F486959

General Info

Members Datasets Scaffolds Average Seq Length
964 362 957 334

Family's Representative Sequence

Representative Sequence 3300053119|Ga0500595_000772|Ga0500595_000772_15423_16586
Length 387
Sequence MRNRVASPDTVMRCALHSAAKVEEQIPPYGLRDRFLANKIDLNEHNGGRRVKYPGLRTTVLLSAVAAALFSLPASAADWKPARPINLIVPWAAGGSTDQITRLVAGEMEKSLGQTIVIINQPGASGSIGTRSALEAAKDGYTWTAGAAQDLGAYQTLGSLDSNIKDWHLFLSVANVQVIAVNPKTPYQNAKDLLDAMKAQPGKISVATAGVTSAGHNAMELIAKNTGVKYRHVTYDGGNPAVVATVSGEADITTQLAVEEADMIRGKRLRPLATVSDKPLELEGFGTIPPLSQTLPGFTAPTNYFGIFIPKGVPDEVIAAVEKIWKENISNSEAVKKYATSRGALFAPASGDAAQKAVFPAVQANAWLLFDTGKAKVSPDTVGIPKI

Samples

Sample ID Description Type Environment
1 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
2 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
181 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
188 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
189 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
192 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
193 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
194 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
195 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
206 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
207 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
208 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
209 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
221 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
222 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
223 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
224 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
225 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
226 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
227 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
228 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
229 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
230 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
231 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
232 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
233 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
234 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
235 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
236 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
237 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
238 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
239 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
240 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
241 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
242 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
243 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
244 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
245 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
246 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
247 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
248 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
249 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
250 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
251 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
252 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
253 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
254 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
255 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
256 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
257 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
258 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
259 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
260 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
261 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
262 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
263 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
264 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
265 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
268 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
269 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
270 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
271 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
272 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
273 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
274 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
275 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
276 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
277 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
278 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
279 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
288 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
289 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
290 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
291 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
292 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
293 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
294 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
295 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
296 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
297 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
298 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
299 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
315 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
316 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
317 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
318 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
319 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
320 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
321 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
322 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
323 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
324 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
325 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
326 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
327 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
328 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
329 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
332 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
333 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
334 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
335 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
336 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
337 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
338 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
339 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
340 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
341 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
342 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
343 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
344 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
345 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
346 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
347 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
348 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
349 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
350 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
351 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
352 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
353 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
354 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
355 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
356 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
357 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
358 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
359 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
360 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
361 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
362 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.81
Nodule 0.1
Rhizoplane 4.56
Rhizosphere 87.97
Stem 0
Stem Tuber 0
Unclassified 1.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10010008 3300002239 Bacteria 1405
2 JGI24742J22300_10000750 3300002244 Bacteria 4920
3 Ga0055540_1005341 3300003792 Bacteria 5452
4 Ga0055531_10001448 3300003794 Bacteria 17513
5 Ga0070658_10193604 3300005327 Bacteria 1714
6 Ga0070676_10001373 3300005328 Bacteria 12266
7 Ga0070676_10014359 3300005328 Bacteria 4353
8 Ga0070676_10169758 3300005328 Bacteria 1410
9 Ga0070683_100006054 3300005329 Bacteria 10139
10 Ga0070683_100060942 3300005329 Bacteria 3507
11 Ga0070683_100098659 3300005329 Bacteria 2749
12 Ga0070690_100127681 3300005330 Bacteria 1714
13 Ga0070670_100002131 3300005331 Bacteria 16246
14 Ga0070670_100014115 3300005331 Bacteria 6852
15 Ga0070670_100014179 3300005331 Bacteria 6838
16 Ga0070670_100039560 3300005331 Bacteria 4055
17 Ga0070670_100053897 3300005331 Bacteria 3453
18 Ga0070670_100108670 3300005331 Bacteria 2390
19 Ga0070670_100120958 3300005331 Bacteria 2258
20 Ga0070670_100121618 3300005331 Bacteria 2252
21 Ga0070670_100121658 3300005331 Bacteria 2252
22 Ga0070670_100209962 3300005331 Bacteria 1693
23 Ga0070677_10006429 3300005333 Bacteria 3904
24 Ga0070677_10057304 3300005333 Bacteria 1596
25 Ga0068869_100010779 3300005334 Bacteria 5971
26 Ga0068869_100375891 3300005334 Bacteria 1163
27 Ga0068869_100394634 3300005334 Unclassified 1137
28 Ga0070666_10005260 3300005335 Bacteria 7930
29 Ga0070666_10013563 3300005335 Bacteria 5174
30 Ga0070666_10050114 3300005335 Bacteria 2808
31 Ga0070680_100061553 3300005336 Bacteria 3073
32 Ga0070680_100089044 3300005336 Bacteria 2554
33 Ga0068868_100003309 3300005338 Bacteria 11212
34 Ga0068868_100023451 3300005338 Bacteria 4670
35 Ga0068868_100035815 3300005338 Bacteria 3838
36 Ga0068868_100065885 3300005338 Bacteria 2878
37 Ga0068868_100198147 3300005338 Bacteria 1673
38 Ga0070660_100010702 3300005339 Bacteria 6490
39 Ga0070660_100019623 3300005339 Bacteria 4957
40 Ga0070660_100164560 3300005339 Bacteria 1789
41 Ga0070689_100008484 3300005340 Bacteria 7240
42 Ga0070689_100097983 3300005340 Bacteria 2319
43 Ga0070691_10012421 3300005341 Bacteria 3899
44 Ga0070691_10056277 3300005341 Bacteria 1885
45 Ga0070687_100010887 3300005343 Bacteria 3956
46 Ga0070687_100033629 3300005343 Bacteria 2533
47 Ga0070661_100016290 3300005344 Bacteria 5254
48 Ga0070661_100090991 3300005344 Bacteria 2259
49 Ga0070661_100183042 3300005344 Bacteria 1595
50 Ga0070692_10033234 3300005345 Bacteria 2599
51 Ga0070668_100004725 3300005347 Bacteria 10100
52 Ga0070668_100005276 3300005347 Bacteria 9586
53 Ga0070668_100007162 3300005347 Bacteria 8267
54 Ga0070668_100008179 3300005347 Bacteria 7768
55 Ga0070668_100052000 3300005347 Bacteria 3158
56 Ga0070669_100003875 3300005353 Bacteria 10818
57 Ga0070669_100015522 3300005353 Bacteria 5429
58 Ga0070669_100039310 3300005353 Bacteria 3437
59 Ga0070669_100043586 3300005353 Bacteria 3268
60 Ga0070669_100202248 3300005353 Bacteria 1563
61 Ga0070675_100000222 3300005354 Bacteria 36370
62 Ga0070675_100002982 3300005354 Bacteria 12785
63 Ga0070675_100003286 3300005354 Bacteria 12257
64 Ga0070675_100004035 3300005354 Bacteria 11144
65 Ga0070675_100016700 3300005354 Bacteria 5826
66 Ga0070675_100017016 3300005354 Bacteria 5778
67 Ga0070675_100127961 3300005354 Bacteria 2162
68 Ga0070675_100136625 3300005354 Bacteria 2092
69 Ga0070671_100002733 3300005355 Bacteria 13699
70 Ga0070671_100030435 3300005355 Bacteria 4454
71 Ga0070671_100060358 3300005355 Bacteria 3157
72 Ga0070671_100143014 3300005355 Bacteria 2019
73 Ga0070671_100171238 3300005355 Bacteria 1836
74 Ga0070674_100004381 3300005356 Bacteria 8045
75 Ga0070674_100007981 3300005356 Bacteria 6270
76 Ga0070674_100025512 3300005356 Bacteria 3849
77 Ga0070674_100095461 3300005356 Bacteria 2156
78 Ga0070673_100008257 3300005364 Bacteria 6915
79 Ga0070673_100019910 3300005364 Bacteria 4828
80 Ga0070673_100021568 3300005364 Bacteria 4673
81 Ga0070673_100024790 3300005364 Bacteria 4403
82 Ga0070673_100083787 3300005364 Bacteria 2591
83 Ga0070673_100116164 3300005364 Bacteria 2226
84 Ga0070673_100174205 3300005364 Bacteria 1838
85 Ga0070673_100177101 3300005364 Bacteria 1823
86 Ga0070673_100200450 3300005364 Bacteria 1718
87 Ga0070688_100013922 3300005365 Bacteria 4549
88 Ga0070688_100084759 3300005365 Bacteria 2059
89 Ga0070688_100093645 3300005365 Bacteria 1968
90 Ga0070659_100002034 3300005366 Bacteria 14467
91 Ga0070659_100013444 3300005366 Bacteria 6092
92 Ga0070667_100001986 3300005367 Bacteria 18138
93 Ga0070667_100006321 3300005367 Bacteria 9845
94 Ga0070667_100024527 3300005367 Bacteria 5009
95 Ga0070667_100068659 3300005367 Bacteria 3016
96 Ga0070667_100073437 3300005367 Bacteria 2916
97 Ga0070667_100135754 3300005367 Bacteria 2151
98 Ga0070667_100550151 3300005367 Bacteria 1061
99 Ga0070714_100127250 3300005435 Bacteria 2273
100 Ga0070713_100010039 3300005436 Bacteria 6825
101 Ga0070710_10035698 3300005437 Bacteria 2712
102 Ga0070701_10042793 3300005438 Bacteria 2313
103 Ga0070711_100205303 3300005439 Bacteria 1523
104 Ga0070705_100094499 3300005440 Bacteria 1872
105 Ga0070705_100095992 3300005440 Bacteria 1860
106 Ga0070705_100239916 3300005440 Bacteria 1266
107 Ga0070700_100018478 3300005441 Bacteria 4008
108 Ga0070700_100055162 3300005441 Bacteria 2486
109 Ga0070700_100096209 3300005441 Bacteria 1942
110 Ga0070694_100020492 3300005444 Bacteria 4215
111 Ga0070663_100053567 3300005455 Bacteria 2880
112 Ga0070663_100161100 3300005455 Unclassified 1727
113 Ga0070663_100210261 3300005455 Bacteria 1523
114 Ga0070678_100000839 3300005456 Bacteria 15604
115 Ga0070678_100000866 3300005456 Bacteria 15460
116 Ga0070678_100004463 3300005456 Bacteria 7939
117 Ga0070678_100030306 3300005456 Bacteria 3717
118 Ga0070678_100117636 3300005456 Bacteria 2090
119 Ga0070678_100204362 3300005456 Bacteria 1632
120 Ga0070662_100003122 3300005457 Bacteria 10290
121 Ga0070662_100037163 3300005457 Bacteria 3451
122 Ga0070662_100038322 3300005457 Bacteria 3404
123 Ga0070681_10001792 3300005458 Bacteria 19299
124 Ga0068867_100016264 3300005459 Bacteria 5283
125 Ga0068867_100017535 3300005459 Bacteria 5084
126 Ga0068867_100019516 3300005459 Bacteria 4830
