450920_000642_1474_2415 279
179 3300042185 Ga0450909_001461 Ga0450909_001461_826_1767 279
180 3300042435 Ga0439434_0002748 Ga0439434_0002748_1926_2867 279
181 3300042435 Ga0439434_0010454 Ga0439434_0010454_320_1255 279
182 3300042531 Ga0450918_006741 Ga0450918_006741_213_1154 279
183 3300046472 Ga0495580_0010680 Ga0495580_0010680_6030_6965 279
184 3300048905 Ga0496102_0037136 Ga0496102_0037136_2151_3086 279
185 3300048907 Ga0496104_0389821 Ga0496104_0389821_191_1159 279
186 3300048923 Ga0496120_0090099 Ga0496120_0090099_442_1368 279
187 3300050516 nmdc:mga0sz30_15904_c1 nmdc:mga0sz30_15904_c1_1160_2095 279
188 3300060344 Ga0587071_001577 Ga0587071_001577_83_1003 279
189 iso_pu_bacteria 2511231022 2511365544 279
190 iso_pu_bacteria 2599185212 2599612082 279
191 iso_pu_bacteria 2599185311 2599993028 279
192 iso_pu_bacteria 2599185319 2600045346 279
193 iso_pu_bacteria 2599185322 2600058108 279
194 iso_pu_bacteria 2599185323 2600067832 279
195 iso_pu_bacteria 2738543004 2739197266 279
196 iso_pu_bacteria 2816332298 2817490222 279
197 iso_pu_bacteria 2825651385 2825656979 279
198 iso_pu_bacteria 2834028612 2834030485 279
199 iso_pu_bacteria 2913036834 2913040572 279
200 iso_pu_bacteria 2919481497 2919483417 279
201 2162886007 SwRhRL2b_contig_1845099 SwRhRL2b_0916.00008340 280
202 3300002459 JGI24751J29686_10007770 JGI24751J29686_100077702 280
203 3300002705 JGI25156J39149_1000365 JGI25156J39149_100036522 280
204 3300003203 JGI25406J46586_10017074 JGI25406J46586_100170741 280
205 3300003215 JGI25153J46596_10000751 JGI25153J46596_100007512 280
206 3300003322 rootL2_10000529 rootL2_1000052960 280
207 3300003323 rootH1_10012306 rootH1_100123065 280
208 3300003756 Ga0055533_1000469 Ga0055533_100046915 280
209 3300003758 Ga0055532_1000577 Ga0055532_10005774 280
210 3300003760 Ga0055527_1000866 Ga0055527_10008665 280
211 3300003761 Ga0055535_1001178 Ga0055535_10011784 280
212 3300003762 Ga0055542_1001170 Ga0055542_10011704 280
213 3300003763 Ga0055529_1000817 Ga0055529_100081713 280
214 3300003775 Ga0055524_1007666 Ga0055524_10076663 280
215 3300003790 Ga0055528_1003975 Ga0055528_10039753 280
216 3300003790 Ga0055528_1012987 Ga0055528_10129872 280
217 3300003790 Ga0055528_1016714 Ga0055528_10167143 280
218 3300003792 Ga0055540_1000571 Ga0055540_10005712 280
219 3300003794 Ga0055531_10008799 Ga0055531_100087993 280
220 3300003856 Ga0058692_1000028 Ga0058692_100002896 280
221 3300004801 Ga0058860_11916293 Ga0058860_119162931 280
222 3300005289 Ga0065704_10070457 Ga0065704_100704576 280
223 3300005327 Ga0070658_10015399 Ga0070658_100153995 280
224 3300005331 Ga0070670_100019120 Ga0070670_1000191205 280
225 3300005331 Ga0070670_100021935 Ga0070670_1000219353 280
226 3300005331 Ga0070670_100074262 Ga0070670_1000742622 280
227 3300005331 Ga0070670_100113107 Ga0070670_1001131072 280
228 3300005340 Ga0070689_100015734 Ga0070689_1000157345 280
229 3300005340 Ga0070689_100211342 Ga0070689_1002113422 280
230 3300005347 Ga0070668_100004095 Ga0070668_10000409512 280
231 3300005347 Ga0070668_100014523 Ga0070668_1000145235 280
232 3300005347 Ga0070668_100046278 Ga0070668_1000462782 280
233 3300005353 Ga0070669_100020177 Ga0070669_1000201774 280
234 3300005353 Ga0070669_100031025 Ga0070669_1000310253 280
235 3300005353 Ga0070669_100137244 Ga0070669_1001372441 280
236 3300005354 Ga0070675_100035183 Ga0070675_1000351832 280
237 3300005354 Ga0070675_100074071 Ga0070675_1000740712 280
238 3300005355 Ga0070671_100023842 Ga0070671_1000238424 280
239 3300005364 Ga0070673_100108118 Ga0070673_1001081182 280
240 3300005434 Ga0070709_10448100 Ga0070709_104481001 280
241 3300005436 Ga0070713_100000289 Ga0070713_10000028913 280
242 3300005436 Ga0070713_100072441 Ga0070713_1000724413 280
243 3300005436 Ga0070713_100075934 Ga0070713_1000759341 280
244 3300005437 Ga0070710_10027841 Ga0070710_100278412 280
245 3300005439 Ga0070711_100056576 Ga0070711_1000565763 280
246 3300005439 Ga0070711_100058341 Ga0070711_1000583411 280
247 3300005439 Ga0070711_100064195 Ga0070711_1000641952 280
248 3300005445 Ga0070708_100066790 Ga0070708_1000667902 280
249 3300005455 Ga0070663_100185400 Ga0070663_1001854002 280
250 3300005457 Ga0070662_100128344 Ga0070662_1001283442 280
251 3300005457 Ga0070662_100198505 Ga0070662_1001985051 280
252 3300005459 Ga0068867_100026629 Ga0068867_1000266292 280
253 3300005467 Ga0070706_100025076 Ga0070706_1000250763 280
254 3300005518 Ga0070699_100053313 Ga0070699_1000533133 280
255 3300005543 Ga0070672_100036248 Ga0070672_1000362482 280
256 3300005543 Ga0070672_100059975 Ga0070672_1000599751 280
257 3300005547 Ga0070693_100119230 Ga0070693_1001192301 280
258 3300005548 Ga0070665_100097495 Ga0070665_1000974952 280
259 3300005548 Ga0070665_100191133 Ga0070665_1001911332 280
260 3300005563 Ga0068855_100020370 Ga0068855_1000203709 280
261 3300005577 Ga0068857_100002837 Ga0068857_1000028379 280
262 3300005578 Ga0068854_100357091 Ga0068854_1003570912 280
263 3300005617 Ga0068859_100042732 Ga0068859_1000427321 280
264 3300005617 Ga0068859_100251484 Ga0068859_1002514841 280
265 3300005618 Ga0068864_100010805 Ga0068864_1000108056 280
266 3300005618 Ga0068864_100083125 Ga0068864_1000831251 280
267 3300005719 Ga0068861_100269451 Ga0068861_1002694511 280
268 3300005719 Ga0068861_100341983 Ga0068861_1003419831 280
269 3300005840 Ga0068870_10023888 Ga0068870_100238881 280
270 3300005841 Ga0068863_100040210 Ga0068863_1000402105 280
271 3300005842 Ga0068858_100006378 Ga0068858_10000637810 280
272 3300005842 Ga0068858_100038154 Ga0068858_1000381542 280
273 3300005843 Ga0068860_100151415 Ga0068860_1001514152 280
274 3300005843 Ga0068860_100467543 Ga0068860_1004675432 280
275 3300005844 Ga0068862_100073070 Ga0068862_1000730703 280
276 3300005844 Ga0068862_100084915 Ga0068862_1000849153 280
277 3300005937 Ga0081455_10015596 Ga0081455_100155962 280
278 3300005983 Ga0081540_1000175 Ga0081540_100017518 280
279 3300005983 Ga0081540_1022037 Ga0081540_10220372 280
280 3300005985 Ga0081539_10004485 Ga0081539_1000448511 280
281 3300005985 Ga0081539_10073243 Ga0081539_100732432 280
282 3300006048 Ga0075363_100014851 Ga0075363_1000148514 280
283 3300006048 Ga0075363_100040205 Ga0075363_1000402052 280
284 3300006051 Ga0075364_10050785 Ga0075364_100507852 280
285 3300006173 Ga0070716_100035078 Ga0070716_1000350781 280
