F486992

General Info

Members Datasets Scaffolds Average Seq Length
966 370 1932 217

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100348884|Ga0075431_1003488841
Length 233
Sequence MSDGSLISYEPSHERTATMKFYLDTASVKEIQEAASLGLLDGVTTNPSLVAKEGRVFREVLVEICNIVDGPISAEVVSIEADAMVKEGRELAKIHKNIVVKVPLIAEGLKATKRLAAEGIRVNVTLCFSPTQALLAAKAGAWCVSPFIGRLDDISSNGMELIRQIVTIYKNYDFKTYVLVASVRHPQHVVEAALAGGHICTMPFTIFQQMVKHPLTDIGLKKFLADWDAQNKK

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
5 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
6 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
7 3300003383 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM Metagenome Rhizosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
193 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
196 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
197 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
198 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
199 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
206 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
207 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
208 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
210 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
212 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
213 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
214 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
215 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
217 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
218 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
221 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
222 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
223 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
224 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
225 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
226 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
227 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
228 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
229 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
230 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
231 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
232 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
233 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
234 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
235 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
236 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
237 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
238 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
239 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
240 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
242 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
243 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
244 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
245 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
246 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
247 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
248 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
251 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
252 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
253 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
254 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
255 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
266 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
267 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
268 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
269 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
270 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
271 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
272 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
273 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
274 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
275 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
276 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
277 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
278 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
293 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
294 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
295 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
296 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
297 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
298 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
299 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
300 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
301 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
302 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
303 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
304 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
305 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
306 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
307 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
308 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
309 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
310 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
311 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
312 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
313 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
314 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
315 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
316 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
317 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
318 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
319 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
320 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
321 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
322 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
323 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
324 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
325 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
326 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
327 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
328 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
329 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
330 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
331 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
332 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
333 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
334 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
335 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
336 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
337 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
338 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
339 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
340 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
341 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
342 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
343 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
344 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
345 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
346 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
347 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
351 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
352 3300049852 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control Metagenome Rhizosphere
353 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
354 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
355 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
356 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
357 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
358 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
359 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
360 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
361 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
362 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
363 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
364 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
365 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
366 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
367 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
368 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
369 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
370 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 1.35
Rhizosphere 98.45
Stem 0
Stem Tuber 0
Unclassified 7.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100348884 3300006847 Bacteria 1488
2 JGI24737J22298_10014609 3300001990 Bacteria 2548
3 JGI24742J22300_10029204 3300002244 Bacteria 959
4 JGI26128J50194_1001488 3300003347 Bacteria 1493
5 JGI26129J50193_1003844 3300003349 Bacteria 1056
6 JGI26145J50221_1000087 3300003371 Bacteria 7040
7 JGI26145J50221_1008090 3300003371 Bacteria 900
8 JGI26140J50224_100604 3300003383 Bacteria 1456
9 Ga0055531_10005374 3300003794 Bacteria 7507
10 Ga0058862_11991263 3300004803 Unclassified 825
11 Ga0065704_10114247 3300005289 Bacteria 1895
12 Ga0065712_10337450 3300005290 Bacteria 805
13 Ga0065715_10004888 3300005293 Bacteria 4050
14 Ga0065715_10581981 3300005293 Bacteria 719
15 Ga0065707_10001145 3300005295 Bacteria 13464
16 Ga0065707_10115873 3300005295 Bacteria 2254
17 Ga0065707_10342428 3300005295 Bacteria 931
18 Ga0070658_10030961 3300005327 Bacteria 4297
19 Ga0070676_10002922 3300005328 Bacteria 8826
20 Ga0070676_10003944 3300005328 Bacteria 7788
21 Ga0070683_100068384 3300005329 Bacteria 3309
22 Ga0070690_100000100 3300005330 Bacteria 44138
23 Ga0070690_100001186 3300005330 Bacteria 13430
24 Ga0070690_100010393 3300005330 Bacteria 5417
25 Ga0070690_100058501 3300005330 Bacteria 2475
26 Ga0070690_100173330 3300005330 Bacteria 1486
27 Ga0070690_100221218 3300005330 Bacteria 1327
28 Ga0070670_100009180 3300005331 Bacteria 8454