127 Ga0068867_100022276 3300005459 Bacteria 4529
128 Ga0068867_100038132 3300005459 Bacteria 3497
129 Ga0068867_100041022 3300005459 Bacteria 3381
130 Ga0068867_100053828 3300005459 Bacteria 2972
131 Ga0070685_10009513 3300005466 Bacteria 5025
132 Ga0070685_10061390 3300005466 Bacteria 2201
133 Ga0070679_100022366 3300005530 Bacteria 6180
134 Ga0070679_100151971 3300005530 Bacteria 2291
135 Ga0070684_100011722 3300005535 Bacteria 6991
136 Ga0068853_100015937 3300005539 Bacteria 6178
137 Ga0068853_100087872 3300005539 Bacteria 2728
138 Ga0068853_100139783 3300005539 Bacteria 2173
139 Ga0068853_100175578 3300005539 Bacteria 1940
140 Ga0070672_100004134 3300005543 Bacteria 9471
141 Ga0070672_100007156 3300005543 Bacteria 7549
142 Ga0070672_100016891 3300005543 Bacteria 5237
143 Ga0070672_100017800 3300005543 Bacteria 5121
144 Ga0070672_100036753 3300005543 Bacteria 3733
145 Ga0070672_100084575 3300005543 Bacteria 2548
146 Ga0070672_100086681 3300005543 Bacteria 2518
147 Ga0070672_100135395 3300005543 Bacteria 2028
148 Ga0070672_100177104 3300005543 Bacteria 1776
149 Ga0070686_100124150 3300005544 Bacteria 1777
150 Ga0070695_100251306 3300005545 Bacteria 1287
151 Ga0070693_100034874 3300005547 Bacteria 2786
152 Ga0070693_100122485 3300005547 Bacteria 1615
153 Ga0070665_100007878 3300005548 Bacteria 10803
154 Ga0070665_100032565 3300005548 Bacteria 5246
155 Ga0070665_100042646 3300005548 Bacteria 4561
156 Ga0070665_100358611 3300005548 Bacteria 1464
157 Ga0070704_100002887 3300005549 Bacteria 9752
158 Ga0070704_100086973 3300005549 Bacteria 2318
159 Ga0070704_100205984 3300005549 Bacteria 1591
160 Ga0068855_100022200 3300005563 Bacteria 7606
161 Ga0068855_100029129 3300005563 Bacteria 6603
162 Ga0070664_100029270 3300005564 Bacteria 4591
163 Ga0070664_100083959 3300005564 Bacteria 2748
164 Ga0070664_100305947 3300005564 Bacteria 1437
165 Ga0070664_100340737 3300005564 Bacteria 1362
166 Ga0070664_100409484 3300005564 Bacteria 1241
167 Ga0068857_100076298 3300005577 Bacteria 2989
168 Ga0068857_100283451 3300005577 Bacteria 1524
169 Ga0068854_100024181 3300005578 Bacteria 4157
170 Ga0068854_100060396 3300005578 Bacteria 2742
171 Ga0068856_100057133 3300005614 Bacteria 3852
172 Ga0068856_100057426 3300005614 Bacteria 3842
173 Ga0068856_100329051 3300005614 Bacteria 1545
174 Ga0070702_100001034 3300005615 Bacteria 11047
175 Ga0070702_100087932 3300005615 Bacteria 1878
176 Ga0068852_100004082 3300005616 Bacteria 10272
177 Ga0068852_100017634 3300005616 Bacteria 5607
178 Ga0068852_100056948 3300005616 Bacteria 3380
179 Ga0068859_100002681 3300005617 Bacteria 18084
180 Ga0068859_100196983 3300005617 Bacteria 2099
181 Ga0068864_100001940 3300005618 Bacteria 16988
182 Ga0068864_100005972 3300005618 Bacteria 9990
183 Ga0068864_100009587 3300005618 Bacteria 7983
184 Ga0068864_100021040 3300005618 Bacteria 5462
185 Ga0068864_100023316 3300005618 Bacteria 5196
186 Ga0068864_100036204 3300005618 Bacteria 4205
187 Ga0068864_100040559 3300005618 Bacteria 3982
188 Ga0068864_100059983 3300005618 Bacteria 3293
189 Ga0068864_100083100 3300005618 Bacteria 2812
190 Ga0068864_100297595 3300005618 Bacteria 1510
191 Ga0068866_10004181 3300005718 Bacteria 5922
192 Ga0068866_10128645 3300005718 Bacteria 1437
193 Ga0068861_100002784 3300005719 Bacteria 11480
194 Ga0068861_100015642 3300005719 Bacteria 5352
195 Ga0068861_100035573 3300005719 Bacteria 3690
196 Ga0068861_100036669 3300005719 Bacteria 3641
197 Ga0068861_100235584 3300005719 Bacteria 1555
198 Ga0068861_100334244 3300005719 Bacteria 1324
199 Ga0068851_10029868 3300005834 Bacteria 2700
200 Ga0068851_10067475 3300005834 Bacteria 1845
201 Ga0068870_10029609 3300005840 Bacteria 2759
202 Ga0068870_10036327 3300005840 Bacteria 2534
203 Ga0068870_10069124 3300005840 Bacteria 1921
204 Ga0068863_100009693 3300005841 Bacteria 9397
205 Ga0068863_100009737 3300005841 Bacteria 9376
206 Ga0068863_100029987 3300005841 Bacteria 5195
207 Ga0068863_100059193 3300005841 Bacteria 3624
208 Ga0068863_100209511 3300005841 Bacteria 1877
209 Ga0068863_100237649 3300005841 Bacteria 1758
210 Ga0068858_100002388 3300005842 Bacteria 18996
211 Ga0068858_100004577 3300005842 Bacteria 13542
212 Ga0068858_100009307 3300005842 Bacteria 9376
213 Ga0068858_100034298 3300005842 Bacteria 4707
214 Ga0068858_100076040 3300005842 Bacteria 3119
215 Ga0068860_100005427 3300005843 Bacteria 12929
216 Ga0068860_100011379 3300005843 Bacteria 8768
217 Ga0068860_100073355 3300005843 Bacteria 3253
218 Ga0068860_100085441 3300005843 Bacteria 3002
219 Ga0068860_100086376 3300005843 Bacteria 2985
220 Ga0068860_100177275 3300005843 Bacteria 2060
221 Ga0068862_100018506 3300005844 Bacteria 5802
222 Ga0068862_100046400 3300005844 Bacteria 3707
223 Ga0068862_100075270 3300005844 Bacteria 2920
224 Ga0068862_100082185 3300005844 Bacteria 2795
225 Ga0068862_100093130 3300005844 Bacteria 2627
226 Ga0068862_100111733 3300005844 Bacteria 2399
227 Ga0068862_100398043 3300005844 Bacteria 1288
228 Ga0081455_10163125 3300005937 Bacteria 1706
229 Ga0081538_10092648 3300005981 Bacteria 1555
230 Ga0075365_10001711 3300006038 Bacteria 10157
231 Ga0075365_10038124 3300006038 Bacteria 3122
232 Ga0075368_10002491 3300006042 Bacteria 6025
233 Ga0075363_100024045 3300006048 Bacteria 3094
234 Ga0075363_100024902 3300006048 Bacteria 3046
235 Ga0075363_100100398 3300006048 Bacteria 1601
236 Ga0075364_10069037 3300006051 Bacteria 2325
237 Ga0070712_100266853 3300006175 Bacteria 1374
238 Ga0075362_10007436 3300006177 Bacteria 4150
239 Ga0075362_10034704 3300006177 Bacteria 2199
240 Ga0075367_10052682 3300006178 Bacteria 2409
241 Ga0075367_10086602 3300006178 Bacteria 1902
242 Ga0075366_10001985 3300006195 Bacteria 10354
243 Ga0075366_10017317 3300006195 Bacteria 4147
244 Ga0075366_10065299 3300006195 Bacteria 2165
245 Ga0097621_100004472 3300006237 Bacteria 9743
246 Ga0097621_100014066 3300006237 Bacteria 5980
247 Ga0097621_100128809 3300006237 Bacteria 2152
248 Ga0075370_10003250 3300006353 Bacteria 7697
249 Ga0075370_10014243 3300006353 Bacteria 4239
250 Ga0068871_100003086 3300006358 Bacteria 11430
251 Ga0068871_100007556 3300006358 Bacteria 7775
252 Ga0068871_100009054 3300006358 Bacteria 7189
253 Ga0068871_100012450 3300006358 Bacteria 6272
254 Ga0068871_100075832 3300006358 Bacteria 2776
255 Ga0068871_100226439 3300006358 Bacteria 1622
256 Ga0075428_100019621 3300006844 Bacteria 7481
257 Ga0075428_100025402 3300006844 Bacteria 6556
258 Ga0075428_100032142 3300006844 Bacteria 5797
259 Ga0075428_100040584 3300006844 Bacteria 5119
260 Ga0075428_100253459 3300006844 Bacteria 1896
261 Ga0075430_100000319 3300006846 Bacteria 34222
262 Ga0075430_100012270 3300006846 Bacteria 7292
263 Ga0075431_100000481 3300006847 Bacteria 33062
264 Ga0075431_100004976 3300006847 Bacteria 13080
265 Ga0075431_100071946 3300006847 Bacteria 3568
266 Ga0075431_100180554 3300006847 Bacteria 2166
267 Ga0075429_100000272 3300006880 Bacteria 36248
268 Ga0075429_100097182 3300006880 Bacteria 2569
269 Ga0068865_100004681 3300006881 Bacteria 8265
270 Ga0068865_100037843 3300006881 Bacteria 3261
271 Ga0068865_100248675 3300006881 Bacteria 1402
272 Ga0097620_100002681 3300006931 Bacteria 18084
273 Ga0097620_100196991 3300006931 Bacteria 2099
274 Ga0105240_10017289 3300009093 Bacteria 9725
275 Ga0105240_10020319 3300009093 Bacteria 8862
276 Ga0105240_10117358 3300009093 Bacteria 3208
277 Ga0111539_10002444 3300009094 Bacteria 24696
278 Ga0111539_10551601 3300009094 Bacteria 1342
279 Ga0105245_10011564 3300009098 Bacteria 7688
280 Ga0105245_10214697 3300009098 Bacteria 1853
281 Ga0105245_10511891 3300009098 Bacteria 1218
282 Ga0105247_10015314 3300009101 Bacteria 4595
283 Ga0105247_10030315 3300009101 Bacteria 3278
284 Ga0114129_10001244 3300009147 Bacteria 33939
285 Ga0105243_10100171 3300009148 Bacteria 2403
286 Ga0105243_10124051 3300009148 Bacteria 2182
287 Ga0105243_10151701 3300009148 Bacteria 1988
288 Ga0105243_10168844 3300009148 Bacteria 1893
289 Ga0105243_10550393 3300009148 Bacteria 1102
290 Ga0105241_10102465 3300009174 Bacteria 2278
291 Ga0105241_10102798 3300009174 Bacteria 2274
292 Ga0105241_10218659 3300009174 Bacteria 1600
293 Ga0105241_10234750 3300009174 Bacteria 1547
294 Ga0105242_10177777 3300009176 Bacteria 1875
295 Ga0105242_10374497 3300009176 Bacteria 1322
296 Ga0105248_10012417 3300009177 Bacteria 9395
297 Ga0105248_10018837 3300009177 Bacteria 7635
298 Ga0105248_10021746 3300009177 Bacteria 7107
299 Ga0105248_10039908 3300009177 Bacteria 5263
300 Ga0105248_10045611 3300009177 Bacteria 4915
301 Ga0105248_10110242 3300009177 Bacteria 3103
302 Ga0105248_10123037 3300009177 Bacteria 2927
303 Ga0105248_10234668 3300009177 Bacteria 2065
304 Ga0105248_10245305 3300009177 Bacteria 2016
305 Ga0105237_10056267 3300009545 Bacteria 3937
306 Ga0105237_10132828 3300009545 Bacteria 2484
307 Ga0105237_10315568 3300009545 Bacteria 1566
308 Ga0105238_10008099 3300009551 Bacteria 10512
309 Ga0105238_10097998 3300009551 Bacteria 2916
310 Ga0105238_10144442 3300009551 Bacteria 2356
311 Ga0105238_10172696 3300009551 Bacteria 2138
312 Ga0105238_10240557 3300009551 Bacteria 1787
313 Ga0105238_10244089 3300009551 Bacteria 1774
314 Ga0105249_10004214 3300009553 Bacteria 12429
315 Ga0105249_10067323 3300009553 Bacteria 3299
316 Ga0105249_10177960 3300009553 Bacteria 2067
317 Ga0105028_102144 3300009993 Bacteria 2073
318 Ga0105239_10099437 3300010375 Bacteria 3216
319 Ga0105239_10108243 3300010375 Bacteria 3080
320 Ga0105239_10135367 3300010375 Bacteria 2743
321 Ga0105246_10058976 3300011119 Bacteria 2661
322 Ga0105246_10065315 3300011119 Bacteria 2544
323 Ga0157373_10002979 3300013100 Bacteria 12820
324 Ga0157371_10032495 3300013102 Bacteria 3755
325 Ga0157370_10347207 3300013104 Bacteria 1368
326 Ga0157369_10026731 3300013105 Bacteria 6401
327 Ga0157369_10027926 3300013105 Bacteria 6249
328 Ga0157374_10001747 3300013296 Bacteria 18243
329 Ga0157374_10091386 3300013296 Bacteria 2903
330 Ga0157374_10215132 3300013296 Bacteria 1885
331 Ga0157378_10012368 3300013297 Bacteria 7474
332 Ga0157378_10040285 3300013297 Bacteria 4142
333 Ga0157378_10324447 3300013297 Bacteria 1497
334 Ga0157378_10340734 3300013297 Bacteria 1462
335 Ga0163162_10001342 3300013306 Bacteria 22916
336 Ga0163162_10005347 3300013306 Bacteria 12394
337 Ga0163162_10010347 3300013306 Bacteria 9067
338 Ga0163162_10046780 3300013306 Bacteria 4337
339 Ga0163162_10053652 3300013306 Bacteria 4052
340 Ga0163162_10062839 3300013306 Bacteria 3754
341 Ga0163162_10288491 3300013306 Bacteria 1773
342 Ga0163162_10438189 3300013306 Bacteria 1439
343 Ga0157375_10007223 3300013308 Bacteria 9714
344 Ga0157375_10033464 3300013308 Bacteria 4885
345 Ga0157375_10040018 3300013308 Bacteria 4515
346 Ga0157375_10120989 3300013308 Bacteria 2727
347 Ga0157375_10126305 3300013308 Bacteria 2673
348 Ga0157375_10310752 3300013308 Bacteria 1740
349 Ga0157375_10742346 3300013308 Bacteria 1133
350 Ga0163163_10005988 3300014325 Bacteria 10575
351 Ga0163163_10327202 3300014325 Bacteria 1587
352 Ga0157380_10040456 3300014326 Bacteria 3631
353 Ga0157380_10051815 3300014326 Bacteria 3248
354 Ga0157380_10061449 3300014326 Bacteria 3006
355 Ga0157380_10145507 3300014326 Bacteria 2042
356 Ga0157380_10182332 3300014326 Bacteria 1846
357 Ga0182008_10005888 3300014497 Bacteria 6928
358 Ga0157377_10006730 3300014745 Bacteria 5504
359 Ga0157379_10002891 3300014968 Bacteria 14487
360 Ga0157379_10037151 3300014968 Bacteria 4342
361 Ga0157379_10042091 3300014968 Bacteria 4077
362 Ga0157376_10003982 3300014969 Bacteria 10210
363 Ga0157376_10005753 3300014969 Bacteria 8684
364 Ga0157376_10057186 3300014969 Bacteria 3261
365 Ga0157376_10059146 3300014969 Bacteria 3213
366 Ga0157376_10165680 3300014969 Bacteria 2008
367 Ga0163161_10034763 3300017792 Bacteria 3605
368 Ga0163161_10039737 3300017792 Bacteria 3379
369 Ga0163161_10107466 3300017792 Bacteria 2083
370 Ga0163161_10110147 3300017792 Bacteria 2058
371 Ga0163161_10114593 3300017792 Bacteria 2019
372 Ga0163161_10156907 3300017792 Bacteria 1733
373 Ga0213875_10034816 3300021388 Unclassified 2377
374 Ga0209673_1029447 3300025273 Bacteria 1748
375 Ga0209130_1019002 3300025284 Bacteria 1603
376 Ga0209675_1012350 3300025291 Bacteria 2759
377 Ga0209758_1010165 3300025297 Bacteria 5688
378 Ga0209051_1000272 3300025303 Bacteria 86518
379 Ga0209257_1000055 3300025304 Bacteria 415534
380 Ga0207697_10011006 3300025315 Bacteria 3839
381 Ga0207697_10013163 3300025315 Bacteria 3454
382 Ga0207697_10025959 3300025315 Bacteria 2395
383 Ga0207656_10014296 3300025321 Bacteria 3054
384 Ga0207656_10056901 3300025321 Bacteria 1706
385 Ga0207682_10001362 3300025893 Bacteria 11271
386 Ga0207682_10032993 3300025893 Bacteria 2082
387 Ga0207688_10000411 3300025901 Bacteria 20090
388 Ga0207688_10013627 3300025901 Bacteria 4420
389 Ga0207688_10045138 3300025901 Bacteria 2458
390 Ga0207688_10054263 3300025901 Bacteria 2248
391 Ga0207688_10190076 3300025901 Bacteria 1227
392 Ga0207680_10002766 3300025903 Bacteria 8204
393 Ga0207680_10036708 3300025903 Bacteria 2824
394 Ga0207645_10003339 3300025907 Bacteria 12235
395 Ga0207645_10024371 3300025907 Bacteria 3924
396 Ga0207645_10026044 3300025907 Bacteria 3782
397 Ga0207645_10027324 3300025907 Bacteria 3686
398 Ga0207645_10035195 3300025907 Bacteria 3216
399 Ga0207643_10001425 3300025908 Bacteria 13707
400 Ga0207643_10022298 3300025908 Bacteria 3485
401 Ga0207643_10023594 3300025908 Bacteria 3392
402 Ga0207705_10155675 3300025909 Bacteria 1714
403 Ga0207705_10168880 3300025909 Bacteria 1646
404 Ga0207707_10007221 3300025912 Bacteria 9669
405 Ga0207707_10041388 3300025912 Bacteria 4024
406 Ga0207695_10139036 3300025913 Bacteria 2379
407 Ga0207695_10154785 3300025913 Bacteria 2228
408 Ga0207671_10139163 3300025914 Bacteria 1869
409 Ga0207693_10258307 3300025915 Bacteria 1366
410 Ga0207660_10004146 3300025917 Bacteria 9430
411 Ga0207662_10005817 3300025918 Bacteria 6606
412 Ga0207662_10050066 3300025918 Bacteria 2480
413 Ga0207662_10179220 3300025918 Bacteria 1363
414 Ga0207657_10002699 3300025919 Bacteria 19136
415 Ga0207657_10098505 3300025919 Bacteria 2430
416 Ga0207657_10220485 3300025919 Bacteria 1520
417 Ga0207652_10047099 3300025921 Bacteria 3682
418 Ga0207652_10055438 3300025921 Bacteria 3409
419 Ga0207681_10003668 3300025923 Bacteria 9544
420 Ga0207681_10009109 3300025923 Bacteria 6064
421 Ga0207681_10018913 3300025923 Bacteria 4345