286 3300006178 Ga0075367_10020906 Ga0075367_100209062 280
287 3300006178 Ga0075367_10053954 Ga0075367_100539543 280
288 3300006195 Ga0075366_10000419 Ga0075366_100004193 280
289 3300006353 Ga0075370_10035756 Ga0075370_100357562 280
290 3300006353 Ga0075370_10211532 Ga0075370_102115321 280
291 3300006844 Ga0075428_100068666 Ga0075428_1000686662 280
292 3300006846 Ga0075430_100011408 Ga0075430_1000114083 280
293 3300006846 Ga0075430_100129615 Ga0075430_1001296151 280
294 3300006847 Ga0075431_100300468 Ga0075431_1003004683 280
295 3300006852 Ga0075433_10016630 Ga0075433_100166305 280
296 3300006871 Ga0075434_100001356 Ga0075434_10000135619 280
297 3300006871 Ga0075434_100296667 Ga0075434_1002966672 280
298 3300006880 Ga0075429_100016836 Ga0075429_1000168364 280
299 3300006931 Ga0097620_100042731 Ga0097620_1000427311 280
300 3300006931 Ga0097620_100251475 Ga0097620_1002514753 280
301 3300006944 Ga0099823_1000033 Ga0099823_100003312 280
302 3300007265 Ga0099794_10002464 Ga0099794_100024646 280
303 3300009011 Ga0105251_10000075 Ga0105251_1000007517 280
304 3300009011 Ga0105251_10000239 Ga0105251_1000023921 280
305 3300009011 Ga0105251_10001422 Ga0105251_1000142215 280
306 3300009011 Ga0105251_10013543 Ga0105251_100135431 280
307 3300009036 Ga0105244_10005583 Ga0105244_100055836 280
308 3300009094 Ga0111539_10562013 Ga0111539_105620132 280
309 3300009098 Ga0105245_10037563 Ga0105245_100375633 280
310 3300009101 Ga0105247_10004686 Ga0105247_100046867 280
311 3300009148 Ga0105243_10015538 Ga0105243_100155382 280
312 3300009148 Ga0105243_10023311 Ga0105243_100233114 280
313 3300009177 Ga0105248_10014957 Ga0105248_100149576 280
314 3300009177 Ga0105248_10126471 Ga0105248_101264712 280
315 3300009177 Ga0105248_10157398 Ga0105248_101573982 280
316 3300009177 Ga0105248_10403316 Ga0105248_104033161 280
317 3300009545 Ga0105237_10024655 Ga0105237_100246553 280
318 3300009551 Ga0105238_10028042 Ga0105238_100280425 280
319 3300010159 Ga0099796_10021889 Ga0099796_100218892 280
320 3300010375 Ga0105239_10200367 Ga0105239_102003672 280
321 3300011119 Ga0105246_10019597 Ga0105246_100195973 280
322 3300013104 Ga0157370_10007312 Ga0157370_100073127 280
323 3300013296 Ga0157374_10431268 Ga0157374_104312681 280
324 3300013296 Ga0157374_10626342 Ga0157374_106263421 280
325 3300013306 Ga0163162_10037551 Ga0163162_100375513 280
326 3300013306 Ga0163162_10107352 Ga0163162_101073522 280
327 3300013307 Ga0157372_10274997 Ga0157372_102749972 280
328 3300013308 Ga0157375_10039196 Ga0157375_100391962 280
329 3300014325 Ga0163163_10026334 Ga0163163_100263343 280
330 3300014325 Ga0163163_10096555 Ga0163163_100965552 280
331 3300014326 Ga0157380_10114610 Ga0157380_101146103 280
332 3300014968 Ga0157379_10140333 Ga0157379_101403332 280
333 3300014968 Ga0157379_10194644 Ga0157379_101946442 280
334 3300025226 Ga0209674_100049 Ga0209674_100049147 280
335 3300025228 Ga0209672_100097 Ga0209672_10009772 280
336 3300025229 Ga0209147_100106 Ga0209147_10010645 280
337 3300025242 Ga0209258_100157 Ga0209258_10015745 280
338 3300025242 Ga0209258_107071 Ga0209258_1070712 280
339 3300025254 Ga0209148_1000150 Ga0209148_100015045 280
340 3300025256 Ga0209759_1000041 Ga0209759_100004186 280
341 3300025272 Ga0209455_1000132 Ga0209455_100013245 280
342 3300025273 Ga0209673_1000324 Ga0209673_100032465 280
343 3300025273 Ga0209673_1001616 Ga0209673_100161613 280
344 3300025273 Ga0209673_1003540 Ga0209673_10035405 280
345 3300025273 Ga0209673_1003939 Ga0209673_10039393 280
346 3300025295 Ga0209564_1011053 Ga0209564_10110533 280
347 3300025297 Ga0209758_1000382 Ga0209758_100038257 280
348 3300025297 Ga0209758_1004836 Ga0209758_10048362 280
349 3300025298 Ga0209050_1002396 Ga0209050_100239611 280
350 3300025298 Ga0209050_1021597 Ga0209050_10215972 280
351 3300025299 Ga0209256_1001786 Ga0209256_10017866 280
352 3300025303 Ga0209051_1000462 Ga0209051_100046251 280
353 3300025303 Ga0209051_1002774 Ga0209051_10027749 280
354 3300025304 Ga0209257_1001143 Ga0209257_100114324 280
355 3300025304 Ga0209257_1009675 Ga0209257_10096752 280
356 3300025735 Ga0207713_1000038 Ga0207713_100003857 280
357 3300025735 Ga0207713_1001016 Ga0207713_10010169 280
358 3300025735 Ga0207713_1007672 Ga0207713_10076723 280
359 3300025900 Ga0207710_10052925 Ga0207710_100529251 280
360 3300025905 Ga0207685_10018230 Ga0207685_100182302 280
361 3300025907 Ga0207645_10089515 Ga0207645_100895152 280
362 3300025908 Ga0207643_10031355 Ga0207643_100313552 280
363 3300025909 Ga0207705_10005976 Ga0207705_1000597610 280
364 3300025913 Ga0207695_10064490 Ga0207695_100644907 280
365 3300025914 Ga0207671_10017485 Ga0207671_100174855 280
366 3300025915 Ga0207693_10033688 Ga0207693_100336882 280
367 3300025915 Ga0207693_10058144 Ga0207693_100581443 280
368 3300025915 Ga0207693_10351693 Ga0207693_103516932 280
369 3300025916 Ga0207663_10074208 Ga0207663_100742083 280
370 3300025916 Ga0207663_10205893 Ga0207663_102058932 280
371 3300025918 Ga0207662_10018677 Ga0207662_100186772 280
372 3300025923 Ga0207681_10036366 Ga0207681_100363662 280
373 3300025923 Ga0207681_10052906 Ga0207681_100529063 280
374 3300025924 Ga0207694_10329011 Ga0207694_103290111 280
375 3300025925 Ga0207650_10002502 Ga0207650_100025029 280
376 3300025925 Ga0207650_10011955 Ga0207650_100119553 280
377 3300025925 Ga0207650_10012392 Ga0207650_100123924 280
378 3300025925 Ga0207650_10038911 Ga0207650_100389112 280
379 3300025926 Ga0207659_10011480 Ga0207659_100114802 280
380 3300025926 Ga0207659_10138200 Ga0207659_101382002 280
381 3300025927 Ga0207687_10017974 Ga0207687_100179744 280
382 3300025928 Ga0207700_10000071 Ga0207700_1000007143 280
383 3300025928 Ga0207700_10057725 Ga0207700_100577252 280
384 3300025931 Ga0207644_10017094 Ga0207644_100170943 280
385 3300025931 Ga0207644_10040520 Ga0207644_100405201 280
386 3300025931 Ga0207644_10056327 Ga0207644_100563272 280
387 3300025933 Ga0207706_10022990 Ga0207706_100229906 280
388 3300025933 Ga0207706_10379492 Ga0207706_103794921 280
389 3300025935 Ga0207709_10003040 Ga0207709_100030402 280
390 3300025936 Ga0207670_10074057 Ga0207670_100740572 280
391 3300025937 Ga0207669_10035112 Ga0207669_100351121 280
392 3300025940 Ga0207691_10070957 Ga0207691_100709573 280
393 3300025940 Ga0207691_10407052 Ga0207691_104070521 280
394 3300025941 Ga0207711_10020446 Ga0207711_100204465 280
