F486959
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 964 | 362 | 957 | 334 |
Family's Representative Sequence
| Representative Sequence | 3300053119|Ga0500595_000772|Ga0500595_000772_15423_16586 |
| Length | 387 |
| Sequence | MRNRVASPDTVMRCALHSAAKVEEQIPPYGLRDRFLANKIDLNEHNGGRRVKYPGLRTTVLLSAVAAALFSLPASAADWKPARPINLIVPWAAGGSTDQITRLVAGEMEKSLGQTIVIINQPGASGSIGTRSALEAAKDGYTWTAGAAQDLGAYQTLGSLDSNIKDWHLFLSVANVQVIAVNPKTPYQNAKDLLDAMKAQPGKISVATAGVTSAGHNAMELIAKNTGVKYRHVTYDGGNPAVVATVSGEADITTQLAVEEADMIRGKRLRPLATVSDKPLELEGFGTIPPLSQTLPGFTAPTNYFGIFIPKGVPDEVIAAVEKIWKENISNSEAVKKYATSRGALFAPASGDAAQKAVFPAVQANAWLLFDTGKAKVSPDTVGIPKI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 2 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 6 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 122 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 187 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 188 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 189 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 190 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 191 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 192 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 194 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 195 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 196 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 198 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 201 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 205 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 206 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 207 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 212 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 214 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 215 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 216 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 217 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 218 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 219 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 220 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 221 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 222 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 223 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 224 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 225 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 226 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 228 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 229 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 230 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 231 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 232 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 233 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 234 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 235 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 236 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 237 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 238 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 239 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 240 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 241 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 242 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 243 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 244 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 245 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 246 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 247 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 248 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 249 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 250 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 251 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 252 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 253 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 254 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 255 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 256 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 257 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 258 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 283 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 285 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 286 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 287 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 288 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 291 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 292 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 293 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 294 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 295 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 296 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 297 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 298 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 299 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 329 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 333 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 334 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 335 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 336 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 337 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 338 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 339 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 349 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 350 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 351 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 352 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 353 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 354 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 355 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 356 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 357 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 358 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 359 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 362 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.69 |
| Metatranscriptomes | 0 |
| Isolates | 0.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.81 |
| Nodule | 0.1 |
| Rhizoplane | 4.56 |
| Rhizosphere | 87.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24034J26672_10010008 | 3300002239 | Bacteria | 1405 |
| 2 | JGI24742J22300_10000750 | 3300002244 | Bacteria | 4920 |
| 3 | Ga0055540_1005341 | 3300003792 | Bacteria | 5452 |
| 4 | Ga0055531_10001448 | 3300003794 | Bacteria | 17513 |
| 5 | Ga0070658_10193604 | 3300005327 | Bacteria | 1714 |
| 6 | Ga0070676_10001373 | 3300005328 | Bacteria | 12266 |
| 7 | Ga0070676_10014359 | 3300005328 | Bacteria | 4353 |
| 8 | Ga0070676_10169758 | 3300005328 | Bacteria | 1410 |
| 9 | Ga0070683_100006054 | 3300005329 | Bacteria | 10139 |
| 10 | Ga0070683_100060942 | 3300005329 | Bacteria | 3507 |
| 11 | Ga0070683_100098659 | 3300005329 | Bacteria | 2749 |
| 12 | Ga0070690_100127681 | 3300005330 | Bacteria | 1714 |
| 13 | Ga0070670_100002131 | 3300005331 | Bacteria | 16246 |
| 14 | Ga0070670_100014115 | 3300005331 | Bacteria | 6852 |
| 15 | Ga0070670_100014179 | 3300005331 | Bacteria | 6838 |
| 16 | Ga0070670_100039560 | 3300005331 | Bacteria | 4055 |
| 17 | Ga0070670_100053897 | 3300005331 | Bacteria | 3453 |
| 18 | Ga0070670_100108670 | 3300005331 | Bacteria | 2390 |
| 19 | Ga0070670_100120958 | 3300005331 | Bacteria | 2258 |
| 20 | Ga0070670_100121618 | 3300005331 | Bacteria | 2252 |
| 21 | Ga0070670_100121658 | 3300005331 | Bacteria | 2252 |
| 22 | Ga0070670_100209962 | 3300005331 | Bacteria | 1693 |
| 23 | Ga0070677_10006429 | 3300005333 | Bacteria | 3904 |
| 24 | Ga0070677_10057304 | 3300005333 | Bacteria | 1596 |
| 25 | Ga0068869_100010779 | 3300005334 | Bacteria | 5971 |
| 26 | Ga0068869_100375891 | 3300005334 | Bacteria | 1163 |
| 27 | Ga0068869_100394634 | 3300005334 | Unclassified | 1137 |
| 28 | Ga0070666_10005260 | 3300005335 | Bacteria | 7930 |
| 29 | Ga0070666_10013563 | 3300005335 | Bacteria | 5174 |
| 30 | Ga0070666_10050114 | 3300005335 | Bacteria | 2808 |
| 31 | Ga0070680_100061553 | 3300005336 | Bacteria | 3073 |
| 32 | Ga0070680_100089044 | 3300005336 | Bacteria | 2554 |
| 33 | Ga0068868_100003309 | 3300005338 | Bacteria | 11212 |
| 34 | Ga0068868_100023451 | 3300005338 | Bacteria | 4670 |
| 35 | Ga0068868_100035815 | 3300005338 | Bacteria | 3838 |
| 36 | Ga0068868_100065885 | 3300005338 | Bacteria | 2878 |
| 37 | Ga0068868_100198147 | 3300005338 | Bacteria | 1673 |
| 38 | Ga0070660_100010702 | 3300005339 | Bacteria | 6490 |
| 39 | Ga0070660_100019623 | 3300005339 | Bacteria | 4957 |
| 40 | Ga0070660_100164560 | 3300005339 | Bacteria | 1789 |
| 41 | Ga0070689_100008484 | 3300005340 | Bacteria | 7240 |
| 42 | Ga0070689_100097983 | 3300005340 | Bacteria | 2319 |
| 43 | Ga0070691_10012421 | 3300005341 | Bacteria | 3899 |
| 44 | Ga0070691_10056277 | 3300005341 | Bacteria | 1885 |
| 45 | Ga0070687_100010887 | 3300005343 | Bacteria | 3956 |
| 46 | Ga0070687_100033629 | 3300005343 | Bacteria | 2533 |
| 47 | Ga0070661_100016290 | 3300005344 | Bacteria | 5254 |
| 48 | Ga0070661_100090991 | 3300005344 | Bacteria | 2259 |
| 49 | Ga0070661_100183042 | 3300005344 | Bacteria | 1595 |
| 50 | Ga0070692_10033234 | 3300005345 | Bacteria | 2599 |
| 51 | Ga0070668_100004725 | 3300005347 | Bacteria | 10100 |
| 52 | Ga0070668_100005276 | 3300005347 | Bacteria | 9586 |
| 53 | Ga0070668_100007162 | 3300005347 | Bacteria | 8267 |
| 54 | Ga0070668_100008179 | 3300005347 | Bacteria | 7768 |
| 55 | Ga0070668_100052000 | 3300005347 | Bacteria | 3158 |
| 56 | Ga0070669_100003875 | 3300005353 | Bacteria | 10818 |
| 57 | Ga0070669_100015522 | 3300005353 | Bacteria | 5429 |
| 58 | Ga0070669_100039310 | 3300005353 | Bacteria | 3437 |
| 59 | Ga0070669_100043586 | 3300005353 | Bacteria | 3268 |
| 60 | Ga0070669_100202248 | 3300005353 | Bacteria | 1563 |
| 61 | Ga0070675_100000222 | 3300005354 | Bacteria | 36370 |
| 62 | Ga0070675_100002982 | 3300005354 | Bacteria | 12785 |
| 63 | Ga0070675_100003286 | 3300005354 | Bacteria | 12257 |
| 64 | Ga0070675_100004035 | 3300005354 | Bacteria | 11144 |
| 65 | Ga0070675_100016700 | 3300005354 | Bacteria | 5826 |
| 66 | Ga0070675_100017016 | 3300005354 | Bacteria | 5778 |
| 67 | Ga0070675_100127961 | 3300005354 | Bacteria | 2162 |
| 68 | Ga0070675_100136625 | 3300005354 | Bacteria | 2092 |
| 69 | Ga0070671_100002733 | 3300005355 | Bacteria | 13699 |
| 70 | Ga0070671_100030435 | 3300005355 | Bacteria | 4454 |
| 71 | Ga0070671_100060358 | 3300005355 | Bacteria | 3157 |
| 72 | Ga0070671_100143014 | 3300005355 | Bacteria | 2019 |
| 73 | Ga0070671_100171238 | 3300005355 | Bacteria | 1836 |
| 74 | Ga0070674_100004381 | 3300005356 | Bacteria | 8045 |
| 75 | Ga0070674_100007981 | 3300005356 | Bacteria | 6270 |
| 76 | Ga0070674_100025512 | 3300005356 | Bacteria | 3849 |
| 77 | Ga0070674_100095461 | 3300005356 | Bacteria | 2156 |
| 78 | Ga0070673_100008257 | 3300005364 | Bacteria | 6915 |
| 79 | Ga0070673_100019910 | 3300005364 | Bacteria | 4828 |
| 80 | Ga0070673_100021568 | 3300005364 | Bacteria | 4673 |
| 81 | Ga0070673_100024790 | 3300005364 | Bacteria | 4403 |
| 82 | Ga0070673_100083787 | 3300005364 | Bacteria | 2591 |
| 83 | Ga0070673_100116164 | 3300005364 | Bacteria | 2226 |
| 84 | Ga0070673_100174205 | 3300005364 | Bacteria | 1838 |
| 85 | Ga0070673_100177101 | 3300005364 | Bacteria | 1823 |
| 86 | Ga0070673_100200450 | 3300005364 | Bacteria | 1718 |
| 87 | Ga0070688_100013922 | 3300005365 | Bacteria | 4549 |
| 88 | Ga0070688_100084759 | 3300005365 | Bacteria | 2059 |
| 89 | Ga0070688_100093645 | 3300005365 | Bacteria | 1968 |
| 90 | Ga0070659_100002034 | 3300005366 | Bacteria | 14467 |
| 91 | Ga0070659_100013444 | 3300005366 | Bacteria | 6092 |
| 92 | Ga0070667_100001986 | 3300005367 | Bacteria | 18138 |
| 93 | Ga0070667_100006321 | 3300005367 | Bacteria | 9845 |
| 94 | Ga0070667_100024527 | 3300005367 | Bacteria | 5009 |
| 95 | Ga0070667_100068659 | 3300005367 | Bacteria | 3016 |
| 96 | Ga0070667_100073437 | 3300005367 | Bacteria | 2916 |
| 97 | Ga0070667_100135754 | 3300005367 | Bacteria | 2151 |
| 98 | Ga0070667_100550151 | 3300005367 | Bacteria | 1061 |
| 99 | Ga0070714_100127250 | 3300005435 | Bacteria | 2273 |
| 100 | Ga0070713_100010039 | 3300005436 | Bacteria | 6825 |
| 101 | Ga0070710_10035698 | 3300005437 | Bacteria | 2712 |
| 102 | Ga0070701_10042793 | 3300005438 | Bacteria | 2313 |
| 103 | Ga0070711_100205303 | 3300005439 | Bacteria | 1523 |
| 104 | Ga0070705_100094499 | 3300005440 | Bacteria | 1872 |
| 105 | Ga0070705_100095992 | 3300005440 | Bacteria | 1860 |
| 106 | Ga0070705_100239916 | 3300005440 | Bacteria | 1266 |
| 107 | Ga0070700_100018478 | 3300005441 | Bacteria | 4008 |
| 108 | Ga0070700_100055162 | 3300005441 | Bacteria | 2486 |
| 109 | Ga0070700_100096209 | 3300005441 | Bacteria | 1942 |
| 110 | Ga0070694_100020492 | 3300005444 | Bacteria | 4215 |
| 111 | Ga0070663_100053567 | 3300005455 | Bacteria | 2880 |
| 112 | Ga0070663_100161100 | 3300005455 | Unclassified | 1727 |
| 113 | Ga0070663_100210261 | 3300005455 | Bacteria | 1523 |
| 114 | Ga0070678_100000839 | 3300005456 | Bacteria | 15604 |
| 115 | Ga0070678_100000866 | 3300005456 | Bacteria | 15460 |
| 116 | Ga0070678_100004463 | 3300005456 | Bacteria | 7939 |
| 117 | Ga0070678_100030306 | 3300005456 | Bacteria | 3717 |
| 118 | Ga0070678_100117636 | 3300005456 | Bacteria | 2090 |
| 119 | Ga0070678_100204362 | 3300005456 | Bacteria | 1632 |
| 120 | Ga0070662_100003122 | 3300005457 | Bacteria | 10290 |
| 121 | Ga0070662_100037163 | 3300005457 | Bacteria | 3451 |
| 122 | Ga0070662_100038322 | 3300005457 | Bacteria | 3404 |
| 123 | Ga0070681_10001792 | 3300005458 | Bacteria | 19299 |
| 124 | Ga0068867_100016264 | 3300005459 | Bacteria | 5283 |
| 125 | Ga0068867_100017535 | 3300005459 | Bacteria | 5084 |
| 126 | Ga0068867_100019516 | 3300005459 | Bacteria | 4830 |
| 127 | Ga0068867_100022276 | 3300005459 | Bacteria | 4529 |
| 128 | Ga0068867_100038132 | 3300005459 | Bacteria | 3497 |
| 129 | Ga0068867_100041022 | 3300005459 | Bacteria | 3381 |
| 130 | Ga0068867_100053828 | 3300005459 | Bacteria | 2972 |
| 131 | Ga0070685_10009513 | 3300005466 | Bacteria | 5025 |
| 132 | Ga0070685_10061390 | 3300005466 | Bacteria | 2201 |
| 133 | Ga0070679_100022366 | 3300005530 | Bacteria | 6180 |
| 134 | Ga0070679_100151971 | 3300005530 | Bacteria | 2291 |
| 135 | Ga0070684_100011722 | 3300005535 | Bacteria | 6991 |
| 136 | Ga0068853_100015937 | 3300005539 | Bacteria | 6178 |
| 137 | Ga0068853_100087872 | 3300005539 | Bacteria | 2728 |
| 138 | Ga0068853_100139783 | 3300005539 | Bacteria | 2173 |
| 139 | Ga0068853_100175578 | 3300005539 | Bacteria | 1940 |
| 140 | Ga0070672_100004134 | 3300005543 | Bacteria | 9471 |
| 141 | Ga0070672_100007156 | 3300005543 | Bacteria | 7549 |
| 142 | Ga0070672_100016891 | 3300005543 | Bacteria | 5237 |
| 143 | Ga0070672_100017800 | 3300005543 | Bacteria | 5121 |
| 144 | Ga0070672_100036753 | 3300005543 | Bacteria | 3733 |
| 145 | Ga0070672_100084575 | 3300005543 | Bacteria | 2548 |
| 146 | Ga0070672_100086681 | 3300005543 | Bacteria | 2518 |
| 147 | Ga0070672_100135395 | 3300005543 | Bacteria | 2028 |
| 148 | Ga0070672_100177104 | 3300005543 | Bacteria | 1776 |
| 149 | Ga0070686_100124150 | 3300005544 | Bacteria | 1777 |
| 150 | Ga0070695_100251306 | 3300005545 | Bacteria | 1287 |
| 151 | Ga0070693_100034874 | 3300005547 | Bacteria | 2786 |
| 152 | Ga0070693_100122485 | 3300005547 | Bacteria | 1615 |
| 153 | Ga0070665_100007878 | 3300005548 | Bacteria | 10803 |
| 154 | Ga0070665_100032565 | 3300005548 | Bacteria | 5246 |
| 155 | Ga0070665_100042646 | 3300005548 | Bacteria | 4561 |
| 156 | Ga0070665_100358611 | 3300005548 | Bacteria | 1464 |
| 157 | Ga0070704_100002887 | 3300005549 | Bacteria | 9752 |
| 158 | Ga0070704_100086973 | 3300005549 | Bacteria | 2318 |
| 159 | Ga0070704_100205984 | 3300005549 | Bacteria | 1591 |
| 160 | Ga0068855_100022200 | 3300005563 | Bacteria | 7606 |
| 161 | Ga0068855_100029129 | 3300005563 | Bacteria | 6603 |
| 162 | Ga0070664_100029270 | 3300005564 | Bacteria | 4591 |
| 163 | Ga0070664_100083959 | 3300005564 | Bacteria | 2748 |
| 164 | Ga0070664_100305947 | 3300005564 | Bacteria | 1437 |
| 165 | Ga0070664_100340737 | 3300005564 | Bacteria | 1362 |
| 166 | Ga0070664_100409484 | 3300005564 | Bacteria | 1241 |
| 167 | Ga0068857_100076298 | 3300005577 | Bacteria | 2989 |
| 168 | Ga0068857_100283451 | 3300005577 | Bacteria | 1524 |
| 169 | Ga0068854_100024181 | 3300005578 | Bacteria | 4157 |
| 170 | Ga0068854_100060396 | 3300005578 | Bacteria | 2742 |
| 171 | Ga0068856_100057133 | 3300005614 | Bacteria | 3852 |
| 172 | Ga0068856_100057426 | 3300005614 | Bacteria | 3842 |
| 173 | Ga0068856_100329051 | 3300005614 | Bacteria | 1545 |
| 174 | Ga0070702_100001034 | 3300005615 | Bacteria | 11047 |