422 Ga0207681_10043519 3300025923 Bacteria 3005
423 Ga0207681_10123673 3300025923 Bacteria 1901
424 Ga0207681_10145845 3300025923 Bacteria 1768
425 Ga0207681_10249045 3300025923 Bacteria 1386
426 Ga0207681_10273928 3300025923 Bacteria 1326
427 Ga0207694_10142644 3300025924 Bacteria 1927
428 Ga0207694_10333191 3300025924 Bacteria 1254
429 Ga0207650_10005456 3300025925 Bacteria 8680
430 Ga0207650_10029833 3300025925 Bacteria 3924
431 Ga0207650_10033505 3300025925 Bacteria 3721
432 Ga0207650_10049858 3300025925 Bacteria 3093
433 Ga0207650_10064050 3300025925 Bacteria 2751
434 Ga0207650_10140443 3300025925 Bacteria 1898
435 Ga0207659_10000489 3300025926 Bacteria 23834
436 Ga0207659_10001915 3300025926 Bacteria 12342
437 Ga0207659_10003913 3300025926 Bacteria 8984
438 Ga0207659_10013639 3300025926 Bacteria 5213
439 Ga0207659_10015637 3300025926 Bacteria 4923
440 Ga0207659_10026428 3300025926 Bacteria 3916
441 Ga0207659_10079980 3300025926 Bacteria 2413
442 Ga0207687_10084656 3300025927 Bacteria 2299
443 Ga0207687_10245379 3300025927 Bacteria 1421
444 Ga0207687_10249896 3300025927 Bacteria 1409
445 Ga0207687_10336881 3300025927 Bacteria 1225
446 Ga0207644_10000440 3300025931 Bacteria 26885
447 Ga0207644_10017335 3300025931 Bacteria 4862
448 Ga0207644_10067036 3300025931 Bacteria 2615
449 Ga0207644_10398123 3300025931 Bacteria 1125
450 Ga0207706_10001936 3300025933 Bacteria 20313
451 Ga0207706_10009759 3300025933 Bacteria 8811
452 Ga0207706_10078092 3300025933 Bacteria 2912
453 Ga0207686_10143336 3300025934 Bacteria 1654
454 Ga0207709_10101544 3300025935 Bacteria 1903
455 Ga0207709_10104478 3300025935 Bacteria 1880
456 Ga0207709_10299092 3300025935 Bacteria 1196
457 Ga0207709_10312497 3300025935 Bacteria 1173
458 Ga0207669_10008595 3300025937 Bacteria 4802
459 Ga0207669_10019762 3300025937 Bacteria 3516
460 Ga0207669_10045926 3300025937 Bacteria 2577
461 Ga0207669_10106707 3300025937 Bacteria 1866
462 Ga0207669_10263083 3300025937 Bacteria 1291
463 Ga0207704_10014203 3300025938 Bacteria 4015
464 Ga0207704_10024167 3300025938 Bacteria 3290
465 Ga0207704_10039214 3300025938 Bacteria 2756
466 Ga0207704_10064102 3300025938 Bacteria 2294
467 Ga0207691_10001672 3300025940 Bacteria 21925
468 Ga0207691_10001953 3300025940 Bacteria 20127
469 Ga0207691_10002980 3300025940 Bacteria 16526
470 Ga0207691_10009947 3300025940 Bacteria 9134
471 Ga0207691_10015104 3300025940 Bacteria 7348
472 Ga0207691_10052408 3300025940 Bacteria 3727
473 Ga0207691_10079757 3300025940 Bacteria 2945
474 Ga0207691_10186667 3300025940 Bacteria 1810
475 Ga0207691_10281963 3300025940 Bacteria 1429
476 Ga0207711_10001723 3300025941 Bacteria 20076
477 Ga0207711_10002271 3300025941 Bacteria 17262
478 Ga0207711_10003157 3300025941 Bacteria 14362
479 Ga0207711_10032833 3300025941 Bacteria 4390
480 Ga0207689_10000284 3300025942 Bacteria 46090
481 Ga0207689_10002774 3300025942 Bacteria 16198
482 Ga0207689_10008263 3300025942 Bacteria 9071
483 Ga0207689_10010981 3300025942 Bacteria 7787
484 Ga0207689_10033860 3300025942 Bacteria 4244
485 Ga0207661_10202051 3300025944 Bacteria 1747
486 Ga0207679_10019489 3300025945 Bacteria 4558
487 Ga0207679_10031315 3300025945 Bacteria 3722
488 Ga0207679_10083958 3300025945 Unclassified 2443
489 Ga0207679_10152945 3300025945 Bacteria 1880
490 Ga0207667_10017213 3300025949 Bacteria 8143
491 Ga0207667_10580856 3300025949 Bacteria 1131
492 Ga0207651_10001637 3300025960 Bacteria 10281
493 Ga0207651_10003747 3300025960 Bacteria 7523
494 Ga0207651_10030890 3300025960 Bacteria 3417
495 Ga0207651_10039671 3300025960 Bacteria 3107
496 Ga0207651_10109674 3300025960 Bacteria 2069
497 Ga0207651_10150554 3300025960 Bacteria 1810
498 Ga0207651_10217811 3300025960 Bacteria 1541
499 Ga0207712_10007655 3300025961 Bacteria 6831
500 Ga0207712_10114457 3300025961 Bacteria 2029
501 Ga0207712_10285743 3300025961 Bacteria 1348
502 Ga0207668_10003274 3300025972 Bacteria 9493
503 Ga0207668_10005494 3300025972 Bacteria 7470
504 Ga0207668_10074754 3300025972 Bacteria 2434
505 Ga0207668_10163240 3300025972 Bacteria 1738
506 Ga0207668_10167525 3300025972 Bacteria 1719
507 Ga0207640_10017173 3300025981 Bacteria 4227
508 Ga0207640_10129447 3300025981 Bacteria 1822
509 Ga0207658_10003036 3300025986 Bacteria 11999
510 Ga0207658_10016033 3300025986 Bacteria 5147
511 Ga0207658_10041412 3300025986 Bacteria 3335
512 Ga0207658_10065172 3300025986 Bacteria 2735
513 Ga0207658_10198237 3300025986 Bacteria 1674
514 Ga0207677_10002416 3300026023 Bacteria 9797
515 Ga0207677_10004673 3300026023 Bacteria 7378
516 Ga0207677_10007814 3300026023 Bacteria 5938
517 Ga0207677_10083500 3300026023 Bacteria 2299
518 Ga0207677_10123110 3300026023 Bacteria 1955
519 Ga0207703_10006503 3300026035 Bacteria 9329
520 Ga0207703_10013570 3300026035 Bacteria 6347
521 Ga0207703_10022401 3300026035 Bacteria 4955
522 Ga0207703_10023566 3300026035 Bacteria 4837
523 Ga0207703_10253692 3300026035 Bacteria 1587
524 Ga0207678_10007008 3300026067 Bacteria 10004
525 Ga0207678_10010648 3300026067 Bacteria 8080
526 Ga0207678_10078600 3300026067 Bacteria 2825
527 Ga0207678_10089401 3300026067 Unclassified 2633
528 Ga0207678_10170457 3300026067 Bacteria 1858
529 Ga0207678_10241157 3300026067 Bacteria 1548
530 Ga0207708_10003811 3300026075 Bacteria 11117
531 Ga0207708_10029269 3300026075 Bacteria 4173
532 Ga0207708_10089458 3300026075 Bacteria 2373
533 Ga0207708_10155191 3300026075 Bacteria 1805
534 Ga0207702_10024004 3300026078 Bacteria 5060
535 Ga0207702_10043419 3300026078 Bacteria 3774
536 Ga0207702_10066859 3300026078 Bacteria 3083
537 Ga0207702_10162852 3300026078 Bacteria 2038
538 Ga0207641_10006088 3300026088 Bacteria 10214
539 Ga0207641_10013843 3300026088 Bacteria 6616
540 Ga0207641_10016227 3300026088 Bacteria 6100
541 Ga0207641_10019101 3300026088 Bacteria 5621
542 Ga0207641_10019127 3300026088 Bacteria 5617
543 Ga0207641_10023350 3300026088 Bacteria 5096
544 Ga0207641_10135902 3300026088 Bacteria 2213
545 Ga0207648_10000585 3300026089 Bacteria 40840
546 Ga0207648_10007574 3300026089 Bacteria 10651
547 Ga0207648_10011125 3300026089 Bacteria 8488
548 Ga0207648_10013819 3300026089 Bacteria 7489
549 Ga0207648_10015261 3300026089 Bacteria 7067
550 Ga0207648_10028121 3300026089 Bacteria 4987
551 Ga0207648_10070362 3300026089 Bacteria 3050
552 Ga0207648_10075862 3300026089 Bacteria 2930
553 Ga0207648_10168440 3300026089 Bacteria 1936
554 Ga0207676_10005447 3300026095 Bacteria 9004
555 Ga0207676_10006093 3300026095 Bacteria 8509
556 Ga0207676_10015912 3300026095 Bacteria 5441
557 Ga0207676_10017484 3300026095 Bacteria 5197
558 Ga0207676_10026747 3300026095 Bacteria 4291
559 Ga0207676_10034652 3300026095 Bacteria 3823
560 Ga0207676_10127141 3300026095 Bacteria 2160
561 Ga0207674_10012155 3300026116 Bacteria 9638
562 Ga0207674_10031146 3300026116 Bacteria 5605
563 Ga0207674_10205907 3300026116 Bacteria 1917
564 Ga0207674_10207804 3300026116 Bacteria 1907
565 Ga0207674_10275856 3300026116 Bacteria 1629
566 Ga0207675_100001107 3300026118 Bacteria 26669
567 Ga0207675_100003203 3300026118 Bacteria 16052
568 Ga0207675_100003350 3300026118 Bacteria 15673
569 Ga0207675_100049590 3300026118 Bacteria 3917
570 Ga0207675_100052291 3300026118 Bacteria 3812
571 Ga0207675_100091777 3300026118 Bacteria 2856
572 Ga0207683_10000704 3300026121 Bacteria 30489
573 Ga0207683_10001491 3300026121 Bacteria 21111
574 Ga0207683_10005317 3300026121 Bacteria 11040
575 Ga0207683_10005998 3300026121 Bacteria 10407
576 Ga0207683_10007493 3300026121 Bacteria 9356
577 Ga0207683_10011907 3300026121 Bacteria 7422
578 Ga0207683_10024038 3300026121 Bacteria 5244
579 Ga0207683_10216203 3300026121 Bacteria 1746
580 Ga0207698_10557466 3300026142 Bacteria 1124
581 Ga0210000_1004854 3300027462 Bacteria 1947
582 Ga0209968_1010145 3300027526 Bacteria 1446
583 Ga0209813_10027812 3300027866 Bacteria 1645
584 Ga0209974_10045517 3300027876 Bacteria 1465
585 Ga0207428_10001178 3300027907 Bacteria 28140
586 Ga0207428_10073491 3300027907 Bacteria 2682
587 Ga0268266_10007037 3300028379 Bacteria 10212
588 Ga0268266_10007392 3300028379 Bacteria 9918
589 Ga0268266_10126527 3300028379 Bacteria 2281
590 Ga0268266_10137815 3300028379 Bacteria 2187
591 Ga0268265_10036945 3300028380 Bacteria 3581
592 Ga0268265_10055764 3300028380 Bacteria 3004
593 Ga0268264_10003913 3300028381 Bacteria 12755
594 Ga0268264_10018355 3300028381 Bacteria 5720
595 Ga0268264_10059738 3300028381 Bacteria 3195
596 Ga0268264_10085250 3300028381 Bacteria 2711
597 Ga0268264_10093564 3300028381 Bacteria 2597
598 Ga0307515_10000152 3300028794 Bacteria 167305
599 Ga0307515_10205356 3300028794 Bacteria 1832
600 Ga0307515_10227378 3300028794 Bacteria 1667
601 Ga0307511_10000043 3300030521 Bacteria 101232
602 Ga0265325_10013325 3300031241 Bacteria 4684
603 Ga0307513_10056083 3300031456 Bacteria 4210
604 Ga0307408_100010963 3300031548 Bacteria 5980
605 Ga0307408_100181120 3300031548 Bacteria 1690
606 Ga0307508_10017344 3300031616 Bacteria 6544
607 Ga0265314_10020832 3300031711 Bacteria 5056
608 Ga0265314_10046206 3300031711 Bacteria 3074
609 Ga0316576_10004332 3300031727 Bacteria 8490
610 Ga0316578_10025602 3300031728 Bacteria 3319
611 Ga0307516_10009418 3300031730 Bacteria 10891
612 Ga0307405_10007144 3300031731 Bacteria 5553
613 Ga0307405_10098415 3300031731 Bacteria 1955
614 Ga0307413_10006777 3300031824 Bacteria 5265
615 Ga0307413_10022710 3300031824 Bacteria 3387
616 Ga0307413_10048448 3300031824 Bacteria 2540
617 Ga0307413_10107531 3300031824 Bacteria 1859
618 Ga0307413_10219154 3300031824 Bacteria 1388
619 Ga0307410_10049862 3300031852 Bacteria 2812
620 Ga0307406_10003754 3300031901 Bacteria 8259
621 Ga0307406_10017952 3300031901 Bacteria 4126
622 Ga0307406_10066401 3300031901 Bacteria 2348
623 Ga0307407_10110713 3300031903 Bacteria 1723
624 Ga0307412_10052651 3300031911 Bacteria 2696
625 Ga0307412_10105785 3300031911 Bacteria 1999
626 Ga0307409_100002822 3300031995 Bacteria 9186
627 Ga0307409_100103769 3300031995 Bacteria 2366
628 Ga0307409_100501812 3300031995 Bacteria 1182
629 Ga0307416_100005326 3300032002 Bacteria 7889
630 Ga0307416_100063038 3300032002 Bacteria 3034
631 Ga0307416_100127763 3300032002 Bacteria 2280
632 Ga0307416_100355537 3300032002 Bacteria 1484
633 Ga0307411_10000754 3300032005 Bacteria 11945
634 Ga0307411_10110117 3300032005 Bacteria 1968
635 Ga0307415_100035721 3300032126 Bacteria 3248
636 Ga0307507_10032564 3300033179 Bacteria 5438
637 Ga0373941_0041241 3300035115 Bacteria 1428
638 Ga0373945_0023118 3300035116 Bacteria 2146
639 Ga0373943_0095990 3300035170 Bacteria 1543
640 Ga0373931_0003551 3300035691 Bacteria 7032
641 Ga0373931_0034639 3300035691 Bacteria 2622
642 Ga0373927_0076141 3300035695 Bacteria 2173
643 Ga0373927_0127927 3300035695 Bacteria 1659
644 Ga0373925_0038576 3300037068 Bacteria 3532
645 Ga0395899_0008753 3300037312 Bacteria 7789
646 Ga0395899_0039593 3300037312 Bacteria 3527
647 Ga0395900_0004850 3300037418 Bacteria 14170
648 Ga0395900_0042887 3300037418 Bacteria 4661
649 Ga0395898_0007453 3300037466 Bacteria 11615
650 Ga0395898_0019113 3300037466 Bacteria 6975
651 Ga0395898_0124148 3300037466 Bacteria 2473
652 Ga0395898_0191143 3300037466 Bacteria 1956
653 Ga0395905_0000811 3300037471 Bacteria 41049
654 Ga0395905_0005128 3300037471 Bacteria 13457
655 Ga0395905_0009567 3300037471 Bacteria 9463
656 Ga0395905_0031216 3300037471 Bacteria 5017
657 Ga0395905_0032813 3300037471 Bacteria 4881
658 Ga0395905_0064592 3300037471 Bacteria 3425
659 Ga0395905_0095276 3300037471 Bacteria 2794
660 Ga0395905_0345914 3300037471 Bacteria 1378
661 Ga0436364_1172960 3300037853 Bacteria 5187
662 Ga0395901_0014806 3300038443 Bacteria 7925
663 Ga0395901_0022205 3300038443 Bacteria 6503
664 Ga0395901_0078986 3300038443 Bacteria 3435
665 Ga0395901_0217299 3300038443 Bacteria 1999
666 Ga0436363_0744681 3300039450 Bacteria 2353
667 Ga0439436_0000292 3300041404 Bacteria 12116
668 Ga0439439_0000873 3300041406 Bacteria 5557
669 Ga0439447_004752 3300041407 Bacteria 4628
670 Ga0439461_0037197 3300041410 Bacteria 1039
671 Ga0439466_0000854 3300041411 Bacteria 11623
672 Ga0439465_0000034 3300041413 Bacteria 28027
673 Ga0451807_2064625 3300041486 Bacteria 1935
674 Ga0439431_0000727 3300041997 Bacteria 7098
675 Ga0439433_0000945 3300041999 Bacteria 5826
676 Ga0439433_0011888 3300041999 Bacteria 1908
677 Ga0439441_000131 3300042001 Bacteria 6309
678 Ga0439441_000190 3300042001 Bacteria 5599
679 Ga0439441_014538 3300042001 Bacteria 1381
680 Ga0439442_019243 3300042002 Bacteria 1413
681 Ga0439443_000733 3300042003 Bacteria 3195
682 Ga0439445_0000511 3300042004 Bacteria 7863
683 Ga0439432_001169 3300042006 Bacteria 9941
684 Ga0439449_0001078 3300042007 Bacteria 10742
685 Ga0439451_002494 3300042009 Bacteria 3732
686 Ga0439452_001608 3300042010 Bacteria 8924
687 Ga0439452_005875 3300042010 Bacteria 3907
688 Ga0439462_0010372 3300042015 Bacteria 2359
689 Ga0439462_0015675 3300042015 Bacteria 1955
690 Ga0450921_001595 3300042123 Bacteria 1398
691 Ga0450898_004537 3300042134 Bacteria 2058
692 Ga0450906_003692 3300042145 Bacteria 3258
693 Ga0439446_0002778 3300042156 Bacteria 4248
694 Ga0439434_0030207 3300042435 Bacteria 1644
695 Ga0439434_0036357 3300042435 Bacteria 1506
696 Ga0439435_0000156 3300042436 Bacteria 9343
697 Ga0439435_0043336 3300042436 Bacteria 1265
698 Ga0439444_0002504 3300042437 Bacteria 2516
699 Ga0439460_0000463 3300042461 Bacteria 8787
700 Ga0450893_0007500 3300042532 Bacteria 1773
701 Ga0451577_0045590 3300042876 Bacteria 3924
702 Ga0466969_0044435 3300044656 Bacteria 2209
703 Ga0466969_0061894 3300044656 Bacteria 1817
704 Ga0466972_0065528 3300044658 Bacteria 1737
705 Ga0453683_0000089 3300044673 Bacteria 137069
706 Ga0466966_0014289 3300044684 Bacteria 5255
707 Ga0466966_0130847 3300044684 Bacteria 1537
708 Ga0466961_0121530 3300044693 Bacteria 1639
709 Ga0453684_0426461 3300044712 Bacteria 1480
710 Ga0453684_0506227 3300044712 Bacteria 1336
711 Ga0466968_0096792 3300044735 Bacteria 1314
712 Ga0466970_0005106 3300044765 Bacteria 6483
713 Ga0466959_0003247 3300045049 Bacteria 10583
714 Ga0451576_0000001 3300045051 Bacteria 1802108
715 Ga0451576_0106379 3300045051 Bacteria 2919
716 Ga0495651_0235444 3300046462 Bacteria 1259
717 Ga0495650_0044624 3300046471 Bacteria 1872
718 Ga0495584_0003056 3300046491 Bacteria 9294
719 Ga0495608_0177596 3300046511 Bacteria 1348
720 Ga0495620_0080336 3300046515 Bacteria 1320
721 Ga0495628_0047562 3300046516 Bacteria 3403
722 Ga0495644_0038473 3300046523 Bacteria 1804
723 Ga0495644_0055853 3300046523 Bacteria 1483
724 Ga0495598_0025327 3300046537 Bacteria 1617
725 Ga0495645_0078591 3300046543 Bacteria 2371
726 Ga0495656_0013332 3300046615 Bacteria 3056
727 Ga0495656_0042030 3300046615 Bacteria 1913
728 Ga0495634_0192055 3300046642 Bacteria 1273
729 Ga0495588_0096096 3300046674 Bacteria 1554
730 Ga0495658_0025905 3300046683 Bacteria 3139
731 Ga0495658_0159477 3300046683 Bacteria 1390
732 Ga0495669_0113604 3300046684 Bacteria 1266
733 Ga0495613_0109422 3300046689 Bacteria 1992
734 Ga0495670_0103283 3300046691 Bacteria 1470
735 Ga0495589_0048232 3300046794 Bacteria 2109
736 Ga0495600_0255475 3300046809 Bacteria 1114
737 Ga0495672_0067290 3300047320 Bacteria 2041
738 Ga0495680_0286898 3300047322 Bacteria 1159
739 Ga0495685_052541 3300047447 Bacteria 1380
740 Ga0495593_0102774 3300047673 Bacteria 1465
741 Ga0496100_0002710 3300048903 Bacteria 9052
742 Ga0496101_0019896 3300048904 Bacteria 4590
743 Ga0496101_0053919 3300048904 Bacteria 2902
744 Ga0496101_0108613 3300048904 Bacteria 2086
745 Ga0496101_0179275 3300048904 Bacteria 1631
746 Ga0496102_0057433 3300048905 Bacteria 3553
747 Ga0496102_0095044 3300048905 Bacteria 2762
748 Ga0496102_0164505 3300048905 Bacteria 2087
749 Ga0496102_0213763 3300048905 Bacteria 1818
750 Ga0496103_0001636 3300048906 Bacteria 14692
751 Ga0496104_0039439 3300048907 Bacteria 4422
752 Ga0496104_0208064 3300048907 Bacteria 1868
753 Ga0496104_0372177 3300048907 Bacteria 1341
754 Ga0496105_0052730 3300048908 Bacteria 3359
755 Ga0496105_0058797 3300048908 Bacteria 3172
756 Ga0496105_0061623 3300048908 Bacteria 3095
757 Ga0496106_0009030 3300048909 Bacteria 7365
758 Ga0496106_0239649 3300048909 Bacteria 1449
759 Ga0496107_0006550 3300048910 Bacteria 8011
760 Ga0496107_0035746 3300048910 Bacteria 3562
761 Ga0496107_0055742 3300048910 Bacteria 2854
762 Ga0496107_0171096 3300048910 Bacteria 1612
763 Ga0496108_0029463 3300048911 Bacteria 4546
764 Ga0496108_0049324 3300048911 Bacteria 3521
765 Ga0496108_0085229 3300048911 Bacteria 2681
766 Ga0496109_0036237 3300048912 Bacteria 4453
767 Ga0496109_0076913 3300048912 Bacteria 3070
768 Ga0496109_0436373 3300048912 Bacteria 1237
769 Ga0496110_0014916 3300048913 Bacteria 6458
770 Ga0496111_0082338 3300048914 Bacteria 2350
771 Ga0496111_0093702 3300048914 Bacteria 2202
772 Ga0496112_0083495 3300048915 Bacteria 3159
773 Ga0496112_0096577 3300048915 Bacteria 2925
774 Ga0496112_0258868 3300048915 Bacteria 1690
775 Ga0496113_0060414 3300048916 Bacteria 2857
776 Ga0496114_0040957 3300048917 Bacteria 3837
777 Ga0496114_0055106 3300048917 Bacteria 3316
778 Ga0496114_0149990 3300048917 Bacteria 2022
779 Ga0496114_0257633 3300048917 Bacteria 1535
780 Ga0496115_0007030 3300048918 Bacteria 8269
781 Ga0496115_0018921 3300048918 Bacteria 5297
782 Ga0496115_0066623 3300048918 Bacteria 2910
783 Ga0496115_0092293 3300048918 Bacteria 2475
784 Ga0496117_0049354 3300048920 Bacteria 2995
785 Ga0496121_0004790 3300048924 Bacteria 17841
786 Ga0496126_0005177 3300048929 Bacteria 15071
787 Ga0501031_0010867 3300049568 Bacteria 5930
788 Ga0501031_0061363 3300049568 Bacteria 2450
789 Ga0501031_0152567 3300049568 Bacteria 1510
790 Ga0501032_0017136 3300049569 Bacteria 5091
791 Ga0501033_0137370 3300049570 Bacteria 1769
792 Ga0501034_0043397 3300049571 Bacteria 4551
793 Ga0501036_0001136 3300049572 Bacteria 20244
794 Ga0501036_0043037 3300049572 Bacteria 3824
795 Ga0501036_0049832 3300049572 Bacteria 3547
796 Ga0501036_0075351 3300049572 Bacteria 2854
797 Ga0501036_0217430 3300049572 Bacteria 1605
798 Ga0501037_0000124 3300049573 Bacteria 71522
799 Ga0501037_0014905 3300049573 Bacteria 5719
800 Ga0501037_0189349 3300049573 Bacteria 1457
801 Ga0501038_0002889 3300049574 Bacteria 16028
802 Ga0501038_0019715 3300049574 Bacteria 6072
803 Ga0501038_0074409 3300049574 Bacteria 2874
804 Ga0501038_0101888 3300049574 Bacteria 2390
805 Ga0501038_0286533 3300049574 Bacteria 1295
806 Ga0501039_0004891 3300049575 Bacteria 10151
807 Ga0501039_0026662 3300049575 Bacteria 4441
808 Ga0501039_0059894 3300049575 Bacteria 2948
809 Ga0501039_0246336 3300049575 Bacteria 1405
810 Ga0501039_0279885 3300049575 Bacteria 1311
811 Ga0501040_0000196 3300049576 Bacteria 35200
812 Ga0501040_0015317 3300049576 Bacteria 5070
813 Ga0501040_0109528 3300049576 Bacteria 1931
814 Ga0501041_0000164 3300049577 Bacteria 29413
815 Ga0501041_0022148 3300049577 Bacteria 3805
816 Ga0501041_0028815 3300049577 Bacteria 3350
817 Ga0501041_0055766 3300049577 Bacteria 2413
818 Ga0501042_0000576 3300049578 Bacteria 19402
819 Ga0501042_0006949 3300049578 Bacteria 7387
820 Ga0501042_0247817 3300049578 Bacteria 1285
821 Ga0501043_0000003 3300049579 Bacteria 318844
822 Ga0501043_0019082 3300049579 Bacteria 5383
823 Ga0501043_0060097 3300049579 Bacteria 2983
824 Ga0501043_0337262 3300049579 Bacteria 1147
825 Ga0501046_0000247 3300049580 Bacteria 55379
826 Ga0501046_0065974 3300049580 Bacteria 2822
827 Ga0501046_0182528 3300049580 Bacteria 1568
828 Ga0501047_0001674 3300049581 Bacteria 21567
829 Ga0501047_0057037 3300049581 Bacteria 3777
830 Ga0501047_0065334 3300049581 Bacteria 3507
831 Ga0501048_0000609 3300049582 Bacteria 25452
832 Ga0501048_0028355 3300049582 Bacteria 4063
833 Ga0501048_0076626 3300049582 Bacteria 2360
834 Ga0501068_0038354 3300049584 Bacteria 2870
835 Ga0501069_0000003 3300049585 Bacteria 210301
836 Ga0501070_0000477 3300049586 Bacteria 36435
837 Ga0501070_0068506 3300049586 Bacteria 2937
838 Ga0501070_0098559 3300049586 Bacteria 2417
839 Ga0501070_0193637 3300049586 Bacteria 1670
840 Ga0501070_0342635 3300049586 Bacteria 1214
841 Ga0501071_0018599 3300049587 Bacteria 4814
842 Ga0501071_0033707 3300049587 Bacteria 3639
843 Ga0501071_0070281 3300049587 Bacteria 2550
844 Ga0501072_0000333 3300049588 Bacteria 33584
845 Ga0501072_0004373 3300049588 Bacteria 10726
846 Ga0501072_0157830 3300049588 Bacteria 1809
847 Ga0501073_0081313 3300049589 Bacteria 2254
848 Ga0501074_0000007 3300049590 Bacteria 111136
849 Ga0501074_0001316 3300049590 Bacteria 16477
850 Ga0501074_0023999 3300049590 Bacteria 4432
851 Ga0501074_0151182 3300049590 Bacteria 1660
852 Ga0501075_0186617 3300049591 Bacteria 1582
853 Ga0501076_0000869 3300049592 Bacteria 19638
854 Ga0501076_0002390 3300049592 Bacteria 12853
855 Ga0501076_0006162 3300049592 Bacteria 8680
856 Ga0501076_0008429 3300049592 Bacteria 7555
857 Ga0501076_0138582 3300049592 Bacteria 1976
858 Ga0501077_0000223 3300049593 Bacteria 33258
859 Ga0501077_0011772 3300049593 Bacteria 5470
860 Ga0501077_0049493 3300049593 Bacteria 2671
861 Ga0501077_0082322 3300049593 Bacteria 2040
862 Ga0501079_0002588 3300049741 Bacteria 13150
863 Ga0501079_0018700 3300049741 Bacteria 5294
864 Ga0501079_0047011 3300049741 Bacteria 3330
865 Ga0501079_0060030 3300049741 Bacteria 2933
866 Ga0501080_0001339 3300049742 Bacteria 20548
867 Ga0501080_0002540 3300049742 Bacteria 15963
868 Ga0501080_0014252 3300049742 Bacteria 7320
869 Ga0501080_0112853 3300049742 Bacteria 2519
870 Ga0501081_0001238 3300049743 Bacteria 15536
871 Ga0501081_0001649 3300049743 Bacteria 13814
872 Ga0501081_0017131 3300049743 Bacteria 4793
873 Ga0501081_0029745 3300049743 Bacteria 3693
874 Ga0501083_0000024 3300049744 Bacteria 123029
875 Ga0501263_003647 3300049760 Bacteria 1657
876 Ga0501035_0006926 3300049822 Bacteria 10587
877 Ga0501035_0011327 3300049822 Bacteria 8266
878 Ga0501035_0037964 3300049822 Bacteria 4361
879 Ga0501035_0040418 3300049822 Bacteria 4214
880 Ga0501035_0162957 3300049822 Bacteria 1929
881 Ga0501035_0221226 3300049822 Bacteria 1616
882 Ga0501044_0000016 3300049823 Bacteria 231626
883 Ga0501044_0001406 3300049823 Bacteria 28215
884 Ga0501044_0045763 3300049823 Bacteria 4533
885 Ga0501044_0175393 3300049823 Bacteria 2113
886 Ga0501044_0188472 3300049823 Bacteria 2026
887 Ga0501045_0000481 3300049824 Bacteria 24710
888 Ga0501045_0000799 3300049824 Bacteria 20290
889 Ga0501045_0072118 3300049824 Bacteria 2542
890 Ga0501045_0206495 3300049824 Bacteria 1463
891 nmdc:mga03683_10753_c1 3300050489 Bacteria 3289
892 nmdc:mga03683_17296_c1 3300050489 Bacteria 2728
893 nmdc:mga03683_29875_c1 3300050489 Bacteria 2177
894 nmdc:mga03n38_12577_c1 3300050490 Bacteria 3189
895 nmdc:mga03n38_1430_c1 3300050490 Bacteria 6822
896 nmdc:mga03n38_5180_c1 3300050490 Bacteria 4412
897 nmdc:mga00v17_38920_c1 3300050491 Bacteria 2846
898 nmdc:mga0yw44_104939_c1 3300050492 Bacteria 1805
899 nmdc:mga0yw44_27341_c1 3300050492 Bacteria 3266
900 nmdc:mga0yw44_5028_c1 3300050492 Bacteria 6177
901 nmdc:mga0k408_149722_c1 3300050493 Bacteria 1390
902 nmdc:mga0k408_218598_c1 3300050493 Bacteria 1138
903 nmdc:mga0k408_22446_c1 3300050493 Bacteria 3554
904 nmdc:mga0k408_28817_c1 3300050493 Bacteria 3157
905 nmdc:mga0k408_44635_c1 3300050493 Bacteria 2557
906 nmdc:mga0k408_74493_c1 3300050493 Bacteria 1983
907 nmdc:mga06z11_52957_c1 3300050494 Bacteria 2085
908 nmdc:mga07m45_1407_c1 3300050496 Bacteria 11010
909 nmdc:mga07m45_46615_c1 3300050496 Bacteria 2436
910 nmdc:mga05p37_528_c1 3300050507 Bacteria 42336
911 nmdc:mga05p37_530_c1 3300050507 Bacteria 42063
912 nmdc:mga05p37_83400_c1 3300050507 Bacteria 3937
913 nmdc:mga09592_19007_c2 3300050508 Bacteria 4681
914 nmdc:mga09592_348610_c1 3300050508 Bacteria 1281
915 nmdc:mga09592_58_c1 3300050508 Bacteria 61599
916 nmdc:mga09592_704_c1 3300050508 Bacteria 25621
917 nmdc:mga0qj67_125314_c1 3300050509 Bacteria 2079
918 nmdc:mga0qj67_252_c1 3300050509 Bacteria 36647
919 nmdc:mga0qj67_57368_c1 3300050509 Bacteria 3087
920 nmdc:mga06r32_116386_c1 3300050510 Bacteria 2634
921 nmdc:mga06r32_12664_c1 3300050510 Bacteria 7623
922 nmdc:mga06r32_13548_c1 3300050510 Bacteria 7389
923 nmdc:mga06r32_241_c1 3300050510 Bacteria 44852
924 nmdc:mga06r32_77686_c1 3300050510 Bacteria 3225
925 nmdc:mga06r32_89618_c1 3300050510 Bacteria 3003
926 nmdc:mga08y16_427_c1 3300050511 Bacteria 38825
927 Ga0495601_0045510 3300053077 Bacteria 2760
928 Ga0495655_0002544 3300053083 Bacteria 2911
929 Ga0495595_0023968 3300053084 Bacteria 2692
930 Ga0495619_0097231 3300053085 Bacteria 2000
931 Ga0500646_0000249 3300053090 Bacteria 16508
932 Ga0500651_0017113 3300053093 Bacteria 4465
933 Ga0500641_0002472 3300053096 Bacteria 6530
934 Ga0500594_0029195 3300053118 Bacteria 1440
935 Ga0500595_000772 3300053119 Bacteria 18763
936 Ga0500628_024927 3300053129 Bacteria 1247
937 Ga0500655_014181 3300053133 Bacteria 1457
938 Ga0500568_0035981 3300053139 Bacteria 2018
939 Ga0500586_050133 3300053145 Bacteria 1438
940 Ga0500604_0000152 3300053151 Bacteria 20372
941 Ga0500616_0008468 3300053153 Bacteria 6383
942 Ga0500616_0045468 3300053153 Bacteria 2339
943 Ga0501084_0004974 3300054114 Bacteria 10868
944 Ga0501084_0012573 3300054114 Bacteria 7013
945 Ga0501084_0014998 3300054114 Bacteria 6425
946 Ga0501084_0038950 3300054114 Bacteria 3975
947 Ga0501084_0069858 3300054114 Bacteria 2941
948 Ga0501084_0369465 3300054114 Bacteria 1212
949 Ga0501082_0004790 3300060353 Bacteria 11800
950 Ga0501082_0015931 3300060353 Bacteria 6465
951 Ga0501082_0041083 3300060353 Bacteria 3987
952 Ga0501082_0056252 3300060353 Bacteria 3388
953 Ga0530510_0000412 3300061734 Bacteria 27774
954 Ga0530510_0000731 3300061734 Bacteria 21331
955 Ga0530510_0038650 3300061734 Bacteria 3445
956 Ga0530510_0040615 3300061734 Bacteria 3358
957 Ga0530510_0057281 3300061734 Bacteria 2816

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006237 Ga0097621_100128809 Ga0097621_1001288092 307
2 3300005334 Ga0068869_100010779 Ga0068869_1000107793 310
3 3300005340 Ga0070689_100097983 Ga0070689_1000979832 310
4 3300005440 Ga0070705_100095992 Ga0070705_1000959922 310
5 3300005441 Ga0070700_100096209 Ga0070700_1000962093 310
6 3300005456 Ga0070678_100030306 Ga0070678_1000303064 310
7 3300005840 Ga0068870_10069124 Ga0068870_100691242 310
8 3300005841 Ga0068863_100237649 Ga0068863_1002376492 310
9 3300006358 Ga0068871_100075832 Ga0068871_1000758323 310
10 3300009176 Ga0105242_10374497 Ga0105242_103744972 310
11 3300025893 Ga0207682_10032993 Ga0207682_100329932 310
12 3300025908 Ga0207643_10022298 Ga0207643_100222983 310
13 3300025942 Ga0207689_10010981 Ga0207689_100109813 310
14 3300026075 Ga0207708_10089458 Ga0207708_100894582 310
15 3300026121 Ga0207683_10005317 Ga0207683_100053174 310
16 3300031901 Ga0307406_10066401 Ga0307406_100664012 312
17 3300042009 Ga0439451_002494 Ga0439451_002494_927_1874 314
18 3300035695 Ga0373927_0076141 Ga0373927_0076141_899_1849 315
19 3300049570 Ga0501033_0137370 Ga0501033_0137370_393_1403 315
20 3300006048 Ga0075363_100024045 Ga0075363_1000240452 316
21 3300006177 Ga0075362_10034704 Ga0075362_100347042 316
22 3300046674 Ga0495588_0096096 Ga0495588_0096096_183_1190 316
23 3300046684 Ga0495669_0113604 Ga0495669_0113604_122_1129 316
24 3300047447 Ga0495685_052541 Ga0495685_052541_262_1269 316
25 3300049590 Ga0501074_0151182 Ga0501074_0151182_380_1390 316
26 3300050493 nmdc:mga0k408_28817_c1 nmdc:mga0k408_28817_c1_32_1051 316
27 3300005367 Ga0070667_100073437 Ga0070667_1000734371 317
28 3300009148 Ga0105243_10151701 Ga0105243_101517012 317
29 3300009174 Ga0105241_10102465 Ga0105241_101024653 317
30 3300009176 Ga0105242_10177777 Ga0105242_101777772 317
31 3300009177 Ga0105248_10039908 Ga0105248_100399082 317
32 3300009545 Ga0105237_10056267 Ga0105237_100562673 317
33 3300009551 Ga0105238_10097998 Ga0105238_100979983 317
34 3300010375 Ga0105239_10099437 Ga0105239_100994373 317
35 3300013306 Ga0163162_10053652 Ga0163162_100536522 317
36 3300031731 Ga0307405_10007144 Ga0307405_100071445 317
37 3300035115 Ga0373941_0041241 Ga0373941_0041241_437_1393 317
38 3300035691 Ga0373931_0003551 Ga0373931_0003551_4151_5107 317
39 3300042001 Ga0439441_000190 Ga0439441_000190_2405_3361 317
40 3300042436 Ga0439435_0000156 Ga0439435_0000156_3437_4393 317
41 3300042461 Ga0439460_0000463 Ga0439460_0000463_5081_6037 317
42 3300044712 Ga0453684_0506227 Ga0453684_0506227_27_1028 317
43 3300048904 Ga0496101_0053919 Ga0496101_0053919_285_1241 317
44 3300048905 Ga0496102_0057433 Ga0496102_0057433_2268_3224 317
45 3300048905 Ga0496102_0213763 Ga0496102_0213763_514_1470 317
46 3300048907 Ga0496104_0039439 Ga0496104_0039439_2892_3848 317
47 3300048908 Ga0496105_0061623 Ga0496105_0061623_1507_2463 317
48 3300048910 Ga0496107_0055742 Ga0496107_0055742_1700_2656 317
49 3300048911 Ga0496108_0029463 Ga0496108_0029463_1685_2641 317
50 3300048912 Ga0496109_0036237 Ga0496109_0036237_1481_2437 317
51 3300048913 Ga0496110_0014916 Ga0496110_0014916_630_1586 317
52 3300048914 Ga0496111_0082338 Ga0496111_0082338_137_1093 317
53 3300048915 Ga0496112_0083495 Ga0496112_0083495_685_1641 317
54 3300048915 Ga0496112_0096577 Ga0496112_0096577_207_1214 317
55 3300048916 Ga0496113_0060414 Ga0496113_0060414_372_1328 317
56 3300048917 Ga0496114_0257633 Ga0496114_0257633_131_1087 317
57 3300048918 Ga0496115_0066623 Ga0496115_0066623_1687_2643 317
58 3300005549 Ga0070704_100002887 Ga0070704_1000028876 318
59 3300006844 Ga0075428_100019621 Ga0075428_1000196214 318
60 3300006847 Ga0075431_100004976 Ga0075431_1000049763 318
61 3300006880 Ga0075429_100000272 Ga0075429_10000027223 318
62 3300009148 Ga0105243_10100171 Ga0105243_101001713 318
63 3300013104 Ga0157370_10347207 Ga0157370_103472072 318
64 3300048915 Ga0496112_0258868 Ga0496112_0258868_673_1638 318
65 3300049573 Ga0501037_0189349 Ga0501037_0189349_226_1185 318
66 3300049586 Ga0501070_0098559 Ga0501070_0098559_483_1442 318
67 3300049587 Ga0501071_0070281 Ga0501071_0070281_665_1624 318
68 3300049590 Ga0501074_0023999 Ga0501074_0023999_2809_3768 318
69 3300049823 Ga0501044_0188472 Ga0501044_0188472_1021_1980 318
70 3300050507 nmdc:mga05p37_530_c1 nmdc:mga05p37_530_c1_20983_21978 318
71 3300050508 nmdc:mga09592_58_c1 nmdc:mga09592_58_c1_13266_14261 318
72 3300050510 nmdc:mga06r32_12664_c1 nmdc:mga06r32_12664_c1_906_1901 318
73 3300005844 Ga0068862_100075270 Ga0068862_1000752703 319
74 3300025935 Ga0207709_10312497 Ga0207709_103124971 319
75 3300028381 Ga0268264_10059738 Ga0268264_100597382 319
76 3300046615 Ga0495656_0042030 Ga0495656_0042030_773_1780 320
77 3300049572 Ga0501036_0217430 Ga0501036_0217430_452_1513 320
78 3300049575 Ga0501039_0279885 Ga0501039_0279885_23_1084 320
79 3300049576 Ga0501040_0109528 Ga0501040_0109528_678_1739 320
80 3300049584 Ga0501068_0038354 Ga0501068_0038354_1877_2842 320
81 3300049586 Ga0501070_0068506 Ga0501070_0068506_237_1202 320
82 3300049587 Ga0501071_0033707 Ga0501071_0033707_2379_3440 320
83 3300049822 Ga0501035_0011327 Ga0501035_0011327_6533_7498 320
84 3300053153 Ga0500616_0045468 Ga0500616_0045468_36_998 320
85 3300031852 Ga0307410_10049862 Ga0307410_100498622 321
86 3300035116 Ga0373945_0023118 Ga0373945_0023118_33_1001 321
87 3300037312 Ga0395899_0008753 Ga0395899_0008753_4812_5819 321
88 3300037466 Ga0395898_0124148 Ga0395898_0124148_303_1310 321
89 3300038443 Ga0395901_0078986 Ga0395901_0078986_462_1469 321
90 3300049568 Ga0501031_0010867 Ga0501031_0010867_56_1024 321
91 3300049569 Ga0501032_0017136 Ga0501032_0017136_22_990 321
92 3300049573 Ga0501037_0000124 Ga0501037_0000124_43659_44627 321
93 3300049574 Ga0501038_0286533 Ga0501038_0286533_150_1118 321
94 3300049579 Ga0501043_0000003 Ga0501043_0000003_95982_96950 321
95 3300049585 Ga0501069_0000003 Ga0501069_0000003_111557_112525 321
96 3300049586 Ga0501070_0000477 Ga0501070_0000477_10973_11941 321
97 3300049587 Ga0501071_0018599 Ga0501071_0018599_260_1228 321
98 3300049590 Ga0501074_0000007 Ga0501074_0000007_9921_10889 321
99 3300049742 Ga0501080_0001339 Ga0501080_0001339_19142_20110 321
100 3300049744 Ga0501083_0000024 Ga0501083_0000024_59513_60481 321
101 3300049822 Ga0501035_0006926 Ga0501035_0006926_5136_6104 321
102 3300049823 Ga0501044_0000016 Ga0501044_0000016_111549_112517 321
103 3300050507 nmdc:mga05p37_83400_c1 nmdc:mga05p37_83400_c1_1171_2139 321
104 3300050508 nmdc:mga09592_19007_c2 nmdc:mga09592_19007_c2_953_1921 321
105 3300037471 Ga0395905_0345914 Ga0395905_0345914_323_1330 322
106 3300053139 Ga0500568_0035981 Ga0500568_0035981_126_1097 322
107 3300005543 Ga0070672_100084575 Ga0070672_1000845753 323
108 3300031995 Ga0307409_100501812 Ga0307409_1005018122 323
109 3300038443 Ga0395901_0022205 Ga0395901_0022205_5313_6320 323
110 3300050508 nmdc:mga09592_348610_c1 nmdc:mga09592_348610_c1_11_1015 323
111 3300050510 nmdc:mga06r32_89618_c1 nmdc:mga06r32_89618_c1_1005_2009 323
112 3300033179 Ga0307507_10032564 Ga0307507_100325644 324
113 3300049579 Ga0501043_0060097 Ga0501043_0060097_1843_2871 324
114 3300049824 Ga0501045_0072118 Ga0501045_0072118_1369_2397 324
115 3300061734 Ga0530510_0057281 Ga0530510_0057281_1321_2349 324
116 3300005347 Ga0070668_100004725 Ga0070668_1000047252 325
117 3300005618 Ga0068864_100083100 Ga0068864_1000831003 325
118 3300005844 Ga0068862_100398043 Ga0068862_1003980431 325
119 3300025972 Ga0207668_10005494 Ga0207668_100054945 325
120 3300027907 Ga0207428_10073491 Ga0207428_100734911 325
121 3300005336 Ga0070680_100061553 Ga0070680_1000615534 326
122 3300005440 Ga0070705_100094499 Ga0070705_1000944991 326
123 3300005444 Ga0070694_100020492 Ga0070694_1000204924 326
124 3300005545 Ga0070695_100251306 Ga0070695_1002513061 326
125 3300005549 Ga0070704_100086973 Ga0070704_1000869733 326
126 3300005564 Ga0070664_100409484 Ga0070664_1004094841 326
127 3300006844 Ga0075428_100040584 Ga0075428_1000405842 326
128 3300006847 Ga0075431_100180554 Ga0075431_1001805542 326
129 3300025945 Ga0207679_10083958 Ga0207679_100839582 326
130 3300039450 Ga0436363_0744681 Ga0436363_0744681_235_1257 326
131 3300050510 nmdc:mga06r32_116386_c1 nmdc:mga06r32_116386_c1_1034_2023 326
132 iso_pu_bacteria 8054563764 8054564691 326
133 3300005981 Ga0081538_10092648 Ga0081538_100926482 327
134 3300006042 Ga0075368_10002491 Ga0075368_100024913 327
135 3300006048 Ga0075363_100024902 Ga0075363_1000249023 327
136 3300006051 Ga0075364_10069037 Ga0075364_100690372 327
137 3300006178 Ga0075367_10052682 Ga0075367_100526822 327
138 3300006195 Ga0075366_10017317 Ga0075366_100173172 327
139 3300006353 Ga0075370_10014243 Ga0075370_100142432 327
140 3300006844 Ga0075428_100032142 Ga0075428_1000321425 327
141 3300009177 Ga0105248_10245305 Ga0105248_102453053 327
142 3300027866 Ga0209813_10027812 Ga0209813_100278121 327
143 3300037471 Ga0395905_0009567 Ga0395905_0009567_6531_7523 327
144 3300041486 Ga0451807_2064625 Ga0451807_2064625_339_1337 327
145 3300042134 Ga0450898_004537 Ga0450898_004537_935_1930 327
146 3300049592 Ga0501076_0138582 Ga0501076_0138582_761_1831 327
147 3300049593 Ga0501077_0082322 Ga0501077_0082322_273_1343 327
148 3300049741 Ga0501079_0018700 Ga0501079_0018700_3974_5044 327
149 3300049743 Ga0501081_0017131 Ga0501081_0017131_3310_4380 327
150 3300050489 nmdc:mga03683_29875_c1 nmdc:mga03683_29875_c1_848_1861 327
151 3300050490 nmdc:mga03n38_5180_c1 nmdc:mga03n38_5180_c1_3149_4162 327
152 3300050491 nmdc:mga00v17_38920_c1 nmdc:mga00v17_38920_c1_260_1273 327
153 3300050493 nmdc:mga0k408_22446_c1 nmdc:mga0k408_22446_c1_1207_2220 327
154 3300050496 nmdc:mga07m45_46615_c1 nmdc:mga07m45_46615_c1_796_1809 327
155 3300053129 Ga0500628_024927 Ga0500628_024927_68_1069 327
156 3300054114 Ga0501084_0012573 Ga0501084_0012573_5876_6946 327
157 3300060353 Ga0501082_0004790 Ga0501082_0004790_5772_6842 327
158 3300061734 Ga0530510_0040615 Ga0530510_0040615_2096_3166 327
159 3300005367 Ga0070667_100068659 Ga0070667_1000686593 328
160 3300005441 Ga0070700_100018478 Ga0070700_1000184783 328
161 3300005459 Ga0068867_100041022 Ga0068867_1000410223 328
162 3300005617 Ga0068859_100196983 Ga0068859_1001969832 328
163 3300005719 Ga0068861_100002784 Ga0068861_1000027844 328
164 3300005843 Ga0068860_100086376 Ga0068860_1000863763 328
165 3300005844 Ga0068862_100046400 Ga0068862_1000464002 328
166 3300006881 Ga0068865_100004681 Ga0068865_1000046815 328
167 3300006931 Ga0097620_100196991 Ga0097620_1001969912 328
168 3300009148 Ga0105243_10168844 Ga0105243_101688442 328
169 3300009174 Ga0105241_10234750 Ga0105241_102347502 328
170 3300013297 Ga0157378_10040285 Ga0157378_100402853 328
171 3300013306 Ga0163162_10005347 Ga0163162_1000534711 328
172 3300013308 Ga0157375_10033464 Ga0157375_100334644 328
173 3300025284 Ga0209130_1019002 Ga0209130_10190021 328
174 3300025907 Ga0207645_10026044 Ga0207645_100260443 328
175 3300025923 Ga0207681_10123673 Ga0207681_101236732 328
176 3300025935 Ga0207709_10104478 Ga0207709_101044782 328
177 3300025938 Ga0207704_10039214 Ga0207704_100392143 328
178 3300026088 Ga0207641_10135902 Ga0207641_101359023 328
179 3300026089 Ga0207648_10000585 Ga0207648_100005853 328
180 3300026118 Ga0207675_100001107 Ga0207675_10000110715 328
181 3300028381 Ga0268264_10018355 Ga0268264_100183554 328
182 3300028794 Ga0307515_10205356 Ga0307515_102053563 328
183 3300031727 Ga0316576_10004332 Ga0316576_100043325 328
184 3300031728 Ga0316578_10025602 Ga0316578_100256023 328
185 3300032005 Ga0307411_10110117 Ga0307411_101101172 328
186 3300042001 Ga0439441_000131 Ga0439441_000131_2329_3324 328
187 3300049575 Ga0501039_0026662 Ga0501039_0026662_2549_3544 328
188 3300049577 Ga0501041_0022148 Ga0501041_0022148_2593_3588 328
189 3300049591 Ga0501075_0186617 Ga0501075_0186617_236_1255 328
190 3300049741 Ga0501079_0047011 Ga0501079_0047011_2148_3143 328
191 iso_pu_bacteria 2885192300 2885195613 328
192 3300003792 Ga0055540_1005341 Ga0055540_10053413 329
193 3300003794 Ga0055531_10001448 Ga0055531_1000144815 329
194 3300005327 Ga0070658_10193604 Ga0070658_101936042 329
195 3300005329 Ga0070683_100060942 Ga0070683_1000609422 329
196 3300005331 Ga0070670_100039560 Ga0070670_1000395604 329
197 3300005331 Ga0070670_100121658 Ga0070670_1001216583 329
198 3300005333 Ga0070677_10006429 Ga0070677_100064292 329
199 3300005338 Ga0068868_100003309 Ga0068868_1000033095 329
200 3300005338 Ga0068868_100065885 Ga0068868_1000658853 329
201 3300005339 Ga0070660_100019623 Ga0070660_1000196233 329
202 3300005353 Ga0070669_100043586 Ga0070669_1000435862 329
203 3300005354 Ga0070675_100016700 Ga0070675_1000167005 329
204 3300005354 Ga0070675_100136625 Ga0070675_1001366251 329
205 3300005355 Ga0070671_100060358 Ga0070671_1000603582 329
206 3300005355 Ga0070671_100171238 Ga0070671_1001712382 329
207 3300005356 Ga0070674_100007981 Ga0070674_1000079815 329
208 3300005356 Ga0070674_100025512 Ga0070674_1000255123 329
209 3300005364 Ga0070673_100200450 Ga0070673_1002004502 329
210 3300005366 Ga0070659_100002034 Ga0070659_1000020342 329
211 3300005367 Ga0070667_100135754 Ga0070667_1001357543 329
212 3300005457 Ga0070662_100003122 Ga0070662_1000031224 329
213 3300005543 Ga0070672_100007156 Ga0070672_1000071566 329
214 3300005547 Ga0070693_100034874 Ga0070693_1000348741 329
215 3300005563 Ga0068855_100029129 Ga0068855_1000291295 329
216 3300005564 Ga0070664_100083959 Ga0070664_1000839593 329
217 3300005578 Ga0068854_100024181 Ga0068854_1000241813 329
218 3300005614 Ga0068856_100057426 Ga0068856_1000574263 329
219 3300005616 Ga0068852_100004082 Ga0068852_1000040826 329
220 3300005618 Ga0068864_100021040 Ga0068864_1000210405 329
221 3300005618 Ga0068864_100059983 Ga0068864_1000599832 329
222 3300005844 Ga0068862_100093130 Ga0068862_1000931301 329
223 3300006844 Ga0075428_100025402 Ga0075428_1000254023 329
224 3300006844 Ga0075428_100040584 Ga0075428_1000405843 329
225 3300006844 Ga0075428_100253459 Ga0075428_1002534592 329
226 3300006846 Ga0075430_100000319 Ga0075430_1000003199 329
227 3300006847 Ga0075431_100071946 Ga0075431_1000719464 329
228 3300006847 Ga0075431_100180554 Ga0075431_1001805543 329
229 3300006880 Ga0075429_100097182 Ga0075429_1000971823 329
230 3300009177 Ga0105248_10018837 Ga0105248_100188373 329
231 3300009551 Ga0105238_10144442 Ga0105238_101444422 329
232 3300009551 Ga0105238_10244089 Ga0105238_102440892 329
233 3300013102 Ga0157371_10032495 Ga0157371_100324953 329
234 3300013105 Ga0157369_10026731 Ga0157369_100267317 329
235 3300013296 Ga0157374_10215132 Ga0157374_102151321 329
236 3300013306 Ga0163162_10001342 Ga0163162_1000134217 329
237 3300013306 Ga0163162_10438189 Ga0163162_104381892 329
238 3300014325 Ga0163163_10327202 Ga0163163_103272022 329
239 3300021388 Ga0213875_10034816 Ga0213875_100348162 329
240 3300025273 Ga0209673_1029447 Ga0209673_10294472 329
241 3300025303 Ga0209051_1000272 Ga0209051_100027255 329
242 3300025304 Ga0209257_1000055 Ga0209257_1000055354 329
243 3300025315 Ga0207697_10013163 Ga0207697_100131634 329
244 3300025901 Ga0207688_10045138 Ga0207688_100451382 329
245 3300025901 Ga0207688_10054263 Ga0207688_100542632 329
246 3300025907 Ga0207645_10027324 Ga0207645_100273242 329
247 3300025909 Ga0207705_10155675 Ga0207705_101556752 329
248 3300025914 Ga0207671_10139163 Ga0207671_101391632 329
249 3300025923 Ga0207681_10145845 Ga0207681_101458452 329
250 3300025925 Ga0207650_10049858 Ga0207650_100498584 329
251 3300025926 Ga0207659_10079980 Ga0207659_100799802 329
252 3300025927 Ga0207687_10249896 Ga0207687_102498961 329
253 3300025933 Ga0207706_10009759 Ga0207706_100097593 329
254 3300025940 Ga0207691_10002980 Ga0207691_100029803 329
255 3300025942 Ga0207689_10000284 Ga0207689_1000028416 329
256 3300025944 Ga0207661_10202051 Ga0207661_102020512 329
257 3300025945 Ga0207679_10031315 Ga0207679_100313153 329
258 3300025945 Ga0207679_10152945 Ga0207679_101529452 329
259 3300025949 Ga0207667_10580856 Ga0207667_105808561 329
260 3300025981 Ga0207640_10017173 Ga0207640_100171733 329
261 3300025986 Ga0207658_10198237 Ga0207658_101982371 329
262 3300026023 Ga0207677_10123110 Ga0207677_101231102 329
263 3300026067 Ga0207678_10007008 Ga0207678_100070085 329
264 3300026078 Ga0207702_10043419 Ga0207702_100434194 329
265 3300026078 Ga0207702_10066859 Ga0207702_100668591 329
266 3300026089 Ga0207648_10015261 Ga0207648_100152614 329
267 3300026095 Ga0207676_10015912 Ga0207676_100159123 329
268 3300026095 Ga0207676_10026747 Ga0207676_100267473 329
269 3300026116 Ga0207674_10275856 Ga0207674_102758562 329
270 3300026118 Ga0207675_100003350 Ga0207675_1000033503 329
271 3300026121 Ga0207683_10216203 Ga0207683_102162032 329
272 3300027462 Ga0210000_1004854 Ga0210000_10048543 329
273 3300027526 Ga0209968_1010145 Ga0209968_10101452 329
274 3300027876 Ga0209974_10045517 Ga0209974_100455172 329
275 3300028380 Ga0268265_10055764 Ga0268265_100557642 329
276 3300028794 Ga0307515_10227378 Ga0307515_102273782 329
277 3300031456 Ga0307513_10056083 Ga0307513_100560832 329
278 3300031548 Ga0307408_100181120 Ga0307408_1001811202 329
279 3300031730 Ga0307516_10009418 Ga0307516_100094187 329
280 3300031824 Ga0307413_10107531 Ga0307413_101075312 329
281 3300031824 Ga0307413_10219154 Ga0307413_102191542 329
282 3300031901 Ga0307406_10017952 Ga0307406_100179523 329
283 3300031911 Ga0307412_10105785 Ga0307412_101057852 329
284 3300037312 Ga0395899_0039593 Ga0395899_0039593_1882_2889 329
285 3300037418 Ga0395900_0004850 Ga0395900_0004850_4175_5182 329
286 3300037418 Ga0395900_0042887 Ga0395900_0042887_3369_4376 329
287 3300037466 Ga0395898_0007453 Ga0395898_0007453_9894_10901 329
288 3300037466 Ga0395898_0019113 Ga0395898_0019113_912_1919 329
289 3300037466 Ga0395898_0191143 Ga0395898_0191143_658_1665 329
290 3300037471 Ga0395905_0000811 Ga0395905_0000811_16760_17767 329
291 3300037471 Ga0395905_0005128 Ga0395905_0005128_3799_4806 329
292 3300037471 Ga0395905_0031216 Ga0395905_0031216_1383_2390 329
293 3300037471 Ga0395905_0032813 Ga0395905_0032813_138_1145 329
294 3300037471 Ga0395905_0064592 Ga0395905_0064592_868_1875 329
295 3300037471 Ga0395905_0095276 Ga0395905_0095276_792_1799 329
296 3300037853 Ga0436364_1172960 Ga0436364_1172960_3507_4577 329
297 3300038443 Ga0395901_0014806 Ga0395901_0014806_6407_7414 329
298 3300042001 Ga0439441_014538 Ga0439441_014538_31_1026 329
299 3300042437 Ga0439444_0002504 Ga0439444_0002504_861_1856 329
300 3300044656 Ga0466969_0044435 Ga0466969_0044435_406_1413 329
301 3300044656 Ga0466969_0061894 Ga0466969_0061894_46_1053 329
302 3300044658 Ga0466972_0065528 Ga0466972_0065528_482_1489 329
303 3300044684 Ga0466966_0014289 Ga0466966_0014289_3767_4774 329
304 3300044684 Ga0466966_0130847 Ga0466966_0130847_379_1386 329
305 3300044693 Ga0466961_0121530 Ga0466961_0121530_53_1060 329
306 3300044765 Ga0466970_0005106 Ga0466970_0005106_1227_2234 329
307 3300045049 Ga0466959_0003247 Ga0466959_0003247_2234_3241 329
308 3300045051 Ga0451576_0106379 Ga0451576_0106379_290_1297 329
309 3300048905 Ga0496102_0095044 Ga0496102_0095044_430_1437 329
310 3300048910 Ga0496107_0035746 Ga0496107_0035746_1926_2933 329
311 3300048911 Ga0496108_0049324 Ga0496108_0049324_1696_2703 329
312 3300048914 Ga0496111_0093702 Ga0496111_0093702_862_1869 329
313 3300048918 Ga0496115_0018921 Ga0496115_0018921_1222_2229 329
314 3300049568 Ga0501031_0061363 Ga0501031_0061363_1026_2021 329
315 3300049568 Ga0501031_0152567 Ga0501031_0152567_279_1286 329
316 3300049571 Ga0501034_0043397 Ga0501034_0043397_2293_3300 329
317 3300049572 Ga0501036_0001136 Ga0501036_0001136_5786_6781 329
318 3300049572 Ga0501036_0043037 Ga0501036_0043037_969_1967 329
319 3300049572 Ga0501036_0049832 Ga0501036_0049832_1253_2260 329
320 3300049572 Ga0501036_0075351 Ga0501036_0075351_1527_2534 329
321 3300049573 Ga0501037_0014905 Ga0501037_0014905_1680_2687 329
322 3300049574 Ga0501038_0002889 Ga0501038_0002889_2239_3234 329
323 3300049574 Ga0501038_0074409 Ga0501038_0074409_573_1580 329
324 3300049574 Ga0501038_0101888 Ga0501038_0101888_113_1111 329
325 3300049575 Ga0501039_0004891 Ga0501039_0004891_4582_5577 329
326 3300049575 Ga0501039_0059894 Ga0501039_0059894_825_1826 329
327 3300049575 Ga0501039_0246336 Ga0501039_0246336_252_1250 329
328 3300049576 Ga0501040_0000196 Ga0501040_0000196_27052_28047 329
329 3300049577 Ga0501041_0000164 Ga0501041_0000164_21270_22265 329
330 3300049577 Ga0501041_0055766 Ga0501041_0055766_81_1082 329
331 3300049578 Ga0501042_0000576 Ga0501042_0000576_7299_8294 329
332 3300049578 Ga0501042_0006949 Ga0501042_0006949_2304_3305 329
333 3300049579 Ga0501043_0019082 Ga0501043_0019082_1134_2141 329
334 3300049580 Ga0501046_0000247 Ga0501046_0000247_10248_11243 329
335 3300049580 Ga0501046_0065974 Ga0501046_0065974_836_1843 329
336 3300049580 Ga0501046_0182528 Ga0501046_0182528_429_1430 329
337 3300049581 Ga0501047_0057037 Ga0501047_0057037_2129_3136 329
338 3300049581 Ga0501047_0065334 Ga0501047_0065334_1989_2996 329
339 3300049582 Ga0501048_0000609 Ga0501048_0000609_17094_18089 329
340 3300049582 Ga0501048_0076626 Ga0501048_0076626_372_1367 329
341 3300049586 Ga0501070_0342635 Ga0501070_0342635_45_1046 329
342 3300049588 Ga0501072_0000333 Ga0501072_0000333_25238_26233 329
343 3300049588 Ga0501072_0004373 Ga0501072_0004373_2073_3074 329
344 3300049588 Ga0501072_0157830 Ga0501072_0157830_481_1482 329
345 3300049589 Ga0501073_0081313 Ga0501073_0081313_732_1739 329
346 3300049590 Ga0501074_0001316 Ga0501074_0001316_12524_13519 329
347 3300049592 Ga0501076_0002390 Ga0501076_0002390_5782_6783 329
348 3300049592 Ga0501076_0006162 Ga0501076_0006162_6354_7349 329
349 3300049593 Ga0501077_0000223 Ga0501077_0000223_2916_3911 329
350 3300049593 Ga0501077_0049493 Ga0501077_0049493_116_1117 329
351 3300049741 Ga0501079_0002588 Ga0501079_0002588_4466_5461 329
352 3300049742 Ga0501080_0002540 Ga0501080_0002540_6699_7694 329
353 3300049742 Ga0501080_0112853 Ga0501080_0112853_788_1795 329
354 3300049743 Ga0501081_0001238 Ga0501081_0001238_1910_2905 329
355 3300049743 Ga0501081_0001649 Ga0501081_0001649_4385_5386 329
356 3300049822 Ga0501035_0037964 Ga0501035_0037964_52_1047 329
357 3300049822 Ga0501035_0040418 Ga0501035_0040418_1563_2570 329
358 3300049822 Ga0501035_0221226 Ga0501035_0221226_465_1472 329
359 3300049823 Ga0501044_0045763 Ga0501044_0045763_1518_2525 329
360 3300049823 Ga0501044_0175393 Ga0501044_0175393_806_1801 329
361 3300049824 Ga0501045_0000481 Ga0501045_0000481_17370_18365 329
362 3300049824 Ga0501045_0206495 Ga0501045_0206495_398_1399 329
363 3300050490 nmdc:mga03n38_1430_c1 nmdc:mga03n38_1430_c1_17_1006 329
364 3300050507 nmdc:mga05p37_83400_c1 nmdc:mga05p37_83400_c1_2143_3138 329
365 3300050508 nmdc:mga09592_19007_c2 nmdc:mga09592_19007_c2_1925_2920 329
366 3300050509 nmdc:mga0qj67_252_c1 nmdc:mga0qj67_252_c1_27736_28731 329
367 3300050509 nmdc:mga0qj67_57368_c1 nmdc:mga0qj67_57368_c1_243_1238 329
368 3300050510 nmdc:mga06r32_13548_c1 nmdc:mga06r32_13548_c1_1981_2976 329
369 3300053145 Ga0500586_050133 Ga0500586_050133_362_1369 329
370 3300054114 Ga0501084_0004974 Ga0501084_0004974_6958_7953 329
371 3300054114 Ga0501084_0014998 Ga0501084_0014998_850_1851 329
372 3300054114 Ga0501084_0069858 Ga0501084_0069858_1426_2421 329
373 3300060353 Ga0501082_0015931 Ga0501082_0015931_3167_4168 329
374 3300060353 Ga0501082_0041083 Ga0501082_0041083_2935_3930 329
375 3300061734 Ga0530510_0000412 Ga0530510_0000412_24862_25857 329
376 3300061734 Ga0530510_0000731 Ga0530510_0000731_4653_5654 329
377 iso_pu_bacteria 2513237351 2514587960 329
378 3300005328 Ga0070676_10169758 Ga0070676_101697582 330
379 3300005330 Ga0070690_100127681 Ga0070690_1001276812 330
380 3300005331 Ga0070670_100014115 Ga0070670_1000141154 330
381 3300005331 Ga0070670_100014179 Ga0070670_1000141796 330
382 3300005331 Ga0070670_100120958 Ga0070670_1001209581 330
383 3300005331 Ga0070670_100209962 Ga0070670_1002099622 330
384 3300005334 Ga0068869_100394634 Ga0068869_1003946341 330
385 3300005335 Ga0070666_10005260 Ga0070666_100052605 330
386 3300005336 Ga0070680_100089044 Ga0070680_1000890442 330
387 3300005338 Ga0068868_100035815 Ga0068868_1000358153 330
388 3300005338 Ga0068868_100198147 Ga0068868_1001981471 330
389 3300005339 Ga0070660_100164560 Ga0070660_1001645602 330
390 3300005343 Ga0070687_100033629 Ga0070687_1000336292 330
391 3300005344 Ga0070661_100016290 Ga0070661_1000162905 330
392 3300005344 Ga0070661_100090991 Ga0070661_1000909912 330
393 3300005347 Ga0070668_100008179 Ga0070668_1000081795 330
394 3300005347 Ga0070668_100052000 Ga0070668_1000520003 330
395 3300005353 Ga0070669_100015522 Ga0070669_1000155223 330
396 3300005353 Ga0070669_100202248 Ga0070669_1002022482 330
397 3300005354 Ga0070675_100002982 Ga0070675_1000029823 330
398 3300005354 Ga0070675_100127961 Ga0070675_1001279612 330
399 3300005355 Ga0070671_100002733 Ga0070671_1000027337 330
400 3300005355 Ga0070671_100030435 Ga0070671_1000304353 330
401 3300005364 Ga0070673_100019910 Ga0070673_1000199105 330
402 3300005364 Ga0070673_100021568 Ga0070673_1000215684 330
403 3300005364 Ga0070673_100024790 Ga0070673_1000247903 330
404 3300005364 Ga0070673_100116164 Ga0070673_1001161642 330
405 3300005364 Ga0070673_100177101 Ga0070673_1001771012 330
406 3300005367 Ga0070667_100006321 Ga0070667_1000063213 330
407 3300005435 Ga0070714_100127250 Ga0070714_1001272502 330
408 3300005456 Ga0070678_100000866 Ga0070678_10000086614 330
409 3300005456 Ga0070678_100204362 Ga0070678_1002043622 330
410 3300005458 Ga0070681_10001792 Ga0070681_100017923 330
411 3300005459 Ga0068867_100017535 Ga0068867_1000175353 330
412 3300005459 Ga0068867_100038132 Ga0068867_1000381322 330
413 3300005530 Ga0070679_100022366 Ga0070679_1000223664 330
414 3300005539 Ga0068853_100087872 Ga0068853_1000878721 330
415 3300005539 Ga0068853_100139783 Ga0068853_1001397832 330
416 3300005539 Ga0068853_100175578 Ga0068853_1001755782 330
417 3300005543 Ga0070672_100016891 Ga0070672_1000168912 330
418 3300005543 Ga0070672_100086681 Ga0070672_1000866812 330
419 3300005547 Ga0070693_100122485 Ga0070693_1001224852 330
420 3300005564 Ga0070664_100029270 Ga0070664_1000292704 330
421 3300005564 Ga0070664_100305947 Ga0070664_1003059472 330
422 3300005564 Ga0070664_100340737 Ga0070664_1003407371 330
423 3300005577 Ga0068857_100076298 Ga0068857_1000762983 330
424 3300005614 Ga0068856_100057133 Ga0068856_1000571333 330
425 3300005614 Ga0068856_100329051 Ga0068856_1003290512 330
426 3300005615 Ga0070702_100087932 Ga0070702_1000879322 330
427 3300005618 Ga0068864_100001940 Ga0068864_1000019409 330
428 3300005618 Ga0068864_100005972 Ga0068864_1000059725 330
429 3300005618 Ga0068864_100009587 Ga0068864_1000095874 330
430 3300005618 Ga0068864_100040559 Ga0068864_1000405594 330
431 3300005719 Ga0068861_100035573 Ga0068861_1000355732 330
432 3300005719 Ga0068861_100036669 Ga0068861_1000366693 330
433 3300005719 Ga0068861_100334244 Ga0068861_1003342442 330
434 3300005840 Ga0068870_10036327 Ga0068870_100363273 330
435 3300005841 Ga0068863_100009737 Ga0068863_1000097375 330
436 3300005841 Ga0068863_100029987 Ga0068863_1000299874 330
437 3300005842 Ga0068858_100002388 Ga0068858_10000238814 330
438 3300005842 Ga0068858_100076040 Ga0068858_1000760402 330
439 3300005843 Ga0068860_100011379 Ga0068860_1000113793 330
440 3300005843 Ga0068860_100177275 Ga0068860_1001772753 330
441 3300005844 Ga0068862_100082185 Ga0068862_1000821853 330
442 3300005844 Ga0068862_100111733 Ga0068862_1001117333 330
443 3300006038 Ga0075365_10001711 Ga0075365_100017113 330
444 3300006048 Ga0075363_100100398 Ga0075363_1001003982 330
445 3300006195 Ga0075366_10065299 Ga0075366_100652991 330
446 3300006353 Ga0075370_10003250 Ga0075370_100032506 330
447 3300006358 Ga0068871_100003086 Ga0068871_1000030869 330
448 3300006358 Ga0068871_100012450 Ga0068871_1000124506 330
449 3300006358 Ga0068871_100226439 Ga0068871_1002264392 330
450 3300009093 Ga0105240_10017289 Ga0105240_100172896 330
451 3300009093 Ga0105240_10117358 Ga0105240_101173582 330
452 3300009094 Ga0111539_10551601 Ga0111539_105516012 330
453 3300009098 Ga0105245_10511891 Ga0105245_105118911 330
454 3300009177 Ga0105248_10045611 Ga0105248_100456113 330
455 3300009177 Ga0105248_10123037 Ga0105248_101230373 330
456 3300009177 Ga0105248_10234668 Ga0105248_102346683 330
457 3300009545 Ga0105237_10132828 Ga0105237_101328283 330
458 3300009551 Ga0105238_10172696 Ga0105238_101726962 330
459 3300009553 Ga0105249_10004214 Ga0105249_100042143 330
460 3300009993 Ga0105028_102144 Ga0105028_1021442 330
461 3300013100 Ga0157373_10002979 Ga0157373_100029796 330
462 3300013297 Ga0157378_10340734 Ga0157378_103407342 330
463 3300013306 Ga0163162_10046780 Ga0163162_100467803 330
464 3300013306 Ga0163162_10062839 Ga0163162_100628393 330
465 3300013308 Ga0157375_10120989 Ga0157375_101209893 330
466 3300014325 Ga0163163_10005988 Ga0163163_100059886 330
467 3300014326 Ga0157380_10051815 Ga0157380_100518153 330
468 3300014326 Ga0157380_10182332 Ga0157380_101823322 330
469 3300014497 Ga0182008_10005888 Ga0182008_100058883 330
470 3300014968 Ga0157379_10042091 Ga0157379_100420913 330
471 3300014969 Ga0157376_10003982 Ga0157376_100039827 330
472 3300017792 Ga0163161_10039737 Ga0163161_100397374 330
473 3300017792 Ga0163161_10156907 Ga0163161_101569072 330
474 3300025315 Ga0207697_10025959 Ga0207697_100259592 330
475 3300025903 Ga0207680_10002766 Ga0207680_100027665 330
476 3300025912 Ga0207707_10007221 Ga0207707_100072215 330
477 3300025913 Ga0207695_10139036 Ga0207695_101390362 330
478 3300025919 Ga0207657_10098505 Ga0207657_100985052 330
479 3300025919 Ga0207657_10220485 Ga0207657_102204852 330
480 3300025921 Ga0207652_10047099 Ga0207652_100470993 330
481 3300025923 Ga0207681_10009109 Ga0207681_100091093 330
482 3300025923 Ga0207681_10018913 Ga0207681_100189134 330
483 3300025923 Ga0207681_10043519 Ga0207681_100435191 330
484 3300025923 Ga0207681_10249045 Ga0207681_102490452 330
485 3300025924 Ga0207694_10333191 Ga0207694_103331911 330
486 3300025925 Ga0207650_10005456 Ga0207650_100054568 330
487 3300025925 Ga0207650_10029833 Ga0207650_100298334 330
488 3300025926 Ga0207659_10003913 Ga0207659_100039133 330
489 3300025926 Ga0207659_10013639 Ga0207659_100136394 330
490 3300025927 Ga0207687_10245379 Ga0207687_102453791 330
491 3300025927 Ga0207687_10336881 Ga0207687_103368812 330
492 3300025931 Ga0207644_10000440 Ga0207644_1000044021 330
493 3300025931 Ga0207644_10017335 Ga0207644_100173353 330
494 3300025937 Ga0207669_10045926 Ga0207669_100459262 330
495 3300025937 Ga0207669_10106707 Ga0207669_101067072 330
496 3300025938 Ga0207704_10024167 Ga0207704_100241673 330
497 3300025940 Ga0207691_10052408 Ga0207691_100524083 330
498 3300025940 Ga0207691_10281963 Ga0207691_102819632 330
499 3300025941 Ga0207711_10002271 Ga0207711_1000227114 330
500 3300025941 Ga0207711_10003157 Ga0207711_100031577 330
501 3300025942 Ga0207689_10033860 Ga0207689_100338604 330
502 3300025945 Ga0207679_10019489 Ga0207679_100194895 330
503 3300025960 Ga0207651_10003747 Ga0207651_100037475 330
504 3300025960 Ga0207651_10030890 Ga0207651_100308902 330
505 3300025960 Ga0207651_10039671 Ga0207651_100396713 330
506 3300025961 Ga0207712_10007655 Ga0207712_100076555 330
507 3300025972 Ga0207668_10163240 Ga0207668_101632402 330
508 3300025981 Ga0207640_10129447 Ga0207640_101294472 330
509 3300025986 Ga0207658_10016033 Ga0207658_100160334 330
510 3300025986 Ga0207658_10065172 Ga0207658_100651722 330
511 3300026023 Ga0207677_10002416 Ga0207677_100024167 330
512 3300026023 Ga0207677_10007814 Ga0207677_100078145 330
513 3300026035 Ga0207703_10013570 Ga0207703_100135703 330
514 3300026035 Ga0207703_10022401 Ga0207703_100224015 330
515 3300026067 Ga0207678_10078600 Ga0207678_100786003 330
516 3300026075 Ga0207708_10029269 Ga0207708_100292693 330
517 3300026078 Ga0207702_10024004 Ga0207702_100240043 330
518 3300026088 Ga0207641_10013843 Ga0207641_100138435 330
519 3300026088 Ga0207641_10016227 Ga0207641_100162273 330
520 3300026088 Ga0207641_10019101 Ga0207641_100191014 330
521 3300026088 Ga0207641_10019127 Ga0207641_100191273 330
522 3300026089 Ga0207648_10028121 Ga0207648_100281214 330
523 3300026089 Ga0207648_10168440 Ga0207648_101684403 330
524 3300026095 Ga0207676_10005447 Ga0207676_100054473 330
525 3300026095 Ga0207676_10006093 Ga0207676_100060937 330
526 3300026095 Ga0207676_10017484 Ga0207676_100174844 330
527 3300026116 Ga0207674_10031146 Ga0207674_100311465 330
528 3300026116 Ga0207674_10207804 Ga0207674_102078042 330
529 3300026118 Ga0207675_100049590 Ga0207675_1000495904 330
530 3300026118 Ga0207675_100091777 Ga0207675_1000917773 330
531 3300026121 Ga0207683_10001491 Ga0207683_1000149112 330
532 3300026142 Ga0207698_10557466 Ga0207698_105574662 330
533 3300028379 Ga0268266_10007392 Ga0268266_100073927 330
534 3300028381 Ga0268264_10093564 Ga0268264_100935642 330
535 3300028794 Ga0307515_10000152 Ga0307515_10000152133 330
536 3300031241 Ga0265325_10013325 Ga0265325_100133253 330
537 3300031548 Ga0307408_100010963 Ga0307408_1000109631 330
538 3300031711 Ga0265314_10020832 Ga0265314_100208323 330
539 3300031711 Ga0265314_10046206 Ga0265314_100462062 330
540 3300031731 Ga0307405_10098415 Ga0307405_100984153 330
541 3300031824 Ga0307413_10006777 Ga0307413_100067774 330
542 3300031901 Ga0307406_10003754 Ga0307406_100037546 330
543 3300031911 Ga0307412_10052651 Ga0307412_100526512 330
544 3300031995 Ga0307409_100002822 Ga0307409_1000028228 330
545 3300031995 Ga0307409_100103769 Ga0307409_1001037693 330
546 3300032002 Ga0307416_100127763 Ga0307416_1001277633 330
547 3300032002 Ga0307416_100355537 Ga0307416_1003555371 330
548 3300032005 Ga0307411_10000754 Ga0307411_100007546 330
549 3300032126 Ga0307415_100035721 Ga0307415_1000357212 330
550 3300035170 Ga0373943_0095990 Ga0373943_0095990_215_1225 330
551 3300035695 Ga0373927_0127927 Ga0373927_0127927_571_1584 330
552 3300037068 Ga0373925_0038576 Ga0373925_0038576_1642_2652 330
553 3300038443 Ga0395901_0217299 Ga0395901_0217299_358_1368 330
554 3300041404 Ga0439436_0000292 Ga0439436_0000292_8386_9396 330
555 3300041406 Ga0439439_0000873 Ga0439439_0000873_3177_4196 330
556 3300041407 Ga0439447_004752 Ga0439447_004752_1093_2103 330
557 3300041410 Ga0439461_0037197 Ga0439461_0037197_14_1024 330
558 3300041411 Ga0439466_0000854 Ga0439466_0000854_9257_10267 330
559 3300041413 Ga0439465_0000034 Ga0439465_0000034_5863_6873 330
560 3300041997 Ga0439431_0000727 Ga0439431_0000727_5833_6843 330
561 3300041999 Ga0439433_0000945 Ga0439433_0000945_3556_4566 330
562 3300041999 Ga0439433_0011888 Ga0439433_0011888_158_1177 330
563 3300042002 Ga0439442_019243 Ga0439442_019243_147_1157 330
564 3300042004 Ga0439445_0000511 Ga0439445_0000511_1151_2161 330
565 3300042006 Ga0439432_001169 Ga0439432_001169_8597_9607 330
566 3300042007 Ga0439449_0001078 Ga0439449_0001078_1780_2799 330
567 3300042010 Ga0439452_001608 Ga0439452_001608_2676_3686 330
568 3300042010 Ga0439452_005875 Ga0439452_005875_1304_2323 330
569 3300042015 Ga0439462_0010372 Ga0439462_0010372_998_2008 330
570 3300042015 Ga0439462_0015675 Ga0439462_0015675_692_1711 330
571 3300042123 Ga0450921_001595 Ga0450921_001595_352_1371 330
572 3300042145 Ga0450906_003692 Ga0450906_003692_1934_2953 330
573 3300042156 Ga0439446_0002778 Ga0439446_0002778_645_1655 330
574 3300042435 Ga0439434_0030207 Ga0439434_0030207_285_1304 330
575 3300042532 Ga0450893_0007500 Ga0450893_0007500_324_1343 330
576 3300042876 Ga0451577_0045590 Ga0451577_0045590_2778_3788 330
577 3300044673 Ga0453683_0000089 Ga0453683_0000089_46208_47221 330
578 3300044712 Ga0453684_0426461 Ga0453684_0426461_330_1340 330
579 3300044735 Ga0466968_0096792 Ga0466968_0096792_43_1047 330
580 3300045051 Ga0451576_0000001 Ga0451576_0000001_1711293_1712306 330
581 3300046471 Ga0495650_0044624 Ga0495650_0044624_655_1665 330
582 3300046511 Ga0495608_0177596 Ga0495608_0177596_115_1125 330
583 3300046515 Ga0495620_0080336 Ga0495620_0080336_196_1203 330
584 3300046516 Ga0495628_0047562 Ga0495628_0047562_1381_2391 330
585 3300046543 Ga0495645_0078591 Ga0495645_0078591_1275_2285 330
586 3300046683 Ga0495658_0025905 Ga0495658_0025905_713_1723 330
587 3300046683 Ga0495658_0159477 Ga0495658_0159477_137_1147 330
588 3300046689 Ga0495613_0109422 Ga0495613_0109422_869_1879 330
589 3300046691 Ga0495670_0103283 Ga0495670_0103283_400_1410 330
590 3300046809 Ga0495600_0255475 Ga0495600_0255475_23_1033 330
591 3300047673 Ga0495593_0102774 Ga0495593_0102774_227_1237 330
592 3300048907 Ga0496104_0208064 Ga0496104_0208064_528_1538 330
593 3300048908 Ga0496105_0052730 Ga0496105_0052730_1104_2114 330
594 3300048910 Ga0496107_0171096 Ga0496107_0171096_323_1333 330
595 3300048917 Ga0496114_0149990 Ga0496114_0149990_397_1407 330
596 3300049574 Ga0501038_0019715 Ga0501038_0019715_3781_4779 330
597 3300049576 Ga0501040_0015317 Ga0501040_0015317_1710_2708 330
598 3300049577 Ga0501041_0028815 Ga0501041_0028815_874_1872 330
599 3300049578 Ga0501042_0247817 Ga0501042_0247817_121_1119 330
600 3300049579 Ga0501043_0337262 Ga0501043_0337262_123_1121 330
601 3300049581 Ga0501047_0001674 Ga0501047_0001674_5492_6517 330
602 3300049582 Ga0501048_0028355 Ga0501048_0028355_223_1221 330
603 3300049586 Ga0501070_0193637 Ga0501070_0193637_20_1045 330
604 3300049592 Ga0501076_0000869 Ga0501076_0000869_12143_13141 330
605 3300049592 Ga0501076_0008429 Ga0501076_0008429_4890_5888 330
606 3300049593 Ga0501077_0011772 Ga0501077_0011772_1266_2264 330
607 3300049741 Ga0501079_0060030 Ga0501079_0060030_992_1990 330
608 3300049742 Ga0501080_0014252 Ga0501080_0014252_2356_3354 330
609 3300049743 Ga0501081_0029745 Ga0501081_0029745_301_1299 330
610 3300049760 Ga0501263_003647 Ga0501263_003647_77_1087 330
611 3300049822 Ga0501035_0162957 Ga0501035_0162957_799_1824 330
612 3300049823 Ga0501044_0001406 Ga0501044_0001406_3161_4186 330
613 3300049824 Ga0501045_0000799 Ga0501045_0000799_9494_10492 330
614 3300050489 nmdc:mga03683_17296_c1 nmdc:mga03683_17296_c1_712_1731 330
615 3300050490 nmdc:mga03n38_12577_c1 nmdc:mga03n38_12577_c1_283_1293 330
616 3300050492 nmdc:mga0yw44_27341_c1 nmdc:mga0yw44_27341_c1_986_1996 330
617 3300050493 nmdc:mga0k408_218598_c1 nmdc:mga0k408_218598_c1_97_1107 330
618 3300050493 nmdc:mga0k408_44635_c1 nmdc:mga0k408_44635_c1_1522_2532 330
619 3300050493 nmdc:mga0k408_74493_c1 nmdc:mga0k408_74493_c1_880_1905 330
620 3300050496 nmdc:mga07m45_1407_c1 nmdc:mga07m45_1407_c1_8338_9357 330
621 3300053084 Ga0495595_0023968 Ga0495595_0023968_953_1963 330
622 3300053085 Ga0495619_0097231 Ga0495619_0097231_298_1308 330
623 3300054114 Ga0501084_0038950 Ga0501084_0038950_102_1100 330
624 3300054114 Ga0501084_0369465 Ga0501084_0369465_65_1090 330
625 3300060353 Ga0501082_0056252 Ga0501082_0056252_965_1963 330
626 3300061734 Ga0530510_0038650 Ga0530510_0038650_1706_2704 330
627 3300005328 Ga0070676_10001373 Ga0070676_100013736 331
628 3300005329 Ga0070683_100006054 Ga0070683_1000060544 331
629 3300005331 Ga0070670_100002131 Ga0070670_1000021319 331
630 3300005331 Ga0070670_100108670 Ga0070670_1001086702 331
631 3300005331 Ga0070670_100121618 Ga0070670_1001216182 331
632 3300005335 Ga0070666_10013563 Ga0070666_100135634 331
633 3300005338 Ga0068868_100023451 Ga0068868_1000234512 331
634 3300005339 Ga0070660_100010702 Ga0070660_1000107026 331
635 3300005340 Ga0070689_100008484 Ga0070689_1000084843 331
636 3300005341 Ga0070691_10056277 Ga0070691_100562772 331
637 3300005344 Ga0070661_100183042 Ga0070661_1001830421 331
638 3300005347 Ga0070668_100005276 Ga0070668_1000052767 331
639 3300005347 Ga0070668_100007162 Ga0070668_1000071627 331
640 3300005353 Ga0070669_100003875 Ga0070669_1000038754 331
641 3300005354 Ga0070675_100000222 Ga0070675_1000002225 331
642 3300005354 Ga0070675_100003286 Ga0070675_1000032868 331
643 3300005355 Ga0070671_100143014 Ga0070671_1001430142 331
644 3300005356 Ga0070674_100095461 Ga0070674_1000954612 331
645 3300005364 Ga0070673_100008257 Ga0070673_1000082577 331
646 3300005364 Ga0070673_100174205 Ga0070673_1001742053 331
647 3300005365 Ga0070688_100013922 Ga0070688_1000139224 331
648 3300005367 Ga0070667_100001986 Ga0070667_10000198611 331
649 3300005367 Ga0070667_100550151 Ga0070667_1005501511 331
650 3300005436 Ga0070713_100010039 Ga0070713_1000100394 331
651 3300005439 Ga0070711_100205303 Ga0070711_1002053031 331
652 3300005455 Ga0070663_100161100 Ga0070663_1001611001 331
653 3300005455 Ga0070663_100210261 Ga0070663_1002102611 331
654 3300005456 Ga0070678_100000839 Ga0070678_1000008397 331
655 3300005456 Ga0070678_100117636 Ga0070678_1001176363 331
656 3300005459 Ga0068867_100016264 Ga0068867_1000162644 331
657 3300005459 Ga0068867_100022276 Ga0068867_1000222763 331
658 3300005466 Ga0070685_10061390 Ga0070685_100613901 331
659 3300005530 Ga0070679_100151971 Ga0070679_1001519712 331
660 3300005535 Ga0070684_100011722 Ga0070684_1000117224 331
661 3300005539 Ga0068853_100015937 Ga0068853_1000159373 331
662 3300005543 Ga0070672_100004134 Ga0070672_1000041347 331
663 3300005543 Ga0070672_100135395 Ga0070672_1001353952 331
664 3300005543 Ga0070672_100177104 Ga0070672_1001771042 331
665 3300005548 Ga0070665_100007878 Ga0070665_1000078782 331
666 3300005548 Ga0070665_100042646 Ga0070665_1000426464 331
667 3300005548 Ga0070665_100358611 Ga0070665_1003586112 331
668 3300005563 Ga0068855_100022200 Ga0068855_1000222003 331
669 3300005616 Ga0068852_100056948 Ga0068852_1000569481 331
670 3300005617 Ga0068859_100002681 Ga0068859_10000268120 331
671 3300005618 Ga0068864_100023316 Ga0068864_1000233164 331
672 3300005618 Ga0068864_100297595 Ga0068864_1002975952 331
673 3300005718 Ga0068866_10128645 Ga0068866_101286452 331
674 3300005719 Ga0068861_100235584 Ga0068861_1002355842 331
675 3300005834 Ga0068851_10029868 Ga0068851_100298683 331
676 3300005834 Ga0068851_10067475 Ga0068851_100674753 331
677 3300005841 Ga0068863_100009693 Ga0068863_1000096937 331
678 3300005841 Ga0068863_100209511 Ga0068863_1002095112 331
679 3300005842 Ga0068858_100009307 Ga0068858_1000093073 331
680 3300005842 Ga0068858_100034298 Ga0068858_1000342984 331
681 3300005843 Ga0068860_100005427 Ga0068860_1000054274 331
682 3300005843 Ga0068860_100073355 Ga0068860_1000733553 331
683 3300005843 Ga0068860_100085441 Ga0068860_1000854414 331
684 3300006237 Ga0097621_100004472 Ga0097621_1000044727 331
685 3300006358 Ga0068871_100007556 Ga0068871_1000075565 331
686 3300006881 Ga0068865_100248675 Ga0068865_1002486751 331
687 3300006931 Ga0097620_100002681 Ga0097620_10000268120 331
688 3300009093 Ga0105240_10020319 Ga0105240_100203195 331
689 3300009148 Ga0105243_10550393 Ga0105243_105503931 331
690 3300009174 Ga0105241_10102798 Ga0105241_101027982 331
691 3300009177 Ga0105248_10012417 Ga0105248_100124173 331
692 3300009545 Ga0105237_10315568 Ga0105237_103155683 331
693 3300009551 Ga0105238_10008099 Ga0105238_100080995 331
694 3300009553 Ga0105249_10067323 Ga0105249_100673233 331
695 3300010375 Ga0105239_10135367 Ga0105239_101353672 331
696 3300013105 Ga0157369_10027926 Ga0157369_100279262 331
697 3300013296 Ga0157374_10001747 Ga0157374_100017477 331
698 3300013306 Ga0163162_10010347 Ga0163162_100103473 331
699 3300013306 Ga0163162_10288491 Ga0163162_102884912 331
700 3300013308 Ga0157375_10007223 Ga0157375_100072233 331
701 3300013308 Ga0157375_10126305 Ga0157375_101263052 331
702 3300013308 Ga0157375_10310752 Ga0157375_103107522 331
703 3300014326 Ga0157380_10145507 Ga0157380_101455072 331
704 3300014968 Ga0157379_10002891 Ga0157379_100028918 331
705 3300014969 Ga0157376_10059146 Ga0157376_100591463 331
706 3300014969 Ga0157376_10165680 Ga0157376_101656802 331
707 3300017792 Ga0163161_10110147 Ga0163161_101101472 331
708 3300017792 Ga0163161_10114593 Ga0163161_101145932 331
709 3300025291 Ga0209675_1012350 Ga0209675_10123503 331
710 3300025297 Ga0209758_1010165 Ga0209758_10101654 331
711 3300025315 Ga0207697_10011006 Ga0207697_100110064 331
712 3300025321 Ga0207656_10014296 Ga0207656_100142961 331
713 3300025321 Ga0207656_10056901 Ga0207656_100569012 331
714 3300025901 Ga0207688_10190076 Ga0207688_101900762 331
715 3300025907 Ga0207645_10003339 Ga0207645_100033397 331
716 3300025909 Ga0207705_10168880 Ga0207705_101688802 331
717 3300025912 Ga0207707_10041388 Ga0207707_100413884 331
718 3300025913 Ga0207695_10154785 Ga0207695_101547853 331
719 3300025917 Ga0207660_10004146 Ga0207660_100041467 331
720 3300025919 Ga0207657_10002699 Ga0207657_100026999 331
721 3300025921 Ga0207652_10055438 Ga0207652_100554381 331
722 3300025923 Ga0207681_10003668 Ga0207681_100036684 331
723 3300025925 Ga0207650_10033505 Ga0207650_100335053 331
724 3300025925 Ga0207650_10064050 Ga0207650_100640503 331
725 3300025926 Ga0207659_10000489 Ga0207659_100004898 331
726 3300025926 Ga0207659_10001915 Ga0207659_100019158 331
727 3300025931 Ga0207644_10398123 Ga0207644_103981231 331
728 3300025934 Ga0207686_10143336 Ga0207686_101433362 331
729 3300025937 Ga0207669_10263083 Ga0207669_102630832 331
730 3300025938 Ga0207704_10014203 Ga0207704_100142034 331
731 3300025938 Ga0207704_10064102 Ga0207704_100641023 331
732 3300025940 Ga0207691_10001953 Ga0207691_100019537 331
733 3300025940 Ga0207691_10015104 Ga0207691_100151043 331
734 3300025940 Ga0207691_10079757 Ga0207691_100797572 331
735 3300025940 Ga0207691_10186667 Ga0207691_101866672 331
736 3300025941 Ga0207711_10001723 Ga0207711_1000172319 331
737 3300025942 Ga0207689_10008263 Ga0207689_100082633 331
738 3300025949 Ga0207667_10017213 Ga0207667_100172132 331
739 3300025960 Ga0207651_10001637 Ga0207651_100016372 331
740 3300025960 Ga0207651_10109674 Ga0207651_101096742 331
741 3300025960 Ga0207651_10217811 Ga0207651_102178112 331
742 3300025961 Ga0207712_10285743 Ga0207712_102857432 331
743 3300025972 Ga0207668_10003274 Ga0207668_100032747 331
744 3300025986 Ga0207658_10003036 Ga0207658_100030362 331
745 3300026023 Ga0207677_10004673 Ga0207677_100046735 331
746 3300026035 Ga0207703_10006503 Ga0207703_100065037 331
747 3300026035 Ga0207703_10253692 Ga0207703_102536922 331
748 3300026067 Ga0207678_10089401 Ga0207678_100894011 331
749 3300026067 Ga0207678_10170457 Ga0207678_101704572 331
750 3300026067 Ga0207678_10241157 Ga0207678_102411572 331
751 3300026075 Ga0207708_10155191 Ga0207708_101551911 331
752 3300026088 Ga0207641_10006088 Ga0207641_100060884 331
753 3300026089 Ga0207648_10007574 Ga0207648_100075744 331
754 3300026089 Ga0207648_10011125 Ga0207648_100111255 331
755 3300026089 Ga0207648_10070362 Ga0207648_100703622 331
756 3300026095 Ga0207676_10034652 Ga0207676_100346523 331
757 3300026116 Ga0207674_10012155 Ga0207674_100121558 331
758 3300026121 Ga0207683_10000704 Ga0207683_1000070422 331
759 3300026121 Ga0207683_10011907 Ga0207683_100119073 331
760 3300026121 Ga0207683_10024038 Ga0207683_100240383 331
761 3300028379 Ga0268266_10007037 Ga0268266_100070373 331
762 3300028379 Ga0268266_10126527 Ga0268266_101265273 331
763 3300028380 Ga0268265_10036945 Ga0268265_100369453 331
764 3300028381 Ga0268264_10003913 Ga0268264_100039139 331
765 3300030521 Ga0307511_10000043 Ga0307511_1000004377 331
766 3300031616 Ga0307508_10017344 Ga0307508_100173444 331
767 3300031824 Ga0307413_10022710 Ga0307413_100227102 331
768 3300031824 Ga0307413_10048448 Ga0307413_100484483 331
769 3300031903 Ga0307407_10110713 Ga0307407_101107131 331
770 3300032002 Ga0307416_100005326 Ga0307416_1000053266 331
771 3300046462 Ga0495651_0235444 Ga0495651_0235444_19_1032 331
772 3300046642 Ga0495634_0192055 Ga0495634_0192055_195_1208 331
773 3300047320 Ga0495672_0067290 Ga0495672_0067290_472_1485 331
774 3300047322 Ga0495680_0286898 Ga0495680_0286898_26_1039 331
775 3300048904 Ga0496101_0179275 Ga0496101_0179275_231_1256 331
776 3300048907 Ga0496104_0372177 Ga0496104_0372177_306_1331 331
777 3300048912 Ga0496109_0436373 Ga0496109_0436373_114_1139 331
778 3300048917 Ga0496114_0055106 Ga0496114_0055106_625_1650 331
779 3300048920 Ga0496117_0049354 Ga0496117_0049354_1788_2918 331
780 3300048924 Ga0496121_0004790 Ga0496121_0004790_10329_11459 331
781 3300053077 Ga0495601_0045510 Ga0495601_0045510_704_1717 331
782 3300053090 Ga0500646_0000249 Ga0500646_0000249_379_1401 331
783 3300053093 Ga0500651_0017113 Ga0500651_0017113_3000_4013 331
784 3300053118 Ga0500594_0029195 Ga0500594_0029195_18_1031 331
785 3300053119 Ga0500595_000772 Ga0500595_000772_15423_16586 331
786 3300053133 Ga0500655_014181 Ga0500655_014181_241_1263 331
787 3300053151 Ga0500604_0000152 Ga0500604_0000152_16567_17589 331
788 3300005577 Ga0068857_100283451 Ga0068857_1002834512 332
789 3300005618 Ga0068864_100036204 Ga0068864_1000362042 332
790 3300005840 Ga0068870_10029609 Ga0068870_100296092 332
791 3300005841 Ga0068863_100059193 Ga0068863_1000591932 332
792 3300009098 Ga0105245_10214697 Ga0105245_102146972 332
793 3300009101 Ga0105247_10030315 Ga0105247_100303153 332
794 3300009174 Ga0105241_10218659 Ga0105241_102186592 332
795 3300009177 Ga0105248_10110242 Ga0105248_101102423 332
796 3300009551 Ga0105238_10240557 Ga0105238_102405572 332
797 3300011119 Ga0105246_10065315 Ga0105246_100653153 332
798 3300013308 Ga0157375_10742346 Ga0157375_107423461 332
799 3300025901 Ga0207688_10013627 Ga0207688_100136274 332
800 3300025908 Ga0207643_10023594 Ga0207643_100235943 332
801 3300025918 Ga0207662_10050066 Ga0207662_100500663 332
802 3300025924 Ga0207694_10142644 Ga0207694_101426442 332
803 3300025925 Ga0207650_10140443 Ga0207650_101404432 332
804 3300025935 Ga0207709_10299092 Ga0207709_102990922 332
805 3300026095 Ga0207676_10127141 Ga0207676_101271412 332
806 3300026116 Ga0207674_10205907 Ga0207674_102059072 332
807 3300048929 Ga0496126_0005177 Ga0496126_0005177_11442_12542 332
808 3300005328 Ga0070676_10014359 Ga0070676_100143592 333
809 3300005331 Ga0070670_100053897 Ga0070670_1000538972 333
810 3300005354 Ga0070675_100017016 Ga0070675_1000170163 333
811 3300005356 Ga0070674_100004381 Ga0070674_1000043815 333
812 3300005364 Ga0070673_100083787 Ga0070673_1000837873 333
813 3300005365 Ga0070688_100084759 Ga0070688_1000847591 333
814 3300005456 Ga0070678_100004463 Ga0070678_1000044635 333
815 3300005457 Ga0070662_100037163 Ga0070662_1000371633 333
816 3300005459 Ga0068867_100053828 Ga0068867_1000538283 333
817 3300005466 Ga0070685_10009513 Ga0070685_100095132 333
818 3300005543 Ga0070672_100017800 Ga0070672_1000178003 333
819 3300011119 Ga0105246_10058976 Ga0105246_100589763 333
820 3300013297 Ga0157378_10324447 Ga0157378_103244472 333
821 3300014326 Ga0157380_10061449 Ga0157380_100614493 333
822 3300014969 Ga0157376_10057186 Ga0157376_100571863 333
823 3300017792 Ga0163161_10107466 Ga0163161_101074662 333
824 3300025893 Ga0207682_10001362 Ga0207682_100013626 333
825 3300025907 Ga0207645_10024371 Ga0207645_100243713 333
826 3300025918 Ga0207662_10179220 Ga0207662_101792202 333
827 3300025923 Ga0207681_10273928 Ga0207681_102739282 333
828 3300025926 Ga0207659_10026428 Ga0207659_100264283 333
829 3300025933 Ga0207706_10078092 Ga0207706_100780923 333
830 3300025937 Ga0207669_10008595 Ga0207669_100085952 333
831 3300025940 Ga0207691_10001672 Ga0207691_100016725 333
832 3300025972 Ga0207668_10074754 Ga0207668_100747542 333
833 3300026089 Ga0207648_10075862 Ga0207648_100758622 333
834 3300026118 Ga0207675_100052291 Ga0207675_1000522913 333
835 3300026121 Ga0207683_10005998 Ga0207683_100059989 333
836 3300032002 Ga0307416_100063038 Ga0307416_1000630382 333
837 3300042435 Ga0439434_0036357 Ga0439434_0036357_364_1365 333
838 3300046615 Ga0495656_0013332 Ga0495656_0013332_1770_2771 333
839 3300053096 Ga0500641_0002472 Ga0500641_0002472_2820_3821 333
840 3300002239 JGI24034J26672_10010008 JGI24034J26672_100100081 334
841 3300002244 JGI24742J22300_10000750 JGI24742J22300_100007502 334
842 3300005329 Ga0070683_100098659 Ga0070683_1000986592 334
843 3300005333 Ga0070677_10057304 Ga0070677_100573042 334
844 3300005334 Ga0068869_100375891 Ga0068869_1003758911 334
845 3300005335 Ga0070666_10050114 Ga0070666_100501143 334
846 3300005341 Ga0070691_10012421 Ga0070691_100124211 334
847 3300005343 Ga0070687_100010887 Ga0070687_1000108872 334
848 3300005345 Ga0070692_10033234 Ga0070692_100332341 334
849 3300005353 Ga0070669_100039310 Ga0070669_1000393102 334
850 3300005354 Ga0070675_100004035 Ga0070675_10000403510 334
851 3300005365 Ga0070688_100093645 Ga0070688_1000936453 334
852 3300005366 Ga0070659_100013444 Ga0070659_1000134442 334
853 3300005367 Ga0070667_100024527 Ga0070667_1000245274 334
854 3300005437 Ga0070710_10035698 Ga0070710_100356983 334
855 3300005438 Ga0070701_10042793 Ga0070701_100427933 334
856 3300005440 Ga0070705_100239916 Ga0070705_1002399161 334
857 3300005441 Ga0070700_100055162 Ga0070700_1000551623 334
858 3300005455 Ga0070663_100053567 Ga0070663_1000535673 334
859 3300005457 Ga0070662_100038322 Ga0070662_1000383223 334
860 3300005459 Ga0068867_100019516 Ga0068867_1000195163 334
861 3300005543 Ga0070672_100036753 Ga0070672_1000367534 334
862 3300005544 Ga0070686_100124150 Ga0070686_1001241502 334
863 3300005548 Ga0070665_100032565 Ga0070665_1000325652 334
864 3300005549 Ga0070704_100205984 Ga0070704_1002059842 334
865 3300005578 Ga0068854_100060396 Ga0068854_1000603963 334
866 3300005615 Ga0070702_100001034 Ga0070702_10000103410 334
867 3300005616 Ga0068852_100017634 Ga0068852_1000176345 334
868 3300005718 Ga0068866_10004181 Ga0068866_100041813 334
869 3300005719 Ga0068861_100015642 Ga0068861_1000156423 334
870 3300005842 Ga0068858_100004577 Ga0068858_10000457715 334
871 3300005844 Ga0068862_100018506 Ga0068862_1000185063 334
872 3300005937 Ga0081455_10163125 Ga0081455_101631252 334
873 3300006038 Ga0075365_10038124 Ga0075365_100381242 334
874 3300006175 Ga0070712_100266853 Ga0070712_1002668532 334
875 3300006177 Ga0075362_10007436 Ga0075362_100074362 334
876 3300006178 Ga0075367_10086602 Ga0075367_100866022 334
877 3300006195 Ga0075366_10001985 Ga0075366_100019854 334
878 3300006237 Ga0097621_100014066 Ga0097621_1000140663 334
879 3300006358 Ga0068871_100009054 Ga0068871_1000090543 334
880 3300006846 Ga0075430_100012270 Ga0075430_1000122702 334
881 3300006847 Ga0075431_100000481 Ga0075431_1000004818 334
882 3300006881 Ga0068865_100037843 Ga0068865_1000378433 334
883 3300009094 Ga0111539_10002444 Ga0111539_1000244418 334
884 3300009098 Ga0105245_10011564 Ga0105245_100115642 334
885 3300009101 Ga0105247_10015314 Ga0105247_100153144 334
886 3300009147 Ga0114129_10001244 Ga0114129_1000124427 334
887 3300009148 Ga0105243_10124051 Ga0105243_101240512 334
888 3300009177 Ga0105248_10021746 Ga0105248_100217468 334
889 3300009553 Ga0105249_10177960 Ga0105249_101779603 334
890 3300010375 Ga0105239_10108243 Ga0105239_101082432 334
891 3300013296 Ga0157374_10091386 Ga0157374_100913861 334
892 3300013297 Ga0157378_10012368 Ga0157378_100123686 334
893 3300013308 Ga0157375_10040018 Ga0157375_100400186 334
894 3300014326 Ga0157380_10040456 Ga0157380_100404563 334
895 3300014745 Ga0157377_10006730 Ga0157377_100067302 334
896 3300014968 Ga0157379_10037151 Ga0157379_100371512 334
897 3300014969 Ga0157376_10005753 Ga0157376_100057533 334
898 3300017792 Ga0163161_10034763 Ga0163161_100347633 334
899 3300025901 Ga0207688_10000411 Ga0207688_100004115 334
900 3300025903 Ga0207680_10036708 Ga0207680_100367083 334
901 3300025907 Ga0207645_10035195 Ga0207645_100351953 334
902 3300025908 Ga0207643_10001425 Ga0207643_100014253 334
903 3300025915 Ga0207693_10258307 Ga0207693_102583072 334
904 3300025918 Ga0207662_10005817 Ga0207662_100058174 334
905 3300025926 Ga0207659_10015637 Ga0207659_100156374 334
906 3300025927 Ga0207687_10084656 Ga0207687_100846562 334
907 3300025931 Ga0207644_10067036 Ga0207644_100670362 334
908 3300025933 Ga0207706_10001936 Ga0207706_100019362 334
909 3300025935 Ga0207709_10101544 Ga0207709_101015443 334
910 3300025937 Ga0207669_10019762 Ga0207669_100197623 334
911 3300025940 Ga0207691_10009947 Ga0207691_100099472 334
912 3300025941 Ga0207711_10032833 Ga0207711_100328332 334
913 3300025942 Ga0207689_10002774 Ga0207689_100027745 334
914 3300025960 Ga0207651_10150554 Ga0207651_101505542 334
915 3300025961 Ga0207712_10114457 Ga0207712_101144572 334
916 3300025972 Ga0207668_10167525 Ga0207668_101675252 334
917 3300025986 Ga0207658_10041412 Ga0207658_100414123 334
918 3300026023 Ga0207677_10083500 Ga0207677_100835002 334
919 3300026035 Ga0207703_10023566 Ga0207703_100235663 334
920 3300026067 Ga0207678_10010648 Ga0207678_100106487 334
921 3300026075 Ga0207708_10003811 Ga0207708_100038114 334
922 3300026078 Ga0207702_10162852 Ga0207702_101628522 334
923 3300026088 Ga0207641_10023350 Ga0207641_100233503 334
924 3300026089 Ga0207648_10013819 Ga0207648_100138192 334
925 3300026118 Ga0207675_100003203 Ga0207675_10000320310 334
926 3300026121 Ga0207683_10007493 Ga0207683_100074936 334
927 3300027907 Ga0207428_10001178 Ga0207428_1000117825 334
928 3300028379 Ga0268266_10137815 Ga0268266_101378152 334
929 3300028381 Ga0268264_10085250 Ga0268264_100852502 334
930 3300035691 Ga0373931_0034639 Ga0373931_0034639_1498_2502 334
931 3300042003 Ga0439443_000733 Ga0439443_000733_809_1813 334
932 3300042436 Ga0439435_0043336 Ga0439435_0043336_239_1243 334
933 3300046491 Ga0495584_0003056 Ga0495584_0003056_2072_3076 334
934 3300046523 Ga0495644_0038473 Ga0495644_0038473_69_1073 334
935 3300046523 Ga0495644_0055853 Ga0495644_0055853_442_1446 334
936 3300046537 Ga0495598_0025327 Ga0495598_0025327_342_1346 334
937 3300046794 Ga0495589_0048232 Ga0495589_0048232_681_1685 334
938 3300048903 Ga0496100_0002710 Ga0496100_0002710_7703_8707 334
939 3300048904 Ga0496101_0019896 Ga0496101_0019896_1255_2259 334
940 3300048904 Ga0496101_0108613 Ga0496101_0108613_653_1657 334
941 3300048905 Ga0496102_0164505 Ga0496102_0164505_511_1515 334
942 3300048906 Ga0496103_0001636 Ga0496103_0001636_13480_14484 334
943 3300048908 Ga0496105_0058797 Ga0496105_0058797_810_1814 334
944 3300048909 Ga0496106_0009030 Ga0496106_0009030_3013_4017 334
945 3300048909 Ga0496106_0239649 Ga0496106_0239649_332_1336 334
946 3300048910 Ga0496107_0006550 Ga0496107_0006550_5646_6650 334
947 3300048911 Ga0496108_0085229 Ga0496108_0085229_423_1427 334
948 3300048912 Ga0496109_0076913 Ga0496109_0076913_1644_2648 334
949 3300048917 Ga0496114_0040957 Ga0496114_0040957_1740_2744 334
950 3300048918 Ga0496115_0007030 Ga0496115_0007030_6931_7935 334
951 3300048918 Ga0496115_0092293 Ga0496115_0092293_412_1416 334
952 3300050489 nmdc:mga03683_10753_c1 nmdc:mga03683_10753_c1_651_1655 334
953 3300050492 nmdc:mga0yw44_104939_c1 nmdc:mga0yw44_104939_c1_336_1340 334
954 3300050492 nmdc:mga0yw44_5028_c1 nmdc:mga0yw44_5028_c1_930_1934 334
955 3300050493 nmdc:mga0k408_149722_c1 nmdc:mga0k408_149722_c1_231_1235 334
956 3300050494 nmdc:mga06z11_52957_c1 nmdc:mga06z11_52957_c1_759_1763 334
957 3300050507 nmdc:mga05p37_528_c1 nmdc:mga05p37_528_c1_28733_29740 334
958 3300050508 nmdc:mga09592_704_c1 nmdc:mga09592_704_c1_12229_13236 334
959 3300050509 nmdc:mga0qj67_125314_c1 nmdc:mga0qj67_125314_c1_114_1121 334
960 3300050510 nmdc:mga06r32_241_c1 nmdc:mga06r32_241_c1_41201_42208 334
961 3300050510 nmdc:mga06r32_77686_c1 nmdc:mga06r32_77686_c1_1481_2485 334
962 3300050511 nmdc:mga08y16_427_c1 nmdc:mga08y16_427_c1_16087_17094 334
963 3300053083 Ga0495655_0002544 Ga0495655_0002544_59_1063 334
964 3300053153 Ga0500616_0008468 Ga0500616_0008468_5279_6283 334

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

100

368

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.889 28 320
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.8751 28 320
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.8747 28 320
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.872 28 320
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.8694 30 320
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9101 124 241 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8842 124 247 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8711 124 247 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8664 124 247 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8538 124 247 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A2V8D509-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.8988 18 320
AF-H0A2I4-F1-model_v4 Tat pathway signal sequence domain protein 0.8982 28 320
AF-B3EWP1-F1-model_v4 UPF0065 protein in clcB-clcD intergenic region 0.8975 47 321
AF-A0A4Q7NH98-F1-model_v4 Tripartite-type tricarboxylate transporter receptor subunit TctC 0.8957 28 320
AF-A0A519I8E8-F1-model_v4 deleted 0.8951 113 320

Feature Viewer

pLDDT pTM Quality
92.25 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map