29 Ga0070670_100033981 3300005331 Unclassified 4390
30 Ga0070670_100285523 3300005331 Bacteria 1441
31 Ga0070677_10009326 3300005333 Bacteria 3325
32 Ga0070677_10034667 3300005333 Bacteria 1951
33 Ga0068869_100008550 3300005334 Bacteria 6609
34 Ga0068869_100118127 3300005334 Bacteria 2025
35 Ga0070666_10008954 3300005335 Bacteria 6230
36 Ga0070666_10281067 3300005335 Bacteria 1183
37 Ga0070680_100000653 3300005336 Bacteria 24054
38 Ga0070680_100002913 3300005336 Bacteria 12718
39 Ga0070680_100003870 3300005336 Bacteria 11190
40 Ga0070680_100018398 3300005336 Bacteria 5519
41 Ga0070680_100040546 3300005336 Bacteria 3771
42 Ga0070680_100669322 3300005336 Unclassified 892
43 Ga0068868_100015109 3300005338 Bacteria 5703
44 Ga0068868_100034927 3300005338 Bacteria 3884
45 Ga0070660_100034994 3300005339 Bacteria 3799
46 Ga0070660_100722124 3300005339 Bacteria 836
47 Ga0070689_100000016 3300005340 Bacteria 166984
48 Ga0070689_100002667 3300005340 Bacteria 11705
49 Ga0070689_100169783 3300005340 Bacteria 1767
50 Ga0070691_10044276 3300005341 Bacteria 2110
51 Ga0070691_10067534 3300005341 Bacteria 1730
52 Ga0070687_100015875 3300005343 Bacteria 3416
53 Ga0070687_100026366 3300005343 Bacteria 2798
54 Ga0070687_100060361 3300005343 Bacteria 2000
55 Ga0070687_100368170 3300005343 Unclassified 932
56 Ga0070661_100001003 3300005344 Bacteria 20035
57 Ga0070661_100917763 3300005344 Unclassified 723
58 Ga0070692_10039347 3300005345 Bacteria 2414
59 Ga0070692_10054282 3300005345 Bacteria 2091
60 Ga0070692_10067416 3300005345 Bacteria 1899
61 Ga0070692_10126358 3300005345 Bacteria 1432
62 Ga0070668_100004413 3300005347 Bacteria 10444
63 Ga0070668_100232229 3300005347 Bacteria 1525
64 Ga0070669_100001731 3300005353 Bacteria 15754
65 Ga0070669_100369883 3300005353 Bacteria 1167
66 Ga0070675_100006040 3300005354 Bacteria 9279
67 Ga0070675_100022193 3300005354 Bacteria 5070
68 Ga0070675_100098038 3300005354 Bacteria 2465
69 Ga0070674_100004202 3300005356 Bacteria 8180
70 Ga0070674_100287990 3300005356 Bacteria 1305
71 Ga0070673_100000461 3300005364 Bacteria 21571
72 Ga0070673_100000477 3300005364 Bacteria 21292
73 Ga0070688_100000273 3300005365 Bacteria 26792
74 Ga0070688_100034967 3300005365 Bacteria 3049
75 Ga0070688_100071248 3300005365 Bacteria 2225
76 Ga0070688_100325152 3300005365 Unclassified 1119
77 Ga0070688_100391042 3300005365 Bacteria 1027
78 Ga0070659_100000535 3300005366 Bacteria 27772
79 Ga0070667_100023723 3300005367 Bacteria 5093
80 Ga0070667_100045291 3300005367 Unclassified 3698
81 Ga0070703_10014369 3300005406 Bacteria 2255
82 Ga0070703_10019067 3300005406 Bacteria 1988
83 Ga0070703_10148159 3300005406 Bacteria 879
84 Ga0070709_10003203 3300005434 Bacteria 8787
85 Ga0070709_10023904 3300005434 Bacteria 3594
86 Ga0070709_10282271 3300005434 Bacteria 1207
87 Ga0070714_100473570 3300005435 Bacteria 1192
88 Ga0070713_100114350 3300005436 Bacteria 2358
89 Ga0070701_10001910 3300005438 Bacteria 7904
90 Ga0070701_10019253 3300005438 Bacteria 3222
91 Ga0070701_10183223 3300005438 Bacteria 1227
92 Ga0070701_10270976 3300005438 Bacteria 1033
93 Ga0070711_100001610 3300005439 Bacteria 12458
94 Ga0070711_100055640 3300005439 Bacteria 2734
95 Ga0070705_100002325 3300005440 Bacteria 9592
96 Ga0070705_100011605 3300005440 Bacteria 4452
97 Ga0070705_100013692 3300005440 Bacteria 4152
98 Ga0070705_100126627 3300005440 Bacteria 1659
99 Ga0070705_100245140 3300005440 Unclassified 1254
100 Ga0070700_100000799 3300005441 Bacteria 15436
101 Ga0070700_100003999 3300005441 Bacteria 7663
102 Ga0070700_100018783 3300005441 Bacteria 3979
103 Ga0070700_100077706 3300005441 Bacteria 2135
104 Ga0070700_100148983 3300005441 Bacteria 1598
105 Ga0070700_100246563 3300005441 Bacteria 1279
106 Ga0070694_100001188 3300005444 Bacteria 14983
107 Ga0070694_100001761 3300005444 Bacteria 12795
108 Ga0070694_100002348 3300005444 Bacteria 11179
109 Ga0070694_100004254 3300005444 Bacteria 8611
110 Ga0070694_100020101 3300005444 Bacteria 4253
111 Ga0070694_100085533 3300005444 Bacteria 2202
112 Ga0070694_100108572 3300005444 Bacteria 1974
113 Ga0070694_100118354 3300005444 Bacteria 1897
114 Ga0070694_100124871 3300005444 Bacteria 1851
115 Ga0070694_100222231 3300005444 Unclassified 1417
116 Ga0070694_100308418 3300005444 Bacteria 1215
117 Ga0070708_100001385 3300005445 Bacteria 18527
118 Ga0070708_100064943 3300005445 Bacteria 3271
119 Ga0070708_100138402 3300005445 Bacteria 2257
120 Ga0070708_100244554 3300005445 Bacteria 1685
121 Ga0070708_100276281 3300005445 Bacteria 1581
122 Ga0070708_100494678 3300005445 Bacteria 1153
123 Ga0070708_100837214 3300005445 Unclassified 864
124 Ga0070708_101020652 3300005445 Bacteria 775
125 Ga0070663_100134806 3300005455 Bacteria 1879
126 Ga0070663_100250074 3300005455 Bacteria 1403
127 Ga0070678_100000415 3300005456 Bacteria 20151
128 Ga0070678_100014179 3300005456 Bacteria 5020
129 Ga0070662_100002500 3300005457 Bacteria 11332
130 Ga0070662_100009580 3300005457 Bacteria 6337
131 Ga0070681_10021313 3300005458 Bacteria 6496
132 Ga0070681_10040125 3300005458 Bacteria 4693
133 Ga0070681_10170869 3300005458 Unclassified 2096
134 Ga0070681_10969255 3300005458 Bacteria 770
135 Ga0068867_100000792 3300005459 Bacteria 21391
136 Ga0068867_100027904 3300005459 Bacteria 4061
137 Ga0068867_100159317 3300005459 Bacteria 1779
138 Ga0070685_10000123 3300005466 Bacteria 49387
139 Ga0070685_10064885 3300005466 Unclassified 2148
140 Ga0070706_100000948 3300005467 Bacteria 31671
141 Ga0070706_100004936 3300005467 Bacteria 12768
142 Ga0070706_100035776 3300005467 Bacteria 4585
143 Ga0070706_100044050 3300005467 Bacteria 4123
144 Ga0070706_100051830 3300005467 Bacteria 3788
145 Ga0070706_100295778 3300005467 Bacteria 1511
146 Ga0070706_100340377 3300005467 Bacteria 1398
147 Ga0070706_100404558 3300005467 Bacteria 1271
148 Ga0070706_100411235 3300005467 Bacteria 1259
149 Ga0070707_100002183 3300005468 Bacteria 18712
150 Ga0070707_100011168 3300005468 Bacteria 8369
151 Ga0070707_100030526 3300005468 Bacteria 5132
152 Ga0070707_100063801 3300005468 Bacteria 3535
153 Ga0070707_100102719 3300005468 Bacteria 2770
154 Ga0070707_100140995 3300005468 Bacteria 2346
155 Ga0070707_100175240 3300005468 Bacteria 2090
156 Ga0070707_100245065 3300005468 Bacteria 1744
157 Ga0070707_100361345 3300005468 Bacteria 1410
158 Ga0070707_100639417 3300005468 Unclassified 1026
159 Ga0070698_100008214 3300005471 Bacteria 11291
160 Ga0070698_100037367 3300005471 Bacteria 5007
161 Ga0070698_100056757 3300005471 Bacteria 3966
162 Ga0070698_100064228 3300005471 Bacteria 3699
163 Ga0070698_100120937 3300005471 Unclassified 2579
164 Ga0070698_100157134 3300005471 Bacteria 2219
165 Ga0070698_100627142 3300005471 Bacteria 1016
166 Ga0070699_100001496 3300005518 Bacteria 21415
167 Ga0070699_100005185 3300005518 Bacteria 11462
168 Ga0070699_100007719 3300005518 Bacteria 9352
169 Ga0070699_100035138 3300005518 Bacteria 4332
170 Ga0070699_100040928 3300005518 Bacteria 4011
171 Ga0070699_100074719 3300005518 Unclassified 2949
172 Ga0070699_100081302 3300005518 Bacteria 2824
173 Ga0070699_100116273 3300005518 Bacteria 2350
174 Ga0070699_100124923 3300005518 Bacteria 2264
175 Ga0070699_100162626 3300005518 Bacteria 1976
176 Ga0070699_100206036 3300005518 Bacteria 1750
177 Ga0070699_100287056 3300005518 Bacteria 1474
178 Ga0070699_100310086 3300005518 Bacteria 1417
179 Ga0070679_100072693 3300005530 Bacteria 3431
180 Ga0070679_100112522 3300005530 Bacteria 2708
181 Ga0070697_100002194 3300005536 Bacteria 14985
182 Ga0070697_100004967 3300005536 Bacteria 10212
183 Ga0070697_100006308 3300005536 Bacteria 9176
184 Ga0070697_100008240 3300005536 Bacteria 8133
185 Ga0070697_100010254 3300005536 Bacteria 7301
186 Ga0070697_100043274 3300005536 Bacteria 3645
187 Ga0070697_100045548 3300005536 Bacteria 3555
188 Ga0070697_100045863 3300005536 Bacteria 3543
189 Ga0070697_100059201 3300005536 Bacteria 3118
190 Ga0070697_100072170 3300005536 Bacteria 2833
191 Ga0070697_100073452 3300005536 Bacteria 2808
192 Ga0070697_100079278 3300005536 Bacteria 2703
193 Ga0070697_100123756 3300005536 Bacteria 2165
194 Ga0070697_100149281 3300005536 Bacteria 1970
195 Ga0070697_100168311 3300005536 Bacteria 1854
196 Ga0070697_100367470 3300005536 Bacteria 1244
197 Ga0070697_100974661 3300005536 Bacteria 753
198 Ga0070672_100002646 3300005543 Bacteria 11443
199 Ga0070672_100002752 3300005543 Bacteria 11261
200 Ga0070672_100173085 3300005543 Unclassified 1796
201 Ga0070686_100000027 3300005544 Bacteria 123854
202 Ga0070686_100002437 3300005544 Bacteria 10251
203 Ga0070686_100008895 3300005544 Bacteria 5631
204 Ga0070686_100011744 3300005544 Bacteria 4975
205 Ga0070686_100028545 3300005544 Bacteria 3385
206 Ga0070686_100029120 3300005544 Bacteria 3355
207 Ga0070695_100005391 3300005545 Bacteria 7528
208 Ga0070695_100007293 3300005545 Bacteria 6554
209 Ga0070695_100007521 3300005545 Bacteria 6454
210 Ga0070695_100007931 3300005545 Bacteria 6286
211 Ga0070695_100015355 3300005545 Bacteria 4624
212 Ga0070695_100040736 3300005545 Unclassified 2942
213 Ga0070695_100050528 3300005545 Bacteria 2664
214 Ga0070695_100056300 3300005545 Bacteria 2537
215 Ga0070695_100149261 3300005545 Unclassified 1629
216 Ga0070696_100002253 3300005546 Bacteria 12716
217 Ga0070696_100015046 3300005546 Bacteria 5193
218 Ga0070696_100079335 3300005546 Bacteria 2323
219 Ga0070696_100094972 3300005546 Bacteria 2128
220 Ga0070696_100096584 3300005546 Bacteria 2112
221 Ga0070696_100098799 3300005546 Bacteria 2088
222 Ga0070696_100143756 3300005546 Bacteria 1746
223 Ga0070696_100155049 3300005546 Bacteria 1684
224 Ga0070696_100211599 3300005546 Bacteria 1451
225 Ga0070665_100027188 3300005548 Bacteria 5762
226 Ga0070665_100144192 3300005548 Bacteria 2385
227 Ga0070665_100262273 3300005548 Unclassified 1729
228 Ga0070704_100000137 3300005549 Bacteria 27322
229 Ga0070704_100003591 3300005549 Bacteria 8917
230 Ga0070704_100003810 3300005549 Bacteria 8683
231 Ga0070704_100035040 3300005549 Bacteria 3409
232 Ga0070704_100045155 3300005549 Bacteria 3064
233 Ga0070704_100056136 3300005549 Bacteria 2795