| 175 | Ga0070702_100087932 | 3300005615 | Bacteria | 1878 |
| 176 | Ga0068852_100004082 | 3300005616 | Bacteria | 10272 |
| 177 | Ga0068852_100017634 | 3300005616 | Bacteria | 5607 |
| 178 | Ga0068852_100056948 | 3300005616 | Bacteria | 3380 |
| 179 | Ga0068859_100002681 | 3300005617 | Bacteria | 18084 |
| 180 | Ga0068859_100196983 | 3300005617 | Bacteria | 2099 |
| 181 | Ga0068864_100001940 | 3300005618 | Bacteria | 16988 |
| 182 | Ga0068864_100005972 | 3300005618 | Bacteria | 9990 |
| 183 | Ga0068864_100009587 | 3300005618 | Bacteria | 7983 |
| 184 | Ga0068864_100021040 | 3300005618 | Bacteria | 5462 |
| 185 | Ga0068864_100023316 | 3300005618 | Bacteria | 5196 |
| 186 | Ga0068864_100036204 | 3300005618 | Bacteria | 4205 |
| 187 | Ga0068864_100040559 | 3300005618 | Bacteria | 3982 |
| 188 | Ga0068864_100059983 | 3300005618 | Bacteria | 3293 |
| 189 | Ga0068864_100083100 | 3300005618 | Bacteria | 2812 |
| 190 | Ga0068864_100297595 | 3300005618 | Bacteria | 1510 |
| 191 | Ga0068866_10004181 | 3300005718 | Bacteria | 5922 |
| 192 | Ga0068866_10128645 | 3300005718 | Bacteria | 1437 |
| 193 | Ga0068861_100002784 | 3300005719 | Bacteria | 11480 |
| 194 | Ga0068861_100015642 | 3300005719 | Bacteria | 5352 |
| 195 | Ga0068861_100035573 | 3300005719 | Bacteria | 3690 |
| 196 | Ga0068861_100036669 | 3300005719 | Bacteria | 3641 |
| 197 | Ga0068861_100235584 | 3300005719 | Bacteria | 1555 |
| 198 | Ga0068861_100334244 | 3300005719 | Bacteria | 1324 |
| 199 | Ga0068851_10029868 | 3300005834 | Bacteria | 2700 |
| 200 | Ga0068851_10067475 | 3300005834 | Bacteria | 1845 |
| 201 | Ga0068870_10029609 | 3300005840 | Bacteria | 2759 |
| 202 | Ga0068870_10036327 | 3300005840 | Bacteria | 2534 |
| 203 | Ga0068870_10069124 | 3300005840 | Bacteria | 1921 |
| 204 | Ga0068863_100009693 | 3300005841 | Bacteria | 9397 |
| 205 | Ga0068863_100009737 | 3300005841 | Bacteria | 9376 |
| 206 | Ga0068863_100029987 | 3300005841 | Bacteria | 5195 |
| 207 | Ga0068863_100059193 | 3300005841 | Bacteria | 3624 |
| 208 | Ga0068863_100209511 | 3300005841 | Bacteria | 1877 |
| 209 | Ga0068863_100237649 | 3300005841 | Bacteria | 1758 |
| 210 | Ga0068858_100002388 | 3300005842 | Bacteria | 18996 |
| 211 | Ga0068858_100004577 | 3300005842 | Bacteria | 13542 |
| 212 | Ga0068858_100009307 | 3300005842 | Bacteria | 9376 |
| 213 | Ga0068858_100034298 | 3300005842 | Bacteria | 4707 |
| 214 | Ga0068858_100076040 | 3300005842 | Bacteria | 3119 |
| 215 | Ga0068860_100005427 | 3300005843 | Bacteria | 12929 |
| 216 | Ga0068860_100011379 | 3300005843 | Bacteria | 8768 |
| 217 | Ga0068860_100073355 | 3300005843 | Bacteria | 3253 |
| 218 | Ga0068860_100085441 | 3300005843 | Bacteria | 3002 |
| 219 | Ga0068860_100086376 | 3300005843 | Bacteria | 2985 |
| 220 | Ga0068860_100177275 | 3300005843 | Bacteria | 2060 |
| 221 | Ga0068862_100018506 | 3300005844 | Bacteria | 5802 |
| 222 | Ga0068862_100046400 | 3300005844 | Bacteria | 3707 |
| 223 | Ga0068862_100075270 | 3300005844 | Bacteria | 2920 |
| 224 | Ga0068862_100082185 | 3300005844 | Bacteria | 2795 |
| 225 | Ga0068862_100093130 | 3300005844 | Bacteria | 2627 |
| 226 | Ga0068862_100111733 | 3300005844 | Bacteria | 2399 |
| 227 | Ga0068862_100398043 | 3300005844 | Bacteria | 1288 |
| 228 | Ga0081455_10163125 | 3300005937 | Bacteria | 1706 |
| 229 | Ga0081538_10092648 | 3300005981 | Bacteria | 1555 |
| 230 | Ga0075365_10001711 | 3300006038 | Bacteria | 10157 |
| 231 | Ga0075365_10038124 | 3300006038 | Bacteria | 3122 |
| 232 | Ga0075368_10002491 | 3300006042 | Bacteria | 6025 |
| 233 | Ga0075363_100024045 | 3300006048 | Bacteria | 3094 |
| 234 | Ga0075363_100024902 | 3300006048 | Bacteria | 3046 |
| 235 | Ga0075363_100100398 | 3300006048 | Bacteria | 1601 |
| 236 | Ga0075364_10069037 | 3300006051 | Bacteria | 2325 |
| 237 | Ga0070712_100266853 | 3300006175 | Bacteria | 1374 |
| 238 | Ga0075362_10007436 | 3300006177 | Bacteria | 4150 |
| 239 | Ga0075362_10034704 | 3300006177 | Bacteria | 2199 |
| 240 | Ga0075367_10052682 | 3300006178 | Bacteria | 2409 |
| 241 | Ga0075367_10086602 | 3300006178 | Bacteria | 1902 |
| 242 | Ga0075366_10001985 | 3300006195 | Bacteria | 10354 |
| 243 | Ga0075366_10017317 | 3300006195 | Bacteria | 4147 |
| 244 | Ga0075366_10065299 | 3300006195 | Bacteria | 2165 |
| 245 | Ga0097621_100004472 | 3300006237 | Bacteria | 9743 |
| 246 | Ga0097621_100014066 | 3300006237 | Bacteria | 5980 |
| 247 | Ga0097621_100128809 | 3300006237 | Bacteria | 2152 |
| 248 | Ga0075370_10003250 | 3300006353 | Bacteria | 7697 |
| 249 | Ga0075370_10014243 | 3300006353 | Bacteria | 4239 |
| 250 | Ga0068871_100003086 | 3300006358 | Bacteria | 11430 |
| 251 | Ga0068871_100007556 | 3300006358 | Bacteria | 7775 |
| 252 | Ga0068871_100009054 | 3300006358 | Bacteria | 7189 |
| 253 | Ga0068871_100012450 | 3300006358 | Bacteria | 6272 |
| 254 | Ga0068871_100075832 | 3300006358 | Bacteria | 2776 |
| 255 | Ga0068871_100226439 | 3300006358 | Bacteria | 1622 |
| 256 | Ga0075428_100019621 | 3300006844 | Bacteria | 7481 |
| 257 | Ga0075428_100025402 | 3300006844 | Bacteria | 6556 |
| 258 | Ga0075428_100032142 | 3300006844 | Bacteria | 5797 |
| 259 | Ga0075428_100040584 | 3300006844 | Bacteria | 5119 |
| 260 | Ga0075428_100253459 | 3300006844 | Bacteria | 1896 |
| 261 | Ga0075430_100000319 | 3300006846 | Bacteria | 34222 |
| 262 | Ga0075430_100012270 | 3300006846 | Bacteria | 7292 |
| 263 | Ga0075431_100000481 | 3300006847 | Bacteria | 33062 |
| 264 | Ga0075431_100004976 | 3300006847 | Bacteria | 13080 |
| 265 | Ga0075431_100071946 | 3300006847 | Bacteria | 3568 |
| 266 | Ga0075431_100180554 | 3300006847 | Bacteria | 2166 |
| 267 | Ga0075429_100000272 | 3300006880 | Bacteria | 36248 |
| 268 | Ga0075429_100097182 | 3300006880 | Bacteria | 2569 |
| 269 | Ga0068865_100004681 | 3300006881 | Bacteria | 8265 |
| 270 | Ga0068865_100037843 | 3300006881 | Bacteria | 3261 |
| 271 | Ga0068865_100248675 | 3300006881 | Bacteria | 1402 |
| 272 | Ga0097620_100002681 | 3300006931 | Bacteria | 18084 |
| 273 | Ga0097620_100196991 | 3300006931 | Bacteria | 2099 |
| 274 | Ga0105240_10017289 | 3300009093 | Bacteria | 9725 |
| 275 | Ga0105240_10020319 | 3300009093 | Bacteria | 8862 |
| 276 | Ga0105240_10117358 | 3300009093 | Bacteria | 3208 |
| 277 | Ga0111539_10002444 | 3300009094 | Bacteria | 24696 |
| 278 | Ga0111539_10551601 | 3300009094 | Bacteria | 1342 |
| 279 | Ga0105245_10011564 | 3300009098 | Bacteria | 7688 |
| 280 | Ga0105245_10214697 | 3300009098 | Bacteria | 1853 |
| 281 | Ga0105245_10511891 | 3300009098 | Bacteria | 1218 |
| 282 | Ga0105247_10015314 | 3300009101 | Bacteria | 4595 |
| 283 | Ga0105247_10030315 | 3300009101 | Bacteria | 3278 |
| 284 | Ga0114129_10001244 | 3300009147 | Bacteria | 33939 |
| 285 | Ga0105243_10100171 | 3300009148 | Bacteria | 2403 |
| 286 | Ga0105243_10124051 | 3300009148 | Bacteria | 2182 |
| 287 | Ga0105243_10151701 | 3300009148 | Bacteria | 1988 |
| 288 | Ga0105243_10168844 | 3300009148 | Bacteria | 1893 |
| 289 | Ga0105243_10550393 | 3300009148 | Bacteria | 1102 |
| 290 | Ga0105241_10102465 | 3300009174 | Bacteria | 2278 |
| 291 | Ga0105241_10102798 | 3300009174 | Bacteria | 2274 |
| 292 | Ga0105241_10218659 | 3300009174 | Bacteria | 1600 |
| 293 | Ga0105241_10234750 | 3300009174 | Bacteria | 1547 |
| 294 | Ga0105242_10177777 | 3300009176 | Bacteria | 1875 |
| 295 | Ga0105242_10374497 | 3300009176 | Bacteria | 1322 |
| 296 | Ga0105248_10012417 | 3300009177 | Bacteria | 9395 |
| 297 | Ga0105248_10018837 | 3300009177 | Bacteria | 7635 |
| 298 | Ga0105248_10021746 | 3300009177 | Bacteria | 7107 |
| 299 | Ga0105248_10039908 | 3300009177 | Bacteria | 5263 |
| 300 | Ga0105248_10045611 | 3300009177 | Bacteria | 4915 |
| 301 | Ga0105248_10110242 | 3300009177 | Bacteria | 3103 |
| 302 | Ga0105248_10123037 | 3300009177 | Bacteria | 2927 |
| 303 | Ga0105248_10234668 | 3300009177 | Bacteria | 2065 |
| 304 | Ga0105248_10245305 | 3300009177 | Bacteria | 2016 |
| 305 | Ga0105237_10056267 | 3300009545 | Bacteria | 3937 |
| 306 | Ga0105237_10132828 | 3300009545 | Bacteria | 2484 |
| 307 | Ga0105237_10315568 | 3300009545 | Bacteria | 1566 |
| 308 | Ga0105238_10008099 | 3300009551 | Bacteria | 10512 |
| 309 | Ga0105238_10097998 | 3300009551 | Bacteria | 2916 |
| 310 | Ga0105238_10144442 | 3300009551 | Bacteria | 2356 |
| 311 | Ga0105238_10172696 | 3300009551 | Bacteria | 2138 |
| 312 | Ga0105238_10240557 | 3300009551 | Bacteria | 1787 |
| 313 | Ga0105238_10244089 | 3300009551 | Bacteria | 1774 |
| 314 | Ga0105249_10004214 | 3300009553 | Bacteria | 12429 |
| 315 | Ga0105249_10067323 | 3300009553 | Bacteria | 3299 |
| 316 | Ga0105249_10177960 | 3300009553 | Bacteria | 2067 |
| 317 | Ga0105028_102144 | 3300009993 | Bacteria | 2073 |
| 318 | Ga0105239_10099437 | 3300010375 | Bacteria | 3216 |
| 319 | Ga0105239_10108243 | 3300010375 | Bacteria | 3080 |
| 320 | Ga0105239_10135367 | 3300010375 | Bacteria | 2743 |
| 321 | Ga0105246_10058976 | 3300011119 | Bacteria | 2661 |
| 322 | Ga0105246_10065315 | 3300011119 | Bacteria | 2544 |
| 323 | Ga0157373_10002979 | 3300013100 | Bacteria | 12820 |
| 324 | Ga0157371_10032495 | 3300013102 | Bacteria | 3755 |
| 325 | Ga0157370_10347207 | 3300013104 | Bacteria | 1368 |
| 326 | Ga0157369_10026731 | 3300013105 | Bacteria | 6401 |
| 327 | Ga0157369_10027926 | 3300013105 | Bacteria | 6249 |
| 328 | Ga0157374_10001747 | 3300013296 | Bacteria | 18243 |
| 329 | Ga0157374_10091386 | 3300013296 | Bacteria | 2903 |
| 330 | Ga0157374_10215132 | 3300013296 | Bacteria | 1885 |
| 331 | Ga0157378_10012368 | 3300013297 | Bacteria | 7474 |
| 332 | Ga0157378_10040285 | 3300013297 | Bacteria | 4142 |
| 333 | Ga0157378_10324447 | 3300013297 | Bacteria | 1497 |
| 334 | Ga0157378_10340734 | 3300013297 | Bacteria | 1462 |
| 335 | Ga0163162_10001342 | 3300013306 | Bacteria | 22916 |
| 336 | Ga0163162_10005347 | 3300013306 | Bacteria | 12394 |
| 337 | Ga0163162_10010347 | 3300013306 | Bacteria | 9067 |
| 338 | Ga0163162_10046780 | 3300013306 | Bacteria | 4337 |
| 339 | Ga0163162_10053652 | 3300013306 | Bacteria | 4052 |
| 340 | Ga0163162_10062839 | 3300013306 | Bacteria | 3754 |
| 341 | Ga0163162_10288491 | 3300013306 | Bacteria | 1773 |
| 342 | Ga0163162_10438189 | 3300013306 | Bacteria | 1439 |
| 343 | Ga0157375_10007223 | 3300013308 | Bacteria | 9714 |
| 344 | Ga0157375_10033464 | 3300013308 | Bacteria | 4885 |
| 345 | Ga0157375_10040018 | 3300013308 | Bacteria | 4515 |
| 346 | Ga0157375_10120989 | 3300013308 | Bacteria | 2727 |
| 347 | Ga0157375_10126305 | 3300013308 | Bacteria | 2673 |
| 348 | Ga0157375_10310752 | 3300013308 | Bacteria | 1740 |
| 349 | Ga0157375_10742346 | 3300013308 | Bacteria | 1133 |
| 350 | Ga0163163_10005988 | 3300014325 | Bacteria | 10575 |
| 351 | Ga0163163_10327202 | 3300014325 | Bacteria | 1587 |
| 352 | Ga0157380_10040456 | 3300014326 | Bacteria | 3631 |
| 353 | Ga0157380_10051815 | 3300014326 | Bacteria | 3248 |
| 354 | Ga0157380_10061449 | 3300014326 | Bacteria | 3006 |
| 355 | Ga0157380_10145507 | 3300014326 | Bacteria | 2042 |
| 356 | Ga0157380_10182332 | 3300014326 | Bacteria | 1846 |
| 357 | Ga0182008_10005888 | 3300014497 | Bacteria | 6928 |
| 358 | Ga0157377_10006730 | 3300014745 | Bacteria | 5504 |
| 359 | Ga0157379_10002891 | 3300014968 | Bacteria | 14487 |
| 360 | Ga0157379_10037151 | 3300014968 | Bacteria | 4342 |
| 361 | Ga0157379_10042091 | 3300014968 | Bacteria | 4077 |
| 362 | Ga0157376_10003982 | 3300014969 | Bacteria | 10210 |
| 363 | Ga0157376_10005753 | 3300014969 | Bacteria | 8684 |
| 364 | Ga0157376_10057186 | 3300014969 | Bacteria | 3261 |
| 365 | Ga0157376_10059146 | 3300014969 | Bacteria | 3213 |
| 366 | Ga0157376_10165680 | 3300014969 | Bacteria | 2008 |
| 367 | Ga0163161_10034763 | 3300017792 | Bacteria | 3605 |
| 368 | Ga0163161_10039737 | 3300017792 | Bacteria | 3379 |
| 369 | Ga0163161_10107466 | 3300017792 | Bacteria | 2083 |
| 370 | Ga0163161_10110147 | 3300017792 | Bacteria | 2058 |
| 371 | Ga0163161_10114593 | 3300017792 | Bacteria | 2019 |
| 372 | Ga0163161_10156907 | 3300017792 | Bacteria | 1733 |
| 373 | Ga0213875_10034816 | 3300021388 | Unclassified | 2377 |
| 374 | Ga0209673_1029447 | 3300025273 | Bacteria | 1748 |
| 375 | Ga0209130_1019002 | 3300025284 | Bacteria | 1603 |
| 376 | Ga0209675_1012350 | 3300025291 | Bacteria | 2759 |
| 377 | Ga0209758_1010165 | 3300025297 | Bacteria | 5688 |
| 378 | Ga0209051_1000272 | 3300025303 | Bacteria | 86518 |
| 379 | Ga0209257_1000055 | 3300025304 | Bacteria | 415534 |
| 380 | Ga0207697_10011006 | 3300025315 | Bacteria | 3839 |
| 381 | Ga0207697_10013163 | 3300025315 | Bacteria | 3454 |
| 382 | Ga0207697_10025959 | 3300025315 | Bacteria | 2395 |
| 383 | Ga0207656_10014296 | 3300025321 | Bacteria | 3054 |
| 384 | Ga0207656_10056901 | 3300025321 | Bacteria | 1706 |
| 385 | Ga0207682_10001362 | 3300025893 | Bacteria | 11271 |
| 386 | Ga0207682_10032993 | 3300025893 | Bacteria | 2082 |
| 387 | Ga0207688_10000411 | 3300025901 | Bacteria | 20090 |
| 388 | Ga0207688_10013627 | 3300025901 | Bacteria | 4420 |
| 389 | Ga0207688_10045138 | 3300025901 | Bacteria | 2458 |
| 390 | Ga0207688_10054263 | 3300025901 | Bacteria | 2248 |
| 391 | Ga0207688_10190076 | 3300025901 | Bacteria | 1227 |
| 392 | Ga0207680_10002766 | 3300025903 | Bacteria | 8204 |
| 393 | Ga0207680_10036708 | 3300025903 | Bacteria | 2824 |
| 394 | Ga0207645_10003339 | 3300025907 | Bacteria | 12235 |
| 395 | Ga0207645_10024371 | 3300025907 | Bacteria | 3924 |
| 396 | Ga0207645_10026044 | 3300025907 | Bacteria | 3782 |
| 397 | Ga0207645_10027324 | 3300025907 | Bacteria | 3686 |
| 398 | Ga0207645_10035195 | 3300025907 | Bacteria | 3216 |
| 399 | Ga0207643_10001425 | 3300025908 | Bacteria | 13707 |
| 400 | Ga0207643_10022298 | 3300025908 | Bacteria | 3485 |
| 401 | Ga0207643_10023594 | 3300025908 | Bacteria | 3392 |
| 402 | Ga0207705_10155675 | 3300025909 | Bacteria | 1714 |
| 403 | Ga0207705_10168880 | 3300025909 | Bacteria | 1646 |
| 404 | Ga0207707_10007221 | 3300025912 | Bacteria | 9669 |
| 405 | Ga0207707_10041388 | 3300025912 | Bacteria | 4024 |
| 406 | Ga0207695_10139036 | 3300025913 | Bacteria | 2379 |
| 407 | Ga0207695_10154785 | 3300025913 | Bacteria | 2228 |
| 408 | Ga0207671_10139163 | 3300025914 | Bacteria | 1869 |
| 409 | Ga0207693_10258307 | 3300025915 | Bacteria | 1366 |
| 410 | Ga0207660_10004146 | 3300025917 | Bacteria | 9430 |
| 411 | Ga0207662_10005817 | 3300025918 | Bacteria | 6606 |
| 412 | Ga0207662_10050066 | 3300025918 | Bacteria | 2480 |
| 413 | Ga0207662_10179220 | 3300025918 | Bacteria | 1363 |
| 414 | Ga0207657_10002699 | 3300025919 | Bacteria | 19136 |
| 415 | Ga0207657_10098505 | 3300025919 | Bacteria | 2430 |
| 416 | Ga0207657_10220485 | 3300025919 | Bacteria | 1520 |
| 417 | Ga0207652_10047099 | 3300025921 | Bacteria | 3682 |
| 418 | Ga0207652_10055438 | 3300025921 | Bacteria | 3409 |
| 419 | Ga0207681_10003668 | 3300025923 | Bacteria | 9544 |
| 420 | Ga0207681_10009109 | 3300025923 | Bacteria | 6064 |
| 421 | Ga0207681_10018913 | 3300025923 | Bacteria | 4345 |
| 422 | Ga0207681_10043519 | 3300025923 | Bacteria | 3005 |
| 423 | Ga0207681_10123673 | 3300025923 | Bacteria | 1901 |
| 424 | Ga0207681_10145845 | 3300025923 | Bacteria | 1768 |
| 425 | Ga0207681_10249045 | 3300025923 | Bacteria | 1386 |
| 426 | Ga0207681_10273928 | 3300025923 | Bacteria | 1326 |
| 427 | Ga0207694_10142644 | 3300025924 | Bacteria | 1927 |
| 428 | Ga0207694_10333191 | 3300025924 | Bacteria | 1254 |
| 429 | Ga0207650_10005456 | 3300025925 | Bacteria | 8680 |
| 430 | Ga0207650_10029833 | 3300025925 | Bacteria | 3924 |
| 431 | Ga0207650_10033505 | 3300025925 | Bacteria | 3721 |
| 432 | Ga0207650_10049858 | 3300025925 | Bacteria | 3093 |
| 433 | Ga0207650_10064050 | 3300025925 | Bacteria | 2751 |
| 434 | Ga0207650_10140443 | 3300025925 | Bacteria | 1898 |
| 435 | Ga0207659_10000489 | 3300025926 | Bacteria | 23834 |
| 436 | Ga0207659_10001915 | 3300025926 | Bacteria | 12342 |
| 437 | Ga0207659_10003913 | 3300025926 | Bacteria | 8984 |
| 438 | Ga0207659_10013639 | 3300025926 | Bacteria | 5213 |
| 439 | Ga0207659_10015637 | 3300025926 | Bacteria | 4923 |
| 440 | Ga0207659_10026428 | 3300025926 | Bacteria | 3916 |
| 441 | Ga0207659_10079980 | 3300025926 | Bacteria | 2413 |
| 442 | Ga0207687_10084656 | 3300025927 | Bacteria | 2299 |
| 443 | Ga0207687_10245379 | 3300025927 | Bacteria | 1421 |
| 444 | Ga0207687_10249896 | 3300025927 | Bacteria | 1409 |
| 445 | Ga0207687_10336881 | 3300025927 | Bacteria | 1225 |
| 446 | Ga0207644_10000440 | 3300025931 | Bacteria | 26885 |
| 447 | Ga0207644_10017335 | 3300025931 | Bacteria | 4862 |
| 448 | Ga0207644_10067036 | 3300025931 | Bacteria | 2615 |
| 449 | Ga0207644_10398123 | 3300025931 | Bacteria | 1125 |
| 450 | Ga0207706_10001936 | 3300025933 | Bacteria | 20313 |
| 451 | Ga0207706_10009759 | 3300025933 | Bacteria | 8811 |
| 452 | Ga0207706_10078092 | 3300025933 | Bacteria | 2912 |
| 453 | Ga0207686_10143336 | 3300025934 | Bacteria | 1654 |
| 454 | Ga0207709_10101544 | 3300025935 | Bacteria | 1903 |
| 455 | Ga0207709_10104478 | 3300025935 | Bacteria | 1880 |