395 3300025941 Ga0207711_10282102 Ga0207711_102821021 280
396 3300025942 Ga0207689_10138058 Ga0207689_101380582 280
397 3300025945 Ga0207679_10536605 Ga0207679_105366051 280
398 3300025949 Ga0207667_10001176 Ga0207667_1000117628 280
399 3300025960 Ga0207651_10038654 Ga0207651_100386542 280
400 3300025960 Ga0207651_10233357 Ga0207651_102333571 280
401 3300025972 Ga0207668_10004844 Ga0207668_100048442 280
402 3300025972 Ga0207668_10034036 Ga0207668_100340362 280
403 3300025972 Ga0207668_10082720 Ga0207668_100827202 280
404 3300025981 Ga0207640_10246346 Ga0207640_102463462 280
405 3300026035 Ga0207703_10035852 Ga0207703_100358523 280
406 3300026035 Ga0207703_10052382 Ga0207703_100523822 280
407 3300026041 Ga0207639_10274664 Ga0207639_102746642 280
408 3300026067 Ga0207678_10210463 Ga0207678_102104632 280
409 3300026088 Ga0207641_10032484 Ga0207641_100324843 280
410 3300026088 Ga0207641_10050190 Ga0207641_100501902 280
411 3300026089 Ga0207648_10093070 Ga0207648_100930702 280
412 3300026089 Ga0207648_10477397 Ga0207648_104773971 280
413 3300026095 Ga0207676_10014487 Ga0207676_100144872 280
414 3300026095 Ga0207676_10068794 Ga0207676_100687942 280
415 3300026116 Ga0207674_10022818 Ga0207674_100228184 280
416 3300026118 Ga0207675_100052226 Ga0207675_1000522263 280
417 3300026118 Ga0207675_100126177 Ga0207675_1001261774 280
418 3300026118 Ga0207675_100245502 Ga0207675_1002455022 280
419 3300027296 Ga0209389_1005072 Ga0209389_10050729 280
420 3300027312 Ga0209371_1000025 Ga0209371_1000025166 280
421 3300027312 Ga0209371_1000259 Ga0209371_100025938 280
422 3300027312 Ga0209371_1000604 Ga0209371_100060426 280
423 3300027671 Ga0209588_1000642 Ga0209588_10006428 280
424 3300028379 Ga0268266_10074285 Ga0268266_100742853 280
425 3300028379 Ga0268266_10418653 Ga0268266_104186531 280
426 3300028380 Ga0268265_10080942 Ga0268265_100809422 280
427 3300028380 Ga0268265_10309660 Ga0268265_103096602 280
428 3300030500 Ga0268256_1000027 Ga0268256_1000027166 280
429 3300030500 Ga0268256_1000233 Ga0268256_100023352 280
430 3300030500 Ga0268256_1000510 Ga0268256_100051012 280
431 3300031235 Ga0265330_10051485 Ga0265330_100514852 280
432 3300031456 Ga0307513_10440403 Ga0307513_104404031 280
433 3300031548 Ga0307408_100002383 Ga0307408_1000023832 280
434 3300031548 Ga0307408_100016611 Ga0307408_1000166113 280
435 3300031731 Ga0307405_10134869 Ga0307405_101348692 280
436 3300031824 Ga0307413_10076889 Ga0307413_100768892 280
437 3300031852 Ga0307410_10008484 Ga0307410_100084845 280
438 3300031852 Ga0307410_10287293 Ga0307410_102872931 280
439 3300031901 Ga0307406_10232960 Ga0307406_102329601 280
440 3300031903 Ga0307407_10008019 Ga0307407_100080194 280
441 3300031911 Ga0307412_10000015 Ga0307412_1000001522 280
442 3300031911 Ga0307412_10017164 Ga0307412_100171643 280
443 3300031995 Ga0307409_100026764 Ga0307409_1000267642 280
444 3300031995 Ga0307409_100339081 Ga0307409_1003390812 280
445 3300031995 Ga0307409_100417644 Ga0307409_1004176442 280
446 3300032002 Ga0307416_100013635 Ga0307416_1000136355 280
447 3300032126 Ga0307415_100009223 Ga0307415_1000092234 280
448 3300032168 Ga0316593_10002636 Ga0316593_100026363 280
449 3300032168 Ga0316593_10012634 Ga0316593_100126341 280
450 3300032168 Ga0316593_10094855 Ga0316593_100948551 280
451 3300033524 Ga0316592_1001937 Ga0316592_10019371 280
452 3300033524 Ga0316592_1007064 Ga0316592_10070642 280
453 3300033524 Ga0316592_1008227 Ga0316592_10082272 280
454 3300033528 Ga0316588_1015147 Ga0316588_10151472 280
455 3300033541 Ga0316596_1011671 Ga0316596_10116712 280
456 3300035083 Ga0373926_0048813 Ga0373926_0048813_80_1030 280
457 3300035083 Ga0373926_0101378 Ga0373926_0101378_44_988 280
458 3300035111 Ga0373923_0027239 Ga0373923_0027239_546_1499 280
459 3300035113 Ga0373936_0019183 Ga0373936_0019183_1252_2196 280
460 3300035116 Ga0373945_0011383 Ga0373945_0011383_1363_2313 280
461 3300035117 Ga0373953_0009240 Ga0373953_0009240_661_1614 280
462 3300035118 Ga0373954_0003072 Ga0373954_0003072_3051_4004 280
463 3300035118 Ga0373954_0067827 Ga0373954_0067827_670_1620 280
464 3300035170 Ga0373943_0016830 Ga0373943_0016830_1263_2213 280
465 3300035171 Ga0373946_0011243 Ga0373946_0011243_1858_2808 280
466 3300035171 Ga0373946_0034050 Ga0373946_0034050_601_1545 280
467 3300035172 Ga0373955_0004841 Ga0373955_0004841_2254_3207 280
468 3300035398 Ga0316574_0002172 Ga0316574_0002172_1753_2712 280
469 3300035692 Ga0373935_0027481 Ga0373935_0027481_2498_3451 280
470 3300035692 Ga0373935_0045369 Ga0373935_0045369_330_1280 280
471 3300035692 Ga0373935_0128848 Ga0373935_0128848_492_1436 280
472 3300035695 Ga0373927_0018924 Ga0373927_0018924_1770_2720 280
473 3300035695 Ga0373927_0024801 Ga0373927_0024801_1615_2559 280
474 3300035695 Ga0373927_0185870 Ga0373927_0185870_395_1345 280
475 3300035724 Ga0373933_0058601 Ga0373933_0058601_14_958 280
476 3300035725 Ga0373947_0011648 Ga0373947_0011648_2367_3311 280
477 3300035725 Ga0373947_0045708 Ga0373947_0045708_1271_2221 280
478 3300036401 Ga0373937_0022427 Ga0373937_0022427_2192_3145 280
479 3300036401 Ga0373937_0040021 Ga0373937_0040021_2046_2990 280
480 3300036401 Ga0373937_0316220 Ga0373937_0316220_399_1343 280
481 3300037312 Ga0395899_0024573 Ga0395899_0024573_2022_3044 280
482 3300037312 Ga0395899_0047828 Ga0395899_0047828_299_1276 280
483 3300037418 Ga0395900_0072067 Ga0395900_0072067_1217_2239 280
484 3300037418 Ga0395900_0173016 Ga0395900_0173016_135_1112 280
485 3300037418 Ga0395900_0254885 Ga0395900_0254885_61_1041 280
486 3300037466 Ga0395898_0014126 Ga0395898_0014126_2854_3831 280
487 3300037466 Ga0395898_0083465 Ga0395898_0083465_1218_2240 280
488 3300037466 Ga0395898_0181688 Ga0395898_0181688_652_1575 280
489 3300037466 Ga0395898_0390286 Ga0395898_0390286_125_1135 280
490 3300037471 Ga0395905_0002322 Ga0395905_0002322_16450_17394 280
491 3300038443 Ga0395901_0066588 Ga0395901_0066588_1173_2195 280
492 3300038443 Ga0395901_0347415 Ga0395901_0347415_73_1053 280
493 3300039447 Ga0436361_0370358 Ga0436361_0370358_1123_2067 280
494 3300039450 Ga0436363_0686554 Ga0436363_0686554_269_1216 280
495 3300041404 Ga0439436_0005519 Ga0439436_0005519_1748_2785 280
496 3300041999 Ga0439433_0013928 Ga0439433_0013928_709_1746 280
497 3300042010 Ga0439452_000001 Ga0439452_000001_1657353_1658282 280
498 3300042134 Ga0450898_017965 Ga0450898_017965_232_1161 280