234 Ga0070704_100217962 3300005549 Bacteria 1550
235 Ga0070704_100265187 3300005549 Bacteria 1417
236 Ga0070704_100504922 3300005549 Bacteria 1050
237 Ga0068855_100165462 3300005563 Bacteria 2508
238 Ga0070664_100001975 3300005564 Bacteria 16434
239 Ga0070664_100002822 3300005564 Bacteria 14057
240 Ga0070664_100021921 3300005564 Bacteria 5267
241 Ga0068857_100078653 3300005577 Bacteria 2943
242 Ga0070702_100004120 3300005615 Bacteria 6602
243 Ga0070702_100034393 3300005615 Bacteria 2793
244 Ga0070702_100046197 3300005615 Bacteria 2467
245 Ga0070702_100274240 3300005615 Unclassified 1155
246 Ga0068859_100000617 3300005617 Bacteria 35639
247 Ga0068859_100154628 3300005617 Bacteria 2370
248 Ga0068859_100316661 3300005617 Bacteria 1654
249 Ga0068859_100682062 3300005617 Bacteria 1119
250 Ga0068859_100984253 3300005617 Bacteria 926
251 Ga0068864_101110834 3300005618 Bacteria 787
252 Ga0068866_10005130 3300005718 Bacteria 5397
253 Ga0068866_10028475 3300005718 Unclassified 2662
254 Ga0068866_10296103 3300005718 Bacteria 1008
255 Ga0068861_100194504 3300005719 Unclassified 1698
256 Ga0068861_100203165 3300005719 Bacteria 1665
257 Ga0068851_10085389 3300005834 Bacteria 1654
258 Ga0068870_10003331 3300005840 Bacteria 6793
259 Ga0068860_100060177 3300005843 Bacteria 3610
260 Ga0068860_100073324 3300005843 Unclassified 3254
261 Ga0068860_100512804 3300005843 Bacteria 1198
262 Ga0068862_100004652 3300005844 Bacteria 11562
263 Ga0068862_100260854 3300005844 Bacteria 1582
264 Ga0068862_100841947 3300005844 Bacteria 898
265 Ga0081455_10000641 3300005937 Bacteria 45309
266 Ga0081455_10038374 3300005937 Bacteria 4242
267 Ga0075432_10000245 3300006058 Bacteria 14714
268 Ga0070715_10117859 3300006163 Unclassified 1262
269 Ga0097621_100021651 3300006237 Bacteria 4978
270 Ga0097621_100046089 3300006237 Unclassified 3525
271 Ga0097621_100070403 3300006237 Bacteria 2888
272 Ga0068871_100005813 3300006358 Bacteria 8666
273 Ga0068871_100006995 3300006358 Bacteria 8041
274 Ga0068871_100010170 3300006358 Bacteria 6852
275 Ga0068871_100072998 3300006358 Bacteria 2828
276 Ga0075428_100077642 3300006844 Bacteria 3625
277 Ga0075428_100088475 3300006844 Bacteria 3378
278 Ga0075428_100138276 3300006844 Bacteria 2648
279 Ga0075428_100155387 3300006844 Bacteria 2485
280 Ga0075428_100168349 3300006844 Unclassified 2377
281 Ga0075430_100000957 3300006846 Bacteria 22751
282 Ga0075430_100000988 3300006846 Bacteria 22431
283 Ga0075430_100002015 3300006846 Bacteria 16741
284 Ga0075430_100010142 3300006846 Bacteria 7974
285 Ga0075431_100007759 3300006847 Bacteria 10689
286 Ga0075431_100045855 3300006847 Bacteria 4506
287 Ga0075431_100103063 3300006847 Bacteria 2945
288 Ga0075431_100497930 3300006847 Bacteria 1210
289 Ga0075431_100547142 3300006847 Bacteria 1145
290 Ga0075433_10000986 3300006852 Bacteria 20243
291 Ga0075433_10003058 3300006852 Bacteria 12853
292 Ga0075433_10022516 3300006852 Bacteria 5288
293 Ga0075433_10029452 3300006852 Bacteria 4678
294 Ga0075433_10078023 3300006852 Bacteria 2918
295 Ga0075433_10105393 3300006852 Bacteria 2498
296 Ga0075433_10333006 3300006852 Bacteria 1342
297 Ga0075433_10359643 3300006852 Bacteria 1286
298 Ga0075433_10460532 3300006852 Unclassified 1121
299 Ga0075433_10558003 3300006852 Unclassified 1006
300 Ga0075433_10926962 3300006852 Bacteria 759
301 Ga0075434_100000664 3300006871 Bacteria 26666
302 Ga0075434_100000723 3300006871 Bacteria 25875
303 Ga0075434_100013775 3300006871 Bacteria 7710
304 Ga0075434_100029308 3300006871 Bacteria 5413
305 Ga0075434_100092346 3300006871 Bacteria 3029
306 Ga0075434_100102177 3300006871 Bacteria 2874
307 Ga0075434_100209900 3300006871 Bacteria 1967
308 Ga0075434_100372232 3300006871 Bacteria 1449
309 Ga0075434_101026319 3300006871 Unclassified 838
310 Ga0075434_101057016 3300006871 Bacteria 825
311 Ga0075429_100001860 3300006880 Bacteria 17478
312 Ga0075429_100005575 3300006880 Bacteria 10847
313 Ga0075429_100055028 3300006880 Bacteria 3462
314 Ga0075429_100193793 3300006880 Bacteria 1780
315 Ga0075429_100225776 3300006880 Bacteria 1640
316 Ga0075429_100636901 3300006880 Bacteria 934
317 Ga0068865_100000068 3300006881 Bacteria 54053
318 Ga0068865_100048208 3300006881 Unclassified 2931
319 Ga0068865_100119277 3300006881 Bacteria 1958
320 Ga0075436_100003988 3300006914 Bacteria 10122
321 Ga0075436_100005627 3300006914 Bacteria 8600
322 Ga0075436_100020968 3300006914 Bacteria 4482
323 Ga0075436_100032712 3300006914 Bacteria 3584
324 Ga0075436_100038436 3300006914 Bacteria 3303
325 Ga0075436_100058561 3300006914 Bacteria 2660
326 Ga0075436_100064306 3300006914 Bacteria 2535
327 Ga0097620_100000617 3300006931 Bacteria 35639
328 Ga0097620_100154620 3300006931 Bacteria 2370
329 Ga0097620_100316668 3300006931 Bacteria 1654
330 Ga0097620_100681992 3300006931 Bacteria 1119
331 Ga0097620_100984220 3300006931 Bacteria 926
332 Ga0075435_100009474 3300007076 Bacteria 7054
333 Ga0075435_100038950 3300007076 Bacteria 3792
334 Ga0075435_100097772 3300007076 Bacteria 2429
335 Ga0075435_100107767 3300007076 Bacteria 2314
336 Ga0075435_100140467 3300007076 Bacteria 2026
337 Ga0075435_100350373 3300007076 Bacteria 1266
338 Ga0099794_10000360 3300007265 Bacteria 15649
339 Ga0099794_10047748 3300007265 Bacteria 2053
340 Ga0099794_10082972 3300007265 Bacteria 1583
341 Ga0099794_10147449 3300007265 Bacteria 1194
342 Ga0111539_10000444 3300009094 Bacteria 52248
343 Ga0111539_10077068 3300009094 Bacteria 3925
344 Ga0111539_10129384 3300009094 Bacteria 2956
345 Ga0111539_10845931 3300009094 Bacteria 1064
346 Ga0105245_10007385 3300009098 Bacteria 9623
347 Ga0105245_10394731 3300009098 Bacteria 1381
348 Ga0105245_10800627 3300009098 Bacteria 980
349 Ga0114129_10001982 3300009147 Bacteria 28013
350 Ga0114129_10010841 3300009147 Bacteria 12986
351 Ga0114129_10076314 3300009147 Bacteria 4666
352 Ga0114129_10133235 3300009147 Unclassified 3412
353 Ga0114129_10367401 3300009147 Unclassified 1903
354 Ga0114129_10766486 3300009147 Bacteria 1234
355 Ga0114129_10858097 3300009147 Bacteria 1154
356 Ga0105242_10001189 3300009176 Bacteria 20522
357 Ga0105242_10013235 3300009176 Bacteria 6370
358 Ga0105242_10368731 3300009176 Bacteria 1331
359 Ga0105248_10000484 3300009177 Bacteria 45397
360 Ga0105249_10769600 3300009553 Bacteria 1025
361 Ga0105239_10004228 3300010375 Bacteria 17243
362 Ga0105246_10013063 3300011119 Bacteria 5196
363 Ga0105246_10455679 3300011119 Bacteria 1076
364 Ga0105246_10476300 3300011119 Bacteria 1055
365 Ga0157373_10416943 3300013100 Bacteria 964
366 Ga0157371_10043824 3300013102 Bacteria 3186
367 Ga0157370_10110908 3300013104 Bacteria 2564
368 Ga0157369_10065897 3300013105 Bacteria 3898
369 Ga0157374_10082700 3300013296 Bacteria 3049
370 Ga0157374_10096894 3300013296 Bacteria 2822
371 Ga0157374_10827315 3300013296 Bacteria 942
372 Ga0157378_10001289 3300013297 Bacteria 22567
373 Ga0157378_10038956 3300013297 Bacteria 4214
374 Ga0157378_10070501 3300013297 Bacteria 3138
375 Ga0157378_10088500 3300013297 Bacteria 2810
376 Ga0157378_10443695 3300013297 Bacteria 1287
377 Ga0157378_10467259 3300013297 Bacteria 1255
378 Ga0157378_10558291 3300013297 Bacteria 1151
379 Ga0163162_10071990 3300013306 Bacteria 3511
380 Ga0163162_10348618 3300013306 Bacteria 1613
381 Ga0157372_10217354 3300013307 Bacteria 2215
382 Ga0157375_10002356 3300013308 Bacteria 16328
383 Ga0157375_10058868 3300013308 Bacteria 3803
384 Ga0157375_10110759 3300013308 Bacteria 2843
385 Ga0157375_10220233 3300013308 Unclassified 2056
386 Ga0157375_10578800 3300013308 Bacteria 1283
387 Ga0157380_10003727 3300014326 Bacteria 10482
388 Ga0182008_10371832 3300014497 Bacteria 762
389 Ga0157377_10000988 3300014745 Bacteria 11973
390 Ga0157376_10000457 3300014969 Bacteria 26365
391 Ga0157376_10000495 3300014969 Bacteria 25493
392 Ga0157376_10031303 3300014969 Unclassified 4258
393 Ga0157376_10438587 3300014969 Bacteria 1271
394 Ga0206355_1232426 3300020076 Bacteria 776
395 Ga0207656_10176109 3300025321 Bacteria 1024
396 Ga0207653_10000037 3300025885 Bacteria 99765
397 Ga0207653_10010147 3300025885 Bacteria 2937
398 Ga0207653_10013327 3300025885 Bacteria 2574
399 Ga0207653_10056741 3300025885 Bacteria 1314
400 Ga0207682_10007150 3300025893 Bacteria 4466
401 Ga0207682_10119923 3300025893 Bacteria 1166
402 Ga0207642_10024563 3300025899 Unclassified 2424
403 Ga0207642_10050553 3300025899 Bacteria 1876
404 Ga0207642_10088968 3300025899 Bacteria 1520
405 Ga0207688_10002114 3300025901 Bacteria 10689
406 Ga0207680_10003802 3300025903 Bacteria 7112
407 Ga0207680_10025591 3300025903 Bacteria 3257
408 Ga0207680_10165699 3300025903 Bacteria 1485
409 Ga0207647_10109277 3300025904 Bacteria 1635
410 Ga0207699_10009891 3300025906 Bacteria 4766
411 Ga0207699_10059223 3300025906 Bacteria 2294
412 Ga0207699_10146328 3300025906 Bacteria 1558
413 Ga0207645_10000032 3300025907 Bacteria 92521
414 Ga0207643_10002698 3300025908 Bacteria 9592
415 Ga0207705_10026332 3300025909 Bacteria 4148
416 Ga0207684_10000493 3300025910 Bacteria 50013
417 Ga0207684_10000543 3300025910 Bacteria 46477
418 Ga0207684_10006827 3300025910 Bacteria 10345
419 Ga0207684_10079507 3300025910 Bacteria 2789
420 Ga0207684_10094440 3300025910 Bacteria 2551
421 Ga0207684_10175564 3300025910 Bacteria 1847
422 Ga0207684_10267267 3300025910 Bacteria 1476
423 Ga0207684_10268838 3300025910 Bacteria 1471
424 Ga0207684_10375265 3300025910 Bacteria 1223
425 Ga0207684_10457633 3300025910 Bacteria 1095
426 Ga0207684_10551929 3300025910 Bacteria 986
427 Ga0207654_10028962 3300025911 Bacteria 3025
428 Ga0207707_10032027 3300025912 Bacteria 4603
429 Ga0207707_10044286 3300025912 Bacteria 3880
430 Ga0207707_10060590 3300025912 Bacteria 3292
431 Ga0207707_10067641 3300025912 Bacteria 3112
432 Ga0207707_10135569 3300025912 Unclassified 2152
433 Ga0207663_10000535 3300025916 Bacteria 16692
434 Ga0207663_10241565 3300025916 Bacteria 1325
435 Ga0207660_10003766 3300025917 Bacteria 9878
436 Ga0207660_10008510 3300025917 Bacteria 6637
437 Ga0207660_10039661 3300025917 Bacteria 3293
438 Ga0207660_10061409 3300025917 Bacteria 2704
439 Ga0207660_10172121 3300025917 Bacteria 1677