| 456 | Ga0207709_10299092 | 3300025935 | Bacteria | 1196 |
| 457 | Ga0207709_10312497 | 3300025935 | Bacteria | 1173 |
| 458 | Ga0207669_10008595 | 3300025937 | Bacteria | 4802 |
| 459 | Ga0207669_10019762 | 3300025937 | Bacteria | 3516 |
| 460 | Ga0207669_10045926 | 3300025937 | Bacteria | 2577 |
| 461 | Ga0207669_10106707 | 3300025937 | Bacteria | 1866 |
| 462 | Ga0207669_10263083 | 3300025937 | Bacteria | 1291 |
| 463 | Ga0207704_10014203 | 3300025938 | Bacteria | 4015 |
| 464 | Ga0207704_10024167 | 3300025938 | Bacteria | 3290 |
| 465 | Ga0207704_10039214 | 3300025938 | Bacteria | 2756 |
| 466 | Ga0207704_10064102 | 3300025938 | Bacteria | 2294 |
| 467 | Ga0207691_10001672 | 3300025940 | Bacteria | 21925 |
| 468 | Ga0207691_10001953 | 3300025940 | Bacteria | 20127 |
| 469 | Ga0207691_10002980 | 3300025940 | Bacteria | 16526 |
| 470 | Ga0207691_10009947 | 3300025940 | Bacteria | 9134 |
| 471 | Ga0207691_10015104 | 3300025940 | Bacteria | 7348 |
| 472 | Ga0207691_10052408 | 3300025940 | Bacteria | 3727 |
| 473 | Ga0207691_10079757 | 3300025940 | Bacteria | 2945 |
| 474 | Ga0207691_10186667 | 3300025940 | Bacteria | 1810 |
| 475 | Ga0207691_10281963 | 3300025940 | Bacteria | 1429 |
| 476 | Ga0207711_10001723 | 3300025941 | Bacteria | 20076 |
| 477 | Ga0207711_10002271 | 3300025941 | Bacteria | 17262 |
| 478 | Ga0207711_10003157 | 3300025941 | Bacteria | 14362 |
| 479 | Ga0207711_10032833 | 3300025941 | Bacteria | 4390 |
| 480 | Ga0207689_10000284 | 3300025942 | Bacteria | 46090 |
| 481 | Ga0207689_10002774 | 3300025942 | Bacteria | 16198 |
| 482 | Ga0207689_10008263 | 3300025942 | Bacteria | 9071 |
| 483 | Ga0207689_10010981 | 3300025942 | Bacteria | 7787 |
| 484 | Ga0207689_10033860 | 3300025942 | Bacteria | 4244 |
| 485 | Ga0207661_10202051 | 3300025944 | Bacteria | 1747 |
| 486 | Ga0207679_10019489 | 3300025945 | Bacteria | 4558 |
| 487 | Ga0207679_10031315 | 3300025945 | Bacteria | 3722 |
| 488 | Ga0207679_10083958 | 3300025945 | Unclassified | 2443 |
| 489 | Ga0207679_10152945 | 3300025945 | Bacteria | 1880 |
| 490 | Ga0207667_10017213 | 3300025949 | Bacteria | 8143 |
| 491 | Ga0207667_10580856 | 3300025949 | Bacteria | 1131 |
| 492 | Ga0207651_10001637 | 3300025960 | Bacteria | 10281 |
| 493 | Ga0207651_10003747 | 3300025960 | Bacteria | 7523 |
| 494 | Ga0207651_10030890 | 3300025960 | Bacteria | 3417 |
| 495 | Ga0207651_10039671 | 3300025960 | Bacteria | 3107 |
| 496 | Ga0207651_10109674 | 3300025960 | Bacteria | 2069 |
| 497 | Ga0207651_10150554 | 3300025960 | Bacteria | 1810 |
| 498 | Ga0207651_10217811 | 3300025960 | Bacteria | 1541 |
| 499 | Ga0207712_10007655 | 3300025961 | Bacteria | 6831 |
| 500 | Ga0207712_10114457 | 3300025961 | Bacteria | 2029 |
| 501 | Ga0207712_10285743 | 3300025961 | Bacteria | 1348 |
| 502 | Ga0207668_10003274 | 3300025972 | Bacteria | 9493 |
| 503 | Ga0207668_10005494 | 3300025972 | Bacteria | 7470 |
| 504 | Ga0207668_10074754 | 3300025972 | Bacteria | 2434 |
| 505 | Ga0207668_10163240 | 3300025972 | Bacteria | 1738 |
| 506 | Ga0207668_10167525 | 3300025972 | Bacteria | 1719 |
| 507 | Ga0207640_10017173 | 3300025981 | Bacteria | 4227 |
| 508 | Ga0207640_10129447 | 3300025981 | Bacteria | 1822 |
| 509 | Ga0207658_10003036 | 3300025986 | Bacteria | 11999 |
| 510 | Ga0207658_10016033 | 3300025986 | Bacteria | 5147 |
| 511 | Ga0207658_10041412 | 3300025986 | Bacteria | 3335 |
| 512 | Ga0207658_10065172 | 3300025986 | Bacteria | 2735 |
| 513 | Ga0207658_10198237 | 3300025986 | Bacteria | 1674 |
| 514 | Ga0207677_10002416 | 3300026023 | Bacteria | 9797 |
| 515 | Ga0207677_10004673 | 3300026023 | Bacteria | 7378 |
| 516 | Ga0207677_10007814 | 3300026023 | Bacteria | 5938 |
| 517 | Ga0207677_10083500 | 3300026023 | Bacteria | 2299 |
| 518 | Ga0207677_10123110 | 3300026023 | Bacteria | 1955 |
| 519 | Ga0207703_10006503 | 3300026035 | Bacteria | 9329 |
| 520 | Ga0207703_10013570 | 3300026035 | Bacteria | 6347 |
| 521 | Ga0207703_10022401 | 3300026035 | Bacteria | 4955 |
| 522 | Ga0207703_10023566 | 3300026035 | Bacteria | 4837 |
| 523 | Ga0207703_10253692 | 3300026035 | Bacteria | 1587 |
| 524 | Ga0207678_10007008 | 3300026067 | Bacteria | 10004 |
| 525 | Ga0207678_10010648 | 3300026067 | Bacteria | 8080 |
| 526 | Ga0207678_10078600 | 3300026067 | Bacteria | 2825 |
| 527 | Ga0207678_10089401 | 3300026067 | Unclassified | 2633 |
| 528 | Ga0207678_10170457 | 3300026067 | Bacteria | 1858 |
| 529 | Ga0207678_10241157 | 3300026067 | Bacteria | 1548 |
| 530 | Ga0207708_10003811 | 3300026075 | Bacteria | 11117 |
| 531 | Ga0207708_10029269 | 3300026075 | Bacteria | 4173 |
| 532 | Ga0207708_10089458 | 3300026075 | Bacteria | 2373 |
| 533 | Ga0207708_10155191 | 3300026075 | Bacteria | 1805 |
| 534 | Ga0207702_10024004 | 3300026078 | Bacteria | 5060 |
| 535 | Ga0207702_10043419 | 3300026078 | Bacteria | 3774 |
| 536 | Ga0207702_10066859 | 3300026078 | Bacteria | 3083 |
| 537 | Ga0207702_10162852 | 3300026078 | Bacteria | 2038 |
| 538 | Ga0207641_10006088 | 3300026088 | Bacteria | 10214 |
| 539 | Ga0207641_10013843 | 3300026088 | Bacteria | 6616 |
| 540 | Ga0207641_10016227 | 3300026088 | Bacteria | 6100 |
| 541 | Ga0207641_10019101 | 3300026088 | Bacteria | 5621 |
| 542 | Ga0207641_10019127 | 3300026088 | Bacteria | 5617 |
| 543 | Ga0207641_10023350 | 3300026088 | Bacteria | 5096 |
| 544 | Ga0207641_10135902 | 3300026088 | Bacteria | 2213 |
| 545 | Ga0207648_10000585 | 3300026089 | Bacteria | 40840 |
| 546 | Ga0207648_10007574 | 3300026089 | Bacteria | 10651 |
| 547 | Ga0207648_10011125 | 3300026089 | Bacteria | 8488 |
| 548 | Ga0207648_10013819 | 3300026089 | Bacteria | 7489 |
| 549 | Ga0207648_10015261 | 3300026089 | Bacteria | 7067 |
| 550 | Ga0207648_10028121 | 3300026089 | Bacteria | 4987 |
| 551 | Ga0207648_10070362 | 3300026089 | Bacteria | 3050 |
| 552 | Ga0207648_10075862 | 3300026089 | Bacteria | 2930 |
| 553 | Ga0207648_10168440 | 3300026089 | Bacteria | 1936 |
| 554 | Ga0207676_10005447 | 3300026095 | Bacteria | 9004 |
| 555 | Ga0207676_10006093 | 3300026095 | Bacteria | 8509 |
| 556 | Ga0207676_10015912 | 3300026095 | Bacteria | 5441 |
| 557 | Ga0207676_10017484 | 3300026095 | Bacteria | 5197 |
| 558 | Ga0207676_10026747 | 3300026095 | Bacteria | 4291 |
| 559 | Ga0207676_10034652 | 3300026095 | Bacteria | 3823 |
| 560 | Ga0207676_10127141 | 3300026095 | Bacteria | 2160 |
| 561 | Ga0207674_10012155 | 3300026116 | Bacteria | 9638 |
| 562 | Ga0207674_10031146 | 3300026116 | Bacteria | 5605 |
| 563 | Ga0207674_10205907 | 3300026116 | Bacteria | 1917 |
| 564 | Ga0207674_10207804 | 3300026116 | Bacteria | 1907 |
| 565 | Ga0207674_10275856 | 3300026116 | Bacteria | 1629 |
| 566 | Ga0207675_100001107 | 3300026118 | Bacteria | 26669 |
| 567 | Ga0207675_100003203 | 3300026118 | Bacteria | 16052 |
| 568 | Ga0207675_100003350 | 3300026118 | Bacteria | 15673 |
| 569 | Ga0207675_100049590 | 3300026118 | Bacteria | 3917 |
| 570 | Ga0207675_100052291 | 3300026118 | Bacteria | 3812 |
| 571 | Ga0207675_100091777 | 3300026118 | Bacteria | 2856 |
| 572 | Ga0207683_10000704 | 3300026121 | Bacteria | 30489 |
| 573 | Ga0207683_10001491 | 3300026121 | Bacteria | 21111 |
| 574 | Ga0207683_10005317 | 3300026121 | Bacteria | 11040 |
| 575 | Ga0207683_10005998 | 3300026121 | Bacteria | 10407 |
| 576 | Ga0207683_10007493 | 3300026121 | Bacteria | 9356 |
| 577 | Ga0207683_10011907 | 3300026121 | Bacteria | 7422 |
| 578 | Ga0207683_10024038 | 3300026121 | Bacteria | 5244 |
| 579 | Ga0207683_10216203 | 3300026121 | Bacteria | 1746 |
| 580 | Ga0207698_10557466 | 3300026142 | Bacteria | 1124 |
| 581 | Ga0210000_1004854 | 3300027462 | Bacteria | 1947 |
| 582 | Ga0209968_1010145 | 3300027526 | Bacteria | 1446 |
| 583 | Ga0209813_10027812 | 3300027866 | Bacteria | 1645 |
| 584 | Ga0209974_10045517 | 3300027876 | Bacteria | 1465 |
| 585 | Ga0207428_10001178 | 3300027907 | Bacteria | 28140 |
| 586 | Ga0207428_10073491 | 3300027907 | Bacteria | 2682 |
| 587 | Ga0268266_10007037 | 3300028379 | Bacteria | 10212 |
| 588 | Ga0268266_10007392 | 3300028379 | Bacteria | 9918 |
| 589 | Ga0268266_10126527 | 3300028379 | Bacteria | 2281 |
| 590 | Ga0268266_10137815 | 3300028379 | Bacteria | 2187 |
| 591 | Ga0268265_10036945 | 3300028380 | Bacteria | 3581 |
| 592 | Ga0268265_10055764 | 3300028380 | Bacteria | 3004 |
| 593 | Ga0268264_10003913 | 3300028381 | Bacteria | 12755 |
| 594 | Ga0268264_10018355 | 3300028381 | Bacteria | 5720 |
| 595 | Ga0268264_10059738 | 3300028381 | Bacteria | 3195 |
| 596 | Ga0268264_10085250 | 3300028381 | Bacteria | 2711 |
| 597 | Ga0268264_10093564 | 3300028381 | Bacteria | 2597 |
| 598 | Ga0307515_10000152 | 3300028794 | Bacteria | 167305 |
| 599 | Ga0307515_10205356 | 3300028794 | Bacteria | 1832 |
| 600 | Ga0307515_10227378 | 3300028794 | Bacteria | 1667 |
| 601 | Ga0307511_10000043 | 3300030521 | Bacteria | 101232 |
| 602 | Ga0265325_10013325 | 3300031241 | Bacteria | 4684 |
| 603 | Ga0307513_10056083 | 3300031456 | Bacteria | 4210 |
| 604 | Ga0307408_100010963 | 3300031548 | Bacteria | 5980 |
| 605 | Ga0307408_100181120 | 3300031548 | Bacteria | 1690 |
| 606 | Ga0307508_10017344 | 3300031616 | Bacteria | 6544 |
| 607 | Ga0265314_10020832 | 3300031711 | Bacteria | 5056 |
| 608 | Ga0265314_10046206 | 3300031711 | Bacteria | 3074 |
| 609 | Ga0316576_10004332 | 3300031727 | Bacteria | 8490 |
| 610 | Ga0316578_10025602 | 3300031728 | Bacteria | 3319 |
| 611 | Ga0307516_10009418 | 3300031730 | Bacteria | 10891 |
| 612 | Ga0307405_10007144 | 3300031731 | Bacteria | 5553 |
| 613 | Ga0307405_10098415 | 3300031731 | Bacteria | 1955 |
| 614 | Ga0307413_10006777 | 3300031824 | Bacteria | 5265 |
| 615 | Ga0307413_10022710 | 3300031824 | Bacteria | 3387 |
| 616 | Ga0307413_10048448 | 3300031824 | Bacteria | 2540 |
| 617 | Ga0307413_10107531 | 3300031824 | Bacteria | 1859 |
| 618 | Ga0307413_10219154 | 3300031824 | Bacteria | 1388 |
| 619 | Ga0307410_10049862 | 3300031852 | Bacteria | 2812 |
| 620 | Ga0307406_10003754 | 3300031901 | Bacteria | 8259 |
| 621 | Ga0307406_10017952 | 3300031901 | Bacteria | 4126 |
| 622 | Ga0307406_10066401 | 3300031901 | Bacteria | 2348 |
| 623 | Ga0307407_10110713 | 3300031903 | Bacteria | 1723 |
| 624 | Ga0307412_10052651 | 3300031911 | Bacteria | 2696 |
| 625 | Ga0307412_10105785 | 3300031911 | Bacteria | 1999 |
| 626 | Ga0307409_100002822 | 3300031995 | Bacteria | 9186 |
| 627 | Ga0307409_100103769 | 3300031995 | Bacteria | 2366 |
| 628 | Ga0307409_100501812 | 3300031995 | Bacteria | 1182 |
| 629 | Ga0307416_100005326 | 3300032002 | Bacteria | 7889 |
| 630 | Ga0307416_100063038 | 3300032002 | Bacteria | 3034 |
| 631 | Ga0307416_100127763 | 3300032002 | Bacteria | 2280 |
| 632 | Ga0307416_100355537 | 3300032002 | Bacteria | 1484 |
| 633 | Ga0307411_10000754 | 3300032005 | Bacteria | 11945 |
| 634 | Ga0307411_10110117 | 3300032005 | Bacteria | 1968 |
| 635 | Ga0307415_100035721 | 3300032126 | Bacteria | 3248 |
| 636 | Ga0307507_10032564 | 3300033179 | Bacteria | 5438 |
| 637 | Ga0373941_0041241 | 3300035115 | Bacteria | 1428 |
| 638 | Ga0373945_0023118 | 3300035116 | Bacteria | 2146 |
| 639 | Ga0373943_0095990 | 3300035170 | Bacteria | 1543 |
| 640 | Ga0373931_0003551 | 3300035691 | Bacteria | 7032 |
| 641 | Ga0373931_0034639 | 3300035691 | Bacteria | 2622 |
| 642 | Ga0373927_0076141 | 3300035695 | Bacteria | 2173 |
| 643 | Ga0373927_0127927 | 3300035695 | Bacteria | 1659 |
| 644 | Ga0373925_0038576 | 3300037068 | Bacteria | 3532 |
| 645 | Ga0395899_0008753 | 3300037312 | Bacteria | 7789 |
| 646 | Ga0395899_0039593 | 3300037312 | Bacteria | 3527 |
| 647 | Ga0395900_0004850 | 3300037418 | Bacteria | 14170 |
| 648 | Ga0395900_0042887 | 3300037418 | Bacteria | 4661 |
| 649 | Ga0395898_0007453 | 3300037466 | Bacteria | 11615 |
| 650 | Ga0395898_0019113 | 3300037466 | Bacteria | 6975 |
| 651 | Ga0395898_0124148 | 3300037466 | Bacteria | 2473 |
| 652 | Ga0395898_0191143 | 3300037466 | Bacteria | 1956 |
| 653 | Ga0395905_0000811 | 3300037471 | Bacteria | 41049 |
| 654 | Ga0395905_0005128 | 3300037471 | Bacteria | 13457 |
| 655 | Ga0395905_0009567 | 3300037471 | Bacteria | 9463 |
| 656 | Ga0395905_0031216 | 3300037471 | Bacteria | 5017 |
| 657 | Ga0395905_0032813 | 3300037471 | Bacteria | 4881 |
| 658 | Ga0395905_0064592 | 3300037471 | Bacteria | 3425 |
| 659 | Ga0395905_0095276 | 3300037471 | Bacteria | 2794 |
| 660 | Ga0395905_0345914 | 3300037471 | Bacteria | 1378 |
| 661 | Ga0436364_1172960 | 3300037853 | Bacteria | 5187 |
| 662 | Ga0395901_0014806 | 3300038443 | Bacteria | 7925 |
| 663 | Ga0395901_0022205 | 3300038443 | Bacteria | 6503 |
| 664 | Ga0395901_0078986 | 3300038443 | Bacteria | 3435 |
| 665 | Ga0395901_0217299 | 3300038443 | Bacteria | 1999 |
| 666 | Ga0436363_0744681 | 3300039450 | Bacteria | 2353 |
| 667 | Ga0439436_0000292 | 3300041404 | Bacteria | 12116 |
| 668 | Ga0439439_0000873 | 3300041406 | Bacteria | 5557 |
| 669 | Ga0439447_004752 | 3300041407 | Bacteria | 4628 |
| 670 | Ga0439461_0037197 | 3300041410 | Bacteria | 1039 |
| 671 | Ga0439466_0000854 | 3300041411 | Bacteria | 11623 |
| 672 | Ga0439465_0000034 | 3300041413 | Bacteria | 28027 |
| 673 | Ga0451807_2064625 | 3300041486 | Bacteria | 1935 |
| 674 | Ga0439431_0000727 | 3300041997 | Bacteria | 7098 |
| 675 | Ga0439433_0000945 | 3300041999 | Bacteria | 5826 |
| 676 | Ga0439433_0011888 | 3300041999 | Bacteria | 1908 |
| 677 | Ga0439441_000131 | 3300042001 | Bacteria | 6309 |
| 678 | Ga0439441_000190 | 3300042001 | Bacteria | 5599 |
| 679 | Ga0439441_014538 | 3300042001 | Bacteria | 1381 |
| 680 | Ga0439442_019243 | 3300042002 | Bacteria | 1413 |
| 681 | Ga0439443_000733 | 3300042003 | Bacteria | 3195 |
| 682 | Ga0439445_0000511 | 3300042004 | Bacteria | 7863 |
| 683 | Ga0439432_001169 | 3300042006 | Bacteria | 9941 |
| 684 | Ga0439449_0001078 | 3300042007 | Bacteria | 10742 |
| 685 | Ga0439451_002494 | 3300042009 | Bacteria | 3732 |
| 686 | Ga0439452_001608 | 3300042010 | Bacteria | 8924 |
| 687 | Ga0439452_005875 | 3300042010 | Bacteria | 3907 |
| 688 | Ga0439462_0010372 | 3300042015 | Bacteria | 2359 |
| 689 | Ga0439462_0015675 | 3300042015 | Bacteria | 1955 |
| 690 | Ga0450921_001595 | 3300042123 | Bacteria | 1398 |
| 691 | Ga0450898_004537 | 3300042134 | Bacteria | 2058 |
| 692 | Ga0450906_003692 | 3300042145 | Bacteria | 3258 |
| 693 | Ga0439446_0002778 | 3300042156 | Bacteria | 4248 |
| 694 | Ga0439434_0030207 | 3300042435 | Bacteria | 1644 |
| 695 | Ga0439434_0036357 | 3300042435 | Bacteria | 1506 |
| 696 | Ga0439435_0000156 | 3300042436 | Bacteria | 9343 |
| 697 | Ga0439435_0043336 | 3300042436 | Bacteria | 1265 |
| 698 | Ga0439444_0002504 | 3300042437 | Bacteria | 2516 |
| 699 | Ga0439460_0000463 | 3300042461 | Bacteria | 8787 |
| 700 | Ga0450893_0007500 | 3300042532 | Bacteria | 1773 |
| 701 | Ga0451577_0045590 | 3300042876 | Bacteria | 3924 |
| 702 | Ga0466969_0044435 | 3300044656 | Bacteria | 2209 |
| 703 | Ga0466969_0061894 | 3300044656 | Bacteria | 1817 |
| 704 | Ga0466972_0065528 | 3300044658 | Bacteria | 1737 |
| 705 | Ga0453683_0000089 | 3300044673 | Bacteria | 137069 |
| 706 | Ga0466966_0014289 | 3300044684 | Bacteria | 5255 |
| 707 | Ga0466966_0130847 | 3300044684 | Bacteria | 1537 |
| 708 | Ga0466961_0121530 | 3300044693 | Bacteria | 1639 |
| 709 | Ga0453684_0426461 | 3300044712 | Bacteria | 1480 |
| 710 | Ga0453684_0506227 | 3300044712 | Bacteria | 1336 |
| 711 | Ga0466968_0096792 | 3300044735 | Bacteria | 1314 |
| 712 | Ga0466970_0005106 | 3300044765 | Bacteria | 6483 |
| 713 | Ga0466959_0003247 | 3300045049 | Bacteria | 10583 |
| 714 | Ga0451576_0000001 | 3300045051 | Bacteria | 1802108 |
| 715 | Ga0451576_0106379 | 3300045051 | Bacteria | 2919 |
| 716 | Ga0495651_0235444 | 3300046462 | Bacteria | 1259 |
| 717 | Ga0495650_0044624 | 3300046471 | Bacteria | 1872 |
| 718 | Ga0495584_0003056 | 3300046491 | Bacteria | 9294 |
| 719 | Ga0495608_0177596 | 3300046511 | Bacteria | 1348 |
| 720 | Ga0495620_0080336 | 3300046515 | Bacteria | 1320 |
| 721 | Ga0495628_0047562 | 3300046516 | Bacteria | 3403 |
| 722 | Ga0495644_0038473 | 3300046523 | Bacteria | 1804 |
| 723 | Ga0495644_0055853 | 3300046523 | Bacteria | 1483 |
| 724 | Ga0495598_0025327 | 3300046537 | Bacteria | 1617 |
| 725 | Ga0495645_0078591 | 3300046543 | Bacteria | 2371 |
| 726 | Ga0495656_0013332 | 3300046615 | Bacteria | 3056 |
| 727 | Ga0495656_0042030 | 3300046615 | Bacteria | 1913 |
| 728 | Ga0495634_0192055 | 3300046642 | Bacteria | 1273 |
| 729 | Ga0495588_0096096 | 3300046674 | Bacteria | 1554 |
| 730 | Ga0495658_0025905 | 3300046683 | Bacteria | 3139 |
| 731 | Ga0495658_0159477 | 3300046683 | Bacteria | 1390 |
| 732 | Ga0495669_0113604 | 3300046684 | Bacteria | 1266 |
| 733 | Ga0495613_0109422 | 3300046689 | Bacteria | 1992 |
| 734 | Ga0495670_0103283 | 3300046691 | Bacteria | 1470 |
| 735 | Ga0495589_0048232 | 3300046794 | Bacteria | 2109 |
| 736 | Ga0495600_0255475 | 3300046809 | Bacteria | 1114 |
| 737 | Ga0495672_0067290 | 3300047320 | Bacteria | 2041 |
| 738 | Ga0495680_0286898 | 3300047322 | Bacteria | 1159 |
| 739 | Ga0495685_052541 | 3300047447 | Bacteria | 1380 |