499 3300042184 Ga0450908_008554 Ga0450908_008554_547_1584 280
500 3300042435 Ga0439434_0017534 Ga0439434_0017534_109_1131 280
501 3300042438 Ga0439459_0018379 Ga0439459_0018379_22_1116 280
502 3300044650 Ga0466986_0000518 Ga0466986_0000518_6754_7710 280
503 3300044658 Ga0466972_0000427 Ga0466972_0000427_18516_19472 280
504 3300044683 Ga0466965_0177323 Ga0466965_0177323_90_1061 280
505 3300044684 Ga0466966_0026078 Ga0466966_0026078_1841_2812 280
506 3300044684 Ga0466966_0113509 Ga0466966_0113509_576_1499 280
507 3300044693 Ga0466961_0000053 Ga0466961_0000053_12755_13711 280
508 3300044693 Ga0466961_0021527 Ga0466961_0021527_521_1444 280
509 3300044694 Ga0466963_0035631 Ga0466963_0035631_1847_2770 280
510 3300044735 Ga0466968_0003097 Ga0466968_0003097_3747_4703 280
511 3300044765 Ga0466970_0000057 Ga0466970_0000057_37979_38935 280
512 3300044765 Ga0466970_0007989 Ga0466970_0007989_2957_3877 280
513 3300045049 Ga0466959_0001715 Ga0466959_0001715_3244_4200 280
514 3300045049 Ga0466959_0164799 Ga0466959_0164799_166_1095 280
515 3300045976 Ga0466967_0016266 Ga0466967_0016266_3349_4305 280
516 3300046454 Ga0495592_0009546 Ga0495592_0009546_3448_4377 280
517 3300046454 Ga0495592_0012268 Ga0495592_0012268_783_1715 280
518 3300046454 Ga0495592_0031919 Ga0495592_0031919_2479_3432 280
519 3300046454 Ga0495592_0059500 Ga0495592_0059500_1232_2182 280
520 3300046455 Ga0495603_0012824 Ga0495603_0012824_2306_3250 280
521 3300046455 Ga0495603_0059203 Ga0495603_0059203_400_1350 280
522 3300046457 Ga0495590_0060064 Ga0495590_0060064_221_1186 280
523 3300046459 Ga0495629_0018239 Ga0495629_0018239_800_1744 280
524 3300046461 Ga0495641_0003517 Ga0495641_0003517_10061_10990 280
525 3300046461 Ga0495641_0014889 Ga0495641_0014889_1465_2415 280
526 3300046462 Ga0495651_0023866 Ga0495651_0023866_1244_2197 280
527 3300046462 Ga0495651_0050593 Ga0495651_0050593_738_1688 280
528 3300046462 Ga0495651_0172312 Ga0495651_0172312_519_1466 280
529 3300046463 Ga0495653_0011267 Ga0495653_0011267_585_1535 280
530 3300046463 Ga0495653_0028059 Ga0495653_0028059_171_1103 280
531 3300046463 Ga0495653_0035346 Ga0495653_0035346_1302_2255 280
532 3300046463 Ga0495653_0050594 Ga0495653_0050594_309_1253 280
533 3300046472 Ga0495580_0034339 Ga0495580_0034339_1894_2844 280
534 3300046472 Ga0495580_0099894 Ga0495580_0099894_151_1095 280
535 3300046473 Ga0495582_0049291 Ga0495582_0049291_82_1026 280
536 3300046474 Ga0495605_0140857 Ga0495605_0140857_70_1014 280
537 3300046475 Ga0495639_0014797 Ga0495639_0014797_632_1582 280
538 3300046475 Ga0495639_0015417 Ga0495639_0015417_429_1373 280
539 3300046476 Ga0495662_0030700 Ga0495662_0030700_739_1689 280
540 3300046477 Ga0495664_0268527 Ga0495664_0268527_38_976 280
541 3300046499 Ga0495594_0014756 Ga0495594_0014756_1350_2294 280
542 3300046511 Ga0495608_0014921 Ga0495608_0014921_2261_3214 280
543 3300046511 Ga0495608_0021592 Ga0495608_0021592_1682_2632 280
544 3300046514 Ga0495618_0009337 Ga0495618_0009337_1990_2934 280
545 3300046516 Ga0495628_0026376 Ga0495628_0026376_1011_1964 280
546 3300046516 Ga0495628_0066603 Ga0495628_0066603_1872_2804 280
547 3300046516 Ga0495628_0123729 Ga0495628_0123729_340_1284 280
548 3300046517 Ga0495630_0096720 Ga0495630_0096720_1226_2197 280
549 3300046517 Ga0495630_0202698 Ga0495630_0202698_466_1419 280
550 3300046522 Ga0495643_0019784 Ga0495643_0019784_2915_3859 280
551 3300046526 Ga0495666_0028998 Ga0495666_0028998_97_1041 280
552 3300046528 Ga0495642_0006593 Ga0495642_0006593_2315_3259 280
553 3300046529 Ga0495652_0016270 Ga0495652_0016270_916_1848 280
554 3300046529 Ga0495652_0024838 Ga0495652_0024838_2897_3850 280
555 3300046529 Ga0495652_0036216 Ga0495652_0036216_1424_2374 280
556 3300046529 Ga0495652_0095683 Ga0495652_0095683_249_1178 280
557 3300046531 Ga0495665_0060245 Ga0495665_0060245_954_1898 280
558 3300046531 Ga0495665_0119539 Ga0495665_0119539_259_1203 280
559 3300046533 Ga0495640_0013821 Ga0495640_0013821_1378_2322 280
560 3300046533 Ga0495640_0019133 Ga0495640_0019133_3793_4746 280
561 3300046536 Ga0495587_0024465 Ga0495587_0024465_1359_2312 280
562 3300046536 Ga0495587_0030508 Ga0495587_0030508_884_1834 280
563 3300046542 Ga0495597_0000102 Ga0495597_0000102_16791_17735 280
564 3300046543 Ga0495645_0019292 Ga0495645_0019292_1880_2833 280
565 3300046559 Ga0495667_0015567 Ga0495667_0015567_1977_2930 280
566 3300046559 Ga0495667_0021890 Ga0495667_0021890_1264_2214 280
567 3300046615 Ga0495656_0097898 Ga0495656_0097898_304_1254 280
568 3300046616 Ga0495668_0000020 Ga0495668_0000020_309299_310222 280
569 3300046616 Ga0495668_0011692 Ga0495668_0011692_2671_3615 280
570 3300046642 Ga0495634_0012821 Ga0495634_0012821_2419_3363 280
571 3300046642 Ga0495634_0019336 Ga0495634_0019336_1977_2930 280
572 3300046642 Ga0495634_0024572 Ga0495634_0024572_2557_3528 280
573 3300046642 Ga0495634_0067823 Ga0495634_0067823_632_1582 280
574 3300046663 Ga0495635_0012490 Ga0495635_0012490_3128_4081 280
575 3300046663 Ga0495635_0030818 Ga0495635_0030818_1083_2012 280
576 3300046663 Ga0495635_0042929 Ga0495635_0042929_2027_2977 280
577 3300046665 Ga0495661_0009296 Ga0495661_0009296_2769_3713 280
578 3300046675 Ga0495657_0007494 Ga0495657_0007494_316_1287 280
579 3300046675 Ga0495657_0025296 Ga0495657_0025296_2255_3208 280
580 3300046678 Ga0495599_0006520 Ga0495599_0006520_3667_4620 280
581 3300046678 Ga0495599_0039811 Ga0495599_0039811_1925_2890 280
582 3300046679 Ga0495623_0006249 Ga0495623_0006249_2535_3488 280
583 3300046680 Ga0495646_0027875 Ga0495646_0027875_487_1440 280
584 3300046680 Ga0495646_0062282 Ga0495646_0062282_982_1932 280
585 3300046680 Ga0495646_0084386 Ga0495646_0084386_659_1591 280
586 3300046681 Ga0495647_0016556 Ga0495647_0016556_1055_2005 280
587 3300046683 Ga0495658_0006869 Ga0495658_0006869_1376_2320 280
588 3300046683 Ga0495658_0092091 Ga0495658_0092091_330_1274 280
589 3300046689 Ga0495613_0069830 Ga0495613_0069830_494_1438 280
590 3300046689 Ga0495613_0149215 Ga0495613_0149215_378_1328 280
591 3300046689 Ga0495613_0180350 Ga0495613_0180350_133_1086 280
592 3300046690 Ga0495624_0001476 Ga0495624_0001476_16447_17418 280
593 3300046690 Ga0495624_0002969 Ga0495624_0002969_6453_7382 280
594 3300046690 Ga0495624_0024218 Ga0495624_0024218_1024_1974 280
595 3300046690 Ga0495624_0042860 Ga0495624_0042860_302_1246 280