440 Ga0207662_10012300 3300025918 Bacteria 4763
441 Ga0207662_10015253 3300025918 Bacteria 4323
442 Ga0207662_10035874 3300025918 Bacteria 2897
443 Ga0207657_10016849 3300025919 Bacteria 7034
444 Ga0207657_10701127 3300025919 Bacteria 786
445 Ga0207649_10114792 3300025920 Bacteria 1805
446 Ga0207649_10135619 3300025920 Bacteria 1678
447 Ga0207652_10048019 3300025921 Unclassified 3647
448 Ga0207652_10184653 3300025921 Bacteria 1875
449 Ga0207652_10422327 3300025921 Bacteria 1202
450 Ga0207646_10000026 3300025922 Bacteria 235945
451 Ga0207646_10000623 3300025922 Bacteria 46113
452 Ga0207646_10005326 3300025922 Bacteria 13561
453 Ga0207646_10007444 3300025922 Bacteria 11127
454 Ga0207646_10042576 3300025922 Bacteria 4079
455 Ga0207646_10044187 3300025922 Bacteria 3999
456 Ga0207646_10069437 3300025922 Bacteria 3147
457 Ga0207646_10092901 3300025922 Bacteria 2701
458 Ga0207646_10103791 3300025922 Bacteria 2550
459 Ga0207646_10132996 3300025922 Bacteria 2239
460 Ga0207681_10023296 3300025923 Bacteria 3958
461 Ga0207650_10020670 3300025925 Unclassified 4645
462 Ga0207650_10029451 3300025925 Bacteria 3947
463 Ga0207659_10025283 3300025926 Bacteria 3988
464 Ga0207659_10035200 3300025926 Bacteria 3459
465 Ga0207659_10123020 3300025926 Bacteria 1991
466 Ga0207687_10034611 3300025927 Bacteria 3430
467 Ga0207687_10347716 3300025927 Bacteria 1207
468 Ga0207687_10517694 3300025927 Bacteria 997
469 Ga0207700_10125777 3300025928 Bacteria 2086
470 Ga0207664_10408179 3300025929 Bacteria 1209
471 Ga0207690_10015616 3300025932 Bacteria 4605
472 Ga0207690_10882895 3300025932 Bacteria 741
473 Ga0207706_10000100 3300025933 Bacteria 90861
474 Ga0207706_10115055 3300025933 Bacteria 2365
475 Ga0207686_10014916 3300025934 Bacteria 4337
476 Ga0207686_10115794 3300025934 Unclassified 1816
477 Ga0207670_10000028 3300025936 Bacteria 127019
478 Ga0207670_10026355 3300025936 Bacteria 3661
479 Ga0207670_10446161 3300025936 Bacteria 1042
480 Ga0207669_10009577 3300025937 Bacteria 4624
481 Ga0207669_10010327 3300025937 Bacteria 4490
482 Ga0207669_10053646 3300025937 Bacteria 2430
483 Ga0207669_10545692 3300025937 Bacteria 935
484 Ga0207704_10008594 3300025938 Bacteria 4891
485 Ga0207704_10029209 3300025938 Unclassified 3070
486 Ga0207704_10039161 3300025938 Unclassified 2757
487 Ga0207665_10059144 3300025939 Bacteria 2593
488 Ga0207691_10000019 3300025940 Bacteria 133680
489 Ga0207691_10000159 3300025940 Bacteria 63202
490 Ga0207691_10168498 3300025940 Unclassified 1918
491 Ga0207711_10002860 3300025941 Bacteria 15132
492 Ga0207689_10021641 3300025942 Bacteria 5407
493 Ga0207689_10076555 3300025942 Bacteria 2750
494 Ga0207689_10165113 3300025942 Bacteria 1824
495 Ga0207661_10026724 3300025944 Bacteria 4402
496 Ga0207679_10002651 3300025945 Bacteria 11044
497 Ga0207679_10142693 3300025945 Bacteria 1938
498 Ga0207651_10007732 3300025960 Bacteria 5744
499 Ga0207651_10016811 3300025960 Bacteria 4300
500 Ga0207651_10029943 3300025960 Bacteria 3458
501 Ga0207712_10578783 3300025961 Bacteria 969
502 Ga0207668_10176507 3300025972 Bacteria 1681
503 Ga0207668_10227226 3300025972 Bacteria 1502
504 Ga0207658_10029235 3300025986 Bacteria 3890
505 Ga0207658_10167535 3300025986 Bacteria 1806
506 Ga0207658_10446237 3300025986 Bacteria 1145
507 Ga0207677_10027069 3300026023 Bacteria 3605
508 Ga0207677_10189209 3300026023 Bacteria 1626
509 Ga0207703_10334140 3300026035 Bacteria 1391
510 Ga0207703_10397122 3300026035 Bacteria 1279
511 Ga0207678_10241519 3300026067 Bacteria 1547
512 Ga0207708_10000039 3300026075 Bacteria 133321
513 Ga0207708_10003785 3300026075 Bacteria 11154
514 Ga0207708_10034608 3300026075 Bacteria 3842
515 Ga0207702_10722769 3300026078 Bacteria 982
516 Ga0207648_10000034 3300026089 Bacteria 125133
517 Ga0207648_10009231 3300026089 Bacteria 9474
518 Ga0207648_10142792 3300026089 Bacteria 2111
519 Ga0207674_10374982 3300026116 Bacteria 1375
520 Ga0207675_100065253 3300026118 Unclassified 3403
521 Ga0207675_100148973 3300026118 Bacteria 2226
522 Ga0207683_10000013 3300026121 Bacteria 133581
523 Ga0207683_10000443 3300026121 Bacteria 38316
524 Ga0209973_1000091 3300027252 Bacteria 5059
525 Ga0209969_1000069 3300027360 Bacteria 12329
526 Ga0209967_1008030 3300027364 Bacteria 1447
527 Ga0209981_1003896 3300027378 Bacteria 1944
528 Ga0209996_1000112 3300027395 Bacteria 10424
529 Ga0209984_1003549 3300027424 Bacteria 1791
530 Ga0210000_1000504 3300027462 Bacteria 5320
531 Ga0209995_1040904 3300027471 Bacteria 782
532 Ga0209968_1000044 3300027526 Bacteria 22976
533 Ga0209968_1042938 3300027526 Bacteria 775
534 Ga0209999_1000018 3300027543 Bacteria 16536
535 Ga0209999_1027864 3300027543 Bacteria 1047
536 Ga0209982_1000543 3300027552 Bacteria 4699
537 Ga0209982_1019941 3300027552 Bacteria 1028
538 Ga0209970_1000001 3300027614 Bacteria 43796
539 Ga0210002_1000090 3300027617 Bacteria 14204
540 Ga0209983_1001454 3300027665 Bacteria 5262
541 Ga0209588_1000966 3300027671 Bacteria 7367
542 Ga0209588_1001546 3300027671 Bacteria 6052
543 Ga0209588_1044639 3300027671 Bacteria 1433
544 Ga0209588_1054529 3300027671 Bacteria 1293
545 Ga0209971_1000202 3300027682 Bacteria 17841
546 Ga0209966_1000140 3300027695 Bacteria 30460
547 Ga0209966_1007234 3300027695 Bacteria 1941
548 Ga0209998_10000011 3300027717 Bacteria 94915
549 Ga0209998_10005997 3300027717 Bacteria 2529
550 Ga0209998_10021750 3300027717 Bacteria 1379
551 Ga0209974_10000116 3300027876 Bacteria 23211
552 Ga0209974_10004733 3300027876 Bacteria 4832
553 Ga0209974_10024331 3300027876 Bacteria 2004
554 Ga0207428_10001059 3300027907 Bacteria 30205
555 Ga0207428_10001209 3300027907 Bacteria 27696
556 Ga0268266_10043417 3300028379 Unclassified 3842
557 Ga0268266_10190702 3300028379 Bacteria 1871
558 Ga0268266_10272421 3300028379 Unclassified 1572
559 Ga0268265_10299409 3300028380 Bacteria 1447
560 Ga0268265_10643835 3300028380 Bacteria 1018
561 Ga0268264_10048345 3300028381 Bacteria 3539
562 Ga0268264_10067306 3300028381 Unclassified 3023
563 Ga0265338_10026368 3300028800 Bacteria 5864
564 Ga0307408_100046417 3300031548 Unclassified 3107
565 Ga0316575_10012397 3300031665 Bacteria 3171
566 Ga0316579_10001020 3300031691 Bacteria 9862
567 Ga0307405_10034022 3300031731 Bacteria 3028
568 Ga0307405_10106565 3300031731 Unclassified 1891
569 Ga0316577_10000381 3300031733 Bacteria 16848
570 Ga0307413_10552206 3300031824 Bacteria 934
571 Ga0307410_10103690 3300031852 Bacteria 2043
572 Ga0307406_10007686 3300031901 Bacteria 5986
573 Ga0307407_10016659 3300031903 Unclassified 3664
574 Ga0307409_100082474 3300031995 Bacteria 2603
575 Ga0307409_100230653 3300031995 Bacteria 1678
576 Ga0307416_100462887 3300032002 Bacteria 1324
577 Ga0307416_100464527 3300032002 Bacteria 1322
578 Ga0307414_10404156 3300032004 Bacteria 1187
579 Ga0307411_10020662 3300032005 Unclassified 3835
580 Ga0307415_100000643 3300032126 Bacteria 15343
581 Ga0307415_100321230 3300032126 Bacteria 1291
582 Ga0373950_0006121 3300034818 Bacteria 1824
583 Ga0373940_0028070 3300035088 Bacteria 1483
584 Ga0373952_0031418 3300035092 Bacteria 1181
585 Ga0373923_0128773 3300035111 Bacteria 1136
586 Ga0373923_0200820 3300035111 Bacteria 922
587 Ga0373932_0116954 3300035112 Unclassified 885
588 Ga0373936_0080439 3300035113 Bacteria 1356
589 Ga0373945_0025756 3300035116 Bacteria 2046
590 Ga0373960_0010502 3300035121 Bacteria 2264
591 Ga0373960_0117165 3300035121 Unclassified 880
592 Ga0373961_0043128 3300035241 Bacteria 1311
593 Ga0373962_0151221 3300035242 Bacteria 760
594 Ga0373924_0111413 3300035410 Bacteria 1183
595 Ga0373931_0070268 3300035691 Unclassified 1910
596 Ga0373931_0343766 3300035691 Bacteria 932
597 Ga0373935_0122033 3300035692 Bacteria 1742
598 Ga0316582_0054343 3300036647 Bacteria 2549
599 Ga0373925_0139932 3300037068 Bacteria 1893
600 Ga0316581_0006706 3300037588 Bacteria 3060
601 Ga0439436_0138151 3300041404 Bacteria 685
602 Ga0439438_022984 3300041405 Bacteria 1724
603 Ga0439447_023531 3300041407 Bacteria 1604
604 Ga0439465_0171302 3300041413 Bacteria 782
605 Ga0439441_004819 3300042001 Bacteria 2065
606 Ga0439448_0165406 3300042005 Bacteria 771
607 Ga0439432_052028 3300042006 Bacteria 1275
608 Ga0439452_007957 3300042010 Bacteria 3212
609 Ga0439463_041286 3300042016 Unclassified 1173
610 Ga0450890_010986 3300042127 Bacteria 1167
611 Ga0439446_0052554 3300042156 Bacteria 1219
612 Ga0439435_0122288 3300042436 Bacteria 816
613 Ga0439459_0081438 3300042438 Bacteria 765
614 Ga0439464_0062397 3300042439 Bacteria 1093
615 Ga0439460_0056193 3300042461 Bacteria 1192
616 Ga0451577_0231860 3300042876 Bacteria 1670
617 Ga0451577_0356835 3300042876 Bacteria 1326
618 Ga0451577_0448547 3300042876 Bacteria 1172
619 Ga0439440_0082533 3300042993 Bacteria 852
620 Ga0453683_0044292 3300044673 Bacteria 2792
621 Ga0453683_0121976 3300044673 Bacteria 1641
622 Ga0453683_0219468 3300044673 Bacteria 1209
623 Ga0453683_0241480 3300044673 Bacteria 1151
624 Ga0453683_0667319 3300044673 Bacteria 680
625 Ga0453684_0292402 3300044712 Bacteria 1855
626 Ga0451576_0003872 3300045051 Bacteria 20072
627 Ga0451576_0006244 3300045051 Bacteria 14669
628 Ga0451576_0008185 3300045051 Bacteria 12311
629 Ga0451576_0008187 3300045051 Bacteria 12310
630 Ga0451576_0015092 3300045051 Bacteria 8578
631 Ga0451576_0029905 3300045051 Bacteria 5826
632 Ga0451576_0059444 3300045051 Bacteria 3989
633 Ga0451576_0410115 3300045051 Bacteria 1421
634 Ga0451576_0460369 3300045051 Bacteria 1335
635 Ga0451576_0680860 3300045051 Bacteria 1080
636 Ga0451576_0875643 3300045051 Bacteria 943
637 Ga0466967_0032496 3300045976 Bacteria 4407
638 Ga0495653_0257025 3300046463 Bacteria 1157
639 Ga0495594_0021390 3300046499 Bacteria 3452
640 Ga0495630_0348052 3300046517 Bacteria 1134
641 Ga0495587_0068619 3300046536 Unclassified 2065
642 Ga0495621_0059493 3300046539 Unclassified 1384
643 Ga0495635_0055075 3300046663 Bacteria 2740
644 Ga0495657_0009130 3300046675 Bacteria 7534
645 Ga0495658_0095269 3300046683 Bacteria 1769
646 Ga0495624_0186625 3300046690 Bacteria 1262
647 Ga0495636_0033138 3300047318 Bacteria 2121
648 Ga0495676_0124199 3300047321 Bacteria 1873