| 740 | Ga0495593_0102774 | 3300047673 | Bacteria | 1465 |
| 741 | Ga0496100_0002710 | 3300048903 | Bacteria | 9052 |
| 742 | Ga0496101_0019896 | 3300048904 | Bacteria | 4590 |
| 743 | Ga0496101_0053919 | 3300048904 | Bacteria | 2902 |
| 744 | Ga0496101_0108613 | 3300048904 | Bacteria | 2086 |
| 745 | Ga0496101_0179275 | 3300048904 | Bacteria | 1631 |
| 746 | Ga0496102_0057433 | 3300048905 | Bacteria | 3553 |
| 747 | Ga0496102_0095044 | 3300048905 | Bacteria | 2762 |
| 748 | Ga0496102_0164505 | 3300048905 | Bacteria | 2087 |
| 749 | Ga0496102_0213763 | 3300048905 | Bacteria | 1818 |
| 750 | Ga0496103_0001636 | 3300048906 | Bacteria | 14692 |
| 751 | Ga0496104_0039439 | 3300048907 | Bacteria | 4422 |
| 752 | Ga0496104_0208064 | 3300048907 | Bacteria | 1868 |
| 753 | Ga0496104_0372177 | 3300048907 | Bacteria | 1341 |
| 754 | Ga0496105_0052730 | 3300048908 | Bacteria | 3359 |
| 755 | Ga0496105_0058797 | 3300048908 | Bacteria | 3172 |
| 756 | Ga0496105_0061623 | 3300048908 | Bacteria | 3095 |
| 757 | Ga0496106_0009030 | 3300048909 | Bacteria | 7365 |
| 758 | Ga0496106_0239649 | 3300048909 | Bacteria | 1449 |
| 759 | Ga0496107_0006550 | 3300048910 | Bacteria | 8011 |
| 760 | Ga0496107_0035746 | 3300048910 | Bacteria | 3562 |
| 761 | Ga0496107_0055742 | 3300048910 | Bacteria | 2854 |
| 762 | Ga0496107_0171096 | 3300048910 | Bacteria | 1612 |
| 763 | Ga0496108_0029463 | 3300048911 | Bacteria | 4546 |
| 764 | Ga0496108_0049324 | 3300048911 | Bacteria | 3521 |
| 765 | Ga0496108_0085229 | 3300048911 | Bacteria | 2681 |
| 766 | Ga0496109_0036237 | 3300048912 | Bacteria | 4453 |
| 767 | Ga0496109_0076913 | 3300048912 | Bacteria | 3070 |
| 768 | Ga0496109_0436373 | 3300048912 | Bacteria | 1237 |
| 769 | Ga0496110_0014916 | 3300048913 | Bacteria | 6458 |
| 770 | Ga0496111_0082338 | 3300048914 | Bacteria | 2350 |
| 771 | Ga0496111_0093702 | 3300048914 | Bacteria | 2202 |
| 772 | Ga0496112_0083495 | 3300048915 | Bacteria | 3159 |
| 773 | Ga0496112_0096577 | 3300048915 | Bacteria | 2925 |
| 774 | Ga0496112_0258868 | 3300048915 | Bacteria | 1690 |
| 775 | Ga0496113_0060414 | 3300048916 | Bacteria | 2857 |
| 776 | Ga0496114_0040957 | 3300048917 | Bacteria | 3837 |
| 777 | Ga0496114_0055106 | 3300048917 | Bacteria | 3316 |
| 778 | Ga0496114_0149990 | 3300048917 | Bacteria | 2022 |
| 779 | Ga0496114_0257633 | 3300048917 | Bacteria | 1535 |
| 780 | Ga0496115_0007030 | 3300048918 | Bacteria | 8269 |
| 781 | Ga0496115_0018921 | 3300048918 | Bacteria | 5297 |
| 782 | Ga0496115_0066623 | 3300048918 | Bacteria | 2910 |
| 783 | Ga0496115_0092293 | 3300048918 | Bacteria | 2475 |
| 784 | Ga0496117_0049354 | 3300048920 | Bacteria | 2995 |
| 785 | Ga0496121_0004790 | 3300048924 | Bacteria | 17841 |
| 786 | Ga0496126_0005177 | 3300048929 | Bacteria | 15071 |
| 787 | Ga0501031_0010867 | 3300049568 | Bacteria | 5930 |
| 788 | Ga0501031_0061363 | 3300049568 | Bacteria | 2450 |
| 789 | Ga0501031_0152567 | 3300049568 | Bacteria | 1510 |
| 790 | Ga0501032_0017136 | 3300049569 | Bacteria | 5091 |
| 791 | Ga0501033_0137370 | 3300049570 | Bacteria | 1769 |
| 792 | Ga0501034_0043397 | 3300049571 | Bacteria | 4551 |
| 793 | Ga0501036_0001136 | 3300049572 | Bacteria | 20244 |
| 794 | Ga0501036_0043037 | 3300049572 | Bacteria | 3824 |
| 795 | Ga0501036_0049832 | 3300049572 | Bacteria | 3547 |
| 796 | Ga0501036_0075351 | 3300049572 | Bacteria | 2854 |
| 797 | Ga0501036_0217430 | 3300049572 | Bacteria | 1605 |
| 798 | Ga0501037_0000124 | 3300049573 | Bacteria | 71522 |
| 799 | Ga0501037_0014905 | 3300049573 | Bacteria | 5719 |
| 800 | Ga0501037_0189349 | 3300049573 | Bacteria | 1457 |
| 801 | Ga0501038_0002889 | 3300049574 | Bacteria | 16028 |
| 802 | Ga0501038_0019715 | 3300049574 | Bacteria | 6072 |
| 803 | Ga0501038_0074409 | 3300049574 | Bacteria | 2874 |
| 804 | Ga0501038_0101888 | 3300049574 | Bacteria | 2390 |
| 805 | Ga0501038_0286533 | 3300049574 | Bacteria | 1295 |
| 806 | Ga0501039_0004891 | 3300049575 | Bacteria | 10151 |
| 807 | Ga0501039_0026662 | 3300049575 | Bacteria | 4441 |
| 808 | Ga0501039_0059894 | 3300049575 | Bacteria | 2948 |
| 809 | Ga0501039_0246336 | 3300049575 | Bacteria | 1405 |
| 810 | Ga0501039_0279885 | 3300049575 | Bacteria | 1311 |
| 811 | Ga0501040_0000196 | 3300049576 | Bacteria | 35200 |
| 812 | Ga0501040_0015317 | 3300049576 | Bacteria | 5070 |
| 813 | Ga0501040_0109528 | 3300049576 | Bacteria | 1931 |
| 814 | Ga0501041_0000164 | 3300049577 | Bacteria | 29413 |
| 815 | Ga0501041_0022148 | 3300049577 | Bacteria | 3805 |
| 816 | Ga0501041_0028815 | 3300049577 | Bacteria | 3350 |
| 817 | Ga0501041_0055766 | 3300049577 | Bacteria | 2413 |
| 818 | Ga0501042_0000576 | 3300049578 | Bacteria | 19402 |
| 819 | Ga0501042_0006949 | 3300049578 | Bacteria | 7387 |
| 820 | Ga0501042_0247817 | 3300049578 | Bacteria | 1285 |
| 821 | Ga0501043_0000003 | 3300049579 | Bacteria | 318844 |
| 822 | Ga0501043_0019082 | 3300049579 | Bacteria | 5383 |
| 823 | Ga0501043_0060097 | 3300049579 | Bacteria | 2983 |
| 824 | Ga0501043_0337262 | 3300049579 | Bacteria | 1147 |
| 825 | Ga0501046_0000247 | 3300049580 | Bacteria | 55379 |
| 826 | Ga0501046_0065974 | 3300049580 | Bacteria | 2822 |
| 827 | Ga0501046_0182528 | 3300049580 | Bacteria | 1568 |
| 828 | Ga0501047_0001674 | 3300049581 | Bacteria | 21567 |
| 829 | Ga0501047_0057037 | 3300049581 | Bacteria | 3777 |
| 830 | Ga0501047_0065334 | 3300049581 | Bacteria | 3507 |
| 831 | Ga0501048_0000609 | 3300049582 | Bacteria | 25452 |
| 832 | Ga0501048_0028355 | 3300049582 | Bacteria | 4063 |
| 833 | Ga0501048_0076626 | 3300049582 | Bacteria | 2360 |
| 834 | Ga0501068_0038354 | 3300049584 | Bacteria | 2870 |
| 835 | Ga0501069_0000003 | 3300049585 | Bacteria | 210301 |
| 836 | Ga0501070_0000477 | 3300049586 | Bacteria | 36435 |
| 837 | Ga0501070_0068506 | 3300049586 | Bacteria | 2937 |
| 838 | Ga0501070_0098559 | 3300049586 | Bacteria | 2417 |
| 839 | Ga0501070_0193637 | 3300049586 | Bacteria | 1670 |
| 840 | Ga0501070_0342635 | 3300049586 | Bacteria | 1214 |
| 841 | Ga0501071_0018599 | 3300049587 | Bacteria | 4814 |
| 842 | Ga0501071_0033707 | 3300049587 | Bacteria | 3639 |
| 843 | Ga0501071_0070281 | 3300049587 | Bacteria | 2550 |
| 844 | Ga0501072_0000333 | 3300049588 | Bacteria | 33584 |
| 845 | Ga0501072_0004373 | 3300049588 | Bacteria | 10726 |
| 846 | Ga0501072_0157830 | 3300049588 | Bacteria | 1809 |
| 847 | Ga0501073_0081313 | 3300049589 | Bacteria | 2254 |
| 848 | Ga0501074_0000007 | 3300049590 | Bacteria | 111136 |
| 849 | Ga0501074_0001316 | 3300049590 | Bacteria | 16477 |
| 850 | Ga0501074_0023999 | 3300049590 | Bacteria | 4432 |
| 851 | Ga0501074_0151182 | 3300049590 | Bacteria | 1660 |
| 852 | Ga0501075_0186617 | 3300049591 | Bacteria | 1582 |
| 853 | Ga0501076_0000869 | 3300049592 | Bacteria | 19638 |
| 854 | Ga0501076_0002390 | 3300049592 | Bacteria | 12853 |
| 855 | Ga0501076_0006162 | 3300049592 | Bacteria | 8680 |
| 856 | Ga0501076_0008429 | 3300049592 | Bacteria | 7555 |
| 857 | Ga0501076_0138582 | 3300049592 | Bacteria | 1976 |
| 858 | Ga0501077_0000223 | 3300049593 | Bacteria | 33258 |
| 859 | Ga0501077_0011772 | 3300049593 | Bacteria | 5470 |
| 860 | Ga0501077_0049493 | 3300049593 | Bacteria | 2671 |
| 861 | Ga0501077_0082322 | 3300049593 | Bacteria | 2040 |
| 862 | Ga0501079_0002588 | 3300049741 | Bacteria | 13150 |
| 863 | Ga0501079_0018700 | 3300049741 | Bacteria | 5294 |
| 864 | Ga0501079_0047011 | 3300049741 | Bacteria | 3330 |
| 865 | Ga0501079_0060030 | 3300049741 | Bacteria | 2933 |
| 866 | Ga0501080_0001339 | 3300049742 | Bacteria | 20548 |
| 867 | Ga0501080_0002540 | 3300049742 | Bacteria | 15963 |
| 868 | Ga0501080_0014252 | 3300049742 | Bacteria | 7320 |
| 869 | Ga0501080_0112853 | 3300049742 | Bacteria | 2519 |
| 870 | Ga0501081_0001238 | 3300049743 | Bacteria | 15536 |
| 871 | Ga0501081_0001649 | 3300049743 | Bacteria | 13814 |
| 872 | Ga0501081_0017131 | 3300049743 | Bacteria | 4793 |
| 873 | Ga0501081_0029745 | 3300049743 | Bacteria | 3693 |
| 874 | Ga0501083_0000024 | 3300049744 | Bacteria | 123029 |
| 875 | Ga0501263_003647 | 3300049760 | Bacteria | 1657 |
| 876 | Ga0501035_0006926 | 3300049822 | Bacteria | 10587 |
| 877 | Ga0501035_0011327 | 3300049822 | Bacteria | 8266 |
| 878 | Ga0501035_0037964 | 3300049822 | Bacteria | 4361 |
| 879 | Ga0501035_0040418 | 3300049822 | Bacteria | 4214 |
| 880 | Ga0501035_0162957 | 3300049822 | Bacteria | 1929 |
| 881 | Ga0501035_0221226 | 3300049822 | Bacteria | 1616 |
| 882 | Ga0501044_0000016 | 3300049823 | Bacteria | 231626 |
| 883 | Ga0501044_0001406 | 3300049823 | Bacteria | 28215 |
| 884 | Ga0501044_0045763 | 3300049823 | Bacteria | 4533 |
| 885 | Ga0501044_0175393 | 3300049823 | Bacteria | 2113 |
| 886 | Ga0501044_0188472 | 3300049823 | Bacteria | 2026 |
| 887 | Ga0501045_0000481 | 3300049824 | Bacteria | 24710 |
| 888 | Ga0501045_0000799 | 3300049824 | Bacteria | 20290 |
| 889 | Ga0501045_0072118 | 3300049824 | Bacteria | 2542 |
| 890 | Ga0501045_0206495 | 3300049824 | Bacteria | 1463 |
| 891 | nmdc:mga03683_10753_c1 | 3300050489 | Bacteria | 3289 |
| 892 | nmdc:mga03683_17296_c1 | 3300050489 | Bacteria | 2728 |
| 893 | nmdc:mga03683_29875_c1 | 3300050489 | Bacteria | 2177 |
| 894 | nmdc:mga03n38_12577_c1 | 3300050490 | Bacteria | 3189 |
| 895 | nmdc:mga03n38_1430_c1 | 3300050490 | Bacteria | 6822 |
| 896 | nmdc:mga03n38_5180_c1 | 3300050490 | Bacteria | 4412 |
| 897 | nmdc:mga00v17_38920_c1 | 3300050491 | Bacteria | 2846 |
| 898 | nmdc:mga0yw44_104939_c1 | 3300050492 | Bacteria | 1805 |
| 899 | nmdc:mga0yw44_27341_c1 | 3300050492 | Bacteria | 3266 |
| 900 | nmdc:mga0yw44_5028_c1 | 3300050492 | Bacteria | 6177 |
| 901 | nmdc:mga0k408_149722_c1 | 3300050493 | Bacteria | 1390 |
| 902 | nmdc:mga0k408_218598_c1 | 3300050493 | Bacteria | 1138 |
| 903 | nmdc:mga0k408_22446_c1 | 3300050493 | Bacteria | 3554 |
| 904 | nmdc:mga0k408_28817_c1 | 3300050493 | Bacteria | 3157 |
| 905 | nmdc:mga0k408_44635_c1 | 3300050493 | Bacteria | 2557 |
| 906 | nmdc:mga0k408_74493_c1 | 3300050493 | Bacteria | 1983 |
| 907 | nmdc:mga06z11_52957_c1 | 3300050494 | Bacteria | 2085 |
| 908 | nmdc:mga07m45_1407_c1 | 3300050496 | Bacteria | 11010 |
| 909 | nmdc:mga07m45_46615_c1 | 3300050496 | Bacteria | 2436 |
| 910 | nmdc:mga05p37_528_c1 | 3300050507 | Bacteria | 42336 |
| 911 | nmdc:mga05p37_530_c1 | 3300050507 | Bacteria | 42063 |
| 912 | nmdc:mga05p37_83400_c1 | 3300050507 | Bacteria | 3937 |
| 913 | nmdc:mga09592_19007_c2 | 3300050508 | Bacteria | 4681 |
| 914 | nmdc:mga09592_348610_c1 | 3300050508 | Bacteria | 1281 |
| 915 | nmdc:mga09592_58_c1 | 3300050508 | Bacteria | 61599 |
| 916 | nmdc:mga09592_704_c1 | 3300050508 | Bacteria | 25621 |
| 917 | nmdc:mga0qj67_125314_c1 | 3300050509 | Bacteria | 2079 |
| 918 | nmdc:mga0qj67_252_c1 | 3300050509 | Bacteria | 36647 |
| 919 | nmdc:mga0qj67_57368_c1 | 3300050509 | Bacteria | 3087 |
| 920 | nmdc:mga06r32_116386_c1 | 3300050510 | Bacteria | 2634 |
| 921 | nmdc:mga06r32_12664_c1 | 3300050510 | Bacteria | 7623 |
| 922 | nmdc:mga06r32_13548_c1 | 3300050510 | Bacteria | 7389 |
| 923 | nmdc:mga06r32_241_c1 | 3300050510 | Bacteria | 44852 |
| 924 | nmdc:mga06r32_77686_c1 | 3300050510 | Bacteria | 3225 |
| 925 | nmdc:mga06r32_89618_c1 | 3300050510 | Bacteria | 3003 |
| 926 | nmdc:mga08y16_427_c1 | 3300050511 | Bacteria | 38825 |
| 927 | Ga0495601_0045510 | 3300053077 | Bacteria | 2760 |
| 928 | Ga0495655_0002544 | 3300053083 | Bacteria | 2911 |
| 929 | Ga0495595_0023968 | 3300053084 | Bacteria | 2692 |
| 930 | Ga0495619_0097231 | 3300053085 | Bacteria | 2000 |
| 931 | Ga0500646_0000249 | 3300053090 | Bacteria | 16508 |
| 932 | Ga0500651_0017113 | 3300053093 | Bacteria | 4465 |
| 933 | Ga0500641_0002472 | 3300053096 | Bacteria | 6530 |
| 934 | Ga0500594_0029195 | 3300053118 | Bacteria | 1440 |
| 935 | Ga0500595_000772 | 3300053119 | Bacteria | 18763 |
| 936 | Ga0500628_024927 | 3300053129 | Bacteria | 1247 |
| 937 | Ga0500655_014181 | 3300053133 | Bacteria | 1457 |
| 938 | Ga0500568_0035981 | 3300053139 | Bacteria | 2018 |
| 939 | Ga0500586_050133 | 3300053145 | Bacteria | 1438 |
| 940 | Ga0500604_0000152 | 3300053151 | Bacteria | 20372 |
| 941 | Ga0500616_0008468 | 3300053153 | Bacteria | 6383 |
| 942 | Ga0500616_0045468 | 3300053153 | Bacteria | 2339 |
| 943 | Ga0501084_0004974 | 3300054114 | Bacteria | 10868 |
| 944 | Ga0501084_0012573 | 3300054114 | Bacteria | 7013 |
| 945 | Ga0501084_0014998 | 3300054114 | Bacteria | 6425 |
| 946 | Ga0501084_0038950 | 3300054114 | Bacteria | 3975 |
| 947 | Ga0501084_0069858 | 3300054114 | Bacteria | 2941 |
| 948 | Ga0501084_0369465 | 3300054114 | Bacteria | 1212 |
| 949 | Ga0501082_0004790 | 3300060353 | Bacteria | 11800 |
| 950 | Ga0501082_0015931 | 3300060353 | Bacteria | 6465 |
| 951 | Ga0501082_0041083 | 3300060353 | Bacteria | 3987 |
| 952 | Ga0501082_0056252 | 3300060353 | Bacteria | 3388 |
| 953 | Ga0530510_0000412 | 3300061734 | Bacteria | 27774 |
| 954 | Ga0530510_0000731 | 3300061734 | Bacteria | 21331 |
| 955 | Ga0530510_0038650 | 3300061734 | Bacteria | 3445 |
| 956 | Ga0530510_0040615 | 3300061734 | Bacteria | 3358 |
| 957 | Ga0530510_0057281 | 3300061734 | Bacteria | 2816 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006237 | Ga0097621_100128809 | Ga0097621_1001288092 | 307 |
| 2 | 3300005334 | Ga0068869_100010779 | Ga0068869_1000107793 | 310 |
| 3 | 3300005340 | Ga0070689_100097983 | Ga0070689_1000979832 | 310 |
| 4 | 3300005440 | Ga0070705_100095992 | Ga0070705_1000959922 | 310 |
| 5 | 3300005441 | Ga0070700_100096209 | Ga0070700_1000962093 | 310 |
| 6 | 3300005456 | Ga0070678_100030306 | Ga0070678_1000303064 | 310 |
| 7 | 3300005840 | Ga0068870_10069124 | Ga0068870_100691242 | 310 |
| 8 | 3300005841 | Ga0068863_100237649 | Ga0068863_1002376492 | 310 |
| 9 | 3300006358 | Ga0068871_100075832 | Ga0068871_1000758323 | 310 |
| 10 | 3300009176 | Ga0105242_10374497 | Ga0105242_103744972 | 310 |
| 11 | 3300025893 | Ga0207682_10032993 | Ga0207682_100329932 | 310 |
| 12 | 3300025908 | Ga0207643_10022298 | Ga0207643_100222983 | 310 |
| 13 | 3300025942 | Ga0207689_10010981 | Ga0207689_100109813 | 310 |
| 14 | 3300026075 | Ga0207708_10089458 | Ga0207708_100894582 | 310 |
| 15 | 3300026121 | Ga0207683_10005317 | Ga0207683_100053174 | 310 |
| 16 | 3300031901 | Ga0307406_10066401 | Ga0307406_100664012 | 312 |
| 17 | 3300042009 | Ga0439451_002494 | Ga0439451_002494_927_1874 | 314 |
| 18 | 3300035695 | Ga0373927_0076141 | Ga0373927_0076141_899_1849 | 315 |
| 19 | 3300049570 | Ga0501033_0137370 | Ga0501033_0137370_393_1403 | 315 |
| 20 | 3300006048 | Ga0075363_100024045 | Ga0075363_1000240452 | 316 |
| 21 | 3300006177 | Ga0075362_10034704 | Ga0075362_100347042 | 316 |
| 22 | 3300046674 | Ga0495588_0096096 | Ga0495588_0096096_183_1190 | 316 |
| 23 | 3300046684 | Ga0495669_0113604 | Ga0495669_0113604_122_1129 | 316 |
| 24 | 3300047447 | Ga0495685_052541 | Ga0495685_052541_262_1269 | 316 |
| 25 | 3300049590 | Ga0501074_0151182 | Ga0501074_0151182_380_1390 | 316 |
| 26 | 3300050493 | nmdc:mga0k408_28817_c1 | nmdc:mga0k408_28817_c1_32_1051 | 316 |
| 27 | 3300005367 | Ga0070667_100073437 | Ga0070667_1000734371 | 317 |
| 28 | 3300009148 | Ga0105243_10151701 | Ga0105243_101517012 | 317 |
| 29 | 3300009174 | Ga0105241_10102465 | Ga0105241_101024653 | 317 |
| 30 | 3300009176 | Ga0105242_10177777 | Ga0105242_101777772 | 317 |
| 31 | 3300009177 | Ga0105248_10039908 | Ga0105248_100399082 | 317 |
| 32 | 3300009545 | Ga0105237_10056267 | Ga0105237_100562673 | 317 |
| 33 | 3300009551 | Ga0105238_10097998 | Ga0105238_100979983 | 317 |
| 34 | 3300010375 | Ga0105239_10099437 | Ga0105239_100994373 | 317 |
| 35 | 3300013306 | Ga0163162_10053652 | Ga0163162_100536522 | 317 |
| 36 | 3300031731 | Ga0307405_10007144 | Ga0307405_100071445 | 317 |
| 37 | 3300035115 | Ga0373941_0041241 | Ga0373941_0041241_437_1393 | 317 |
| 38 | 3300035691 | Ga0373931_0003551 | Ga0373931_0003551_4151_5107 | 317 |
| 39 | 3300042001 | Ga0439441_000190 | Ga0439441_000190_2405_3361 | 317 |
| 40 | 3300042436 | Ga0439435_0000156 | Ga0439435_0000156_3437_4393 | 317 |
| 41 | 3300042461 | Ga0439460_0000463 | Ga0439460_0000463_5081_6037 | 317 |
| 42 | 3300044712 | Ga0453684_0506227 | Ga0453684_0506227_27_1028 | 317 |
| 43 | 3300048904 | Ga0496101_0053919 | Ga0496101_0053919_285_1241 | 317 |
| 44 | 3300048905 | Ga0496102_0057433 | Ga0496102_0057433_2268_3224 | 317 |
| 45 | 3300048905 | Ga0496102_0213763 | Ga0496102_0213763_514_1470 | 317 |
| 46 | 3300048907 | Ga0496104_0039439 | Ga0496104_0039439_2892_3848 | 317 |
| 47 | 3300048908 | Ga0496105_0061623 | Ga0496105_0061623_1507_2463 | 317 |
| 48 | 3300048910 | Ga0496107_0055742 | Ga0496107_0055742_1700_2656 | 317 |
| 49 | 3300048911 | Ga0496108_0029463 | Ga0496108_0029463_1685_2641 | 317 |
| 50 | 3300048912 | Ga0496109_0036237 | Ga0496109_0036237_1481_2437 | 317 |
| 51 | 3300048913 | Ga0496110_0014916 | Ga0496110_0014916_630_1586 | 317 |
| 52 | 3300048914 | Ga0496111_0082338 | Ga0496111_0082338_137_1093 | 317 |
| 53 | 3300048915 | Ga0496112_0083495 | Ga0496112_0083495_685_1641 | 317 |
| 54 | 3300048915 | Ga0496112_0096577 | Ga0496112_0096577_207_1214 | 317 |