596 3300046794 Ga0495589_0000091 Ga0495589_0000091_65822_66766 280
597 3300046809 Ga0495600_0010245 Ga0495600_0010245_2248_3201 280
598 3300046809 Ga0495600_0071471 Ga0495600_0071471_823_1755 280
599 3300047315 Ga0495581_0041039 Ga0495581_0041039_622_1572 280
600 3300047317 Ga0495604_0006471 Ga0495604_0006471_2808_3758 280
601 3300047317 Ga0495604_0013652 Ga0495604_0013652_742_1674 280
602 3300047317 Ga0495604_0018787 Ga0495604_0018787_1961_2914 280
603 3300047317 Ga0495604_0028182 Ga0495604_0028182_1224_2168 280
604 3300047319 Ga0495674_0009452 Ga0495674_0009452_4939_5910 280
605 3300047319 Ga0495674_0011849 Ga0495674_0011849_4982_5935 280
606 3300047319 Ga0495674_0014791 Ga0495674_0014791_5132_6076 280
607 3300047319 Ga0495674_0032997 Ga0495674_0032997_1689_2627 280
608 3300047321 Ga0495676_0002631 Ga0495676_0002631_5913_6842 280
609 3300047321 Ga0495676_0007948 Ga0495676_0007948_7329_8300 280
610 3300047321 Ga0495676_0042145 Ga0495676_0042145_2008_2958 280
611 3300047322 Ga0495680_0024592 Ga0495680_0024592_3581_4525 280
612 3300047322 Ga0495680_0046045 Ga0495680_0046045_2070_3023 280
613 3300047322 Ga0495680_0117713 Ga0495680_0117713_946_1878 280
614 3300047443 Ga0495687_014386 Ga0495687_014386_1260_2204 280
615 3300047444 Ga0495675_0016865 Ga0495675_0016865_1926_2879 280
616 3300047471 Ga0495684_0005133 Ga0495684_0005133_1812_2762 280
617 3300047471 Ga0495684_0006871 Ga0495684_0006871_4921_5865 280
618 3300047471 Ga0495684_0020155 Ga0495684_0020155_3670_4635 280
619 3300047471 Ga0495684_0023268 Ga0495684_0023268_2509_3462 280
620 3300047673 Ga0495593_0012276 Ga0495593_0012276_2250_3200 280
621 3300047673 Ga0495593_0035643 Ga0495593_0035643_1589_2533 280
622 3300048088 Ga0495602_0004743 Ga0495602_0004743_1743_2675 280
623 3300048088 Ga0495602_0014752 Ga0495602_0014752_4877_5806 280
624 3300048088 Ga0495602_0037302 Ga0495602_0037302_1691_2644 280
625 3300048088 Ga0495602_0039196 Ga0495602_0039196_2661_3593 280
626 3300048088 Ga0495602_0312836 Ga0495602_0312836_142_1107 280
627 3300048089 Ga0495614_0058969 Ga0495614_0058969_633_1577 280
628 3300048903 Ga0496100_0035948 Ga0496100_0035948_1377_2315 280
629 3300048903 Ga0496100_0110286 Ga0496100_0110286_882_1838 280
630 3300048904 Ga0496101_0000731 Ga0496101_0000731_13787_14725 280
631 3300048905 Ga0496102_0000056 Ga0496102_0000056_111968_112906 280
632 3300048905 Ga0496102_0252967 Ga0496102_0252967_239_1162 280
633 3300048906 Ga0496103_0000040 Ga0496103_0000040_59785_60723 280
634 3300048907 Ga0496104_0254514 Ga0496104_0254514_18_1028 280
635 3300048909 Ga0496106_0020159 Ga0496106_0020159_83_1021 280
636 3300048909 Ga0496106_0124626 Ga0496106_0124626_447_1418 280
637 3300048910 Ga0496107_0139725 Ga0496107_0139725_353_1309 280
638 3300048910 Ga0496107_0367450 Ga0496107_0367450_39_977 280
639 3300048911 Ga0496108_0121995 Ga0496108_0121995_30_977 280
640 3300048912 Ga0496109_0042830 Ga0496109_0042830_1591_2541 280
641 3300048915 Ga0496112_0005743 Ga0496112_0005743_7272_8237 280
642 3300048915 Ga0496112_0039083 Ga0496112_0039083_1902_2852 280
643 3300048916 Ga0496113_0028553 Ga0496113_0028553_91_1038 280
644 3300048918 Ga0496115_0110909 Ga0496115_0110909_605_1555 280
645 3300048918 Ga0496115_0179409 Ga0496115_0179409_497_1453 280
646 3300048919 Ga0496116_0000056 Ga0496116_0000056_59802_60740 280
647 3300048919 Ga0496116_0000110 Ga0496116_0000110_118160_119089 280
648 3300048920 Ga0496117_0000003 Ga0496117_0000003_1820358_1821296 280
649 3300048920 Ga0496117_0000802 Ga0496117_0000802_3999_4928 280
650 3300048920 Ga0496117_0005072 Ga0496117_0005072_10246_11175 280
651 3300048921 Ga0496118_0000001 Ga0496118_0000001_1820361_1821299 280
652 3300048921 Ga0496118_0008850 Ga0496118_0008850_4351_5355 280
653 3300048921 Ga0496118_0011094 Ga0496118_0011094_4428_5357 280
654 3300048921 Ga0496118_0017185 Ga0496118_0017185_5606_6556 280
655 3300048922 Ga0496119_0000263 Ga0496119_0000263_41545_42483 280
656 3300048922 Ga0496119_0000648 Ga0496119_0000648_35907_36836 280
657 3300048923 Ga0496120_0000318 Ga0496120_0000318_37283_38221 280
658 3300048923 Ga0496120_0000749 Ga0496120_0000749_10199_11128 280
659 3300048924 Ga0496121_0000121 Ga0496121_0000121_59803_60741 280
660 3300048924 Ga0496121_0007340 Ga0496121_0007340_8039_8989 280
661 3300048925 Ga0496122_0001087 Ga0496122_0001087_10271_11200 280
662 3300048925 Ga0496122_0090011 Ga0496122_0090011_1012_1965 280
663 3300048926 Ga0496123_0000889 Ga0496123_0000889_36120_37049 280
664 3300048927 Ga0496124_0000219 Ga0496124_0000219_86919_87848 280
665 3300048927 Ga0496124_0006361 Ga0496124_0006361_10157_11086 280
666 3300048928 Ga0496125_0000796 Ga0496125_0000796_18919_19872 280
667 3300048928 Ga0496125_0006057 Ga0496125_0006057_3688_4644 280
668 3300048929 Ga0496126_0000837 Ga0496126_0000837_1909_2847 280
669 3300048929 Ga0496126_0093310 Ga0496126_0093310_1453_2403 280
670 3300049127 Ga0501306_011306 Ga0501306_011306_41_970 280
671 3300049130 Ga0501310_008254 Ga0501310_008254_37_966 280
672 3300049160 Ga0501304_004913 Ga0501304_004913_40_969 280
673 3300049162 Ga0501307_011885 Ga0501307_011885_79_1002 280
674 3300049540 Ga0501324_002633 Ga0501324_002633_36_956 280
675 3300049572 Ga0501036_0064815 Ga0501036_0064815_1721_2680 280
676 3300049575 Ga0501039_0221374 Ga0501039_0221374_357_1316 280
677 3300049578 Ga0501042_0110916 Ga0501042_0110916_699_1658 280
678 3300049580 Ga0501046_0060300 Ga0501046_0060300_1575_2534 280
679 3300049591 Ga0501075_0012498 Ga0501075_0012498_3053_4012 280
680 3300049592 Ga0501076_0002231 Ga0501076_0002231_6631_7590 280
681 3300049593 Ga0501077_0044776 Ga0501077_0044776_1497_2456 280
682 3300049741 Ga0501079_0005429 Ga0501079_0005429_2612_3571 280
683 3300049742 Ga0501080_0334394 Ga0501080_0334394_334_1293 280
684 3300050490 nmdc:mga03n38_24630_c1 nmdc:mga03n38_24630_c1_536_1480 280
685 3300050491 nmdc:mga00v17_231581_c1 nmdc:mga00v17_231581_c1_103_1047 280
686 3300050493 nmdc:mga0k408_23202_c1 nmdc:mga0k408_23202_c1_1149_2093 280
687 3300050493 nmdc:mga0k408_35008_c1 nmdc:mga0k408_35008_c1_1195_2145 280
688 3300050494 nmdc:mga06z11_17720_c1 nmdc:mga06z11_17720_c1_2015_2959 280
689 3300050496 nmdc:mga07m45_23200_c1 nmdc:mga07m45_23200_c1_2194_3138 280
690 3300050507 nmdc:mga05p37_559607_c1 nmdc:mga05p37_559607_c1_325_1269 280
691 3300050508 nmdc:mga09592_11987_c1 nmdc:mga09592_11987_c1_2799_3728 280
692 3300050508 nmdc:mga09592_70455_c1 nmdc:mga09592_70455_c1_181_1125 280
693 3300050509 nmdc:mga0qj67_106602_c1 nmdc:mga0qj67_106602_c1_1189_2133 280
694 3300050510 nmdc:mga06r32_138352_c1 nmdc:mga06r32_138352_c1_1200_2144 280
695 3300050511 nmdc:mga08y16_493360_c1 nmdc:mga08y16_493360_c1_54_1007 280
696 3300050513 nmdc:mga0rr50_212668_c1 nmdc:mga0rr50_212668_c1_521_1465 280
697 3300050515 nmdc:mga0a205_10045_c1 nmdc:mga0a205_10045_c1_5465_6415 280
698 3300050515 nmdc:mga0a205_353408_c1 nmdc:mga0a205_353408_c1_147_1091 280
699 3300050516 nmdc:mga0sz30_24420_c2 nmdc:mga0sz30_24420_c2_283_1239 280
700 3300053077 Ga0495601_0012010 Ga0495601_0012010_2255_3208 280
701 3300053077 Ga0495601_0013485 Ga0495601_0013485_1392_2336 280
702 3300053077 Ga0495601_0029907 Ga0495601_0029907_1799_2749 280
703 3300053077 Ga0495601_0041517 Ga0495601_0041517_1406_2353 280
704 3300053077 Ga0495601_0189851 Ga0495601_0189851_74_1099 280
705 3300053078 Ga0495612_0008448 Ga0495612_0008448_2070_3014 280
706 3300053084 Ga0495595_0022118 Ga0495595_0022118_557_1501 280
707 3300053085 Ga0495619_0004470 Ga0495619_0004470_5132_6076 280
708 3300053085 Ga0495619_0005558 Ga0495619_0005558_1391_2341 280
709 3300053085 Ga0495619_0007982 Ga0495619_0007982_3412_4365 280
710 3300053085 Ga0495619_0015724 Ga0495619_0015724_2576_3523 280
711 3300053085 Ga0495619_0124124 Ga0495619_0124124_16_960 280
712 3300053119 Ga0500595_000351 Ga0500595_000351_3147_4097 280
713 3300053153 Ga0500616_0000002 Ga0500616_0000002_690836_691786 280
714 3300053153 Ga0500616_0003816 Ga0500616_0003816_5145_6083 280
715 3300054114 Ga0501084_0011217 Ga0501084_0011217_2130_3089 280
716 3300054114 Ga0501084_0457518 Ga0501084_0457518_72_1061 280
717 3300059478 Ga0587093_001988 Ga0587093_001988_202_1272 280
718 3300059510 Ga0587090_005294 Ga0587090_005294_105_1049 280
719 3300060353 Ga0501082_0002439 Ga0501082_0002439_9967_10926 280
720 3300061734 Ga0530510_0000677 Ga0530510_0000677_862_1821 280
721 iso_pu_bacteria 2928170801 2928177934 280
722 iso_pu_bacteria 8004025490 8004028256 280
723 iso_pu_bacteria 8021120328 8021127151 280
724 iso_pu_bacteria 8055301274 8055306949 280
725 3300005337 Ga0070682_100074703 Ga0070682_1000747032 281
726 3300005353 Ga0070669_100010538 Ga0070669_1000105384 281
727 3300009011 Ga0105251_10001294 Ga0105251_1000129415 281
728 3300013306 Ga0163162_10000398 Ga0163162_100003986 281
729 3300017792 Ga0163161_10000427 Ga0163161_100004279 281
730 3300041496 Ga0451839_0004112 Ga0451839_0004112_419_1345 281
731 3300046459 Ga0495629_0034343 Ga0495629_0034343_1515_2441 281
732 3300046675 Ga0495657_0168811 Ga0495657_0168811_212_1138 281
733 3300048920 Ga0496117_0000354 Ga0496117_0000354_44732_45721 281
734 3300048921 Ga0496118_0009737 Ga0496118_0009737_5311_6300 281
735 3300048924 Ga0496121_0012058 Ga0496121_0012058_3140_4129 281
736 3300048927 Ga0496124_0001992 Ga0496124_0001992_1259_2248 281
737 3300048928 Ga0496125_0025241 Ga0496125_0025241_2852_3841 281
738 3300048929 Ga0496126_0001389 Ga0496126_0001389_5039_6028 281
739 3300003761 Ga0055535_1011754 Ga0055535_10117542 282
740 3300005355 Ga0070671_100000044 Ga0070671_10000004478 282
741 3300006195 Ga0075366_10011020 Ga0075366_100110204 282
742 3300006195 Ga0075366_10015917 Ga0075366_100159172 282
743 3300009148 Ga0105243_10023100 Ga0105243_100231003 282
744 3300025242 Ga0209258_101138 Ga0209258_1011386 282
745 3300025925 Ga0207650_10208193 Ga0207650_102081932 282
746 3300025931 Ga0207644_10000080 Ga0207644_1000008057 282
747 3300025935 Ga0207709_10032763 Ga0207709_100327632 282
748 3300025942 Ga0207689_10373778 Ga0207689_103737781 282
749 3300026067 Ga0207678_10130582 Ga0207678_101305821 282
750 3300026121 Ga0207683_10259477 Ga0207683_102594772 282
751 3300028794 Ga0307515_10001534 Ga0307515_1000153427 282
752 3300031824 Ga0307413_10386825 Ga0307413_103868251 282
753 3300037471 Ga0395905_0003918 Ga0395905_0003918_479_1414 282
754 3300037471 Ga0395905_0109828 Ga0395905_0109828_207_1142 282
755 3300041452 Ga0451793_1176449 Ga0451793_1176449_130_1056 282
756 3300041456 Ga0451795_1559355 Ga0451795_1559355_445_1371 282
757 3300042121 Ga0450919_000409 Ga0450919_000409_1311_2255 282
758 3300042531 Ga0450918_000078 Ga0450918_000078_6112_7056 282
759 3300044658 Ga0466972_0011719 Ga0466972_0011719_2271_3200 282
760 3300046454 Ga0495592_0233704 Ga0495592_0233704_189_1115 282
761 3300046462 Ga0495651_0197068 Ga0495651_0197068_28_954 282
762 3300047319 Ga0495674_0315848 Ga0495674_0315848_281_1207 282
763 3300048088 Ga0495602_0349409 Ga0495602_0349409_87_1013 282
764 3300048905 Ga0496102_0274076 Ga0496102_0274076_103_1029 282
765 3300048906 Ga0496103_0158216 Ga0496103_0158216_364_1290 282
766 3300048907 Ga0496104_0052036 Ga0496104_0052036_518_1444 282
767 3300048908 Ga0496105_0000423 Ga0496105_0000423_6980_7933 282
768 3300048908 Ga0496105_0076506 Ga0496105_0076506_223_1149 282
769 3300048908 Ga0496105_0104763 Ga0496105_0104763_948_1901 282
770 3300048909 Ga0496106_0519628 Ga0496106_0519628_19_945 282
771 3300048911 Ga0496108_0170890 Ga0496108_0170890_811_1737 282
772 3300048918 Ga0496115_0153409 Ga0496115_0153409_893_1819 282
773 3300048924 Ga0496121_0005718 Ga0496121_0005718_11966_12901 282
774 3300048927 Ga0496124_0003260 Ga0496124_0003260_5274_6209 282
775 3300048928 Ga0496125_0005292 Ga0496125_0005292_8862_9797 282
776 3300048928 Ga0496125_0030371 Ga0496125_0030371_1648_2577 282
777 3300050493 nmdc:mga0k408_2991_c1 nmdc:mga0k408_2991_c1_3013_3942 282
778 2162886007 SwRhRL2b_contig_1448349 SwRhRL2b_0697.00003760 283
779 3300005288 Ga0065714_10002420 Ga0065714_100024204 283
780 3300005289 Ga0065704_10000243 Ga0065704_1000024320 283
781 3300005331 Ga0070670_100175692 Ga0070670_1001756922 283
782 3300005334 Ga0068869_100174439 Ga0068869_1001744392 283
783 3300005344 Ga0070661_100127517 Ga0070661_1001275172 283
784 3300005345 Ga0070692_10123958 Ga0070692_101239582 283
785 3300005347 Ga0070668_100062129 Ga0070668_1000621292 283
786 3300005455 Ga0070663_100028759 Ga0070663_1000287592 283
787 3300005466 Ga0070685_10072180 Ga0070685_100721802 283
788 3300005548 Ga0070665_100205038 Ga0070665_1002050382 283
789 3300005564 Ga0070664_100032779 Ga0070664_1000327792 283
790 3300005616 Ga0068852_100273399 Ga0068852_1002733991 283
791 3300005617 Ga0068859_100098143 Ga0068859_1000981432 283
792 3300005618 Ga0068864_100169922 Ga0068864_1001699222 283
793 3300006058 Ga0075432_10010009 Ga0075432_100100093 283
794 3300006195 Ga0075366_10054373 Ga0075366_100543732 283
795 3300006846 Ga0075430_100138678 Ga0075430_1001386781 283
796 3300006931 Ga0097620_100098144 Ga0097620_1000981442 283
797 3300009011 Ga0105251_10002112 Ga0105251_100021124 283
798 3300009011 Ga0105251_10024951 Ga0105251_100249512 283
799 3300009092 Ga0105250_10002874 Ga0105250_100028744 283
800 3300009545 Ga0105237_10509750 Ga0105237_105097501 283
801 3300013105 Ga0157369_10196540 Ga0157369_101965402 283
802 3300014745 Ga0157377_10195811 Ga0157377_101958111 283
803 3300015262 Ga0182007_10004297 Ga0182007_100042973 283
804 3300020076 Ga0206355_1050631 Ga0206355_10506311 283
805 3300020081 Ga0206354_11554051 Ga0206354_115540511 283
806 3300025711 Ga0207696_1002726 Ga0207696_10027265 283
807 3300025711 Ga0207696_1025010 Ga0207696_10250102 283
808 3300025735 Ga0207713_1006052 Ga0207713_10060526 283
809 3300025907 Ga0207645_10131205 Ga0207645_101312052 283
810 3300025914 Ga0207671_10366936 Ga0207671_103669361 283
811 3300025924 Ga0207694_10202000 Ga0207694_102020002 283
812 3300025945 Ga0207679_10077238 Ga0207679_100772381 283
813 3300026067 Ga0207678_10124403 Ga0207678_101244032 283
814 3300026121 Ga0207683_10221060 Ga0207683_102210602 283
815 3300026142 Ga0207698_10256724 Ga0207698_102567242 283
816 3300028379 Ga0268266_10211819 Ga0268266_102118191 283
817 3300031824 Ga0307413_10030443 Ga0307413_100304432 283
818 3300031911 Ga0307412_10257455 Ga0307412_102574552 283
819 3300042006 Ga0439432_000130 Ga0439432_000130_4750_5679 283
820 3300042009 Ga0439451_000493 Ga0439451_000493_2348_3277 283
821 3300042009 Ga0439451_004046 Ga0439451_004046_1295_2224 283
822 3300042013 Ga0439456_000597 Ga0439456_000597_4147_5076 283
823 3300042013 Ga0439456_001303 Ga0439456_001303_1412_2341 283
824 3300042016 Ga0439463_000469 Ga0439463_000469_2170_3099 283
825 3300042016 Ga0439463_001793 Ga0439463_001793_486_1415 283
826 3300042145 Ga0450906_002930 Ga0450906_002930_1855_2784 283
827 3300042532 Ga0450893_0012673 Ga0450893_0012673_118_1047 283
828 3300048911 Ga0496108_0216249 Ga0496108_0216249_681_1610 283
829 3300049460 Ga0495682_0002192 Ga0495682_0002192_980_1909 283
830 3300050511 nmdc:mga08y16_63983_c1 nmdc:mga08y16_63983_c1_1609_2538 283
831 3300005367 Ga0070667_100000485 Ga0070667_10000048529 284
832 3300005841 Ga0068863_100009249 Ga0068863_1000092495 284
833 3300005843 Ga0068860_100004982 Ga0068860_1000049825 284
834 3300025903 Ga0207680_10057312 Ga0207680_100573121 284
835 3300025986 Ga0207658_10000213 Ga0207658_100002137 284
836 3300026088 Ga0207641_10003981 Ga0207641_1000398111 284
837 3300028381 Ga0268264_10002221 Ga0268264_1000222111 284
838 3300009101 Ga0105247_10034631 Ga0105247_100346313 286
839 3300048905 Ga0496102_0000174 Ga0496102_0000174_2690_3652 286
840 3300048908 Ga0496105_0002210 Ga0496105_0002210_2860_3822 286
841 3300048914 Ga0496111_0015171 Ga0496111_0015171_749_1711 286
842 3300048917 Ga0496114_0014125 Ga0496114_0014125_182_1144 286
843 3300048918 Ga0496115_0000009 Ga0496115_0000009_91652_92614 286
844 3300048919 Ga0496116_0008516 Ga0496116_0008516_2805_3767 286
845 3300048920 Ga0496117_0019332 Ga0496117_0019332_3816_4778 286
846 3300048921 Ga0496118_0000077 Ga0496118_0000077_49295_50257 286
847 3300048924 Ga0496121_0000432 Ga0496121_0000432_33471_34433 286
848 3300048925 Ga0496122_0008986 Ga0496122_0008986_2235_3197 286
849 3300048927 Ga0496124_0000050 Ga0496124_0000050_115086_116048 286
850 3300048928 Ga0496125_0000114 Ga0496125_0000114_143461_144423 286
851 3300048929 Ga0496126_0000113 Ga0496126_0000113_49337_50299 286
852 2162886007 SwRhRL2b_contig_42532 SwRhRL2b_0957.00003220 287
853 3300002239 JGI24034J26672_10004338 JGI24034J26672_100043382 287
854 3300005289 Ga0065704_10070434 Ga0065704_1007043416 287
855 3300005347 Ga0070668_100013153 Ga0070668_1000131531 287
856 3300005353 Ga0070669_100000198 Ga0070669_10000019833 287
857 3300005355 Ga0070671_100001152 Ga0070671_10000115216 287
858 3300005367 Ga0070667_100004482 Ga0070667_1000044829 287
859 3300005548 Ga0070665_100003594 Ga0070665_1000035944 287
860 3300005617 Ga0068859_100411617 Ga0068859_1004116171 287
861 3300005843 Ga0068860_100007867 Ga0068860_1000078677 287
862 3300005844 Ga0068862_100030283 Ga0068862_1000302832 287
863 3300006931 Ga0097620_100411614 Ga0097620_1004116141 287
864 3300009011 Ga0105251_10025991 Ga0105251_100259912 287
865 3300009092 Ga0105250_10003656 Ga0105250_100036564 287
866 3300013306 Ga0163162_10014417 Ga0163162_100144172 287
867 3300017792 Ga0163161_10213310 Ga0163161_102133102 287
868 3300025711 Ga0207696_1001489 Ga0207696_10014899 287
869 3300025735 Ga0207713_1003536 Ga0207713_10035363 287
870 3300025923 Ga0207681_10000177 Ga0207681_1000017733 287
871 3300025931 Ga0207644_10002305 Ga0207644_100023052 287
872 3300025961 Ga0207712_10101710 Ga0207712_101017102 287
873 3300025972 Ga0207668_10021228 Ga0207668_100212283 287
874 3300025986 Ga0207658_10003133 Ga0207658_100031332 287
875 3300028379 Ga0268266_10002815 Ga0268266_100028151 287
876 3300028380 Ga0268265_10045029 Ga0268265_100450292 287
877 3300028381 Ga0268264_10003005 Ga0268264_100030057 287
878 3300048904 Ga0496101_0030130 Ga0496101_0030130_2733_3695 287
879 3300048905 Ga0496102_0000484 Ga0496102_0000484_40145_41107 287
880 3300048906 Ga0496103_0000320 Ga0496103_0000320_40141_41103 287
881 3300048907 Ga0496104_0000282 Ga0496104_0000282_35776_36738 287
882 3300048908 Ga0496105_0000136 Ga0496105_0000136_40141_41103 287
883 3300048910 Ga0496107_0017622 Ga0496107_0017622_181_1143 287
884 3300048915 Ga0496112_0039026 Ga0496112_0039026_663_1625 287
885 3300048916 Ga0496113_0000119 Ga0496113_0000119_4936_5898 287
886 3300048919 Ga0496116_0014709 Ga0496116_0014709_2031_2993 287
887 3300048920 Ga0496117_0008930 Ga0496117_0008930_5529_6491 287
888 3300048921 Ga0496118_0006305 Ga0496118_0006305_3064_4026 287
889 3300048922 Ga0496119_0000754 Ga0496119_0000754_34023_34985 287
890 3300048923 Ga0496120_0000689 Ga0496120_0000689_8419_9381 287
891 3300048924 Ga0496121_0002135 Ga0496121_0002135_27612_28574 287
892 3300048925 Ga0496122_0001497 Ga0496122_0001497_27802_28764 287
893 3300048926 Ga0496123_0001632 Ga0496123_0001632_1462_2424 287
894 3300048927 Ga0496124_0036067 Ga0496124_0036067_1610_2572 287
895 3300048928 Ga0496125_0001252 Ga0496125_0001252_27919_28881 287
896 3300048929 Ga0496126_0001447 Ga0496126_0001447_27924_28886 287
897 3300005347 Ga0070668_100109911 Ga0070668_1001099111 289
898 3300005353 Ga0070669_100008875 Ga0070669_1000088752 289
899 3300005355 Ga0070671_100053822 Ga0070671_1000538224 289
900 3300005841 Ga0068863_100065603 Ga0068863_1000656032 289
901 3300005844 Ga0068862_100076885 Ga0068862_1000768852 289
902 3300009177 Ga0105248_10042429 Ga0105248_100424293 289
903 3300009553 Ga0105249_10010654 Ga0105249_100106543 289
904 3300009978 Ga0105148_102481 Ga0105148_1024812 289
905 3300013306 Ga0163162_10172008 Ga0163162_101720082 289
906 3300014326 Ga0157380_10000081 Ga0157380_100000813 289
907 3300017792 Ga0163161_10011170 Ga0163161_100111704 289
908 3300025900 Ga0207710_10001632 Ga0207710_100016324 289
909 3300025961 Ga0207712_10005748 Ga0207712_100057484 289
910 3300025972 Ga0207668_10021701 Ga0207668_100217013 289
911 3300026088 Ga0207641_10020272 Ga0207641_100202722 289
912 3300026118 Ga0207675_100001472 Ga0207675_10000147218 289
913 3300028380 Ga0268265_10000218 Ga0268265_1000021856 289
914 3300028380 Ga0268265_10047013 Ga0268265_100470132 289
915 3300048921 Ga0496118_0000310 Ga0496118_0000310_55572_56534 289
916 3300048927 Ga0496124_0080025 Ga0496124_0080025_130_1092 289
917 iso_pu_bacteria 2510917022 2511136520 289
918 iso_pu_bacteria 2582581307 2585274321 289
919 iso_pu_bacteria 2585427531 2585560770 289
920 3300005844 Ga0068862_100011964 Ga0068862_1000119646 290
921 3300028380 Ga0268265_10058166 Ga0268265_100581662 290
922 iso_pu_bacteria 2751185897 2753767746 290
923 iso_pu_bacteria 2818991438 2819550701 290
924 3300017792 Ga0163161_10028287 Ga0163161_100282873 292
925 2162886007 SwRhRL2b_contig_2237776 SwRhRL2b_0434.00007960 293
926 3300005289 Ga0065704_10070144 Ga0065704_10070144251 293
927 3300005331 Ga0070670_100117294 Ga0070670_1001172942 293
928 3300005353 Ga0070669_100353720 Ga0070669_1003537201 293
929 3300005466 Ga0070685_10174814 Ga0070685_101748142 293
930 3300005548 Ga0070665_100141383 Ga0070665_1001413833 293
931 3300006048 Ga0075363_100125773 Ga0075363_1001257731 293
932 3300009978 Ga0105148_100125 Ga0105148_1001252 293
933 3300017792 Ga0163161_10181101 Ga0163161_101811011 293
934 3300048911 Ga0496108_0003089 Ga0496108_0003089_7396_8358 293
935 3300048911 Ga0496108_0030847 Ga0496108_0030847_3428_4390 293
936 3300048913 Ga0496110_0036175 Ga0496110_0036175_236_1198 293
937 3300048913 Ga0496110_0092722 Ga0496110_0092722_737_1699 293
938 3300048915 Ga0496112_0269203 Ga0496112_0269203_53_1015 293
939 3300048924 Ga0496121_0000984 Ga0496121_0000984_41744_42706 293
940 3300048925 Ga0496122_0197494 Ga0496122_0197494_22_984 293
941 3300048927 Ga0496124_0012220 Ga0496124_0012220_5811_6773 293
942 3300048927 Ga0496124_0062622 Ga0496124_0062622_1717_2679 293
943 3300048928 Ga0496125_0089350 Ga0496125_0089350_253_1215 293
944 3300048928 Ga0496125_0156461 Ga0496125_0156461_84_1046 293
945 3300048929 Ga0496126_0063154 Ga0496126_0063154_1062_2024 293
946 3300048929 Ga0496126_0141114 Ga0496126_0141114_108_1070 293
947 2162886007 SwRhRL2b_contig_1024214 SwRhRL2b_0545.00006610 294
948 3300005289 Ga0065704_10000696 Ga0065704_1000069610 294
949 3300005331 Ga0070670_100011500 Ga0070670_1000115002 294
950 3300005347 Ga0070668_100017328 Ga0070668_1000173282 294
951 3300005355 Ga0070671_100014900 Ga0070671_1000149005 294
952 3300005548 Ga0070665_100000878 Ga0070665_1000008788 294
953 3300005841 Ga0068863_100010052 Ga0068863_1000100523 294
954 3300005843 Ga0068860_100050953 Ga0068860_1000509532 294
955 3300005844 Ga0068862_100012903 Ga0068862_1000129033 294
956 3300009011 Ga0105251_10001607 Ga0105251_100016079 294
957 3300009177 Ga0105248_10003673 Ga0105248_100036734 294
958 3300025735 Ga0207713_1007177 Ga0207713_10071772 294
959 3300025903 Ga0207680_10315771 Ga0207680_103157711 294
960 3300025931 Ga0207644_10000766 Ga0207644_100007666 294
961 3300025941 Ga0207711_10003533 Ga0207711_100035339 294
962 3300025941 Ga0207711_10009758 Ga0207711_100097587 294
963 3300028379 Ga0268266_10001045 Ga0268266_100010455 294
964 3300028381 Ga0268264_10028441 Ga0268264_100284413 294
965 3300048919 Ga0496116_0051874 Ga0496116_0051874_1388_2377 294
966 3300048920 Ga0496117_0052166 Ga0496117_0052166_1772_2761 294
967 3300048924 Ga0496121_0005637 Ga0496121_0005637_4723_5712 294

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00701

DHDPS

Dihydrodipicolinate synthetase family

5

88

0.93

PF00701

DHDPS

Dihydrodipicolinate synthetase family

97

281

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c54-assembly2.cif.gz_G crystal structure of a novel n-acetylneuraminic acid lyase from corynebacterium glutamicum 0.8461 28 290
5c55-assembly1.cif.gz_A crystal structure of the y138f mutant of c.glutamicum n-acetylneuraminic acid lyase in complex with pyruvate 0.8331 28 290
3pb0-assembly4.cif.gz_D characterisation of the first monomeric dihydrodipicolinate synthase variant reveals evolutionary insights 0.8319 28 294
1f5z-assembly1.cif.gz_C crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form i 0.8257 24 289
5c54-assembly1.cif.gz_D crystal structure of a novel n-acetylneuraminic acid lyase from corynebacterium glutamicum 0.8236 28 290
ID Description Score Start End Superfamily
5c54C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8456 28 290 3.20.20.70
4xkyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8143 29 292 3.20.20.70
3pb2D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8015 28 294 3.20.20.70
3s5oA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7952 28 294 3.20.20.70
4ah7B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7951 27 292 3.20.20.70
ID Description Score Start End GO Terms
AF-H0FUD8-F1-model_v4 Dihydrodipicolinate synthetase 0.952 204 292
AF-A0A4S9Y1N8-F1-model_v4 Aldolase 0.9363 142 293 GO:0008840
AF-A0A0K2RB42-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase 0.936 214 294 GO:0016829
AF-A0A354Y9G7-F1-model_v4 Dihydrodipicolinate synthase family protein 0.9267 146 262 GO:0008840
AF-A0A6H9SBS6-F1-model_v4 Dihydrodipicolinate synthase family protein 0.9262 95 266 GO:0008840

Feature Viewer

pLDDT pTM Quality
81.36 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map