649 Ga0495680_0048780 3300047322 Bacteria 3323
650 Ga0495677_0080256 3300047445 Unclassified 1222
651 Ga0496100_0099428 3300048903 Bacteria 2002
652 Ga0496100_0163370 3300048903 Bacteria 1598
653 Ga0496102_0102416 3300048905 Bacteria 2662
654 Ga0496104_0077361 3300048907 Unclassified 3170
655 Ga0496105_0123221 3300048908 Bacteria 2137
656 Ga0496106_0091273 3300048909 Bacteria 2352
657 Ga0496108_0139879 3300048911 Bacteria 2085
658 Ga0496109_0018971 3300048912 Bacteria 6056
659 Ga0496110_0001331 3300048913 Bacteria 17745
660 Ga0496110_0676986 3300048913 Bacteria 932
661 Ga0496112_0966913 3300048915 Bacteria 772
662 Ga0496112_1031308 3300048915 Bacteria 742
663 Ga0496114_0006772 3300048917 Bacteria 9027
664 Ga0501290_000029 3300049513 Bacteria 19188
665 Ga0501291_000104 3300049514 Bacteria 10084
666 Ga0501292_000095 3300049515 Bacteria 15706
667 Ga0501293_000228 3300049516 Bacteria 4106
668 Ga0501294_001196 3300049517 Unclassified 2686
669 Ga0501295_000023 3300049518 Bacteria 16232
670 Ga0501296_000064 3300049519 Bacteria 12106
671 Ga0501297_000024 3300049520 Bacteria 15025
672 Ga0501298_000007 3300049521 Bacteria 20655
673 Ga0501299_000013 3300049522 Bacteria 24673
674 Ga0501299_064901 3300049522 Unclassified 781
675 Ga0501300_000010 3300049523 Bacteria 30371
676 Ga0501302_000184 3300049525 Unclassified 3231
677 Ga0501303_000146 3300049526 Bacteria 6132
678 Ga0501031_0000384 3300049568 Bacteria 25955
679 Ga0501031_0038185 3300049568 Bacteria 3134
680 Ga0501031_0165959 3300049568 Bacteria 1443
681 Ga0501031_0430837 3300049568 Bacteria 852
682 Ga0501032_0032449 3300049569 Bacteria 3579
683 Ga0501032_0191840 3300049569 Bacteria 1335
684 Ga0501033_0005781 3300049570 Bacteria 9735
685 Ga0501034_0115950 3300049571 Bacteria 2667
686 Ga0501036_0029394 3300049572 Bacteria 4643
687 Ga0501036_0030568 3300049572 Bacteria 4548
688 Ga0501036_0037253 3300049572 Bacteria 4115
689 Ga0501036_0062323 3300049572 Bacteria 3159
690 Ga0501036_0099916 3300049572 Bacteria 2454
691 Ga0501036_0119932 3300049572 Bacteria 2221
692 Ga0501036_0275097 3300049572 Bacteria 1410
693 Ga0501036_0775263 3300049572 Bacteria 790
694 Ga0501037_0003492 3300049573 Bacteria 11412
695 Ga0501037_0014299 3300049573 Bacteria 5849
696 Ga0501037_0083648 3300049573 Bacteria 2312
697 Ga0501038_0001104 3300049574 Bacteria 24446
698 Ga0501038_0008928 3300049574 Bacteria 9196
699 Ga0501038_0011350 3300049574 Bacteria 8132
700 Ga0501038_0013211 3300049574 Bacteria 7531
701 Ga0501038_0021463 3300049574 Bacteria 5795
702 Ga0501038_0272807 3300049574 Bacteria 1333
703 Ga0501039_0002270 3300049575 Bacteria 14261
704 Ga0501039_0015960 3300049575 Bacteria 5750
705 Ga0501039_0016599 3300049575 Bacteria 5640
706 Ga0501039_0120558 3300049575 Bacteria 2055
707 Ga0501039_0130778 3300049575 Bacteria 1970
708 Ga0501039_0160636 3300049575 Bacteria 1766
709 Ga0501039_0213421 3300049575 Bacteria 1517
710 Ga0501039_0442865 3300049575 Bacteria 1020
711 Ga0501039_0484524 3300049575 Bacteria 971
712 Ga0501040_0000246 3300049576 Bacteria 31868
713 Ga0501040_0011413 3300049576 Bacteria 5816
714 Ga0501040_0061499 3300049576 Bacteria 2583
715 Ga0501040_0061967 3300049576 Bacteria 2573
716 Ga0501040_0097084 3300049576 Bacteria 2052
717 Ga0501041_0000526 3300049577 Bacteria 19761
718 Ga0501041_0001324 3300049577 Bacteria 13635
719 Ga0501041_0012849 3300049577 Bacteria 4959
720 Ga0501041_0040878 3300049577 Bacteria 2816
721 Ga0501041_0042256 3300049577 Bacteria 2770
722 Ga0501041_0059150 3300049577 Bacteria 2346
723 Ga0501041_0131878 3300049577 Bacteria 1556
724 Ga0501041_0437905 3300049577 Bacteria 829
725 Ga0501042_0000433 3300049578 Bacteria 21307
726 Ga0501042_0057234 3300049578 Bacteria 2782
727 Ga0501042_0061670 3300049578 Bacteria 2679
728 Ga0501042_0121212 3300049578 Bacteria 1883
729 Ga0501042_0167293 3300049578 Bacteria 1586
730 Ga0501042_0261793 3300049578 Bacteria 1248
731 Ga0501043_0013356 3300049579 Bacteria 6421
732 Ga0501043_0133114 3300049579 Bacteria 1948
733 Ga0501043_0297778 3300049579 Bacteria 1233
734 Ga0501043_0335560 3300049579 Bacteria 1151
735 Ga0501046_0000971 3300049580 Bacteria 28071
736 Ga0501046_0002290 3300049580 Bacteria 18049
737 Ga0501046_0017803 3300049580 Bacteria 5927
738 Ga0501046_0077993 3300049580 Bacteria 2564
739 Ga0501046_0085586 3300049580 Bacteria 2430
740 Ga0501046_0177218 3300049580 Bacteria 1596
741 Ga0501046_0188347 3300049580 Bacteria 1540
742 Ga0501046_0281180 3300049580 Bacteria 1219
743 Ga0501048_0003044 3300049582 Bacteria 12781
744 Ga0501048_0004251 3300049582 Bacteria 10912
745 Ga0501048_0053733 3300049582 Bacteria 2863
746 Ga0501048_0101169 3300049582 Bacteria 2033
747 Ga0501048_0107572 3300049582 Bacteria 1969
748 Ga0501048_0114592 3300049582 Bacteria 1904
749 Ga0501048_0171854 3300049582 Bacteria 1535
750 Ga0501067_0147931 3300049583 Bacteria 1309
751 Ga0501068_0011766 3300049584 Bacteria 4946
752 Ga0501068_0217729 3300049584 Bacteria 1213
753 Ga0501069_0244337 3300049585 Bacteria 1046
754 Ga0501071_0001562 3300049587 Bacteria 13386
755 Ga0501071_0006321 3300049587 Bacteria 7685
756 Ga0501071_0039814 3300049587 Bacteria 3363
757 Ga0501071_0081070 3300049587 Bacteria 2374
758 Ga0501071_0119283 3300049587 Bacteria 1955
759 Ga0501071_0231671 3300049587 Bacteria 1391
760 Ga0501071_0315774 3300049587 Bacteria 1186
761 Ga0501071_0736763 3300049587 Bacteria 759
762 Ga0501071_0741738 3300049587 Bacteria 756
763 Ga0501072_0007356 3300049588 Bacteria 8353
764 Ga0501072_0008180 3300049588 Bacteria 7941
765 Ga0501072_0008624 3300049588 Bacteria 7737
766 Ga0501072_0018238 3300049588 Bacteria 5399
767 Ga0501072_0071688 3300049588 Bacteria 2738
768 Ga0501073_0084561 3300049589 Bacteria 2208
769 Ga0501073_0143437 3300049589 Bacteria 1655
770 Ga0501074_0113583 3300049590 Bacteria 1938
771 Ga0501074_0136600 3300049590 Bacteria 1754
772 Ga0501074_0151361 3300049590 Bacteria 1658
773 Ga0501074_0190043 3300049590 Bacteria 1464
774 Ga0501074_0726041 3300049590 Bacteria 701
775 Ga0501075_0000305 3300049591 Bacteria 27456
776 Ga0501075_0001097 3300049591 Bacteria 17429
777 Ga0501075_0091164 3300049591 Bacteria 2313
778 Ga0501075_0112670 3300049591 Bacteria 2068
779 Ga0501075_0145995 3300049591 Bacteria 1803
780 Ga0501075_0156943 3300049591 Bacteria 1735
781 Ga0501075_0159708 3300049591 Bacteria 1719
782 Ga0501075_0167844 3300049591 Bacteria 1674
783 Ga0501075_0239811 3300049591 Bacteria 1382
784 Ga0501075_0372156 3300049591 Bacteria 1089
785 Ga0501075_0499610 3300049591 Bacteria 928
786 Ga0501076_0000012 3300049592 Bacteria 113396
787 Ga0501076_0025397 3300049592 Bacteria 4584
788 Ga0501076_0039893 3300049592 Bacteria 3687
789 Ga0501076_0042585 3300049592 Bacteria 3575
790 Ga0501076_0077645 3300049592 Bacteria 2664
791 Ga0501076_0078177 3300049592 Bacteria 2655
792 Ga0501076_0084053 3300049592 Bacteria 2556
793 Ga0501076_0105002 3300049592 Bacteria 2280
794 Ga0501076_0138231 3300049592 Bacteria 1978
795 Ga0501076_0884264 3300049592 Bacteria 737
796 Ga0501077_0004017 3300049593 Bacteria 8876
797 Ga0501077_0005177 3300049593 Bacteria 7921
798 Ga0501077_0248782 3300049593 Bacteria 1130
799 Ga0501201_000070 3300049651 Bacteria 7495
800 Ga0501202_000142 3300049652 Bacteria 8464
801 Ga0501206_000088 3300049653 Bacteria 9396
802 Ga0501207_000577 3300049654 Unclassified 4203
803 Ga0501214_000080 3300049659 Bacteria 5324
804 Ga0501216_001797 3300049660 Bacteria 2951
805 Ga0501217_000036 3300049661 Bacteria 14732
806 Ga0501222_010065 3300049662 Bacteria 1249
807 Ga0501223_003482 3300049663 Unclassified 3420
808 Ga0501227_073003 3300049665 Bacteria 892
809 Ga0501228_000363 3300049666 Bacteria 2833
810 Ga0501233_000031 3300049668 Bacteria 18067
811 Ga0501235_000093 3300049669 Bacteria 14134
812 Ga0501236_000005 3300049670 Bacteria 29093
813 Ga0501239_000013 3300049672 Bacteria 15607
814 Ga0501243_021542 3300049675 Bacteria 1064
815 Ga0501249_000408 3300049679 Bacteria 10962
816 Ga0501252_024190 3300049682 Bacteria 811
817 Ga0501255_000715 3300049684 Bacteria 2396
818 Ga0501257_000578 3300049686 Bacteria 7241
819 Ga0501258_000321 3300049687 Unclassified 3047
820 Ga0501219_000225 3300049703 Bacteria 10726
821 Ga0501221_000546 3300049704 Bacteria 5977
822 Ga0501225_0000090 3300049705 Bacteria 29039
823 Ga0501229_007091 3300049706 Bacteria 1391
824 Ga0501245_000058 3300049708 Bacteria 10439
825 Ga0501079_0035926 3300049741 Bacteria 3815
826 Ga0501079_0037823 3300049741 Bacteria 3721
827 Ga0501079_0052367 3300049741 Bacteria 3150
828 Ga0501079_0195880 3300049741 Bacteria 1577
829 Ga0501079_0313200 3300049741 Bacteria 1228
830 Ga0501079_0813445 3300049741 Unclassified 736
831 Ga0501080_0002580 3300049742 Bacteria 15863
832 Ga0501080_0071342 3300049742 Bacteria 3231
833 Ga0501080_0080138 3300049742 Bacteria 3035
834 Ga0501080_0133290 3300049742 Bacteria 2300
835 Ga0501080_0376576 3300049742 Bacteria 1279
836 Ga0501080_0391695 3300049742 Bacteria 1251
837 Ga0501080_0435616 3300049742 Bacteria 1176
838 Ga0501080_1074881 3300049742 Bacteria 695
839 Ga0501081_0000487 3300049743 Bacteria 22094
840 Ga0501081_0003544 3300049743 Bacteria 9972
841 Ga0501081_0006525 3300049743 Bacteria 7578
842 Ga0501081_0035216 3300049743 Bacteria 3407
843 Ga0501081_0063590 3300049743 Bacteria 2561
844 Ga0501081_0109470 3300049743 Bacteria 1960
845 Ga0501081_0469746 3300049743 Bacteria 936
846 Ga0501083_0224139 3300049744 Bacteria 1225
847 Ga0501232_025295 3300049757 Bacteria 792
848 Ga0501262_000259 3300049759 Bacteria 6420
849 Ga0501264_000943 3300049761 Unclassified 3620
850 Ga0501266_007425 3300049763 Bacteria 1373
851 Ga0501269_004350 3300049766 Bacteria 1705
852 Ga0501270_000437 3300049767 Unclassified 3570
853 Ga0501271_000284 3300049768 Bacteria 4352
854 Ga0501273_000239 3300049770 Bacteria 4098
855 Ga0501275_002821 3300049772 Bacteria 1592
856 Ga0501276_000058 3300049773 Bacteria 6074
857 Ga0501278_001047 3300049774 Bacteria 1989
858 Ga0501279_001293 3300049775 Unclassified 3293
859 Ga0501280_004191 3300049776 Unclassified 2137
860 Ga0501282_000938 3300049778 Unclassified 3299
861 Ga0501283_000053 3300049779 Bacteria 14670