| 55 | 3300048916 | Ga0496113_0060414 | Ga0496113_0060414_372_1328 | 317 |
| 56 | 3300048917 | Ga0496114_0257633 | Ga0496114_0257633_131_1087 | 317 |
| 57 | 3300048918 | Ga0496115_0066623 | Ga0496115_0066623_1687_2643 | 317 |
| 58 | 3300005549 | Ga0070704_100002887 | Ga0070704_1000028876 | 318 |
| 59 | 3300006844 | Ga0075428_100019621 | Ga0075428_1000196214 | 318 |
| 60 | 3300006847 | Ga0075431_100004976 | Ga0075431_1000049763 | 318 |
| 61 | 3300006880 | Ga0075429_100000272 | Ga0075429_10000027223 | 318 |
| 62 | 3300009148 | Ga0105243_10100171 | Ga0105243_101001713 | 318 |
| 63 | 3300013104 | Ga0157370_10347207 | Ga0157370_103472072 | 318 |
| 64 | 3300048915 | Ga0496112_0258868 | Ga0496112_0258868_673_1638 | 318 |
| 65 | 3300049573 | Ga0501037_0189349 | Ga0501037_0189349_226_1185 | 318 |
| 66 | 3300049586 | Ga0501070_0098559 | Ga0501070_0098559_483_1442 | 318 |
| 67 | 3300049587 | Ga0501071_0070281 | Ga0501071_0070281_665_1624 | 318 |
| 68 | 3300049590 | Ga0501074_0023999 | Ga0501074_0023999_2809_3768 | 318 |
| 69 | 3300049823 | Ga0501044_0188472 | Ga0501044_0188472_1021_1980 | 318 |
| 70 | 3300050507 | nmdc:mga05p37_530_c1 | nmdc:mga05p37_530_c1_20983_21978 | 318 |
| 71 | 3300050508 | nmdc:mga09592_58_c1 | nmdc:mga09592_58_c1_13266_14261 | 318 |
| 72 | 3300050510 | nmdc:mga06r32_12664_c1 | nmdc:mga06r32_12664_c1_906_1901 | 318 |
| 73 | 3300005844 | Ga0068862_100075270 | Ga0068862_1000752703 | 319 |
| 74 | 3300025935 | Ga0207709_10312497 | Ga0207709_103124971 | 319 |
| 75 | 3300028381 | Ga0268264_10059738 | Ga0268264_100597382 | 319 |
| 76 | 3300046615 | Ga0495656_0042030 | Ga0495656_0042030_773_1780 | 320 |
| 77 | 3300049572 | Ga0501036_0217430 | Ga0501036_0217430_452_1513 | 320 |
| 78 | 3300049575 | Ga0501039_0279885 | Ga0501039_0279885_23_1084 | 320 |
| 79 | 3300049576 | Ga0501040_0109528 | Ga0501040_0109528_678_1739 | 320 |
| 80 | 3300049584 | Ga0501068_0038354 | Ga0501068_0038354_1877_2842 | 320 |
| 81 | 3300049586 | Ga0501070_0068506 | Ga0501070_0068506_237_1202 | 320 |
| 82 | 3300049587 | Ga0501071_0033707 | Ga0501071_0033707_2379_3440 | 320 |
| 83 | 3300049822 | Ga0501035_0011327 | Ga0501035_0011327_6533_7498 | 320 |
| 84 | 3300053153 | Ga0500616_0045468 | Ga0500616_0045468_36_998 | 320 |
| 85 | 3300031852 | Ga0307410_10049862 | Ga0307410_100498622 | 321 |
| 86 | 3300035116 | Ga0373945_0023118 | Ga0373945_0023118_33_1001 | 321 |
| 87 | 3300037312 | Ga0395899_0008753 | Ga0395899_0008753_4812_5819 | 321 |
| 88 | 3300037466 | Ga0395898_0124148 | Ga0395898_0124148_303_1310 | 321 |
| 89 | 3300038443 | Ga0395901_0078986 | Ga0395901_0078986_462_1469 | 321 |
| 90 | 3300049568 | Ga0501031_0010867 | Ga0501031_0010867_56_1024 | 321 |
| 91 | 3300049569 | Ga0501032_0017136 | Ga0501032_0017136_22_990 | 321 |
| 92 | 3300049573 | Ga0501037_0000124 | Ga0501037_0000124_43659_44627 | 321 |
| 93 | 3300049574 | Ga0501038_0286533 | Ga0501038_0286533_150_1118 | 321 |
| 94 | 3300049579 | Ga0501043_0000003 | Ga0501043_0000003_95982_96950 | 321 |
| 95 | 3300049585 | Ga0501069_0000003 | Ga0501069_0000003_111557_112525 | 321 |
| 96 | 3300049586 | Ga0501070_0000477 | Ga0501070_0000477_10973_11941 | 321 |
| 97 | 3300049587 | Ga0501071_0018599 | Ga0501071_0018599_260_1228 | 321 |
| 98 | 3300049590 | Ga0501074_0000007 | Ga0501074_0000007_9921_10889 | 321 |
| 99 | 3300049742 | Ga0501080_0001339 | Ga0501080_0001339_19142_20110 | 321 |
| 100 | 3300049744 | Ga0501083_0000024 | Ga0501083_0000024_59513_60481 | 321 |
| 101 | 3300049822 | Ga0501035_0006926 | Ga0501035_0006926_5136_6104 | 321 |
| 102 | 3300049823 | Ga0501044_0000016 | Ga0501044_0000016_111549_112517 | 321 |
| 103 | 3300050507 | nmdc:mga05p37_83400_c1 | nmdc:mga05p37_83400_c1_1171_2139 | 321 |
| 104 | 3300050508 | nmdc:mga09592_19007_c2 | nmdc:mga09592_19007_c2_953_1921 | 321 |
| 105 | 3300037471 | Ga0395905_0345914 | Ga0395905_0345914_323_1330 | 322 |
| 106 | 3300053139 | Ga0500568_0035981 | Ga0500568_0035981_126_1097 | 322 |
| 107 | 3300005543 | Ga0070672_100084575 | Ga0070672_1000845753 | 323 |
| 108 | 3300031995 | Ga0307409_100501812 | Ga0307409_1005018122 | 323 |
| 109 | 3300038443 | Ga0395901_0022205 | Ga0395901_0022205_5313_6320 | 323 |
| 110 | 3300050508 | nmdc:mga09592_348610_c1 | nmdc:mga09592_348610_c1_11_1015 | 323 |
| 111 | 3300050510 | nmdc:mga06r32_89618_c1 | nmdc:mga06r32_89618_c1_1005_2009 | 323 |
| 112 | 3300033179 | Ga0307507_10032564 | Ga0307507_100325644 | 324 |
| 113 | 3300049579 | Ga0501043_0060097 | Ga0501043_0060097_1843_2871 | 324 |
| 114 | 3300049824 | Ga0501045_0072118 | Ga0501045_0072118_1369_2397 | 324 |
| 115 | 3300061734 | Ga0530510_0057281 | Ga0530510_0057281_1321_2349 | 324 |
| 116 | 3300005347 | Ga0070668_100004725 | Ga0070668_1000047252 | 325 |
| 117 | 3300005618 | Ga0068864_100083100 | Ga0068864_1000831003 | 325 |
| 118 | 3300005844 | Ga0068862_100398043 | Ga0068862_1003980431 | 325 |
| 119 | 3300025972 | Ga0207668_10005494 | Ga0207668_100054945 | 325 |
| 120 | 3300027907 | Ga0207428_10073491 | Ga0207428_100734911 | 325 |
| 121 | 3300005336 | Ga0070680_100061553 | Ga0070680_1000615534 | 326 |
| 122 | 3300005440 | Ga0070705_100094499 | Ga0070705_1000944991 | 326 |
| 123 | 3300005444 | Ga0070694_100020492 | Ga0070694_1000204924 | 326 |
| 124 | 3300005545 | Ga0070695_100251306 | Ga0070695_1002513061 | 326 |
| 125 | 3300005549 | Ga0070704_100086973 | Ga0070704_1000869733 | 326 |
| 126 | 3300005564 | Ga0070664_100409484 | Ga0070664_1004094841 | 326 |
| 127 | 3300006844 | Ga0075428_100040584 | Ga0075428_1000405842 | 326 |
| 128 | 3300006847 | Ga0075431_100180554 | Ga0075431_1001805542 | 326 |
| 129 | 3300025945 | Ga0207679_10083958 | Ga0207679_100839582 | 326 |
| 130 | 3300039450 | Ga0436363_0744681 | Ga0436363_0744681_235_1257 | 326 |
| 131 | 3300050510 | nmdc:mga06r32_116386_c1 | nmdc:mga06r32_116386_c1_1034_2023 | 326 |
| 132 | iso_pu_bacteria | 8054563764 | 8054564691 | 326 |
| 133 | 3300005981 | Ga0081538_10092648 | Ga0081538_100926482 | 327 |
| 134 | 3300006042 | Ga0075368_10002491 | Ga0075368_100024913 | 327 |
| 135 | 3300006048 | Ga0075363_100024902 | Ga0075363_1000249023 | 327 |
| 136 | 3300006051 | Ga0075364_10069037 | Ga0075364_100690372 | 327 |
| 137 | 3300006178 | Ga0075367_10052682 | Ga0075367_100526822 | 327 |
| 138 | 3300006195 | Ga0075366_10017317 | Ga0075366_100173172 | 327 |
| 139 | 3300006353 | Ga0075370_10014243 | Ga0075370_100142432 | 327 |
| 140 | 3300006844 | Ga0075428_100032142 | Ga0075428_1000321425 | 327 |
| 141 | 3300009177 | Ga0105248_10245305 | Ga0105248_102453053 | 327 |
| 142 | 3300027866 | Ga0209813_10027812 | Ga0209813_100278121 | 327 |
| 143 | 3300037471 | Ga0395905_0009567 | Ga0395905_0009567_6531_7523 | 327 |
| 144 | 3300041486 | Ga0451807_2064625 | Ga0451807_2064625_339_1337 | 327 |
| 145 | 3300042134 | Ga0450898_004537 | Ga0450898_004537_935_1930 | 327 |
| 146 | 3300049592 | Ga0501076_0138582 | Ga0501076_0138582_761_1831 | 327 |
| 147 | 3300049593 | Ga0501077_0082322 | Ga0501077_0082322_273_1343 | 327 |
| 148 | 3300049741 | Ga0501079_0018700 | Ga0501079_0018700_3974_5044 | 327 |
| 149 | 3300049743 | Ga0501081_0017131 | Ga0501081_0017131_3310_4380 | 327 |
| 150 | 3300050489 | nmdc:mga03683_29875_c1 | nmdc:mga03683_29875_c1_848_1861 | 327 |
| 151 | 3300050490 | nmdc:mga03n38_5180_c1 | nmdc:mga03n38_5180_c1_3149_4162 | 327 |
| 152 | 3300050491 | nmdc:mga00v17_38920_c1 | nmdc:mga00v17_38920_c1_260_1273 | 327 |
| 153 | 3300050493 | nmdc:mga0k408_22446_c1 | nmdc:mga0k408_22446_c1_1207_2220 | 327 |
| 154 | 3300050496 | nmdc:mga07m45_46615_c1 | nmdc:mga07m45_46615_c1_796_1809 | 327 |
| 155 | 3300053129 | Ga0500628_024927 | Ga0500628_024927_68_1069 | 327 |
| 156 | 3300054114 | Ga0501084_0012573 | Ga0501084_0012573_5876_6946 | 327 |
| 157 | 3300060353 | Ga0501082_0004790 | Ga0501082_0004790_5772_6842 | 327 |
| 158 | 3300061734 | Ga0530510_0040615 | Ga0530510_0040615_2096_3166 | 327 |
| 159 | 3300005367 | Ga0070667_100068659 | Ga0070667_1000686593 | 328 |
| 160 | 3300005441 | Ga0070700_100018478 | Ga0070700_1000184783 | 328 |
| 161 | 3300005459 | Ga0068867_100041022 | Ga0068867_1000410223 | 328 |
| 162 | 3300005617 | Ga0068859_100196983 | Ga0068859_1001969832 | 328 |
| 163 | 3300005719 | Ga0068861_100002784 | Ga0068861_1000027844 | 328 |
| 164 | 3300005843 | Ga0068860_100086376 | Ga0068860_1000863763 | 328 |
| 165 | 3300005844 | Ga0068862_100046400 | Ga0068862_1000464002 | 328 |
| 166 | 3300006881 | Ga0068865_100004681 | Ga0068865_1000046815 | 328 |
| 167 | 3300006931 | Ga0097620_100196991 | Ga0097620_1001969912 | 328 |
| 168 | 3300009148 | Ga0105243_10168844 | Ga0105243_101688442 | 328 |
| 169 | 3300009174 | Ga0105241_10234750 | Ga0105241_102347502 | 328 |
| 170 | 3300013297 | Ga0157378_10040285 | Ga0157378_100402853 | 328 |
| 171 | 3300013306 | Ga0163162_10005347 | Ga0163162_1000534711 | 328 |
| 172 | 3300013308 | Ga0157375_10033464 | Ga0157375_100334644 | 328 |
| 173 | 3300025284 | Ga0209130_1019002 | Ga0209130_10190021 | 328 |
| 174 | 3300025907 | Ga0207645_10026044 | Ga0207645_100260443 | 328 |
| 175 | 3300025923 | Ga0207681_10123673 | Ga0207681_101236732 | 328 |
| 176 | 3300025935 | Ga0207709_10104478 | Ga0207709_101044782 | 328 |
| 177 | 3300025938 | Ga0207704_10039214 | Ga0207704_100392143 | 328 |
| 178 | 3300026088 | Ga0207641_10135902 | Ga0207641_101359023 | 328 |
| 179 | 3300026089 | Ga0207648_10000585 | Ga0207648_100005853 | 328 |
| 180 | 3300026118 | Ga0207675_100001107 | Ga0207675_10000110715 | 328 |
| 181 | 3300028381 | Ga0268264_10018355 | Ga0268264_100183554 | 328 |
| 182 | 3300028794 | Ga0307515_10205356 | Ga0307515_102053563 | 328 |
| 183 | 3300031727 | Ga0316576_10004332 | Ga0316576_100043325 | 328 |
| 184 | 3300031728 | Ga0316578_10025602 | Ga0316578_100256023 | 328 |
| 185 | 3300032005 | Ga0307411_10110117 | Ga0307411_101101172 | 328 |
| 186 | 3300042001 | Ga0439441_000131 | Ga0439441_000131_2329_3324 | 328 |
| 187 | 3300049575 | Ga0501039_0026662 | Ga0501039_0026662_2549_3544 | 328 |
| 188 | 3300049577 | Ga0501041_0022148 | Ga0501041_0022148_2593_3588 | 328 |
| 189 | 3300049591 | Ga0501075_0186617 | Ga0501075_0186617_236_1255 | 328 |
| 190 | 3300049741 | Ga0501079_0047011 | Ga0501079_0047011_2148_3143 | 328 |
| 191 | iso_pu_bacteria | 2885192300 | 2885195613 | 328 |
| 192 | 3300003792 | Ga0055540_1005341 | Ga0055540_10053413 | 329 |
| 193 | 3300003794 | Ga0055531_10001448 | Ga0055531_1000144815 | 329 |
| 194 | 3300005327 | Ga0070658_10193604 | Ga0070658_101936042 | 329 |
| 195 | 3300005329 | Ga0070683_100060942 | Ga0070683_1000609422 | 329 |
| 196 | 3300005331 | Ga0070670_100039560 | Ga0070670_1000395604 | 329 |
| 197 | 3300005331 | Ga0070670_100121658 | Ga0070670_1001216583 | 329 |
| 198 | 3300005333 | Ga0070677_10006429 | Ga0070677_100064292 | 329 |
| 199 | 3300005338 | Ga0068868_100003309 | Ga0068868_1000033095 | 329 |
| 200 | 3300005338 | Ga0068868_100065885 | Ga0068868_1000658853 | 329 |
| 201 | 3300005339 | Ga0070660_100019623 | Ga0070660_1000196233 | 329 |
| 202 | 3300005353 | Ga0070669_100043586 | Ga0070669_1000435862 | 329 |
| 203 | 3300005354 | Ga0070675_100016700 | Ga0070675_1000167005 | 329 |
| 204 | 3300005354 | Ga0070675_100136625 | Ga0070675_1001366251 | 329 |
| 205 | 3300005355 | Ga0070671_100060358 | Ga0070671_1000603582 | 329 |
| 206 | 3300005355 | Ga0070671_100171238 | Ga0070671_1001712382 | 329 |
| 207 | 3300005356 | Ga0070674_100007981 | Ga0070674_1000079815 | 329 |
| 208 | 3300005356 | Ga0070674_100025512 | Ga0070674_1000255123 | 329 |
| 209 | 3300005364 | Ga0070673_100200450 | Ga0070673_1002004502 | 329 |
| 210 | 3300005366 | Ga0070659_100002034 | Ga0070659_1000020342 | 329 |
| 211 | 3300005367 | Ga0070667_100135754 | Ga0070667_1001357543 | 329 |
| 212 | 3300005457 | Ga0070662_100003122 | Ga0070662_1000031224 | 329 |
| 213 | 3300005543 | Ga0070672_100007156 | Ga0070672_1000071566 | 329 |
| 214 | 3300005547 | Ga0070693_100034874 | Ga0070693_1000348741 | 329 |
| 215 | 3300005563 | Ga0068855_100029129 | Ga0068855_1000291295 | 329 |
| 216 | 3300005564 | Ga0070664_100083959 | Ga0070664_1000839593 | 329 |
| 217 | 3300005578 | Ga0068854_100024181 | Ga0068854_1000241813 | 329 |
| 218 | 3300005614 | Ga0068856_100057426 | Ga0068856_1000574263 | 329 |
| 219 | 3300005616 | Ga0068852_100004082 | Ga0068852_1000040826 | 329 |
| 220 | 3300005618 | Ga0068864_100021040 | Ga0068864_1000210405 | 329 |
| 221 | 3300005618 | Ga0068864_100059983 | Ga0068864_1000599832 | 329 |
| 222 | 3300005844 | Ga0068862_100093130 | Ga0068862_1000931301 | 329 |
| 223 | 3300006844 | Ga0075428_100025402 | Ga0075428_1000254023 | 329 |
| 224 | 3300006844 | Ga0075428_100040584 | Ga0075428_1000405843 | 329 |
| 225 | 3300006844 | Ga0075428_100253459 | Ga0075428_1002534592 | 329 |
| 226 | 3300006846 | Ga0075430_100000319 | Ga0075430_1000003199 | 329 |
| 227 | 3300006847 | Ga0075431_100071946 | Ga0075431_1000719464 | 329 |
| 228 | 3300006847 | Ga0075431_100180554 | Ga0075431_1001805543 | 329 |
| 229 | 3300006880 | Ga0075429_100097182 | Ga0075429_1000971823 | 329 |
| 230 | 3300009177 | Ga0105248_10018837 | Ga0105248_100188373 | 329 |
| 231 | 3300009551 | Ga0105238_10144442 | Ga0105238_101444422 | 329 |
| 232 | 3300009551 | Ga0105238_10244089 | Ga0105238_102440892 | 329 |
| 233 | 3300013102 | Ga0157371_10032495 | Ga0157371_100324953 | 329 |
| 234 | 3300013105 | Ga0157369_10026731 | Ga0157369_100267317 | 329 |
| 235 | 3300013296 | Ga0157374_10215132 | Ga0157374_102151321 | 329 |
| 236 | 3300013306 | Ga0163162_10001342 | Ga0163162_1000134217 | 329 |
| 237 | 3300013306 | Ga0163162_10438189 | Ga0163162_104381892 | 329 |
| 238 | 3300014325 | Ga0163163_10327202 | Ga0163163_103272022 | 329 |
| 239 | 3300021388 | Ga0213875_10034816 | Ga0213875_100348162 | 329 |
| 240 | 3300025273 | Ga0209673_1029447 | Ga0209673_10294472 | 329 |
| 241 | 3300025303 | Ga0209051_1000272 | Ga0209051_100027255 | 329 |
| 242 | 3300025304 | Ga0209257_1000055 | Ga0209257_1000055354 | 329 |
| 243 | 3300025315 | Ga0207697_10013163 | Ga0207697_100131634 | 329 |
| 244 | 3300025901 | Ga0207688_10045138 | Ga0207688_100451382 | 329 |
| 245 | 3300025901 | Ga0207688_10054263 | Ga0207688_100542632 | 329 |
| 246 | 3300025907 | Ga0207645_10027324 | Ga0207645_100273242 | 329 |
| 247 | 3300025909 | Ga0207705_10155675 | Ga0207705_101556752 | 329 |
| 248 | 3300025914 | Ga0207671_10139163 | Ga0207671_101391632 | 329 |
| 249 | 3300025923 | Ga0207681_10145845 | Ga0207681_101458452 | 329 |
| 250 | 3300025925 | Ga0207650_10049858 | Ga0207650_100498584 | 329 |
| 251 | 3300025926 | Ga0207659_10079980 | Ga0207659_100799802 | 329 |
| 252 | 3300025927 | Ga0207687_10249896 | Ga0207687_102498961 | 329 |
| 253 | 3300025933 | Ga0207706_10009759 | Ga0207706_100097593 | 329 |
| 254 | 3300025940 | Ga0207691_10002980 | Ga0207691_100029803 | 329 |
| 255 | 3300025942 | Ga0207689_10000284 | Ga0207689_1000028416 | 329 |
| 256 | 3300025944 | Ga0207661_10202051 | Ga0207661_102020512 | 329 |
| 257 | 3300025945 | Ga0207679_10031315 | Ga0207679_100313153 | 329 |
| 258 | 3300025945 | Ga0207679_10152945 | Ga0207679_101529452 | 329 |
| 259 | 3300025949 | Ga0207667_10580856 | Ga0207667_105808561 | 329 |
| 260 | 3300025981 | Ga0207640_10017173 | Ga0207640_100171733 | 329 |
| 261 | 3300025986 | Ga0207658_10198237 | Ga0207658_101982371 | 329 |
| 262 | 3300026023 | Ga0207677_10123110 | Ga0207677_101231102 | 329 |
| 263 | 3300026067 | Ga0207678_10007008 | Ga0207678_100070085 | 329 |
| 264 | 3300026078 | Ga0207702_10043419 | Ga0207702_100434194 | 329 |
| 265 | 3300026078 | Ga0207702_10066859 | Ga0207702_100668591 | 329 |
| 266 | 3300026089 | Ga0207648_10015261 | Ga0207648_100152614 | 329 |
| 267 | 3300026095 | Ga0207676_10015912 | Ga0207676_100159123 | 329 |
| 268 | 3300026095 | Ga0207676_10026747 | Ga0207676_100267473 | 329 |
| 269 | 3300026116 | Ga0207674_10275856 | Ga0207674_102758562 | 329 |
| 270 | 3300026118 | Ga0207675_100003350 | Ga0207675_1000033503 | 329 |
| 271 | 3300026121 | Ga0207683_10216203 | Ga0207683_102162032 | 329 |
| 272 | 3300027462 | Ga0210000_1004854 | Ga0210000_10048543 | 329 |
| 273 | 3300027526 | Ga0209968_1010145 | Ga0209968_10101452 | 329 |
| 274 | 3300027876 | Ga0209974_10045517 | Ga0209974_100455172 | 329 |
| 275 | 3300028380 | Ga0268265_10055764 | Ga0268265_100557642 | 329 |
| 276 | 3300028794 | Ga0307515_10227378 | Ga0307515_102273782 | 329 |
| 277 | 3300031456 | Ga0307513_10056083 | Ga0307513_100560832 | 329 |
| 278 | 3300031548 | Ga0307408_100181120 | Ga0307408_1001811202 | 329 |
| 279 | 3300031730 | Ga0307516_10009418 | Ga0307516_100094187 | 329 |
| 280 | 3300031824 | Ga0307413_10107531 | Ga0307413_101075312 | 329 |
| 281 | 3300031824 | Ga0307413_10219154 | Ga0307413_102191542 | 329 |
| 282 | 3300031901 | Ga0307406_10017952 | Ga0307406_100179523 | 329 |
| 283 | 3300031911 | Ga0307412_10105785 | Ga0307412_101057852 | 329 |
| 284 | 3300037312 | Ga0395899_0039593 | Ga0395899_0039593_1882_2889 | 329 |
| 285 | 3300037418 | Ga0395900_0004850 | Ga0395900_0004850_4175_5182 | 329 |
| 286 | 3300037418 | Ga0395900_0042887 | Ga0395900_0042887_3369_4376 | 329 |
| 287 | 3300037466 | Ga0395898_0007453 | Ga0395898_0007453_9894_10901 | 329 |
| 288 | 3300037466 | Ga0395898_0019113 | Ga0395898_0019113_912_1919 | 329 |
| 289 | 3300037466 | Ga0395898_0191143 | Ga0395898_0191143_658_1665 | 329 |
| 290 | 3300037471 | Ga0395905_0000811 | Ga0395905_0000811_16760_17767 | 329 |
| 291 | 3300037471 | Ga0395905_0005128 | Ga0395905_0005128_3799_4806 | 329 |
| 292 | 3300037471 | Ga0395905_0031216 | Ga0395905_0031216_1383_2390 | 329 |
| 293 | 3300037471 | Ga0395905_0032813 | Ga0395905_0032813_138_1145 | 329 |
| 294 | 3300037471 | Ga0395905_0064592 | Ga0395905_0064592_868_1875 | 329 |
| 295 | 3300037471 | Ga0395905_0095276 | Ga0395905_0095276_792_1799 | 329 |
| 296 | 3300037853 | Ga0436364_1172960 | Ga0436364_1172960_3507_4577 | 329 |
| 297 | 3300038443 | Ga0395901_0014806 | Ga0395901_0014806_6407_7414 | 329 |
| 298 | 3300042001 | Ga0439441_014538 | Ga0439441_014538_31_1026 | 329 |
| 299 | 3300042437 | Ga0439444_0002504 | Ga0439444_0002504_861_1856 | 329 |
| 300 | 3300044656 | Ga0466969_0044435 | Ga0466969_0044435_406_1413 | 329 |
| 301 | 3300044656 | Ga0466969_0061894 | Ga0466969_0061894_46_1053 | 329 |
| 302 | 3300044658 | Ga0466972_0065528 | Ga0466972_0065528_482_1489 | 329 |
| 303 | 3300044684 | Ga0466966_0014289 | Ga0466966_0014289_3767_4774 | 329 |
| 304 | 3300044684 | Ga0466966_0130847 | Ga0466966_0130847_379_1386 | 329 |
| 305 | 3300044693 | Ga0466961_0121530 | Ga0466961_0121530_53_1060 | 329 |
| 306 | 3300044765 | Ga0466970_0005106 | Ga0466970_0005106_1227_2234 | 329 |
| 307 | 3300045049 | Ga0466959_0003247 | Ga0466959_0003247_2234_3241 | 329 |
| 308 | 3300045051 | Ga0451576_0106379 | Ga0451576_0106379_290_1297 | 329 |
| 309 | 3300048905 | Ga0496102_0095044 | Ga0496102_0095044_430_1437 | 329 |
| 310 | 3300048910 | Ga0496107_0035746 | Ga0496107_0035746_1926_2933 | 329 |
| 311 | 3300048911 | Ga0496108_0049324 | Ga0496108_0049324_1696_2703 | 329 |
| 312 | 3300048914 | Ga0496111_0093702 | Ga0496111_0093702_862_1869 | 329 |
| 313 | 3300048918 | Ga0496115_0018921 | Ga0496115_0018921_1222_2229 | 329 |
| 314 | 3300049568 | Ga0501031_0061363 | Ga0501031_0061363_1026_2021 | 329 |
| 315 | 3300049568 | Ga0501031_0152567 | Ga0501031_0152567_279_1286 | 329 |
| 316 | 3300049571 | Ga0501034_0043397 | Ga0501034_0043397_2293_3300 | 329 |
| 317 | 3300049572 | Ga0501036_0001136 | Ga0501036_0001136_5786_6781 | 329 |
| 318 | 3300049572 | Ga0501036_0043037 | Ga0501036_0043037_969_1967 | 329 |
| 319 | 3300049572 | Ga0501036_0049832 | Ga0501036_0049832_1253_2260 | 329 |
| 320 | 3300049572 | Ga0501036_0075351 | Ga0501036_0075351_1527_2534 | 329 |
| 321 | 3300049573 | Ga0501037_0014905 | Ga0501037_0014905_1680_2687 | 329 |
| 322 | 3300049574 | Ga0501038_0002889 | Ga0501038_0002889_2239_3234 | 329 |
| 323 | 3300049574 | Ga0501038_0074409 | Ga0501038_0074409_573_1580 | 329 |
| 324 | 3300049574 | Ga0501038_0101888 | Ga0501038_0101888_113_1111 | 329 |
| 325 | 3300049575 | Ga0501039_0004891 | Ga0501039_0004891_4582_5577 | 329 |
| 326 | 3300049575 | Ga0501039_0059894 | Ga0501039_0059894_825_1826 | 329 |
| 327 | 3300049575 | Ga0501039_0246336 | Ga0501039_0246336_252_1250 | 329 |
| 328 | 3300049576 | Ga0501040_0000196 | Ga0501040_0000196_27052_28047 | 329 |
| 329 | 3300049577 | Ga0501041_0000164 | Ga0501041_0000164_21270_22265 | 329 |
| 330 | 3300049577 | Ga0501041_0055766 | Ga0501041_0055766_81_1082 | 329 |
| 331 | 3300049578 | Ga0501042_0000576 | Ga0501042_0000576_7299_8294 | 329 |
| 332 | 3300049578 | Ga0501042_0006949 | Ga0501042_0006949_2304_3305 | 329 |
| 333 | 3300049579 | Ga0501043_0019082 | Ga0501043_0019082_1134_2141 | 329 |
| 334 | 3300049580 | Ga0501046_0000247 | Ga0501046_0000247_10248_11243 | 329 |
| 335 | 3300049580 | Ga0501046_0065974 | Ga0501046_0065974_836_1843 | 329 |
| 336 | 3300049580 | Ga0501046_0182528 | Ga0501046_0182528_429_1430 | 329 |
| 337 | 3300049581 | Ga0501047_0057037 | Ga0501047_0057037_2129_3136 | 329 |
| 338 | 3300049581 | Ga0501047_0065334 | Ga0501047_0065334_1989_2996 | 329 |
| 339 | 3300049582 | Ga0501048_0000609 | Ga0501048_0000609_17094_18089 | 329 |
| 340 | 3300049582 | Ga0501048_0076626 | Ga0501048_0076626_372_1367 | 329 |
| 341 | 3300049586 | Ga0501070_0342635 | Ga0501070_0342635_45_1046 | 329 |
| 342 | 3300049588 | Ga0501072_0000333 | Ga0501072_0000333_25238_26233 | 329 |
| 343 | 3300049588 | Ga0501072_0004373 | Ga0501072_0004373_2073_3074 | 329 |
| 344 | 3300049588 | Ga0501072_0157830 | Ga0501072_0157830_481_1482 | 329 |
| 345 | 3300049589 | Ga0501073_0081313 | Ga0501073_0081313_732_1739 | 329 |
| 346 | 3300049590 | Ga0501074_0001316 | Ga0501074_0001316_12524_13519 | 329 |
| 347 | 3300049592 | Ga0501076_0002390 | Ga0501076_0002390_5782_6783 | 329 |
| 348 | 3300049592 | Ga0501076_0006162 | Ga0501076_0006162_6354_7349 | 329 |
| 349 | 3300049593 | Ga0501077_0000223 | Ga0501077_0000223_2916_3911 | 329 |
| 350 | 3300049593 | Ga0501077_0049493 | Ga0501077_0049493_116_1117 | 329 |
| 351 | 3300049741 | Ga0501079_0002588 | Ga0501079_0002588_4466_5461 | 329 |
| 352 | 3300049742 | Ga0501080_0002540 | Ga0501080_0002540_6699_7694 | 329 |
| 353 | 3300049742 | Ga0501080_0112853 | Ga0501080_0112853_788_1795 | 329 |
| 354 | 3300049743 | Ga0501081_0001238 | Ga0501081_0001238_1910_2905 | 329 |
| 355 | 3300049743 | Ga0501081_0001649 | Ga0501081_0001649_4385_5386 | 329 |
| 356 | 3300049822 | Ga0501035_0037964 | Ga0501035_0037964_52_1047 | 329 |
| 357 | 3300049822 | Ga0501035_0040418 | Ga0501035_0040418_1563_2570 | 329 |
| 358 | 3300049822 | Ga0501035_0221226 | Ga0501035_0221226_465_1472 | 329 |
| 359 | 3300049823 | Ga0501044_0045763 | Ga0501044_0045763_1518_2525 | 329 |
| 360 | 3300049823 | Ga0501044_0175393 | Ga0501044_0175393_806_1801 | 329 |
| 361 | 3300049824 | Ga0501045_0000481 | Ga0501045_0000481_17370_18365 | 329 |
| 362 | 3300049824 | Ga0501045_0206495 | Ga0501045_0206495_398_1399 | 329 |
| 363 | 3300050490 | nmdc:mga03n38_1430_c1 | nmdc:mga03n38_1430_c1_17_1006 | 329 |
| 364 | 3300050507 | nmdc:mga05p37_83400_c1 | nmdc:mga05p37_83400_c1_2143_3138 | 329 |
| 365 | 3300050508 | nmdc:mga09592_19007_c2 | nmdc:mga09592_19007_c2_1925_2920 | 329 |
| 366 | 3300050509 | nmdc:mga0qj67_252_c1 | nmdc:mga0qj67_252_c1_27736_28731 | 329 |
| 367 | 3300050509 | nmdc:mga0qj67_57368_c1 | nmdc:mga0qj67_57368_c1_243_1238 | 329 |
| 368 | 3300050510 | nmdc:mga06r32_13548_c1 | nmdc:mga06r32_13548_c1_1981_2976 | 329 |
| 369 | 3300053145 | Ga0500586_050133 | Ga0500586_050133_362_1369 | 329 |
| 370 | 3300054114 | Ga0501084_0004974 | Ga0501084_0004974_6958_7953 | 329 |
| 371 | 3300054114 | Ga0501084_0014998 | Ga0501084_0014998_850_1851 | 329 |
| 372 | 3300054114 | Ga0501084_0069858 | Ga0501084_0069858_1426_2421 | 329 |
| 373 | 3300060353 | Ga0501082_0015931 | Ga0501082_0015931_3167_4168 | 329 |
| 374 | 3300060353 | Ga0501082_0041083 | Ga0501082_0041083_2935_3930 | 329 |
| 375 | 3300061734 | Ga0530510_0000412 | Ga0530510_0000412_24862_25857 | 329 |
| 376 | 3300061734 | Ga0530510_0000731 | Ga0530510_0000731_4653_5654 | 329 |
| 377 | iso_pu_bacteria | 2513237351 | 2514587960 | 329 |
| 378 | 3300005328 | Ga0070676_10169758 | Ga0070676_101697582 | 330 |
| 379 | 3300005330 | Ga0070690_100127681 | Ga0070690_1001276812 | 330 |
| 380 | 3300005331 | Ga0070670_100014115 | Ga0070670_1000141154 | 330 |
| 381 | 3300005331 | Ga0070670_100014179 | Ga0070670_1000141796 | 330 |
| 382 | 3300005331 | Ga0070670_100120958 | Ga0070670_1001209581 | 330 |
| 383 | 3300005331 | Ga0070670_100209962 | Ga0070670_1002099622 | 330 |
| 384 | 3300005334 | Ga0068869_100394634 | Ga0068869_1003946341 | 330 |
| 385 | 3300005335 | Ga0070666_10005260 | Ga0070666_100052605 | 330 |
| 386 | 3300005336 | Ga0070680_100089044 | Ga0070680_1000890442 | 330 |
| 387 | 3300005338 | Ga0068868_100035815 | Ga0068868_1000358153 | 330 |
| 388 | 3300005338 | Ga0068868_100198147 | Ga0068868_1001981471 | 330 |
| 389 | 3300005339 | Ga0070660_100164560 | Ga0070660_1001645602 | 330 |
| 390 | 3300005343 | Ga0070687_100033629 | Ga0070687_1000336292 | 330 |
| 391 | 3300005344 | Ga0070661_100016290 | Ga0070661_1000162905 | 330 |
| 392 | 3300005344 | Ga0070661_100090991 | Ga0070661_1000909912 | 330 |
| 393 | 3300005347 | Ga0070668_100008179 | Ga0070668_1000081795 | 330 |
| 394 | 3300005347 | Ga0070668_100052000 | Ga0070668_1000520003 | 330 |
| 395 | 3300005353 | Ga0070669_100015522 | Ga0070669_1000155223 | 330 |
| 396 | 3300005353 | Ga0070669_100202248 | Ga0070669_1002022482 | 330 |
| 397 | 3300005354 | Ga0070675_100002982 | Ga0070675_1000029823 | 330 |
| 398 | 3300005354 | Ga0070675_100127961 | Ga0070675_1001279612 | 330 |
| 399 | 3300005355 | Ga0070671_100002733 | Ga0070671_1000027337 | 330 |
| 400 | 3300005355 | Ga0070671_100030435 | Ga0070671_1000304353 | 330 |
| 401 | 3300005364 | Ga0070673_100019910 | Ga0070673_1000199105 | 330 |
| 402 | 3300005364 | Ga0070673_100021568 | Ga0070673_1000215684 | 330 |
| 403 | 3300005364 | Ga0070673_100024790 | Ga0070673_1000247903 | 330 |
| 404 | 3300005364 | Ga0070673_100116164 | Ga0070673_1001161642 | 330 |
| 405 | 3300005364 | Ga0070673_100177101 | Ga0070673_1001771012 | 330 |
| 406 | 3300005367 | Ga0070667_100006321 | Ga0070667_1000063213 | 330 |
| 407 | 3300005435 | Ga0070714_100127250 | Ga0070714_1001272502 | 330 |
| 408 | 3300005456 | Ga0070678_100000866 | Ga0070678_10000086614 | 330 |
| 409 | 3300005456 | Ga0070678_100204362 | Ga0070678_1002043622 | 330 |
| 410 | 3300005458 | Ga0070681_10001792 | Ga0070681_100017923 | 330 |
| 411 | 3300005459 | Ga0068867_100017535 | Ga0068867_1000175353 | 330 |
| 412 | 3300005459 | Ga0068867_100038132 | Ga0068867_1000381322 | 330 |
| 413 | 3300005530 | Ga0070679_100022366 | Ga0070679_1000223664 | 330 |
| 414 | 3300005539 | Ga0068853_100087872 | Ga0068853_1000878721 | 330 |
| 415 | 3300005539 | Ga0068853_100139783 | Ga0068853_1001397832 | 330 |
| 416 | 3300005539 | Ga0068853_100175578 | Ga0068853_1001755782 | 330 |
| 417 | 3300005543 | Ga0070672_100016891 | Ga0070672_1000168912 | 330 |
| 418 | 3300005543 | Ga0070672_100086681 | Ga0070672_1000866812 | 330 |
| 419 | 3300005547 | Ga0070693_100122485 | Ga0070693_1001224852 | 330 |
| 420 | 3300005564 | Ga0070664_100029270 | Ga0070664_1000292704 | 330 |
| 421 | 3300005564 | Ga0070664_100305947 | Ga0070664_1003059472 | 330 |
| 422 | 3300005564 | Ga0070664_100340737 | Ga0070664_1003407371 | 330 |
| 423 | 3300005577 | Ga0068857_100076298 | Ga0068857_1000762983 | 330 |
| 424 | 3300005614 | Ga0068856_100057133 | Ga0068856_1000571333 | 330 |
| 425 | 3300005614 | Ga0068856_100329051 | Ga0068856_1003290512 | 330 |
| 426 | 3300005615 | Ga0070702_100087932 | Ga0070702_1000879322 | 330 |
| 427 | 3300005618 | Ga0068864_100001940 | Ga0068864_1000019409 | 330 |
| 428 | 3300005618 | Ga0068864_100005972 | Ga0068864_1000059725 | 330 |
| 429 | 3300005618 | Ga0068864_100009587 | Ga0068864_1000095874 | 330 |
| 430 | 3300005618 | Ga0068864_100040559 | Ga0068864_1000405594 | 330 |
| 431 | 3300005719 | Ga0068861_100035573 | Ga0068861_1000355732 | 330 |
| 432 | 3300005719 | Ga0068861_100036669 | Ga0068861_1000366693 | 330 |
| 433 | 3300005719 | Ga0068861_100334244 | Ga0068861_1003342442 | 330 |
| 434 | 3300005840 | Ga0068870_10036327 | Ga0068870_100363273 | 330 |
| 435 | 3300005841 | Ga0068863_100009737 | Ga0068863_1000097375 | 330 |
| 436 | 3300005841 | Ga0068863_100029987 | Ga0068863_1000299874 | 330 |
| 437 | 3300005842 | Ga0068858_100002388 | Ga0068858_10000238814 | 330 |
| 438 | 3300005842 | Ga0068858_100076040 | Ga0068858_1000760402 | 330 |
| 439 | 3300005843 | Ga0068860_100011379 | Ga0068860_1000113793 | 330 |
| 440 | 3300005843 | Ga0068860_100177275 | Ga0068860_1001772753 | 330 |
| 441 | 3300005844 | Ga0068862_100082185 | Ga0068862_1000821853 | 330 |
| 442 | 3300005844 | Ga0068862_100111733 | Ga0068862_1001117333 | 330 |
| 443 | 3300006038 | Ga0075365_10001711 | Ga0075365_100017113 | 330 |
| 444 | 3300006048 | Ga0075363_100100398 | Ga0075363_1001003982 | 330 |
| 445 | 3300006195 | Ga0075366_10065299 | Ga0075366_100652991 | 330 |
| 446 | 3300006353 | Ga0075370_10003250 | Ga0075370_100032506 | 330 |
| 447 | 3300006358 | Ga0068871_100003086 | Ga0068871_1000030869 | 330 |
| 448 | 3300006358 | Ga0068871_100012450 | Ga0068871_1000124506 | 330 |
| 449 | 3300006358 | Ga0068871_100226439 | Ga0068871_1002264392 | 330 |
| 450 | 3300009093 | Ga0105240_10017289 | Ga0105240_100172896 | 330 |
| 451 | 3300009093 | Ga0105240_10117358 | Ga0105240_101173582 | 330 |
| 452 | 3300009094 | Ga0111539_10551601 | Ga0111539_105516012 | 330 |
| 453 | 3300009098 | Ga0105245_10511891 | Ga0105245_105118911 | 330 |
| 454 | 3300009177 | Ga0105248_10045611 | Ga0105248_100456113 | 330 |
| 455 | 3300009177 | Ga0105248_10123037 | Ga0105248_101230373 | 330 |
| 456 | 3300009177 | Ga0105248_10234668 | Ga0105248_102346683 | 330 |
| 457 | 3300009545 | Ga0105237_10132828 | Ga0105237_101328283 | 330 |
| 458 | 3300009551 | Ga0105238_10172696 | Ga0105238_101726962 | 330 |
| 459 | 3300009553 | Ga0105249_10004214 | Ga0105249_100042143 | 330 |
| 460 | 3300009993 | Ga0105028_102144 | Ga0105028_1021442 | 330 |
| 461 | 3300013100 | Ga0157373_10002979 | Ga0157373_100029796 | 330 |
| 462 | 3300013297 | Ga0157378_10340734 | Ga0157378_103407342 | 330 |
| 463 | 3300013306 | Ga0163162_10046780 | Ga0163162_100467803 | 330 |
| 464 | 3300013306 | Ga0163162_10062839 | Ga0163162_100628393 | 330 |
| 465 | 3300013308 | Ga0157375_10120989 | Ga0157375_101209893 | 330 |
| 466 | 3300014325 | Ga0163163_10005988 | Ga0163163_100059886 | 330 |
| 467 | 3300014326 | Ga0157380_10051815 | Ga0157380_100518153 | 330 |
| 468 | 3300014326 | Ga0157380_10182332 | Ga0157380_101823322 | 330 |
| 469 | 3300014497 | Ga0182008_10005888 | Ga0182008_100058883 | 330 |
| 470 | 3300014968 | Ga0157379_10042091 | Ga0157379_100420913 | 330 |
| 471 | 3300014969 | Ga0157376_10003982 | Ga0157376_100039827 | 330 |
| 472 | 3300017792 | Ga0163161_10039737 | Ga0163161_100397374 | 330 |
| 473 | 3300017792 | Ga0163161_10156907 | Ga0163161_101569072 | 330 |
| 474 | 3300025315 | Ga0207697_10025959 | Ga0207697_100259592 | 330 |
| 475 | 3300025903 | Ga0207680_10002766 | Ga0207680_100027665 | 330 |
| 476 | 3300025912 | Ga0207707_10007221 | Ga0207707_100072215 | 330 |
| 477 | 3300025913 | Ga0207695_10139036 | Ga0207695_101390362 | 330 |
| 478 | 3300025919 | Ga0207657_10098505 | Ga0207657_100985052 | 330 |
| 479 | 3300025919 | Ga0207657_10220485 | Ga0207657_102204852 | 330 |
| 480 | 3300025921 | Ga0207652_10047099 | Ga0207652_100470993 | 330 |
| 481 | 3300025923 | Ga0207681_10009109 | Ga0207681_100091093 | 330 |
| 482 | 3300025923 | Ga0207681_10018913 | Ga0207681_100189134 | 330 |
| 483 | 3300025923 | Ga0207681_10043519 | Ga0207681_100435191 | 330 |
| 484 | 3300025923 | Ga0207681_10249045 | Ga0207681_102490452 | 330 |
| 485 | 3300025924 | Ga0207694_10333191 | Ga0207694_103331911 | 330 |
| 486 | 3300025925 | Ga0207650_10005456 | Ga0207650_100054568 | 330 |
| 487 | 3300025925 | Ga0207650_10029833 | Ga0207650_100298334 | 330 |
| 488 | 3300025926 | Ga0207659_10003913 | Ga0207659_100039133 | 330 |
| 489 | 3300025926 | Ga0207659_10013639 | Ga0207659_100136394 | 330 |
| 490 | 3300025927 | Ga0207687_10245379 | Ga0207687_102453791 | 330 |
| 491 | 3300025927 | Ga0207687_10336881 | Ga0207687_103368812 | 330 |
| 492 | 3300025931 | Ga0207644_10000440 | Ga0207644_1000044021 | 330 |
| 493 | 3300025931 | Ga0207644_10017335 | Ga0207644_100173353 | 330 |
| 494 | 3300025937 | Ga0207669_10045926 | Ga0207669_100459262 | 330 |
| 495 | 3300025937 | Ga0207669_10106707 | Ga0207669_101067072 | 330 |
| 496 | 3300025938 | Ga0207704_10024167 | Ga0207704_100241673 | 330 |
| 497 | 3300025940 | Ga0207691_10052408 | Ga0207691_100524083 | 330 |
| 498 | 3300025940 | Ga0207691_10281963 | Ga0207691_102819632 | 330 |
| 499 | 3300025941 | Ga0207711_10002271 | Ga0207711_1000227114 | 330 |
| 500 | 3300025941 | Ga0207711_10003157 | Ga0207711_100031577 | 330 |
| 501 | 3300025942 | Ga0207689_10033860 | Ga0207689_100338604 | 330 |
| 502 | 3300025945 | Ga0207679_10019489 | Ga0207679_100194895 | 330 |
| 503 | 3300025960 | Ga0207651_10003747 | Ga0207651_100037475 | 330 |
| 504 | 3300025960 | Ga0207651_10030890 | Ga0207651_100308902 | 330 |
| 505 | 3300025960 | Ga0207651_10039671 | Ga0207651_100396713 | 330 |
| 506 | 3300025961 | Ga0207712_10007655 | Ga0207712_100076555 | 330 |
| 507 | 3300025972 | Ga0207668_10163240 | Ga0207668_101632402 | 330 |
| 508 | 3300025981 | Ga0207640_10129447 | Ga0207640_101294472 | 330 |
| 509 | 3300025986 | Ga0207658_10016033 | Ga0207658_100160334 | 330 |
| 510 | 3300025986 | Ga0207658_10065172 | Ga0207658_100651722 | 330 |
| 511 | 3300026023 | Ga0207677_10002416 | Ga0207677_100024167 | 330 |
| 512 | 3300026023 | Ga0207677_10007814 | Ga0207677_100078145 | 330 |
| 513 | 3300026035 | Ga0207703_10013570 | Ga0207703_100135703 | 330 |
| 514 | 3300026035 | Ga0207703_10022401 | Ga0207703_100224015 | 330 |
| 515 | 3300026067 | Ga0207678_10078600 | Ga0207678_100786003 | 330 |
| 516 | 3300026075 | Ga0207708_10029269 | Ga0207708_100292693 | 330 |
| 517 | 3300026078 | Ga0207702_10024004 | Ga0207702_100240043 | 330 |
| 518 | 3300026088 | Ga0207641_10013843 | Ga0207641_100138435 | 330 |