862 Ga0501035_0018540 3300049822 Bacteria 6411
863 Ga0501035_0034514 3300049822 Bacteria 4596
864 Ga0501035_0047620 3300049822 Bacteria 3848
865 Ga0501035_0053780 3300049822 Bacteria 3599
866 Ga0501035_0115181 3300049822 Bacteria 2353
867 Ga0501035_0308840 3300049822 Bacteria 1331
868 Ga0501044_0683277 3300049823 Bacteria 913
869 Ga0501045_0000464 3300049824 Bacteria 25180
870 Ga0501045_0024839 3300049824 Bacteria 4304
871 Ga0501045_0038389 3300049824 Bacteria 3483
872 Ga0501045_0250827 3300049824 Bacteria 1317
873 Ga0501204_007089 3300049850 Bacteria 1257
874 Ga0501212_003600 3300049851 Bacteria 1954
875 Ga0501220_01150 3300049852 Bacteria 945
876 Ga0501226_000154 3300049853 Bacteria 12511
877 nmdc:mga05p37_113285_c1 3300050507 Bacteria 3335
878 nmdc:mga05p37_131644_c1 3300050507 Unclassified 3069
879 nmdc:mga05p37_263621_c1 3300050507 Bacteria 2061
880 nmdc:mga05p37_3251_c2 3300050507 Bacteria 8375
881 nmdc:mga05p37_451576_c1 3300050507 Bacteria 1487
882 nmdc:mga05p37_82529_c1 3300050507 Bacteria 3961
883 nmdc:mga09592_10073_c1 3300050508 Bacteria 7687
884 nmdc:mga09592_4155_c1 3300050508 Bacteria 11696
885 nmdc:mga09592_78648_c1 3300050508 Bacteria 2807
886 nmdc:mga09592_97910_c1 3300050508 Bacteria 2511
887 nmdc:mga0qj67_12854_c1 3300050509 Bacteria 6317
888 nmdc:mga0qj67_147626_c1 3300050509 Bacteria 1907
889 nmdc:mga0qj67_29046_c1 3300050509 Bacteria 4294
890 nmdc:mga06r32_25421_c1 3300050510 Bacteria 5510
891 nmdc:mga06r32_420114_c1 3300050510 Bacteria 1318
892 nmdc:mga06r32_48127_c1 3300050510 Bacteria 4075
893 nmdc:mga06r32_71365_c1 3300050510 Bacteria 3360
894 nmdc:mga06r32_771213_c1 3300050510 Bacteria 924
895 nmdc:mga06r32_79582_c1 3300050510 Unclassified 3188
896 nmdc:mga06r32_856786_c1 3300050510 Bacteria 867
897 nmdc:mga08y16_36781_c1 3300050511 Bacteria 5141
898 nmdc:mga08y16_446_c1 3300050511 Bacteria 38236
899 nmdc:mga08y16_46247_c1 3300050511 Bacteria 4556
900 nmdc:mga0n895_118479_c1 3300050512 Bacteria 2668
901 nmdc:mga0n895_1355_c1 3300050512 Bacteria 18193
902 nmdc:mga0n895_16001_c1 3300050512 Bacteria 6869
903 nmdc:mga0n895_2013_c1 3300050512 Bacteria 15621
904 nmdc:mga0n895_262199_c1 3300050512 Bacteria 1754
905 nmdc:mga0n895_274061_c1 3300050512 Unclassified 1711
906 nmdc:mga0n895_2994_c1 3300050512 Bacteria 13411
907 nmdc:mga0n895_415738_c1 3300050512 Bacteria 1360
908 nmdc:mga0n895_5926_c1 3300050512 Bacteria 10278
909 nmdc:mga0n895_72384_c1 3300050512 Bacteria 3419
910 nmdc:mga0n895_850350_c1 3300050512 Bacteria 900
911 nmdc:mga0rr50_12329_c1 3300050513 Bacteria 5521
912 nmdc:mga0rr50_153231_c1 3300050513 Bacteria 1865
913 nmdc:mga0rr50_312416_c1 3300050513 Bacteria 1317
914 nmdc:mga0rr50_43172_c1 3300050513 Bacteria 3297
915 nmdc:mga0rr50_47027_c1 3300050513 Bacteria 3180
916 nmdc:mga08x19_11323_c1 3300050514 Bacteria 5369
917 nmdc:mga08x19_117851_c1 3300050514 Bacteria 1777
918 nmdc:mga08x19_122025_c1 3300050514 Bacteria 1748
919 nmdc:mga08x19_133054_c1 3300050514 Bacteria 1674
920 nmdc:mga08x19_19630_c1 3300050514 Bacteria 4151
921 nmdc:mga08x19_33467_c1 3300050514 Bacteria 3244
922 nmdc:mga08x19_398074_c1 3300050514 Bacteria 966
923 nmdc:mga08x19_48627_c1 3300050514 Bacteria 2717
924 nmdc:mga08x19_62330_c1 3300050514 Bacteria 2418
925 nmdc:mga0a205_126989_c1 3300050515 Bacteria 2450
926 nmdc:mga0a205_129249_c1 3300050515 Bacteria 2427
927 nmdc:mga0a205_193866_c1 3300050515 Bacteria 1923
928 nmdc:mga0a205_28250_c1 3300050515 Bacteria 5363
929 nmdc:mga0a205_356_c1 3300050515 Bacteria 34589
930 nmdc:mga0a205_4071_c1 3300050515 Bacteria 13074
931 nmdc:mga0a205_4718_c1 3300050515 Bacteria 12237
932 nmdc:mga0a205_488857_c1 3300050515 Bacteria 1088
933 nmdc:mga0a205_589201_c1 3300050515 Bacteria 966
934 nmdc:mga0a205_77980_c1 3300050515 Unclassified 3200
935 nmdc:mga0a205_79261_c1 3300050515 Bacteria 3173
936 nmdc:mga0a205_90016_c1 3300050515 Bacteria 2966
937 Ga0495601_0262864 3300053077 Unclassified 1126
938 Ga0495601_0684357 3300053077 Bacteria 655
939 Ga0495612_0200504 3300053078 Bacteria 880
940 Ga0495619_0013683 3300053085 Bacteria 5115
941 Ga0500601_011732 3300053737 Unclassified 986
942 Ga0501084_0000368 3300054114 Bacteria 34446
943 Ga0501084_0015947 3300054114 Bacteria 6235
944 Ga0501084_0023680 3300054114 Bacteria 5121
945 Ga0501084_0040973 3300054114 Bacteria 3874
946 Ga0501084_0043377 3300054114 Bacteria 3763
947 Ga0501084_0085367 3300054114 Bacteria 2650
948 Ga0501084_0092430 3300054114 Bacteria 2540
949 Ga0501084_0094282 3300054114 Bacteria 2513
950 Ga0501084_0384964 3300054114 Bacteria 1185
951 Ga0590077_041096 3300059426 Bacteria 1027
952 Ga0501082_0002877 3300060353 Bacteria 15001
953 Ga0501082_0009668 3300060353 Bacteria 8303
954 Ga0501082_0011757 3300060353 Bacteria 7524
955 Ga0501082_0019523 3300060353 Bacteria 5844
956 Ga0501082_0037449 3300060353 Bacteria 4181
957 Ga0501082_0080749 3300060353 Bacteria 2807
958 Ga0501082_0083703 3300060353 Bacteria 2752
959 Ga0501082_0333734 3300060353 Bacteria 1321
960 Ga0501082_0569571 3300060353 Bacteria 991
961 Ga0501082_0938035 3300060353 Bacteria 757
962 Ga0530510_0000122 3300061734 Bacteria 44511
963 Ga0530510_0000345 3300061734 Bacteria 29910
964 Ga0530510_0009780 3300061734 Bacteria 6729
965 Ga0530510_0167682 3300061734 Bacteria 1626
966 Ga0530510_0609462 3300061734 Bacteria 830
967 Ga0075431_100348884
968 JGI24737J22298_10014609
969 JGI24742J22300_10029204
970 JGI26128J50194_1001488
971 JGI26129J50193_1003844
972 JGI26145J50221_1000087
973 JGI26145J50221_1008090
974 JGI26140J50224_100604
975 Ga0055531_10005374
976 Ga0058862_11991263
977 Ga0065704_10114247
978 Ga0065712_10337450
979 Ga0065715_10004888
980 Ga0065715_10581981
981 Ga0065707_10001145
982 Ga0065707_10115873
983 Ga0065707_10342428
984 Ga0070658_10030961
985 Ga0070676_10002922
986 Ga0070676_10003944
987 Ga0070683_100068384
988 Ga0070690_100000100
989 Ga0070690_100001186
990 Ga0070690_100010393
991 Ga0070690_100058501
992 Ga0070690_100173330
993 Ga0070690_100221218
994 Ga0070670_100009180
995 Ga0070670_100033981
996 Ga0070670_100285523
997 Ga0070677_10009326
998 Ga0070677_10034667
999 Ga0068869_100008550
1000 Ga0068869_100118127
1001 Ga0070666_10008954
1002 Ga0070666_10281067
1003 Ga0070680_100000653
1004 Ga0070680_100002913
1005 Ga0070680_100003870
1006 Ga0070680_100018398
1007 Ga0070680_100040546
1008 Ga0070680_100669322
1009 Ga0068868_100015109
1010 Ga0068868_100034927
1011 Ga0070660_100034994
1012 Ga0070660_100722124
1013 Ga0070689_100000016
1014 Ga0070689_100002667
1015 Ga0070689_100169783
1016 Ga0070691_10044276
1017 Ga0070691_10067534
1018 Ga0070687_100015875
1019 Ga0070687_100026366
1020 Ga0070687_100060361
1021 Ga0070687_100368170
1022 Ga0070661_100001003
1023 Ga0070661_100917763
1024 Ga0070692_10039347
1025 Ga0070692_10054282
1026 Ga0070692_10067416
1027 Ga0070692_10126358
1028 Ga0070668_100004413
1029 Ga0070668_100232229
1030 Ga0070669_100001731
1031 Ga0070669_100369883
1032 Ga0070675_100006040
1033 Ga0070675_100022193
1034 Ga0070675_100098038
1035 Ga0070674_100004202
1036 Ga0070674_100287990
1037 Ga0070673_100000461
1038 Ga0070673_100000477
1039 Ga0070688_100000273
1040 Ga0070688_100034967
1041 Ga0070688_100071248
1042 Ga0070688_100325152
1043 Ga0070688_100391042
1044 Ga0070659_100000535
1045 Ga0070667_100023723
1046 Ga0070667_100045291
1047 Ga0070703_10014369
1048 Ga0070703_10019067
1049 Ga0070703_10148159
1050 Ga0070709_10003203
1051 Ga0070709_10023904
1052 Ga0070709_10282271
1053 Ga0070714_100473570
1054 Ga0070713_100114350
1055 Ga0070701_10001910
1056 Ga0070701_10019253
1057 Ga0070701_10183223
1058 Ga0070701_10270976
1059 Ga0070711_100001610
1060 Ga0070711_100055640
1061 Ga0070705_100002325
1062 Ga0070705_100011605
1063 Ga0070705_100013692
1064 Ga0070705_100126627
1065 Ga0070705_100245140
1066 Ga0070700_100000799
1067 Ga0070700_100003999
1068 Ga0070700_100018783
1069 Ga0070700_100077706
1070 Ga0070700_100148983
1071 Ga0070700_100246563
1072 Ga0070694_100001188
1073 Ga0070694_100001761
1074 Ga0070694_100002348
1075 Ga0070694_100004254
1076 Ga0070694_100020101
1077 Ga0070694_100085533
1078 Ga0070694_100108572
1079 Ga0070694_100118354
1080 Ga0070694_100124871
1081 Ga0070694_100222231
1082 Ga0070694_100308418
1083 Ga0070708_100001385
1084 Ga0070708_100064943
1085 Ga0070708_100138402
1086 Ga0070708_100244554
1087 Ga0070708_100276281
1088 Ga0070708_100494678
1089 Ga0070708_100837214
1090 Ga0070708_101020652
1091 Ga0070663_100134806
1092 Ga0070663_100250074
1093 Ga0070678_100000415
1094 Ga0070678_100014179
1095 Ga0070662_100002500
1096 Ga0070662_100009580
1097 Ga0070681_10021313
1098 Ga0070681_10040125
1099 Ga0070681_10170869
1100 Ga0070681_10969255
1101 Ga0068867_100000792
1102 Ga0068867_100027904
1103 Ga0068867_100159317
1104 Ga0070685_10000123
1105 Ga0070685_10064885
1106 Ga0070706_100000948
1107 Ga0070706_100004936
1108 Ga0070706_100035776
1109 Ga0070706_100044050
1110 Ga0070706_100051830
1111 Ga0070706_100295778
1112 Ga0070706_100340377
1113 Ga0070706_100404558
1114 Ga0070706_100411235
1115 Ga0070707_100002183
1116 Ga0070707_100011168
1117 Ga0070707_100030526
1118 Ga0070707_100063801
1119 Ga0070707_100102719
1120 Ga0070707_100140995
1121 Ga0070707_100175240
1122 Ga0070707_100245065
1123 Ga0070707_100361345
1124 Ga0070707_100639417
1125 Ga0070698_100008214
1126 Ga0070698_100037367
1127 Ga0070698_100056757
1128 Ga0070698_100064228
1129 Ga0070698_100120937
1130 Ga0070698_100157134
1131 Ga0070698_100627142
1132 Ga0070699_100001496
1133 Ga0070699_100005185
1134 Ga0070699_100007719
1135 Ga0070699_100035138
1136 Ga0070699_100040928
1137 Ga0070699_100074719
1138 Ga0070699_100081302
1139 Ga0070699_100116273
1140 Ga0070699_100124923
1141 Ga0070699_100162626
1142 Ga0070699_100206036
1143 Ga0070699_100287056
1144 Ga0070699_100310086
1145 Ga0070679_100072693
1146 Ga0070679_100112522
1147 Ga0070697_100002194
1148 Ga0070697_100004967
1149 Ga0070697_100006308
1150 Ga0070697_100008240
1151 Ga0070697_100010254
1152 Ga0070697_100043274
1153 Ga0070697_100045548
1154 Ga0070697_100045863
1155 Ga0070697_100059201
1156 Ga0070697_100072170
1157 Ga0070697_100073452
1158 Ga0070697_100079278
1159 Ga0070697_100123756
1160 Ga0070697_100149281
1161 Ga0070697_100168311
1162 Ga0070697_100367470
1163 Ga0070697_100974661
1164 Ga0070672_100002646
1165 Ga0070672_100002752
1166 Ga0070672_100173085
1167 Ga0070686_100000027
1168 Ga0070686_100002437
1169 Ga0070686_100008895
1170 Ga0070686_100011744
1171 Ga0070686_100028545
1172 Ga0070686_100029120
1173 Ga0070695_100005391
1174 Ga0070695_100007293
1175 Ga0070695_100007521
1176 Ga0070695_100007931
1177 Ga0070695_100015355
1178 Ga0070695_100040736
1179 Ga0070695_100050528
1180 Ga0070695_100056300
1181 Ga0070695_100149261
1182 Ga0070696_100002253
1183 Ga0070696_100015046
1184 Ga0070696_100079335
1185 Ga0070696_100094972
1186 Ga0070696_100096584
1187 Ga0070696_100098799
1188 Ga0070696_100143756
1189 Ga0070696_100155049
1190 Ga0070696_100211599
1191 Ga0070665_100027188
1192 Ga0070665_100144192
1193 Ga0070665_100262273
1194 Ga0070704_100000137
1195 Ga0070704_100003591
1196 Ga0070704_100003810
1197 Ga0070704_100035040
1198 Ga0070704_100045155
1199 Ga0070704_100056136
1200 Ga0070704_100217962
1201 Ga0070704_100265187
1202 Ga0070704_100504922
1203 Ga0068855_100165462
1204 Ga0070664_100001975
1205 Ga0070664_100002822
1206 Ga0070664_100021921
1207 Ga0068857_100078653
1208 Ga0070702_100004120
1209 Ga0070702_100034393
1210 Ga0070702_100046197
1211 Ga0070702_100274240
1212 Ga0068859_100000617
1213 Ga0068859_100154628
1214 Ga0068859_100316661
1215 Ga0068859_100682062
1216 Ga0068859_100984253
1217 Ga0068864_101110834
1218 Ga0068866_10005130
1219 Ga0068866_10028475
1220 Ga0068866_10296103
1221 Ga0068861_100194504
1222 Ga0068861_100203165
1223 Ga0068851_10085389
1224 Ga0068870_10003331
1225 Ga0068860_100060177
1226 Ga0068860_100073324
1227 Ga0068860_100512804
1228 Ga0068862_100004652
1229 Ga0068862_100260854
1230 Ga0068862_100841947
1231 Ga0081455_10000641
1232 Ga0081455_10038374
1233 Ga0075432_10000245
1234 Ga0070715_10117859
1235 Ga0097621_100021651
1236 Ga0097621_100046089
1237 Ga0097621_100070403
1238 Ga0068871_100005813
1239 Ga0068871_100006995
1240 Ga0068871_100010170
1241 Ga0068871_100072998
1242 Ga0075428_100077642
1243 Ga0075428_100088475
1244 Ga0075428_100138276
1245 Ga0075428_100155387
1246 Ga0075428_100168349
1247 Ga0075430_100000957
1248 Ga0075430_100000988
1249 Ga0075430_100002015
1250 Ga0075430_100010142
1251 Ga0075431_100007759
1252 Ga0075431_100045855
1253 Ga0075431_100103063
1254 Ga0075431_100497930
1255 Ga0075431_100547142
1256 Ga0075433_10000986
1257 Ga0075433_10003058
1258 Ga0075433_10022516
1259 Ga0075433_10029452
1260 Ga0075433_10078023
1261 Ga0075433_10105393
1262 Ga0075433_10333006
1263 Ga0075433_10359643
1264 Ga0075433_10460532
1265 Ga0075433_10558003
1266 Ga0075433_10926962
1267 Ga0075434_100000664
1268 Ga0075434_100000723
1269 Ga0075434_100013775
1270 Ga0075434_100029308
1271 Ga0075434_100092346
1272 Ga0075434_100102177
1273 Ga0075434_100209900
1274 Ga0075434_100372232
1275 Ga0075434_101026319
1276 Ga0075434_101057016
1277 Ga0075429_100001860
1278 Ga0075429_100005575
1279 Ga0075429_100055028
1280 Ga0075429_100193793
1281 Ga0075429_100225776
1282 Ga0075429_100636901
1283 Ga0068865_100000068
1284 Ga0068865_100048208
1285 Ga0068865_100119277
1286 Ga0075436_100003988
1287 Ga0075436_100005627
1288 Ga0075436_100020968
1289 Ga0075436_100032712
1290 Ga0075436_100038436
1291 Ga0075436_100058561
1292 Ga0075436_100064306
1293 Ga0097620_100000617
1294 Ga0097620_100154620
1295 Ga0097620_100316668
1296 Ga0097620_100681992
1297 Ga0097620_100984220
1298 Ga0075435_100009474
1299 Ga0075435_100038950
1300 Ga0075435_100097772
1301 Ga0075435_100107767
1302 Ga0075435_100140467
1303 Ga0075435_100350373
1304 Ga0099794_10000360
1305 Ga0099794_10047748
1306 Ga0099794_10082972
1307 Ga0099794_10147449
1308 Ga0111539_10000444
1309 Ga0111539_10077068
1310 Ga0111539_10129384
1311 Ga0111539_10845931
1312 Ga0105245_10007385
1313 Ga0105245_10394731
1314 Ga0105245_10800627
1315 Ga0114129_10001982
1316 Ga0114129_10010841
1317 Ga0114129_10076314
1318 Ga0114129_10133235
1319 Ga0114129_10367401
1320 Ga0114129_10766486
1321 Ga0114129_10858097
1322 Ga0105242_10001189
1323 Ga0105242_10013235
1324 Ga0105242_10368731
1325 Ga0105248_10000484
1326 Ga0105249_10769600
1327 Ga0105239_10004228
1328 Ga0105246_10013063
1329 Ga0105246_10455679
1330 Ga0105246_10476300
1331 Ga0157373_10416943
1332 Ga0157371_10043824
1333 Ga0157370_10110908
1334 Ga0157369_10065897
1335 Ga0157374_10082700
1336 Ga0157374_10096894
1337 Ga0157374_10827315
1338 Ga0157378_10001289
1339 Ga0157378_10038956
1340 Ga0157378_10070501
1341 Ga0157378_10088500
1342 Ga0157378_10443695
1343 Ga0157378_10467259
1344 Ga0157378_10558291
1345 Ga0163162_10071990
1346 Ga0163162_10348618
1347 Ga0157372_10217354
1348 Ga0157375_10002356
1349 Ga0157375_10058868
1350 Ga0157375_10110759
1351 Ga0157375_10220233
1352 Ga0157375_10578800
1353 Ga0157380_10003727
1354 Ga0182008_10371832
1355 Ga0157377_10000988
1356 Ga0157376_10000457
1357 Ga0157376_10000495
1358 Ga0157376_10031303
1359 Ga0157376_10438587
1360 Ga0206355_1232426
1361 Ga0207656_10176109
1362 Ga0207653_10000037
1363 Ga0207653_10010147
1364 Ga0207653_10013327
1365 Ga0207653_10056741
1366 Ga0207682_10007150
1367 Ga0207682_10119923
1368 Ga0207642_10024563
1369 Ga0207642_10050553
1370 Ga0207642_10088968
1371 Ga0207688_10002114
1372 Ga0207680_10003802
1373 Ga0207680_10025591
1374 Ga0207680_10165699
1375 Ga0207647_10109277
1376 Ga0207699_10009891
1377 Ga0207699_10059223
1378 Ga0207699_10146328
1379 Ga0207645_10000032
1380 Ga0207643_10002698
1381 Ga0207705_10026332
1382 Ga0207684_10000493
1383 Ga0207684_10000543
1384 Ga0207684_10006827
1385 Ga0207684_10079507
1386 Ga0207684_10094440
1387 Ga0207684_10175564
1388 Ga0207684_10267267
1389 Ga0207684_10268838
1390 Ga0207684_10375265
1391 Ga0207684_10457633
1392 Ga0207684_10551929
1393 Ga0207654_10028962
1394 Ga0207707_10032027
1395 Ga0207707_10044286
1396 Ga0207707_10060590
1397 Ga0207707_10067641
1398 Ga0207707_10135569
1399 Ga0207663_10000535
1400 Ga0207663_10241565
1401 Ga0207660_10003766
1402 Ga0207660_10008510
1403 Ga0207660_10039661
1404 Ga0207660_10061409
1405 Ga0207660_10172121
1406 Ga0207662_10012300
1407 Ga0207662_10015253
1408 Ga0207662_10035874
1409 Ga0207657_10016849
1410 Ga0207657_10701127
1411 Ga0207649_10114792
1412 Ga0207649_10135619
1413 Ga0207652_10048019
1414 Ga0207652_10184653
1415 Ga0207652_10422327
1416 Ga0207646_10000026
1417 Ga0207646_10000623
1418 Ga0207646_10005326
1419 Ga0207646_10007444
1420 Ga0207646_10042576
1421 Ga0207646_10044187
1422 Ga0207646_10069437
1423 Ga0207646_10092901
1424 Ga0207646_10103791
1425 Ga0207646_10132996
1426 Ga0207681_10023296
1427 Ga0207650_10020670
1428 Ga0207650_10029451
1429 Ga0207659_10025283
1430 Ga0207659_10035200
1431 Ga0207659_10123020
1432 Ga0207687_10034611
1433 Ga0207687_10347716
1434 Ga0207687_10517694
1435 Ga0207700_10125777
1436 Ga0207664_10408179
1437 Ga0207690_10015616
1438 Ga0207690_10882895
1439 Ga0207706_10000100
1440 Ga0207706_10115055
1441 Ga0207686_10014916
1442 Ga0207686_10115794
1443 Ga0207670_10000028
1444 Ga0207670_10026355
1445 Ga0207670_10446161
1446 Ga0207669_10009577
1447 Ga0207669_10010327
1448 Ga0207669_10053646
1449 Ga0207669_10545692
1450 Ga0207704_10008594
1451 Ga0207704_10029209
1452 Ga0207704_10039161
1453 Ga0207665_10059144
1454 Ga0207691_10000019
1455 Ga0207691_10000159
1456 Ga0207691_10168498
1457 Ga0207711_10002860
1458 Ga0207689_10021641
1459 Ga0207689_10076555
1460 Ga0207689_10165113
1461 Ga0207661_10026724
1462 Ga0207679_10002651
1463 Ga0207679_10142693
1464 Ga0207651_10007732
1465 Ga0207651_10016811
1466 Ga0207651_10029943
1467 Ga0207712_10578783
1468 Ga0207668_10176507
1469 Ga0207668_10227226
1470 Ga0207658_10029235
1471 Ga0207658_10167535
1472 Ga0207658_10446237
1473 Ga0207677_10027069
1474 Ga0207677_10189209
1475 Ga0207703_10334140
1476 Ga0207703_10397122
1477 Ga0207678_10241519
1478 Ga0207708_10000039
1479 Ga0207708_10003785
1480 Ga0207708_10034608
1481 Ga0207702_10722769
1482 Ga0207648_10000034
1483 Ga0207648_10009231
1484 Ga0207648_10142792
1485 Ga0207674_10374982
1486 Ga0207675_100065253
1487 Ga0207675_100148973
1488 Ga0207683_10000013
1489 Ga0207683_10000443
1490 Ga0209973_1000091
1491 Ga0209969_1000069
1492 Ga0209967_1008030
1493 Ga0209981_1003896
1494 Ga0209996_1000112
1495 Ga0209984_1003549
1496 Ga0210000_1000504
1497 Ga0209995_1040904
1498 Ga0209968_1000044
1499 Ga0209968_1042938
1500 Ga0209999_1000018
1501 Ga0209999_1027864
1502 Ga0209982_1000543
1503 Ga0209982_1019941
1504 Ga0209970_1000001
1505 Ga0210002_1000090
1506 Ga0209983_1001454
1507 Ga0209588_1000966
1508 Ga0209588_1001546
1509 Ga0209588_1044639
1510 Ga0209588_1054529
1511 Ga0209971_1000202
1512 Ga0209966_1000140
1513 Ga0209966_1007234
1514 Ga0209998_10000011
1515 Ga0209998_10005997
1516 Ga0209998_10021750
1517 Ga0209974_10000116
1518 Ga0209974_10004733
1519 Ga0209974_10024331
1520 Ga0207428_10001059
1521 Ga0207428_10001209
1522 Ga0268266_10043417
1523 Ga0268266_10190702
1524 Ga0268266_10272421
1525 Ga0268265_10299409
1526 Ga0268265_10643835
1527 Ga0268264_10048345
1528 Ga0268264_10067306
1529 Ga0265338_10026368
1530 Ga0307408_100046417
1531 Ga0316575_10012397
1532 Ga0316579_10001020
1533 Ga0307405_10034022
1534 Ga0307405_10106565
1535 Ga0316577_10000381
1536 Ga0307413_10552206
1537 Ga0307410_10103690
1538 Ga0307406_10007686
1539 Ga0307407_10016659
1540 Ga0307409_100082474
1541 Ga0307409_100230653
1542 Ga0307416_100462887
1543 Ga0307416_100464527
1544 Ga0307414_10404156
1545 Ga0307411_10020662
1546 Ga0307415_100000643
1547 Ga0307415_100321230
1548 Ga0373950_0006121
1549 Ga0373940_0028070
1550 Ga0373952_0031418
1551 Ga0373923_0128773
1552 Ga0373923_0200820
1553 Ga0373932_0116954
1554 Ga0373936_0080439
1555 Ga0373945_0025756
1556 Ga0373960_0010502
1557 Ga0373960_0117165
1558 Ga0373961_0043128
1559 Ga0373962_0151221
1560 Ga0373924_0111413
1561 Ga0373931_0070268
1562 Ga0373931_0343766
1563 Ga0373935_0122033
1564 Ga0316582_0054343
1565 Ga0373925_0139932
1566 Ga0316581_0006706
1567 Ga0439436_0138151
1568 Ga0439438_022984
1569 Ga0439447_023531
1570 Ga0439465_0171302
1571 Ga0439441_004819
1572 Ga0439448_0165406
1573 Ga0439432_052028
1574 Ga0439452_007957
1575 Ga0439463_041286
1576 Ga0450890_010986
1577 Ga0439446_0052554
1578 Ga0439435_0122288
1579 Ga0439459_0081438
1580 Ga0439464_0062397
1581 Ga0439460_0056193
1582 Ga0451577_0231860
1583 Ga0451577_0356835
1584 Ga0451577_0448547
1585 Ga0439440_0082533
1586 Ga0453683_0044292
1587 Ga0453683_0121976
1588 Ga0453683_0219468
1589 Ga0453683_0241480
1590 Ga0453683_0667319
1591 Ga0453684_0292402
1592 Ga0451576_0003872
1593 Ga0451576_0006244
1594 Ga0451576_0008185
1595 Ga0451576_0008187
1596 Ga0451576_0015092
1597 Ga0451576_0029905
1598 Ga0451576_0059444
1599 Ga0451576_0410115
1600 Ga0451576_0460369
1601 Ga0451576_0680860
1602 Ga0451576_0875643
1603 Ga0466967_0032496
1604 Ga0495653_0257025
1605 Ga0495594_0021390
1606 Ga0495630_0348052
1607 Ga0495587_0068619
1608 Ga0495621_0059493
1609 Ga0495635_0055075
1610 Ga0495657_0009130
1611 Ga0495658_0095269
1612 Ga0495624_0186625
1613 Ga0495636_0033138
1614 Ga0495676_0124199
1615 Ga0495680_0048780
1616 Ga0495677_0080256
1617 Ga0496100_0099428
1618 Ga0496100_0163370
1619 Ga0496102_0102416
1620 Ga0496104_0077361
1621 Ga0496105_0123221
1622 Ga0496106_0091273
1623 Ga0496108_0139879
1624 Ga0496109_0018971
1625 Ga0496110_0001331
1626 Ga0496110_0676986
1627 Ga0496112_0966913
1628 Ga0496112_1031308
1629 Ga0496114_0006772
1630 Ga0501290_000029
1631 Ga0501291_000104
1632 Ga0501292_000095
1633 Ga0501293_000228
1634 Ga0501294_001196
1635 Ga0501295_000023
1636 Ga0501296_000064
1637 Ga0501297_000024
1638 Ga0501298_000007
1639 Ga0501299_000013
1640 Ga0501299_064901
1641 Ga0501300_000010
1642 Ga0501302_000184
1643 Ga0501303_000146
1644 Ga0501031_0000384
1645 Ga0501031_0038185
1646 Ga0501031_0165959
1647 Ga0501031_0430837
1648 Ga0501032_0032449
1649 Ga0501032_0191840
1650 Ga0501033_0005781
1651 Ga0501034_0115950
1652 Ga0501036_0029394
1653 Ga0501036_0030568
1654 Ga0501036_0037253
1655 Ga0501036_0062323
1656 Ga0501036_0099916
1657 Ga0501036_0119932
1658 Ga0501036_0275097
1659 Ga0501036_0775263
1660 Ga0501037_0003492
1661 Ga0501037_0014299
1662 Ga0501037_0083648
1663 Ga0501038_0001104
1664 Ga0501038_0008928
1665 Ga0501038_0011350
1666 Ga0501038_0013211
1667 Ga0501038_0021463
1668 Ga0501038_0272807
1669 Ga0501039_0002270
1670 Ga0501039_0015960
1671 Ga0501039_0016599
1672 Ga0501039_0120558
1673 Ga0501039_0130778
1674 Ga0501039_0160636
1675 Ga0501039_0213421
1676 Ga0501039_0442865
1677 Ga0501039_0484524
1678 Ga0501040_0000246
1679 Ga0501040_0011413
1680 Ga0501040_0061499
1681 Ga0501040_0061967
1682 Ga0501040_0097084
1683 Ga0501041_0000526
1684 Ga0501041_0001324
1685 Ga0501041_0012849
1686 Ga0501041_0040878
1687 Ga0501041_0042256
1688 Ga0501041_0059150
1689 Ga0501041_0131878
1690 Ga0501041_0437905
1691 Ga0501042_0000433
1692 Ga0501042_0057234
1693 Ga0501042_0061670
1694 Ga0501042_0121212
1695 Ga0501042_0167293
1696 Ga0501042_0261793
1697 Ga0501043_0013356
1698 Ga0501043_0133114
1699 Ga0501043_0297778
1700 Ga0501043_0335560
1701 Ga0501046_0000971
1702 Ga0501046_0002290
1703 Ga0501046_0017803
1704 Ga0501046_0077993
1705 Ga0501046_0085586
1706 Ga0501046_0177218
1707 Ga0501046_0188347
1708 Ga0501046_0281180
1709 Ga0501048_0003044
1710 Ga0501048_0004251
1711 Ga0501048_0053733
1712 Ga0501048_0101169
1713 Ga0501048_0107572
1714 Ga0501048_0114592
1715 Ga0501048_0171854
1716 Ga0501067_0147931
1717 Ga0501068_0011766
1718 Ga0501068_0217729
1719 Ga0501069_0244337
1720 Ga0501071_0001562
1721 Ga0501071_0006321
1722 Ga0501071_0039814
1723 Ga0501071_0081070
1724 Ga0501071_0119283
1725 Ga0501071_0231671
1726 Ga0501071_0315774
1727 Ga0501071_0736763
1728 Ga0501071_0741738
1729 Ga0501072_0007356
1730 Ga0501072_0008180
1731 Ga0501072_0008624
1732 Ga0501072_0018238
1733 Ga0501072_0071688
1734 Ga0501073_0084561
1735 Ga0501073_0143437
1736 Ga0501074_0113583
1737 Ga0501074_0136600
1738 Ga0501074_0151361
1739 Ga0501074_0190043
1740 Ga0501074_0726041
1741 Ga0501075_0000305
1742 Ga0501075_0001097
1743 Ga0501075_0091164
1744 Ga0501075_0112670
1745 Ga0501075_0145995
1746 Ga0501075_0156943
1747 Ga0501075_0159708
1748 Ga0501075_0167844
1749 Ga0501075_0239811
1750 Ga0501075_0372156
1751 Ga0501075_0499610
1752 Ga0501076_0000012
1753 Ga0501076_0025397
1754 Ga0501076_0039893
1755 Ga0501076_0042585
1756 Ga0501076_0077645
1757 Ga0501076_0078177
1758 Ga0501076_0084053
1759 Ga0501076_0105002
1760 Ga0501076_0138231
1761 Ga0501076_0884264
1762 Ga0501077_0004017
1763 Ga0501077_0005177
1764 Ga0501077_0248782
1765 Ga0501201_000070
1766 Ga0501202_000142
1767 Ga0501206_000088
1768 Ga0501207_000577
1769 Ga0501214_000080
1770 Ga0501216_001797
1771 Ga0501217_000036
1772 Ga0501222_010065
1773 Ga0501223_003482
1774 Ga0501227_073003
1775 Ga0501228_000363
1776 Ga0501233_000031
1777 Ga0501235_000093
1778 Ga0501236_000005
1779 Ga0501239_000013
1780 Ga0501243_021542
1781 Ga0501249_000408
1782 Ga0501252_024190
1783 Ga0501255_000715
1784 Ga0501257_000578
1785 Ga0501258_000321
1786 Ga0501219_000225
1787 Ga0501221_000546
1788 Ga0501225_0000090
1789 Ga0501229_007091
1790 Ga0501245_000058
1791 Ga0501079_0035926
1792 Ga0501079_0037823
1793 Ga0501079_0052367
1794 Ga0501079_0195880
1795 Ga0501079_0313200
1796 Ga0501079_0813445
1797 Ga0501080_0002580
1798 Ga0501080_0071342
1799 Ga0501080_0080138
1800 Ga0501080_0133290
1801 Ga0501080_0376576
1802 Ga0501080_0391695
1803 Ga0501080_0435616
1804 Ga0501080_1074881
1805 Ga0501081_0000487
1806 Ga0501081_0003544
1807 Ga0501081_0006525
1808 Ga0501081_0035216
1809 Ga0501081_0063590
1810 Ga0501081_0109470
1811 Ga0501081_0469746
1812 Ga0501083_0224139
1813 Ga0501232_025295
1814 Ga0501262_000259
1815 Ga0501264_000943
1816 Ga0501266_007425
1817 Ga0501269_004350
1818 Ga0501270_000437
1819 Ga0501271_000284
1820 Ga0501273_000239
1821 Ga0501275_002821
1822 Ga0501276_000058
1823 Ga0501278_001047
1824 Ga0501279_001293
1825 Ga0501280_004191
1826 Ga0501282_000938
1827 Ga0501283_000053
1828 Ga0501035_0018540
1829 Ga0501035_0034514
1830 Ga0501035_0047620
1831 Ga0501035_0053780
1832 Ga0501035_0115181
1833 Ga0501035_0308840
1834 Ga0501044_0683277
1835 Ga0501045_0000464
1836 Ga0501045_0024839
1837 Ga0501045_0038389
1838 Ga0501045_0250827
1839 Ga0501204_007089
1840 Ga0501212_003600
1841 Ga0501220_01150
1842 Ga0501226_000154
1843 nmdc:mga05p37_113285_c1
1844 nmdc:mga05p37_131644_c1
1845 nmdc:mga05p37_263621_c1
1846 nmdc:mga05p37_3251_c2
1847 nmdc:mga05p37_451576_c1
1848 nmdc:mga05p37_82529_c1
1849 nmdc:mga09592_10073_c1
1850 nmdc:mga09592_4155_c1
1851 nmdc:mga09592_78648_c1
1852 nmdc:mga09592_97910_c1
1853 nmdc:mga0qj67_12854_c1
1854 nmdc:mga0qj67_147626_c1
1855 nmdc:mga0qj67_29046_c1
1856 nmdc:mga06r32_25421_c1
1857 nmdc:mga06r32_420114_c1
1858 nmdc:mga06r32_48127_c1
1859 nmdc:mga06r32_71365_c1
1860 nmdc:mga06r32_771213_c1
1861 nmdc:mga06r32_79582_c1
1862 nmdc:mga06r32_856786_c1
1863 nmdc:mga08y16_36781_c1
1864 nmdc:mga08y16_446_c1
1865 nmdc:mga08y16_46247_c1
1866 nmdc:mga0n895_118479_c1
1867 nmdc:mga0n895_1355_c1
1868 nmdc:mga0n895_16001_c1
1869 nmdc:mga0n895_2013_c1
1870 nmdc:mga0n895_262199_c1
1871 nmdc:mga0n895_274061_c1
1872 nmdc:mga0n895_2994_c1
1873 nmdc:mga0n895_415738_c1
1874 nmdc:mga0n895_5926_c1
1875 nmdc:mga0n895_72384_c1
1876 nmdc:mga0n895_850350_c1
1877 nmdc:mga0rr50_12329_c1
1878 nmdc:mga0rr50_153231_c1
1879 nmdc:mga0rr50_312416_c1
1880 nmdc:mga0rr50_43172_c1
1881 nmdc:mga0rr50_47027_c1
1882 nmdc:mga08x19_11323_c1
1883 nmdc:mga08x19_117851_c1
1884 nmdc:mga08x19_122025_c1
1885 nmdc:mga08x19_133054_c1
1886 nmdc:mga08x19_19630_c1
1887 nmdc:mga08x19_33467_c1
1888 nmdc:mga08x19_398074_c1
1889 nmdc:mga08x19_48627_c1
1890 nmdc:mga08x19_62330_c1
1891 nmdc:mga0a205_126989_c1
1892 nmdc:mga0a205_129249_c1
1893 nmdc:mga0a205_193866_c1
1894 nmdc:mga0a205_28250_c1
1895 nmdc:mga0a205_356_c1
1896 nmdc:mga0a205_4071_c1
1897 nmdc:mga0a205_4718_c1
1898 nmdc:mga0a205_488857_c1
1899 nmdc:mga0a205_589201_c1
1900 nmdc:mga0a205_77980_c1
1901 nmdc:mga0a205_79261_c1
1902 nmdc:mga0a205_90016_c1
1903 Ga0495601_0262864
1904 Ga0495601_0684357
1905 Ga0495612_0200504
1906 Ga0495619_0013683
1907 Ga0500601_011732
1908 Ga0501084_0000368
1909 Ga0501084_0015947
1910 Ga0501084_0023680
1911 Ga0501084_0040973
1912 Ga0501084_0043377
1913 Ga0501084_0085367
1914 Ga0501084_0092430
1915 Ga0501084_0094282
1916 Ga0501084_0384964
1917 Ga0590077_041096
1918 Ga0501082_0002877
1919 Ga0501082_0009668
1920 Ga0501082_0011757
1921 Ga0501082_0019523
1922 Ga0501082_0037449
1923 Ga0501082_0080749
1924 Ga0501082_0083703
1925 Ga0501082_0333734
1926 Ga0501082_0569571
1927 Ga0501082_0938035
1928 Ga0530510_0000122
1929 Ga0530510_0000345
1930 Ga0530510_0009780
1931 Ga0530510_0167682
1932 Ga0530510_0609462

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00923

TAL_FSA

Transaldolase/Fructose-6-phosphate aldolase

21

233

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpx-assembly1.cif.gz_F crystal structure of transaldolase (ec 2.2.1.2) (tm0295) from thermotoga maritima at 2.40 a resolution 0.9788 1 215
1vpx-assembly1.cif.gz_D crystal structure of transaldolase (ec 2.2.1.2) (tm0295) from thermotoga maritima at 2.40 a resolution 0.978 1 207
3r8r-assembly2.cif.gz_N transaldolase from bacillus subtilis 0.9771 1 209
3r8r-assembly2.cif.gz_M transaldolase from bacillus subtilis 0.9768 1 209
1vpx-assembly2.cif.gz_N crystal structure of transaldolase (ec 2.2.1.2) (tm0295) from thermotoga maritima at 2.40 a resolution 0.9767 1 205
ID Description Score Start End Superfamily
3r8rB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9733 1 210 3.20.20.70
3r8rB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9598 1 210 3.20.20.70
1l6wA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.953 1 215 3.20.20.70
1l6wA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9487 1 215 3.20.20.70
af_A0A1L1QZF2_1_286_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8747 1 191 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A4U3ASF6-F1-model_v4 deleted 1.003 109 183
AF-W1XGA7-F1-model_v4 Putative transaldolase 1 1.001 99 185 GO:0005975
AF-A0A4U3BD06-F1-model_v4 deleted 0.9981 1 116
AF-A0A1H7WA31-F1-model_v4 Fructose-6-phosphate aldolase, TalC/MipB family 0.9978 1 123 GO:0005975
AF-A0A3C1YWL9-F1-model_v4 Fructose-6-phosphate aldolase 0.9978 109 189 GO:0005975

Map