| 519 | 3300026088 | Ga0207641_10016227 | Ga0207641_100162273 | 330 |
| 520 | 3300026088 | Ga0207641_10019101 | Ga0207641_100191014 | 330 |
| 521 | 3300026088 | Ga0207641_10019127 | Ga0207641_100191273 | 330 |
| 522 | 3300026089 | Ga0207648_10028121 | Ga0207648_100281214 | 330 |
| 523 | 3300026089 | Ga0207648_10168440 | Ga0207648_101684403 | 330 |
| 524 | 3300026095 | Ga0207676_10005447 | Ga0207676_100054473 | 330 |
| 525 | 3300026095 | Ga0207676_10006093 | Ga0207676_100060937 | 330 |
| 526 | 3300026095 | Ga0207676_10017484 | Ga0207676_100174844 | 330 |
| 527 | 3300026116 | Ga0207674_10031146 | Ga0207674_100311465 | 330 |
| 528 | 3300026116 | Ga0207674_10207804 | Ga0207674_102078042 | 330 |
| 529 | 3300026118 | Ga0207675_100049590 | Ga0207675_1000495904 | 330 |
| 530 | 3300026118 | Ga0207675_100091777 | Ga0207675_1000917773 | 330 |
| 531 | 3300026121 | Ga0207683_10001491 | Ga0207683_1000149112 | 330 |
| 532 | 3300026142 | Ga0207698_10557466 | Ga0207698_105574662 | 330 |
| 533 | 3300028379 | Ga0268266_10007392 | Ga0268266_100073927 | 330 |
| 534 | 3300028381 | Ga0268264_10093564 | Ga0268264_100935642 | 330 |
| 535 | 3300028794 | Ga0307515_10000152 | Ga0307515_10000152133 | 330 |
| 536 | 3300031241 | Ga0265325_10013325 | Ga0265325_100133253 | 330 |
| 537 | 3300031548 | Ga0307408_100010963 | Ga0307408_1000109631 | 330 |
| 538 | 3300031711 | Ga0265314_10020832 | Ga0265314_100208323 | 330 |
| 539 | 3300031711 | Ga0265314_10046206 | Ga0265314_100462062 | 330 |
| 540 | 3300031731 | Ga0307405_10098415 | Ga0307405_100984153 | 330 |
| 541 | 3300031824 | Ga0307413_10006777 | Ga0307413_100067774 | 330 |
| 542 | 3300031901 | Ga0307406_10003754 | Ga0307406_100037546 | 330 |
| 543 | 3300031911 | Ga0307412_10052651 | Ga0307412_100526512 | 330 |
| 544 | 3300031995 | Ga0307409_100002822 | Ga0307409_1000028228 | 330 |
| 545 | 3300031995 | Ga0307409_100103769 | Ga0307409_1001037693 | 330 |
| 546 | 3300032002 | Ga0307416_100127763 | Ga0307416_1001277633 | 330 |
| 547 | 3300032002 | Ga0307416_100355537 | Ga0307416_1003555371 | 330 |
| 548 | 3300032005 | Ga0307411_10000754 | Ga0307411_100007546 | 330 |
| 549 | 3300032126 | Ga0307415_100035721 | Ga0307415_1000357212 | 330 |
| 550 | 3300035170 | Ga0373943_0095990 | Ga0373943_0095990_215_1225 | 330 |
| 551 | 3300035695 | Ga0373927_0127927 | Ga0373927_0127927_571_1584 | 330 |
| 552 | 3300037068 | Ga0373925_0038576 | Ga0373925_0038576_1642_2652 | 330 |
| 553 | 3300038443 | Ga0395901_0217299 | Ga0395901_0217299_358_1368 | 330 |
| 554 | 3300041404 | Ga0439436_0000292 | Ga0439436_0000292_8386_9396 | 330 |
| 555 | 3300041406 | Ga0439439_0000873 | Ga0439439_0000873_3177_4196 | 330 |
| 556 | 3300041407 | Ga0439447_004752 | Ga0439447_004752_1093_2103 | 330 |
| 557 | 3300041410 | Ga0439461_0037197 | Ga0439461_0037197_14_1024 | 330 |
| 558 | 3300041411 | Ga0439466_0000854 | Ga0439466_0000854_9257_10267 | 330 |
| 559 | 3300041413 | Ga0439465_0000034 | Ga0439465_0000034_5863_6873 | 330 |
| 560 | 3300041997 | Ga0439431_0000727 | Ga0439431_0000727_5833_6843 | 330 |
| 561 | 3300041999 | Ga0439433_0000945 | Ga0439433_0000945_3556_4566 | 330 |
| 562 | 3300041999 | Ga0439433_0011888 | Ga0439433_0011888_158_1177 | 330 |
| 563 | 3300042002 | Ga0439442_019243 | Ga0439442_019243_147_1157 | 330 |
| 564 | 3300042004 | Ga0439445_0000511 | Ga0439445_0000511_1151_2161 | 330 |
| 565 | 3300042006 | Ga0439432_001169 | Ga0439432_001169_8597_9607 | 330 |
| 566 | 3300042007 | Ga0439449_0001078 | Ga0439449_0001078_1780_2799 | 330 |
| 567 | 3300042010 | Ga0439452_001608 | Ga0439452_001608_2676_3686 | 330 |
| 568 | 3300042010 | Ga0439452_005875 | Ga0439452_005875_1304_2323 | 330 |
| 569 | 3300042015 | Ga0439462_0010372 | Ga0439462_0010372_998_2008 | 330 |
| 570 | 3300042015 | Ga0439462_0015675 | Ga0439462_0015675_692_1711 | 330 |
| 571 | 3300042123 | Ga0450921_001595 | Ga0450921_001595_352_1371 | 330 |
| 572 | 3300042145 | Ga0450906_003692 | Ga0450906_003692_1934_2953 | 330 |
| 573 | 3300042156 | Ga0439446_0002778 | Ga0439446_0002778_645_1655 | 330 |
| 574 | 3300042435 | Ga0439434_0030207 | Ga0439434_0030207_285_1304 | 330 |
| 575 | 3300042532 | Ga0450893_0007500 | Ga0450893_0007500_324_1343 | 330 |
| 576 | 3300042876 | Ga0451577_0045590 | Ga0451577_0045590_2778_3788 | 330 |
| 577 | 3300044673 | Ga0453683_0000089 | Ga0453683_0000089_46208_47221 | 330 |
| 578 | 3300044712 | Ga0453684_0426461 | Ga0453684_0426461_330_1340 | 330 |
| 579 | 3300044735 | Ga0466968_0096792 | Ga0466968_0096792_43_1047 | 330 |
| 580 | 3300045051 | Ga0451576_0000001 | Ga0451576_0000001_1711293_1712306 | 330 |
| 581 | 3300046471 | Ga0495650_0044624 | Ga0495650_0044624_655_1665 | 330 |
| 582 | 3300046511 | Ga0495608_0177596 | Ga0495608_0177596_115_1125 | 330 |
| 583 | 3300046515 | Ga0495620_0080336 | Ga0495620_0080336_196_1203 | 330 |
| 584 | 3300046516 | Ga0495628_0047562 | Ga0495628_0047562_1381_2391 | 330 |
| 585 | 3300046543 | Ga0495645_0078591 | Ga0495645_0078591_1275_2285 | 330 |
| 586 | 3300046683 | Ga0495658_0025905 | Ga0495658_0025905_713_1723 | 330 |
| 587 | 3300046683 | Ga0495658_0159477 | Ga0495658_0159477_137_1147 | 330 |
| 588 | 3300046689 | Ga0495613_0109422 | Ga0495613_0109422_869_1879 | 330 |
| 589 | 3300046691 | Ga0495670_0103283 | Ga0495670_0103283_400_1410 | 330 |
| 590 | 3300046809 | Ga0495600_0255475 | Ga0495600_0255475_23_1033 | 330 |
| 591 | 3300047673 | Ga0495593_0102774 | Ga0495593_0102774_227_1237 | 330 |
| 592 | 3300048907 | Ga0496104_0208064 | Ga0496104_0208064_528_1538 | 330 |
| 593 | 3300048908 | Ga0496105_0052730 | Ga0496105_0052730_1104_2114 | 330 |
| 594 | 3300048910 | Ga0496107_0171096 | Ga0496107_0171096_323_1333 | 330 |
| 595 | 3300048917 | Ga0496114_0149990 | Ga0496114_0149990_397_1407 | 330 |
| 596 | 3300049574 | Ga0501038_0019715 | Ga0501038_0019715_3781_4779 | 330 |
| 597 | 3300049576 | Ga0501040_0015317 | Ga0501040_0015317_1710_2708 | 330 |
| 598 | 3300049577 | Ga0501041_0028815 | Ga0501041_0028815_874_1872 | 330 |
| 599 | 3300049578 | Ga0501042_0247817 | Ga0501042_0247817_121_1119 | 330 |
| 600 | 3300049579 | Ga0501043_0337262 | Ga0501043_0337262_123_1121 | 330 |
| 601 | 3300049581 | Ga0501047_0001674 | Ga0501047_0001674_5492_6517 | 330 |
| 602 | 3300049582 | Ga0501048_0028355 | Ga0501048_0028355_223_1221 | 330 |
| 603 | 3300049586 | Ga0501070_0193637 | Ga0501070_0193637_20_1045 | 330 |
| 604 | 3300049592 | Ga0501076_0000869 | Ga0501076_0000869_12143_13141 | 330 |
| 605 | 3300049592 | Ga0501076_0008429 | Ga0501076_0008429_4890_5888 | 330 |
| 606 | 3300049593 | Ga0501077_0011772 | Ga0501077_0011772_1266_2264 | 330 |
| 607 | 3300049741 | Ga0501079_0060030 | Ga0501079_0060030_992_1990 | 330 |
| 608 | 3300049742 | Ga0501080_0014252 | Ga0501080_0014252_2356_3354 | 330 |
| 609 | 3300049743 | Ga0501081_0029745 | Ga0501081_0029745_301_1299 | 330 |
| 610 | 3300049760 | Ga0501263_003647 | Ga0501263_003647_77_1087 | 330 |
| 611 | 3300049822 | Ga0501035_0162957 | Ga0501035_0162957_799_1824 | 330 |
| 612 | 3300049823 | Ga0501044_0001406 | Ga0501044_0001406_3161_4186 | 330 |
| 613 | 3300049824 | Ga0501045_0000799 | Ga0501045_0000799_9494_10492 | 330 |
| 614 | 3300050489 | nmdc:mga03683_17296_c1 | nmdc:mga03683_17296_c1_712_1731 | 330 |
| 615 | 3300050490 | nmdc:mga03n38_12577_c1 | nmdc:mga03n38_12577_c1_283_1293 | 330 |
| 616 | 3300050492 | nmdc:mga0yw44_27341_c1 | nmdc:mga0yw44_27341_c1_986_1996 | 330 |
| 617 | 3300050493 | nmdc:mga0k408_218598_c1 | nmdc:mga0k408_218598_c1_97_1107 | 330 |
| 618 | 3300050493 | nmdc:mga0k408_44635_c1 | nmdc:mga0k408_44635_c1_1522_2532 | 330 |
| 619 | 3300050493 | nmdc:mga0k408_74493_c1 | nmdc:mga0k408_74493_c1_880_1905 | 330 |
| 620 | 3300050496 | nmdc:mga07m45_1407_c1 | nmdc:mga07m45_1407_c1_8338_9357 | 330 |
| 621 | 3300053084 | Ga0495595_0023968 | Ga0495595_0023968_953_1963 | 330 |
| 622 | 3300053085 | Ga0495619_0097231 | Ga0495619_0097231_298_1308 | 330 |
| 623 | 3300054114 | Ga0501084_0038950 | Ga0501084_0038950_102_1100 | 330 |
| 624 | 3300054114 | Ga0501084_0369465 | Ga0501084_0369465_65_1090 | 330 |
| 625 | 3300060353 | Ga0501082_0056252 | Ga0501082_0056252_965_1963 | 330 |
| 626 | 3300061734 | Ga0530510_0038650 | Ga0530510_0038650_1706_2704 | 330 |
| 627 | 3300005328 | Ga0070676_10001373 | Ga0070676_100013736 | 331 |
| 628 | 3300005329 | Ga0070683_100006054 | Ga0070683_1000060544 | 331 |
| 629 | 3300005331 | Ga0070670_100002131 | Ga0070670_1000021319 | 331 |
| 630 | 3300005331 | Ga0070670_100108670 | Ga0070670_1001086702 | 331 |
| 631 | 3300005331 | Ga0070670_100121618 | Ga0070670_1001216182 | 331 |
| 632 | 3300005335 | Ga0070666_10013563 | Ga0070666_100135634 | 331 |
| 633 | 3300005338 | Ga0068868_100023451 | Ga0068868_1000234512 | 331 |
| 634 | 3300005339 | Ga0070660_100010702 | Ga0070660_1000107026 | 331 |
| 635 | 3300005340 | Ga0070689_100008484 | Ga0070689_1000084843 | 331 |
| 636 | 3300005341 | Ga0070691_10056277 | Ga0070691_100562772 | 331 |
| 637 | 3300005344 | Ga0070661_100183042 | Ga0070661_1001830421 | 331 |
| 638 | 3300005347 | Ga0070668_100005276 | Ga0070668_1000052767 | 331 |
| 639 | 3300005347 | Ga0070668_100007162 | Ga0070668_1000071627 | 331 |
| 640 | 3300005353 | Ga0070669_100003875 | Ga0070669_1000038754 | 331 |
| 641 | 3300005354 | Ga0070675_100000222 | Ga0070675_1000002225 | 331 |
| 642 | 3300005354 | Ga0070675_100003286 | Ga0070675_1000032868 | 331 |
| 643 | 3300005355 | Ga0070671_100143014 | Ga0070671_1001430142 | 331 |
| 644 | 3300005356 | Ga0070674_100095461 | Ga0070674_1000954612 | 331 |
| 645 | 3300005364 | Ga0070673_100008257 | Ga0070673_1000082577 | 331 |
| 646 | 3300005364 | Ga0070673_100174205 | Ga0070673_1001742053 | 331 |
| 647 | 3300005365 | Ga0070688_100013922 | Ga0070688_1000139224 | 331 |
| 648 | 3300005367 | Ga0070667_100001986 | Ga0070667_10000198611 | 331 |
| 649 | 3300005367 | Ga0070667_100550151 | Ga0070667_1005501511 | 331 |
| 650 | 3300005436 | Ga0070713_100010039 | Ga0070713_1000100394 | 331 |
| 651 | 3300005439 | Ga0070711_100205303 | Ga0070711_1002053031 | 331 |
| 652 | 3300005455 | Ga0070663_100161100 | Ga0070663_1001611001 | 331 |
| 653 | 3300005455 | Ga0070663_100210261 | Ga0070663_1002102611 | 331 |
| 654 | 3300005456 | Ga0070678_100000839 | Ga0070678_1000008397 | 331 |
| 655 | 3300005456 | Ga0070678_100117636 | Ga0070678_1001176363 | 331 |
| 656 | 3300005459 | Ga0068867_100016264 | Ga0068867_1000162644 | 331 |
| 657 | 3300005459 | Ga0068867_100022276 | Ga0068867_1000222763 | 331 |
| 658 | 3300005466 | Ga0070685_10061390 | Ga0070685_100613901 | 331 |
| 659 | 3300005530 | Ga0070679_100151971 | Ga0070679_1001519712 | 331 |
| 660 | 3300005535 | Ga0070684_100011722 | Ga0070684_1000117224 | 331 |
| 661 | 3300005539 | Ga0068853_100015937 | Ga0068853_1000159373 | 331 |
| 662 | 3300005543 | Ga0070672_100004134 | Ga0070672_1000041347 | 331 |
| 663 | 3300005543 | Ga0070672_100135395 | Ga0070672_1001353952 | 331 |
| 664 | 3300005543 | Ga0070672_100177104 | Ga0070672_1001771042 | 331 |
| 665 | 3300005548 | Ga0070665_100007878 | Ga0070665_1000078782 | 331 |
| 666 | 3300005548 | Ga0070665_100042646 | Ga0070665_1000426464 | 331 |
| 667 | 3300005548 | Ga0070665_100358611 | Ga0070665_1003586112 | 331 |
| 668 | 3300005563 | Ga0068855_100022200 | Ga0068855_1000222003 | 331 |
| 669 | 3300005616 | Ga0068852_100056948 | Ga0068852_1000569481 | 331 |
| 670 | 3300005617 | Ga0068859_100002681 | Ga0068859_10000268120 | 331 |
| 671 | 3300005618 | Ga0068864_100023316 | Ga0068864_1000233164 | 331 |
| 672 | 3300005618 | Ga0068864_100297595 | Ga0068864_1002975952 | 331 |
| 673 | 3300005718 | Ga0068866_10128645 | Ga0068866_101286452 | 331 |
| 674 | 3300005719 | Ga0068861_100235584 | Ga0068861_1002355842 | 331 |
| 675 | 3300005834 | Ga0068851_10029868 | Ga0068851_100298683 | 331 |
| 676 | 3300005834 | Ga0068851_10067475 | Ga0068851_100674753 | 331 |
| 677 | 3300005841 | Ga0068863_100009693 | Ga0068863_1000096937 | 331 |
| 678 | 3300005841 | Ga0068863_100209511 | Ga0068863_1002095112 | 331 |
| 679 | 3300005842 | Ga0068858_100009307 | Ga0068858_1000093073 | 331 |
| 680 | 3300005842 | Ga0068858_100034298 | Ga0068858_1000342984 | 331 |
| 681 | 3300005843 | Ga0068860_100005427 | Ga0068860_1000054274 | 331 |
| 682 | 3300005843 | Ga0068860_100073355 | Ga0068860_1000733553 | 331 |
| 683 | 3300005843 | Ga0068860_100085441 | Ga0068860_1000854414 | 331 |
| 684 | 3300006237 | Ga0097621_100004472 | Ga0097621_1000044727 | 331 |
| 685 | 3300006358 | Ga0068871_100007556 | Ga0068871_1000075565 | 331 |
| 686 | 3300006881 | Ga0068865_100248675 | Ga0068865_1002486751 | 331 |
| 687 | 3300006931 | Ga0097620_100002681 | Ga0097620_10000268120 | 331 |
| 688 | 3300009093 | Ga0105240_10020319 | Ga0105240_100203195 | 331 |
| 689 | 3300009148 | Ga0105243_10550393 | Ga0105243_105503931 | 331 |
| 690 | 3300009174 | Ga0105241_10102798 | Ga0105241_101027982 | 331 |
| 691 | 3300009177 | Ga0105248_10012417 | Ga0105248_100124173 | 331 |
| 692 | 3300009545 | Ga0105237_10315568 | Ga0105237_103155683 | 331 |
| 693 | 3300009551 | Ga0105238_10008099 | Ga0105238_100080995 | 331 |
| 694 | 3300009553 | Ga0105249_10067323 | Ga0105249_100673233 | 331 |
| 695 | 3300010375 | Ga0105239_10135367 | Ga0105239_101353672 | 331 |
| 696 | 3300013105 | Ga0157369_10027926 | Ga0157369_100279262 | 331 |
| 697 | 3300013296 | Ga0157374_10001747 | Ga0157374_100017477 | 331 |
| 698 | 3300013306 | Ga0163162_10010347 | Ga0163162_100103473 | 331 |
| 699 | 3300013306 | Ga0163162_10288491 | Ga0163162_102884912 | 331 |
| 700 | 3300013308 | Ga0157375_10007223 | Ga0157375_100072233 | 331 |
| 701 | 3300013308 | Ga0157375_10126305 | Ga0157375_101263052 | 331 |
| 702 | 3300013308 | Ga0157375_10310752 | Ga0157375_103107522 | 331 |
| 703 | 3300014326 | Ga0157380_10145507 | Ga0157380_101455072 | 331 |
| 704 | 3300014968 | Ga0157379_10002891 | Ga0157379_100028918 | 331 |
| 705 | 3300014969 | Ga0157376_10059146 | Ga0157376_100591463 | 331 |
| 706 | 3300014969 | Ga0157376_10165680 | Ga0157376_101656802 | 331 |
| 707 | 3300017792 | Ga0163161_10110147 | Ga0163161_101101472 | 331 |
| 708 | 3300017792 | Ga0163161_10114593 | Ga0163161_101145932 | 331 |
| 709 | 3300025291 | Ga0209675_1012350 | Ga0209675_10123503 | 331 |
| 710 | 3300025297 | Ga0209758_1010165 | Ga0209758_10101654 | 331 |
| 711 | 3300025315 | Ga0207697_10011006 | Ga0207697_100110064 | 331 |
| 712 | 3300025321 | Ga0207656_10014296 | Ga0207656_100142961 | 331 |
| 713 | 3300025321 | Ga0207656_10056901 | Ga0207656_100569012 | 331 |
| 714 | 3300025901 | Ga0207688_10190076 | Ga0207688_101900762 | 331 |
| 715 | 3300025907 | Ga0207645_10003339 | Ga0207645_100033397 | 331 |
| 716 | 3300025909 | Ga0207705_10168880 | Ga0207705_101688802 | 331 |
| 717 | 3300025912 | Ga0207707_10041388 | Ga0207707_100413884 | 331 |
| 718 | 3300025913 | Ga0207695_10154785 | Ga0207695_101547853 | 331 |
| 719 | 3300025917 | Ga0207660_10004146 | Ga0207660_100041467 | 331 |
| 720 | 3300025919 | Ga0207657_10002699 | Ga0207657_100026999 | 331 |
| 721 | 3300025921 | Ga0207652_10055438 | Ga0207652_100554381 | 331 |
| 722 | 3300025923 | Ga0207681_10003668 | Ga0207681_100036684 | 331 |
| 723 | 3300025925 | Ga0207650_10033505 | Ga0207650_100335053 | 331 |
| 724 | 3300025925 | Ga0207650_10064050 | Ga0207650_100640503 | 331 |
| 725 | 3300025926 | Ga0207659_10000489 | Ga0207659_100004898 | 331 |
| 726 | 3300025926 | Ga0207659_10001915 | Ga0207659_100019158 | 331 |
| 727 | 3300025931 | Ga0207644_10398123 | Ga0207644_103981231 | 331 |
| 728 | 3300025934 | Ga0207686_10143336 | Ga0207686_101433362 | 331 |
| 729 | 3300025937 | Ga0207669_10263083 | Ga0207669_102630832 | 331 |
| 730 | 3300025938 | Ga0207704_10014203 | Ga0207704_100142034 | 331 |
| 731 | 3300025938 | Ga0207704_10064102 | Ga0207704_100641023 | 331 |
| 732 | 3300025940 | Ga0207691_10001953 | Ga0207691_100019537 | 331 |
| 733 | 3300025940 | Ga0207691_10015104 | Ga0207691_100151043 | 331 |
| 734 | 3300025940 | Ga0207691_10079757 | Ga0207691_100797572 | 331 |
| 735 | 3300025940 | Ga0207691_10186667 | Ga0207691_101866672 | 331 |
| 736 | 3300025941 | Ga0207711_10001723 | Ga0207711_1000172319 | 331 |
| 737 | 3300025942 | Ga0207689_10008263 | Ga0207689_100082633 | 331 |
| 738 | 3300025949 | Ga0207667_10017213 | Ga0207667_100172132 | 331 |
| 739 | 3300025960 | Ga0207651_10001637 | Ga0207651_100016372 | 331 |
| 740 | 3300025960 | Ga0207651_10109674 | Ga0207651_101096742 | 331 |
| 741 | 3300025960 | Ga0207651_10217811 | Ga0207651_102178112 | 331 |
| 742 | 3300025961 | Ga0207712_10285743 | Ga0207712_102857432 | 331 |
| 743 | 3300025972 | Ga0207668_10003274 | Ga0207668_100032747 | 331 |
| 744 | 3300025986 | Ga0207658_10003036 | Ga0207658_100030362 | 331 |
| 745 | 3300026023 | Ga0207677_10004673 | Ga0207677_100046735 | 331 |
| 746 | 3300026035 | Ga0207703_10006503 | Ga0207703_100065037 | 331 |
| 747 | 3300026035 | Ga0207703_10253692 | Ga0207703_102536922 | 331 |
| 748 | 3300026067 | Ga0207678_10089401 | Ga0207678_100894011 | 331 |
| 749 | 3300026067 | Ga0207678_10170457 | Ga0207678_101704572 | 331 |
| 750 | 3300026067 | Ga0207678_10241157 | Ga0207678_102411572 | 331 |
| 751 | 3300026075 | Ga0207708_10155191 | Ga0207708_101551911 | 331 |
| 752 | 3300026088 | Ga0207641_10006088 | Ga0207641_100060884 | 331 |
| 753 | 3300026089 | Ga0207648_10007574 | Ga0207648_100075744 | 331 |
| 754 | 3300026089 | Ga0207648_10011125 | Ga0207648_100111255 | 331 |
| 755 | 3300026089 | Ga0207648_10070362 | Ga0207648_100703622 | 331 |
| 756 | 3300026095 | Ga0207676_10034652 | Ga0207676_100346523 | 331 |
| 757 | 3300026116 | Ga0207674_10012155 | Ga0207674_100121558 | 331 |
| 758 | 3300026121 | Ga0207683_10000704 | Ga0207683_1000070422 | 331 |
| 759 | 3300026121 | Ga0207683_10011907 | Ga0207683_100119073 | 331 |
| 760 | 3300026121 | Ga0207683_10024038 | Ga0207683_100240383 | 331 |
| 761 | 3300028379 | Ga0268266_10007037 | Ga0268266_100070373 | 331 |
| 762 | 3300028379 | Ga0268266_10126527 | Ga0268266_101265273 | 331 |
| 763 | 3300028380 | Ga0268265_10036945 | Ga0268265_100369453 | 331 |
| 764 | 3300028381 | Ga0268264_10003913 | Ga0268264_100039139 | 331 |
| 765 | 3300030521 | Ga0307511_10000043 | Ga0307511_1000004377 | 331 |
| 766 | 3300031616 | Ga0307508_10017344 | Ga0307508_100173444 | 331 |
| 767 | 3300031824 | Ga0307413_10022710 | Ga0307413_100227102 | 331 |
| 768 | 3300031824 | Ga0307413_10048448 | Ga0307413_100484483 | 331 |
| 769 | 3300031903 | Ga0307407_10110713 | Ga0307407_101107131 | 331 |
| 770 | 3300032002 | Ga0307416_100005326 | Ga0307416_1000053266 | 331 |
| 771 | 3300046462 | Ga0495651_0235444 | Ga0495651_0235444_19_1032 | 331 |
| 772 | 3300046642 | Ga0495634_0192055 | Ga0495634_0192055_195_1208 | 331 |
| 773 | 3300047320 | Ga0495672_0067290 | Ga0495672_0067290_472_1485 | 331 |
| 774 | 3300047322 | Ga0495680_0286898 | Ga0495680_0286898_26_1039 | 331 |
| 775 | 3300048904 | Ga0496101_0179275 | Ga0496101_0179275_231_1256 | 331 |
| 776 | 3300048907 | Ga0496104_0372177 | Ga0496104_0372177_306_1331 | 331 |
| 777 | 3300048912 | Ga0496109_0436373 | Ga0496109_0436373_114_1139 | 331 |
| 778 | 3300048917 | Ga0496114_0055106 | Ga0496114_0055106_625_1650 | 331 |
| 779 | 3300048920 | Ga0496117_0049354 | Ga0496117_0049354_1788_2918 | 331 |
| 780 | 3300048924 | Ga0496121_0004790 | Ga0496121_0004790_10329_11459 | 331 |
| 781 | 3300053077 | Ga0495601_0045510 | Ga0495601_0045510_704_1717 | 331 |
| 782 | 3300053090 | Ga0500646_0000249 | Ga0500646_0000249_379_1401 | 331 |
| 783 | 3300053093 | Ga0500651_0017113 | Ga0500651_0017113_3000_4013 | 331 |
| 784 | 3300053118 | Ga0500594_0029195 | Ga0500594_0029195_18_1031 | 331 |
| 785 | 3300053119 | Ga0500595_000772 | Ga0500595_000772_15423_16586 | 331 |
| 786 | 3300053133 | Ga0500655_014181 | Ga0500655_014181_241_1263 | 331 |
| 787 | 3300053151 | Ga0500604_0000152 | Ga0500604_0000152_16567_17589 | 331 |
| 788 | 3300005577 | Ga0068857_100283451 | Ga0068857_1002834512 | 332 |
| 789 | 3300005618 | Ga0068864_100036204 | Ga0068864_1000362042 | 332 |
| 790 | 3300005840 | Ga0068870_10029609 | Ga0068870_100296092 | 332 |
| 791 | 3300005841 | Ga0068863_100059193 | Ga0068863_1000591932 | 332 |
| 792 | 3300009098 | Ga0105245_10214697 | Ga0105245_102146972 | 332 |
| 793 | 3300009101 | Ga0105247_10030315 | Ga0105247_100303153 | 332 |
| 794 | 3300009174 | Ga0105241_10218659 | Ga0105241_102186592 | 332 |
| 795 | 3300009177 | Ga0105248_10110242 | Ga0105248_101102423 | 332 |
| 796 | 3300009551 | Ga0105238_10240557 | Ga0105238_102405572 | 332 |
| 797 | 3300011119 | Ga0105246_10065315 | Ga0105246_100653153 | 332 |
| 798 | 3300013308 | Ga0157375_10742346 | Ga0157375_107423461 | 332 |
| 799 | 3300025901 | Ga0207688_10013627 | Ga0207688_100136274 | 332 |
| 800 | 3300025908 | Ga0207643_10023594 | Ga0207643_100235943 | 332 |
| 801 | 3300025918 | Ga0207662_10050066 | Ga0207662_100500663 | 332 |
| 802 | 3300025924 | Ga0207694_10142644 | Ga0207694_101426442 | 332 |
| 803 | 3300025925 | Ga0207650_10140443 | Ga0207650_101404432 | 332 |
| 804 | 3300025935 | Ga0207709_10299092 | Ga0207709_102990922 | 332 |
| 805 | 3300026095 | Ga0207676_10127141 | Ga0207676_101271412 | 332 |
| 806 | 3300026116 | Ga0207674_10205907 | Ga0207674_102059072 | 332 |
| 807 | 3300048929 | Ga0496126_0005177 | Ga0496126_0005177_11442_12542 | 332 |
| 808 | 3300005328 | Ga0070676_10014359 | Ga0070676_100143592 | 333 |
| 809 | 3300005331 | Ga0070670_100053897 | Ga0070670_1000538972 | 333 |
| 810 | 3300005354 | Ga0070675_100017016 | Ga0070675_1000170163 | 333 |
| 811 | 3300005356 | Ga0070674_100004381 | Ga0070674_1000043815 | 333 |
| 812 | 3300005364 | Ga0070673_100083787 | Ga0070673_1000837873 | 333 |
| 813 | 3300005365 | Ga0070688_100084759 | Ga0070688_1000847591 | 333 |
| 814 | 3300005456 | Ga0070678_100004463 | Ga0070678_1000044635 | 333 |
| 815 | 3300005457 | Ga0070662_100037163 | Ga0070662_1000371633 | 333 |
| 816 | 3300005459 | Ga0068867_100053828 | Ga0068867_1000538283 | 333 |
| 817 | 3300005466 | Ga0070685_10009513 | Ga0070685_100095132 | 333 |
| 818 | 3300005543 | Ga0070672_100017800 | Ga0070672_1000178003 | 333 |
| 819 | 3300011119 | Ga0105246_10058976 | Ga0105246_100589763 | 333 |
| 820 | 3300013297 | Ga0157378_10324447 | Ga0157378_103244472 | 333 |
| 821 | 3300014326 | Ga0157380_10061449 | Ga0157380_100614493 | 333 |
| 822 | 3300014969 | Ga0157376_10057186 | Ga0157376_100571863 | 333 |
| 823 | 3300017792 | Ga0163161_10107466 | Ga0163161_101074662 | 333 |
| 824 | 3300025893 | Ga0207682_10001362 | Ga0207682_100013626 | 333 |
| 825 | 3300025907 | Ga0207645_10024371 | Ga0207645_100243713 | 333 |
| 826 | 3300025918 | Ga0207662_10179220 | Ga0207662_101792202 | 333 |
| 827 | 3300025923 | Ga0207681_10273928 | Ga0207681_102739282 | 333 |
| 828 | 3300025926 | Ga0207659_10026428 | Ga0207659_100264283 | 333 |
| 829 | 3300025933 | Ga0207706_10078092 | Ga0207706_100780923 | 333 |
| 830 | 3300025937 | Ga0207669_10008595 | Ga0207669_100085952 | 333 |
| 831 | 3300025940 | Ga0207691_10001672 | Ga0207691_100016725 | 333 |
| 832 | 3300025972 | Ga0207668_10074754 | Ga0207668_100747542 | 333 |
| 833 | 3300026089 | Ga0207648_10075862 | Ga0207648_100758622 | 333 |
| 834 | 3300026118 | Ga0207675_100052291 | Ga0207675_1000522913 | 333 |
| 835 | 3300026121 | Ga0207683_10005998 | Ga0207683_100059989 | 333 |
| 836 | 3300032002 | Ga0307416_100063038 | Ga0307416_1000630382 | 333 |
| 837 | 3300042435 | Ga0439434_0036357 | Ga0439434_0036357_364_1365 | 333 |
| 838 | 3300046615 | Ga0495656_0013332 | Ga0495656_0013332_1770_2771 | 333 |
| 839 | 3300053096 | Ga0500641_0002472 | Ga0500641_0002472_2820_3821 | 333 |
| 840 | 3300002239 | JGI24034J26672_10010008 | JGI24034J26672_100100081 | 334 |
| 841 | 3300002244 | JGI24742J22300_10000750 | JGI24742J22300_100007502 | 334 |
| 842 | 3300005329 | Ga0070683_100098659 | Ga0070683_1000986592 | 334 |
| 843 | 3300005333 | Ga0070677_10057304 | Ga0070677_100573042 | 334 |
| 844 | 3300005334 | Ga0068869_100375891 | Ga0068869_1003758911 | 334 |
| 845 | 3300005335 | Ga0070666_10050114 | Ga0070666_100501143 | 334 |
| 846 | 3300005341 | Ga0070691_10012421 | Ga0070691_100124211 | 334 |
| 847 | 3300005343 | Ga0070687_100010887 | Ga0070687_1000108872 | 334 |
| 848 | 3300005345 | Ga0070692_10033234 | Ga0070692_100332341 | 334 |
| 849 | 3300005353 | Ga0070669_100039310 | Ga0070669_1000393102 | 334 |
| 850 | 3300005354 | Ga0070675_100004035 | Ga0070675_10000403510 | 334 |
| 851 | 3300005365 | Ga0070688_100093645 | Ga0070688_1000936453 | 334 |
| 852 | 3300005366 | Ga0070659_100013444 | Ga0070659_1000134442 | 334 |
| 853 | 3300005367 | Ga0070667_100024527 | Ga0070667_1000245274 | 334 |
| 854 | 3300005437 | Ga0070710_10035698 | Ga0070710_100356983 | 334 |
| 855 | 3300005438 | Ga0070701_10042793 | Ga0070701_100427933 | 334 |
| 856 | 3300005440 | Ga0070705_100239916 | Ga0070705_1002399161 | 334 |
| 857 | 3300005441 | Ga0070700_100055162 | Ga0070700_1000551623 | 334 |
| 858 | 3300005455 | Ga0070663_100053567 | Ga0070663_1000535673 | 334 |
| 859 | 3300005457 | Ga0070662_100038322 | Ga0070662_1000383223 | 334 |
| 860 | 3300005459 | Ga0068867_100019516 | Ga0068867_1000195163 | 334 |
| 861 | 3300005543 | Ga0070672_100036753 | Ga0070672_1000367534 | 334 |
| 862 | 3300005544 | Ga0070686_100124150 | Ga0070686_1001241502 | 334 |
| 863 | 3300005548 | Ga0070665_100032565 | Ga0070665_1000325652 | 334 |
| 864 | 3300005549 | Ga0070704_100205984 | Ga0070704_1002059842 | 334 |
| 865 | 3300005578 | Ga0068854_100060396 | Ga0068854_1000603963 | 334 |
| 866 | 3300005615 | Ga0070702_100001034 | Ga0070702_10000103410 | 334 |
| 867 | 3300005616 | Ga0068852_100017634 | Ga0068852_1000176345 | 334 |
| 868 | 3300005718 | Ga0068866_10004181 | Ga0068866_100041813 | 334 |
| 869 | 3300005719 | Ga0068861_100015642 | Ga0068861_1000156423 | 334 |
| 870 | 3300005842 | Ga0068858_100004577 | Ga0068858_10000457715 | 334 |
| 871 | 3300005844 | Ga0068862_100018506 | Ga0068862_1000185063 | 334 |
| 872 | 3300005937 | Ga0081455_10163125 | Ga0081455_101631252 | 334 |
| 873 | 3300006038 | Ga0075365_10038124 | Ga0075365_100381242 | 334 |
| 874 | 3300006175 | Ga0070712_100266853 | Ga0070712_1002668532 | 334 |
| 875 | 3300006177 | Ga0075362_10007436 | Ga0075362_100074362 | 334 |
| 876 | 3300006178 | Ga0075367_10086602 | Ga0075367_100866022 | 334 |
| 877 | 3300006195 | Ga0075366_10001985 | Ga0075366_100019854 | 334 |
| 878 | 3300006237 | Ga0097621_100014066 | Ga0097621_1000140663 | 334 |
| 879 | 3300006358 | Ga0068871_100009054 | Ga0068871_1000090543 | 334 |
| 880 | 3300006846 | Ga0075430_100012270 | Ga0075430_1000122702 | 334 |
| 881 | 3300006847 | Ga0075431_100000481 | Ga0075431_1000004818 | 334 |
| 882 | 3300006881 | Ga0068865_100037843 | Ga0068865_1000378433 | 334 |
| 883 | 3300009094 | Ga0111539_10002444 | Ga0111539_1000244418 | 334 |
| 884 | 3300009098 | Ga0105245_10011564 | Ga0105245_100115642 | 334 |
| 885 | 3300009101 | Ga0105247_10015314 | Ga0105247_100153144 | 334 |
| 886 | 3300009147 | Ga0114129_10001244 | Ga0114129_1000124427 | 334 |
| 887 | 3300009148 | Ga0105243_10124051 | Ga0105243_101240512 | 334 |
| 888 | 3300009177 | Ga0105248_10021746 | Ga0105248_100217468 | 334 |
| 889 | 3300009553 | Ga0105249_10177960 | Ga0105249_101779603 | 334 |
| 890 | 3300010375 | Ga0105239_10108243 | Ga0105239_101082432 | 334 |
| 891 | 3300013296 | Ga0157374_10091386 | Ga0157374_100913861 | 334 |
| 892 | 3300013297 | Ga0157378_10012368 | Ga0157378_100123686 | 334 |
| 893 | 3300013308 | Ga0157375_10040018 | Ga0157375_100400186 | 334 |
| 894 | 3300014326 | Ga0157380_10040456 | Ga0157380_100404563 | 334 |
| 895 | 3300014745 | Ga0157377_10006730 | Ga0157377_100067302 | 334 |
| 896 | 3300014968 | Ga0157379_10037151 | Ga0157379_100371512 | 334 |
| 897 | 3300014969 | Ga0157376_10005753 | Ga0157376_100057533 | 334 |
| 898 | 3300017792 | Ga0163161_10034763 | Ga0163161_100347633 | 334 |
| 899 | 3300025901 | Ga0207688_10000411 | Ga0207688_100004115 | 334 |
| 900 | 3300025903 | Ga0207680_10036708 | Ga0207680_100367083 | 334 |
| 901 | 3300025907 | Ga0207645_10035195 | Ga0207645_100351953 | 334 |
| 902 | 3300025908 | Ga0207643_10001425 | Ga0207643_100014253 | 334 |
| 903 | 3300025915 | Ga0207693_10258307 | Ga0207693_102583072 | 334 |
| 904 | 3300025918 | Ga0207662_10005817 | Ga0207662_100058174 | 334 |
| 905 | 3300025926 | Ga0207659_10015637 | Ga0207659_100156374 | 334 |
| 906 | 3300025927 | Ga0207687_10084656 | Ga0207687_100846562 | 334 |
| 907 | 3300025931 | Ga0207644_10067036 | Ga0207644_100670362 | 334 |
| 908 | 3300025933 | Ga0207706_10001936 | Ga0207706_100019362 | 334 |
| 909 | 3300025935 | Ga0207709_10101544 | Ga0207709_101015443 | 334 |
| 910 | 3300025937 | Ga0207669_10019762 | Ga0207669_100197623 | 334 |
| 911 | 3300025940 | Ga0207691_10009947 | Ga0207691_100099472 | 334 |
| 912 | 3300025941 | Ga0207711_10032833 | Ga0207711_100328332 | 334 |
| 913 | 3300025942 | Ga0207689_10002774 | Ga0207689_100027745 | 334 |
| 914 | 3300025960 | Ga0207651_10150554 | Ga0207651_101505542 | 334 |
| 915 | 3300025961 | Ga0207712_10114457 | Ga0207712_101144572 | 334 |
| 916 | 3300025972 | Ga0207668_10167525 | Ga0207668_101675252 | 334 |
| 917 | 3300025986 | Ga0207658_10041412 | Ga0207658_100414123 | 334 |
| 918 | 3300026023 | Ga0207677_10083500 | Ga0207677_100835002 | 334 |
| 919 | 3300026035 | Ga0207703_10023566 | Ga0207703_100235663 | 334 |
| 920 | 3300026067 | Ga0207678_10010648 | Ga0207678_100106487 | 334 |
| 921 | 3300026075 | Ga0207708_10003811 | Ga0207708_100038114 | 334 |
| 922 | 3300026078 | Ga0207702_10162852 | Ga0207702_101628522 | 334 |
| 923 | 3300026088 | Ga0207641_10023350 | Ga0207641_100233503 | 334 |
| 924 | 3300026089 | Ga0207648_10013819 | Ga0207648_100138192 | 334 |
| 925 | 3300026118 | Ga0207675_100003203 | Ga0207675_10000320310 | 334 |
| 926 | 3300026121 | Ga0207683_10007493 | Ga0207683_100074936 | 334 |
| 927 | 3300027907 | Ga0207428_10001178 | Ga0207428_1000117825 | 334 |
| 928 | 3300028379 | Ga0268266_10137815 | Ga0268266_101378152 | 334 |
| 929 | 3300028381 | Ga0268264_10085250 | Ga0268264_100852502 | 334 |
| 930 | 3300035691 | Ga0373931_0034639 | Ga0373931_0034639_1498_2502 | 334 |
| 931 | 3300042003 | Ga0439443_000733 | Ga0439443_000733_809_1813 | 334 |
| 932 | 3300042436 | Ga0439435_0043336 | Ga0439435_0043336_239_1243 | 334 |
| 933 | 3300046491 | Ga0495584_0003056 | Ga0495584_0003056_2072_3076 | 334 |
| 934 | 3300046523 | Ga0495644_0038473 | Ga0495644_0038473_69_1073 | 334 |
| 935 | 3300046523 | Ga0495644_0055853 | Ga0495644_0055853_442_1446 | 334 |
| 936 | 3300046537 | Ga0495598_0025327 | Ga0495598_0025327_342_1346 | 334 |
| 937 | 3300046794 | Ga0495589_0048232 | Ga0495589_0048232_681_1685 | 334 |
| 938 | 3300048903 | Ga0496100_0002710 | Ga0496100_0002710_7703_8707 | 334 |
| 939 | 3300048904 | Ga0496101_0019896 | Ga0496101_0019896_1255_2259 | 334 |
| 940 | 3300048904 | Ga0496101_0108613 | Ga0496101_0108613_653_1657 | 334 |
| 941 | 3300048905 | Ga0496102_0164505 | Ga0496102_0164505_511_1515 | 334 |
| 942 | 3300048906 | Ga0496103_0001636 | Ga0496103_0001636_13480_14484 | 334 |
| 943 | 3300048908 | Ga0496105_0058797 | Ga0496105_0058797_810_1814 | 334 |
| 944 | 3300048909 | Ga0496106_0009030 | Ga0496106_0009030_3013_4017 | 334 |
| 945 | 3300048909 | Ga0496106_0239649 | Ga0496106_0239649_332_1336 | 334 |
| 946 | 3300048910 | Ga0496107_0006550 | Ga0496107_0006550_5646_6650 | 334 |
| 947 | 3300048911 | Ga0496108_0085229 | Ga0496108_0085229_423_1427 | 334 |
| 948 | 3300048912 | Ga0496109_0076913 | Ga0496109_0076913_1644_2648 | 334 |
| 949 | 3300048917 | Ga0496114_0040957 | Ga0496114_0040957_1740_2744 | 334 |
| 950 | 3300048918 | Ga0496115_0007030 | Ga0496115_0007030_6931_7935 | 334 |
| 951 | 3300048918 | Ga0496115_0092293 | Ga0496115_0092293_412_1416 | 334 |
| 952 | 3300050489 | nmdc:mga03683_10753_c1 | nmdc:mga03683_10753_c1_651_1655 | 334 |
| 953 | 3300050492 | nmdc:mga0yw44_104939_c1 | nmdc:mga0yw44_104939_c1_336_1340 | 334 |
| 954 | 3300050492 | nmdc:mga0yw44_5028_c1 | nmdc:mga0yw44_5028_c1_930_1934 | 334 |
| 955 | 3300050493 | nmdc:mga0k408_149722_c1 | nmdc:mga0k408_149722_c1_231_1235 | 334 |
| 956 | 3300050494 | nmdc:mga06z11_52957_c1 | nmdc:mga06z11_52957_c1_759_1763 | 334 |
| 957 | 3300050507 | nmdc:mga05p37_528_c1 | nmdc:mga05p37_528_c1_28733_29740 | 334 |
| 958 | 3300050508 | nmdc:mga09592_704_c1 | nmdc:mga09592_704_c1_12229_13236 | 334 |
| 959 | 3300050509 | nmdc:mga0qj67_125314_c1 | nmdc:mga0qj67_125314_c1_114_1121 | 334 |
| 960 | 3300050510 | nmdc:mga06r32_241_c1 | nmdc:mga06r32_241_c1_41201_42208 | 334 |
| 961 | 3300050510 | nmdc:mga06r32_77686_c1 | nmdc:mga06r32_77686_c1_1481_2485 | 334 |
| 962 | 3300050511 | nmdc:mga08y16_427_c1 | nmdc:mga08y16_427_c1_16087_17094 | 334 |
| 963 | 3300053083 | Ga0495655_0002544 | Ga0495655_0002544_59_1063 | 334 |
| 964 | 3300053153 | Ga0500616_0008468 | Ga0500616_0008468_5279_6283 | 334 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qpq-assembly3.cif.gz_C | structure of bug27 from bordetella pertussis | 0.889 | 28 | 320 |
| 2qpq-assembly3.cif.gz_C | structure of bug27 from bordetella pertussis | 0.8751 | 28 | 320 |
| 5oku-assembly1.cif.gz_A | r. palustris rpa4515 with adipate | 0.8747 | 28 | 320 |
| 2qpq-assembly2.cif.gz_B | structure of bug27 from bordetella pertussis | 0.872 | 28 | 320 |
| 8hkb-assembly1.cif.gz_A | tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d | 0.8694 | 30 | 320 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9101 | 124 | 241 | 3.40.190.10 |
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8842 | 124 | 247 | 3.40.190.10 |
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8711 | 124 | 247 | 3.40.190.10 |
| 2qpqC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8664 | 124 | 247 | 3.40.190.10 |
| 2qpqC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8538 | 124 | 247 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8D509-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.8988 | 18 | 320 |
|
| AF-H0A2I4-F1-model_v4 | Tat pathway signal sequence domain protein | 0.8982 | 28 | 320 |
|
| AF-B3EWP1-F1-model_v4 | UPF0065 protein in clcB-clcD intergenic region | 0.8975 | 47 | 321 |
|
| AF-A0A4Q7NH98-F1-model_v4 | Tripartite-type tricarboxylate transporter receptor subunit TctC | 0.8957 | 28 | 320 |
|
| AF-A0A519I8E8-F1-model_v4 | deleted | 0.8951 | 113 | 320 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar