F486941

General Info

Members Datasets Scaffolds Average Seq Length
964 352 964 109

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10463298|Ga0307516_104632982
Length 125
Sequence LDYTTFITQGSLLINPKMDIEEKFSSIRKGMLEFLVLKIIAADQVYAADILKDLNATDFATQEGTLYPLLSKLRREELVDYEWKESESGPPRKYYKLTAKGREQLRDTLEHWQKIITTVKNLGQK

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
190 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
191 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
192 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
193 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
194 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
195 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
196 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
197 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
198 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
199 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
202 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
203 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
204 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
205 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
206 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
207 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
208 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
209 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
210 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
211 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
212 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
213 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
214 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
215 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
216 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
217 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
218 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
219 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
222 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
223 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
224 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
225 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
226 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
228 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
229 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
230 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
231 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
232 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
233 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
234 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
235 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
236 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
237 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
240 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
241 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
242 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
243 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
244 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
245 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
246 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
247 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
248 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
249 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
250 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
251 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
252 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
253 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
254 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
255 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
256 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
257 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
258 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
259 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
260 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
261 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
262 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
263 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
264 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
265 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
266 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
267 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
268 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
271 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
272 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
273 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
274 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
275 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
276 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
277 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
278 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
279 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
280 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
281 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
282 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
283 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
284 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
285 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
286 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
287 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
288 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
289 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
290 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
291 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
292 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
293 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
294 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
295 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
296 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
297 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
298 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
299 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
300 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
301 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
302 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
303 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
319 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
320 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
321 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
322 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
323 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
324 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
325 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
326 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
327 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
328 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
329 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
330 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
331 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
334 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
335 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
336 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
337 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
338 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
339 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
340 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
341 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
342 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
343 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
344 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
345 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
346 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
347 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
348 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
349 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
350 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
351 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
352 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0
Rhizoplane 1.76
Rhizosphere 95.44
Stem 0
Stem Tuber 0
Unclassified 1.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10000244 3300003320 Bacteria 697651
2 rootH2_10023934 3300003320 Bacteria 11461
3 rootL2_10196664 3300003322 Bacteria 5843
4 rootH1_10020346 3300003323 Bacteria 1837
5 rootH1_10060084 3300003323 Bacteria 8904
6 rootH1_10112671 3300003323 Bacteria 1119
7 Ga0065716_1014350 3300005277 Unclassified 532
8 Ga0065704_10149850 3300005289 Bacteria 1439
9 Ga0065704_10755470 3300005289 Unclassified 540
10 Ga0065715_10280599 3300005293 Unclassified 1076
11 Ga0065715_10572473 3300005293 Unclassified 726
12 Ga0065715_10597242 3300005293 Unclassified 709
13 Ga0065715_10719566 3300005293 Unclassified 644
14 Ga0065715_10763246 3300005293 Bacteria 616
15 Ga0065707_10001068 3300005295 Bacteria 10689
16 Ga0065707_10015406 3300005295 Unclassified 2169
17 Ga0065707_10185580 3300005295 Unclassified 1391
18 Ga0065707_10633634 3300005295 Bacteria 672
19 Ga0065707_10914318 3300005295 Bacteria 562
20 Ga0070676_10266597 3300005328 Unclassified 1149
21 Ga0070676_10499738 3300005328 Bacteria 863
22 Ga0070683_100033834 3300005329 Bacteria 4664
23 Ga0070690_100004892 3300005330 Bacteria 7489
24 Ga0070690_100428415 3300005330 Bacteria 977
25 Ga0070670_100003854 3300005331 Bacteria 12507
26 Ga0070670_100018306 3300005331 Bacteria 6009
27 Ga0070670_100299315 3300005331 Unclassified 1407
28 Ga0068869_100249480 3300005334 Unclassified 1417
29 Ga0068869_101658879 3300005334 Bacteria 570
30 Ga0068869_101767144 3300005334 Bacteria 553
31 Ga0070666_10006236 3300005335 Bacteria 7337
32 Ga0070666_10006373 3300005335 Bacteria 7258
33 Ga0070666_10033093 3300005335 Bacteria 3419
34 Ga0070680_100039578 3300005336 Bacteria 3814
35 Ga0070680_100301662 3300005336 Bacteria 1358
36 Ga0070680_100506432 3300005336 Bacteria 1033
37 Ga0070680_101243610 3300005336 Unclassified 644
38 Ga0070682_100275948 3300005337 Unclassified 1223
39 Ga0070682_100645637 3300005337 Unclassified 842
40 Ga0070682_101230659 3300005337 Unclassified 633
41 Ga0068868_100004281 3300005338 Bacteria 9993
42 Ga0068868_100154019 3300005338 Unclassified 1895
43 Ga0068868_100355783 3300005338 Unclassified 1255
44 Ga0068868_100748278 3300005338 Bacteria 878
45 Ga0068868_101030630 3300005338 Unclassified 754
46 Ga0068868_101901633 3300005338 Unclassified 563
47 Ga0070660_101094279 3300005339 Bacteria 674
48 Ga0070689_100290041 3300005340 Bacteria 1359
49 Ga0070689_100609939 3300005340 Bacteria 946
50 Ga0070689_100777763 3300005340 Unclassified 841
51 Ga0070691_10227083 3300005341 Bacteria 992
52 Ga0070691_10759396 3300005341 Unclassified 587
53 Ga0070687_100046546 3300005343 Unclassified 2221
54 Ga0070661_100017202 3300005344 Bacteria 5126
55 Ga0070661_100225900 3300005344 Bacteria 1437
56 Ga0070661_100457969 3300005344 Bacteria 1016
57 Ga0070668_100873713 3300005347 Unclassified 802
58 Ga0070668_102085394 3300005347 Bacteria 523
59 Ga0070669_100105297 3300005353 Bacteria 2134
60 Ga0070669_100183311 3300005353 Unclassified 1639
61 Ga0070669_100940671 3300005353 Unclassified 739
62 Ga0070669_101389514 3300005353 Unclassified 609
63 Ga0070675_100057218 3300005354 Unclassified 3214
64 Ga0070675_100429850 3300005354 Bacteria 1182
65 Ga0070675_101219367 3300005354 Unclassified 693
66 Ga0070675_101290714 3300005354 Unclassified 673
67 Ga0070671_100120360 3300005355 Bacteria 2209
68 Ga0070671_100147903 3300005355 Bacteria 1983
69 Ga0070671_100187945 3300005355 Bacteria 1750
70 Ga0070671_100195242 3300005355 Bacteria 1716
71 Ga0070671_100589699 3300005355 Unclassified 960
72 Ga0070674_100148600 3300005356 Bacteria 1766
73 Ga0070674_100210809 3300005356 Unclassified 1505
74 Ga0070674_100285170 3300005356 Bacteria 1310
75 Ga0070674_100398185 3300005356 Unclassified 1124
76 Ga0070674_100887973 3300005356 Unclassified 776
77 Ga0070674_101140347 3300005356 Unclassified 690
78 Ga0070673_100053464 3300005364 Bacteria 3172
79 Ga0070673_100066369 3300005364 Bacteria 2882
80 Ga0070673_100172803 3300005364 Bacteria 1845
81 Ga0070673_102080628 3300005364 Unclassified 539
82 Ga0070688_100503498 3300005365 Unclassified 914
83 Ga0070688_100791409 3300005365 Unclassified 741
84 Ga0070659_100259758 3300005366 Unclassified 1441
85 Ga0070667_100001051 3300005367 Bacteria 25201
86 Ga0070667_100006417 3300005367 Bacteria 9775
87 Ga0070667_100128514 3300005367 Bacteria 2210
88 Ga0070667_100138748 3300005367 Bacteria 2127
89 Ga0070667_100341335 3300005367 Bacteria 1354
90 Ga0070667_100655223 3300005367 Bacteria 969
91 Ga0070667_101628835 3300005367 Bacteria 607
92 Ga0070714_100626221 3300005435 Unclassified 1035
93 Ga0070713_100832444 3300005436 Bacteria 886
94 Ga0070713_100858290 3300005436 Bacteria 872
95 Ga0070713_101282997 3300005436 Bacteria 709
96 Ga0070710_10710368 3300005437 Unclassified 710
97 Ga0070711_100000034 3300005439 Bacteria 95912
98 Ga0070711_101281959 3300005439 Unclassified 635
99 Ga0070705_100486604 3300005440 Bacteria 934
100 Ga0070705_101348026 3300005440 Bacteria 593
101 Ga0070705_101448893 3300005440 Bacteria 574
102 Ga0070700_100485934 3300005441 Bacteria 947
103 Ga0070700_100545334 3300005441 Unclassified 900
104 Ga0070694_101254484 3300005444 Unclassified 622
105 Ga0070694_101565399 3300005444 Unclassified 559
106 Ga0070708_102060234 3300005445 Unclassified 528
107 Ga0070663_101323533 3300005455 Unclassified 636
108 Ga0070678_100146613 3300005456 Bacteria 1895
109 Ga0070678_100274857 3300005456 Bacteria 1422
110 Ga0070678_100297867 3300005456 Bacteria 1370
111 Ga0070678_100569943 3300005456 Unclassified 1007
112 Ga0070678_100807793 3300005456 Unclassified 852
113 Ga0070678_100876573 3300005456 Unclassified 819
114 Ga0070678_100921623 3300005456 Unclassified 800
115 Ga0070662_100246788 3300005457 Bacteria 1434
116 Ga0070662_100974513 3300005457 Unclassified 725
117 Ga0070681_10000277 3300005458 Bacteria 41097
118 Ga0070681_10013079 3300005458 Bacteria 8241
119 Ga0070681_10146165 3300005458 Unclassified 2293
120 Ga0070681_10225312 3300005458 Unclassified 1789
121 Ga0070681_10321470 3300005458 Bacteria 1457
122 Ga0070681_10509578 3300005458 Unclassified 1117
123 Ga0070681_10793512 3300005458 Unclassified 864
124 Ga0068867_100023104 3300005459 Bacteria 4451
125 Ga0068867_100920797 3300005459 Unclassified 788
126 Ga0068867_100935396 3300005459 Unclassified 782
127 Ga0068867_102023105 3300005459 Bacteria 545
128 Ga0070685_10218311 3300005466 Unclassified 1248
129 Ga0070685_10258809 3300005466 Unclassified 1156
130 Ga0070707_100150543 3300005468 Bacteria 2266
131 Ga0070707_100459353 3300005468 Bacteria 1234
132 Ga0070698_101156672 3300005471 Unclassified 723
133 Ga0070679_100020411 3300005530 Bacteria 6460
134 Ga0070679_100044245 3300005530 Bacteria 4436
135 Ga0070679_100123695 3300005530 Bacteria 2570
136 Ga0070679_100265620 3300005530 Bacteria 1671
137 Ga0070679_100596242 3300005530 Unclassified 1048
138 Ga0070679_100815721 3300005530 Bacteria 876
139 Ga0070679_101037253 3300005530 Unclassified 764
140 Ga0070679_101634845 3300005530 Unclassified 592
141 Ga0070684_100004819 3300005535 Bacteria 10305
142 Ga0070684_100097126 3300005535 Unclassified 2627
143 Ga0070684_100122765 3300005535 Bacteria 2337
144 Ga0070684_100783566 3300005535 Bacteria 891
145 Ga0068853_100012063 3300005539 Bacteria 7032
146 Ga0068853_100012521 3300005539 Bacteria 6901
147 Ga0068853_100116728 3300005539 Bacteria 2377
148 Ga0070672_100007574 3300005543 Bacteria 7379
149 Ga0070672_100024871 3300005543 Bacteria 4433
150 Ga0070672_100710995 3300005543 Unclassified 880
151 Ga0070686_100013755 3300005544 Unclassified 4642
152 Ga0070686_100204295 3300005544 Bacteria 1418
153 Ga0070686_100272503 3300005544 Unclassified 1245
154 Ga0070686_101947409 3300005544 Bacteria 502
155 Ga0070695_101035505 3300005545 Unclassified 669
156 Ga0070695_101124633 3300005545 Unclassified 644
157 Ga0070696_100680782 3300005546 Unclassified 837
158 Ga0070693_100007674 3300005547 Bacteria 5283
159 Ga0070693_100739856 3300005547 Unclassified 724
160 Ga0070665_100002424 3300005548 Bacteria 20557
161 Ga0070665_100665322 3300005548 Bacteria 1054
162 Ga0070665_102252951 3300005548 Unclassified 548
163 Ga0070704_100457338 3300005549 Unclassified 1100
164 Ga0068855_100140430 3300005563 Bacteria 2754
165 Ga0068855_100282700 3300005563 Bacteria 1842
166 Ga0068855_100327140 3300005563 Bacteria 1693
167 Ga0068855_100741520 3300005563 Bacteria 1048
168 Ga0070664_100037509 3300005564 Bacteria 4075
169 Ga0070664_100080692 3300005564 Unclassified 2802
170 Ga0070664_100720420 3300005564 Unclassified 930
171 Ga0070664_102288591 3300005564 Unclassified 513
172 Ga0068857_100009726 3300005577 Bacteria 8353
173 Ga0068857_100042068 3300005577 Bacteria 4052
174 Ga0068857_101375990 3300005577 Unclassified 686
175 Ga0068854_100494337 3300005578 Unclassified 1029
176 Ga0068854_101134136 3300005578 Unclassified 698
177 Ga0068854_101328548 3300005578 Bacteria 648
178 Ga0068856_100000001 3300005614 Bacteria 565602
179 Ga0068856_100039095 3300005614 Bacteria 4658
180 Ga0068856_100089561 3300005614 Bacteria 3060
181 Ga0068856_100460069 3300005614 Bacteria 1293
182 Ga0068856_102371587 3300005614 Unclassified 538
183 Ga0070702_100147511 3300005615 Bacteria 1506
184 Ga0068852_100314248 3300005616 Bacteria 1520
185 Ga0068852_101066879 3300005616 Unclassified 827
186 Ga0068852_101206836 3300005616 Bacteria 777
187 Ga0068852_101831934 3300005616 Unclassified 629
188 Ga0068859_100063322 3300005617 Bacteria 3729
189 Ga0068859_100118199 3300005617 Bacteria 2717
190 Ga0068859_100136174 3300005617 Unclassified 2529
191 Ga0068859_100511565 3300005617 Unclassified 1296
192 Ga0068859_100619623 3300005617 Bacteria 1175
193 Ga0068859_100624571 3300005617 Bacteria 1170
194 Ga0068859_101039449 3300005617 Bacteria 900
195 Ga0068859_101125852 3300005617 Bacteria 864
196 Ga0068859_101662287 3300005617 Bacteria 705
197 Ga0068859_102725635 3300005617 Unclassified 543
198 Ga0068864_100009805 3300005618 Bacteria 7898
199 Ga0068864_100100119 3300005618 Bacteria 2569
200 Ga0068864_100401574 3300005618 Unclassified 1302
201 Ga0068864_101233103 3300005618 Bacteria 747
202 Ga0068864_102519451 3300005618 Unclassified 520
203 Ga0068866_10385685 3300005718 Unclassified 900
204 Ga0068861_101017335 3300005719 Unclassified 792
205 Ga0068851_10084221 3300005834 Bacteria 1665
206 Ga0068870_10137638 3300005840 Unclassified 1425
207 Ga0068870_10672591 3300005840 Unclassified 711
208 Ga0068863_100000665 3300005841 Bacteria 34641
209 Ga0068863_100018390 3300005841 Bacteria 6689
210 Ga0068863_100038650 3300005841 Bacteria 4540
211 Ga0068863_100091145 3300005841 Bacteria 2890
212 Ga0068863_100107190 3300005841 Unclassified 2658
213 Ga0068863_100139898 3300005841 Unclassified 2313
214 Ga0068863_100231180 3300005841 Bacteria 1784
215 Ga0068863_100311563 3300005841 Unclassified 1528
216 Ga0068858_100008434 3300005842 Bacteria 9908
217 Ga0068858_100114498 3300005842 Unclassified 2520
218 Ga0068858_100142832 3300005842 Bacteria 2248
219 Ga0068858_100199400 3300005842 Bacteria 1892
220 Ga0068858_100741555 3300005842 Unclassified 957
221 Ga0068858_101433318 3300005842 Unclassified 681
222 Ga0068858_101718545 3300005842 Bacteria 620
223 Ga0068860_100024709 3300005843 Bacteria 5803
224 Ga0068860_100129405 3300005843 Bacteria 2421
225 Ga0068860_100183298 3300005843 Unclassified 2024
226 Ga0068860_100328041 3300005843 Bacteria 1503
227 Ga0068860_101185949 3300005843 Unclassified 784
228 Ga0068862_100024578 3300005844 Bacteria 5056
229 Ga0068862_100192101 3300005844 Unclassified 1838
230 Ga0068862_100517306 3300005844 Bacteria 1135
231 Ga0081455_10024812 3300005937 Bacteria 5543
232 Ga0081455_10433448 3300005937 Unclassified 903
233 Ga0075368_10162061 3300006042 Bacteria 937
234 Ga0075368_10245610 3300006042 Unclassified 764
235 Ga0075364_10026629 3300006051 Unclassified 3690
236 Ga0075364_10038708 3300006051 Unclassified 3090
237 Ga0075432_10133411 3300006058 Bacteria 942
238 Ga0070716_100229622 3300006173 Bacteria 1252
239 Ga0070716_100244523 3300006173 Bacteria 1219
240 Ga0097621_100011887 3300006237 Bacteria 6438
241 Ga0097621_100016353 3300006237 Bacteria 5606
242 Ga0097621_100051013 3300006237 Bacteria 3366
243 Ga0097621_100129336 3300006237 Bacteria 2148
244 Ga0097621_100195492 3300006237 Unclassified 1754
245 Ga0097621_100916974 3300006237 Unclassified 817
246 Ga0068871_100039347 3300006358 Bacteria 3783
247 Ga0068871_100056075 3300006358 Unclassified 3202
248 Ga0068871_100134365 3300006358 Unclassified 2100
249 Ga0068871_100136777 3300006358 Unclassified 2081
250 Ga0068871_100197298 3300006358 Bacteria 1736
251 Ga0068871_100249390 3300006358 Unclassified 1546
252 Ga0068871_100629206 3300006358 Unclassified 978
253 Ga0068871_101185544 3300006358 Bacteria 716
254 Ga0075428_100000574 3300006844 Bacteria 37525
255 Ga0075428_100157590 3300006844 Bacteria 2465
256 Ga0075428_100259211 3300006844 Unclassified 1872
257 Ga0075430_100131173 3300006846 Bacteria 2088
258 Ga0075431_100255474 3300006847 Bacteria 1780
259 Ga0075431_100366964 3300006847 Bacteria 1445
260 Ga0075433_10753686 3300006852 Bacteria 852
261 Ga0075434_100122664 3300006871 Bacteria 2614
262 Ga0075434_100150670 3300006871 Bacteria 2346
263 Ga0075429_100082854 3300006880 Bacteria 2796
264 Ga0075429_100091566 3300006880 Bacteria 2652
265 Ga0068865_100002579 3300006881 Bacteria 10756
266 Ga0068865_100029325 3300006881 Bacteria 3650
267 Ga0068865_100070439 3300006881 Bacteria 2478
268 Ga0068865_100152186 3300006881 Bacteria 1756
269 Ga0068865_101743681 3300006881 Bacteria 562
270 Ga0068865_102012575 3300006881 Unclassified 524
271 Ga0075436_101524788 3300006914 Bacteria 508
272 Ga0097620_100063325 3300006931 Bacteria 3729
273 Ga0097620_100118198 3300006931 Bacteria 2717
274 Ga0097620_100136168 3300006931 Unclassified 2529
275 Ga0097620_100511578 3300006931 Unclassified 1296
276 Ga0097620_100619708 3300006931 Bacteria 1175
277 Ga0097620_100624583 3300006931 Bacteria 1170
278 Ga0097620_101039573 3300006931 Bacteria 900
279 Ga0097620_101125683 3300006931 Bacteria 864
280 Ga0097620_101662098 3300006931 Bacteria 705
281 Ga0097620_102725734 3300006931 Unclassified 543
282 Ga0099795_10361773 3300007788 Bacteria 651
283 Ga0105251_10325794 3300009011 Bacteria 698
284 Ga0105240_10033308 3300009093 Bacteria 6659
285 Ga0105240_10195764 3300009093 Bacteria 2373
286 Ga0105240_10208043 3300009093 Bacteria 2288
287 Ga0105240_10264741 3300009093 Bacteria 1982
288 Ga0105240_10282646 3300009093 Bacteria 1905
289 Ga0105240_10540088 3300009093 Bacteria 1291
290 Ga0105240_11026932 3300009093 Bacteria 881
291 Ga0105240_12123896 3300009093 Unclassified 583
292 Ga0111539_10000282 3300009094 Bacteria 61040
293 Ga0111539_10000811 3300009094 Bacteria 40581
294 Ga0111539_10092584 3300009094 Bacteria 3552
295 Ga0111539_10095837 3300009094 Bacteria 3485
296 Ga0111539_10567516 3300009094 Unclassified 1322
297 Ga0111539_13034792 3300009094 Bacteria 542
298 Ga0105245_10538622 3300009098 Bacteria 1188
299 Ga0105245_10725818 3300009098 Bacteria 1028
300 Ga0105245_11513876 3300009098 Bacteria 722
301 Ga0105245_12095569 3300009098 Unclassified 619
302 Ga0105247_10187319 3300009101 Bacteria 1384
303 Ga0105247_10226314 3300009101 Unclassified 1268
304 Ga0105247_11123103 3300009101 Bacteria 621
305 Ga0105247_11344490 3300009101 Unclassified 576
306 Ga0114129_10000741 3300009147 Bacteria 41481
307 Ga0114129_10075673 3300009147 Bacteria 4687
308 Ga0114129_10158596 3300009147 Bacteria 3093
309 Ga0114129_10785109 3300009147 Bacteria 1216
310 Ga0114129_11329456 3300009147 Bacteria 890
311 Ga0105243_10338676 3300009148 Bacteria 1377
312 Ga0105243_10502515 3300009148 Bacteria 1149
313 Ga0105243_11243149 3300009148 Bacteria 760
314 Ga0105243_11543735 3300009148 Unclassified 689
315 Ga0105243_12284170 3300009148 Bacteria 578
316 Ga0105241_10012309 3300009174 Bacteria 6276
317 Ga0105241_10386150 3300009174 Bacteria 1225
318 Ga0105241_11402181 3300009174 Unclassified 669
319 Ga0105241_11414968 3300009174 Unclassified 666
320 Ga0105241_12312710 3300009174 Unclassified 535
321 Ga0105242_10005186 3300009176 Bacteria 10060
322 Ga0105242_10321088 3300009176 Bacteria 1420
323 Ga0105242_10486745 3300009176 Bacteria 1170
324 Ga0105242_12035086 3300009176 Unclassified 617
325 Ga0105242_12574073 3300009176 Unclassified 558
326 Ga0105242_12945088 3300009176 Bacteria 526
327 Ga0105248_10033995 3300009177 Bacteria 5699
328 Ga0105248_10079800 3300009177 Bacteria 3678
329 Ga0105248_10172202 3300009177 Unclassified 2440
330 Ga0105248_10641630 3300009177 Bacteria 1198
331 Ga0105248_10691462 3300009177 Bacteria 1151
332 Ga0105248_10909020 3300009177 Unclassified 994
333 Ga0105248_12542943 3300009177 Bacteria 584
334 Ga0105248_12826096 3300009177 Bacteria 554
335 Ga0105237_10091701 3300009545 Bacteria 3028
336 Ga0105237_10225794 3300009545 Bacteria 1873
337 Ga0105237_10228044 3300009545 Bacteria 1863
338 Ga0105237_10547063 3300009545 Bacteria 1164
339 Ga0105238_10024332 3300009551 Bacteria 6172
340 Ga0105238_10136472 3300009551 Bacteria 2431
341 Ga0105238_10149432 3300009551 Unclassified 2312
342 Ga0105238_10156998 3300009551 Bacteria 2250
343 Ga0105238_10548458 3300009551 Bacteria 1160
344 Ga0105238_10782973 3300009551 Bacteria 969
345 Ga0105238_12389179 3300009551 Unclassified 564
346 Ga0105249_10032077 3300009553 Bacteria 4752
347 Ga0105249_10064664 3300009553 Bacteria 3364
348 Ga0105249_10839179 3300009553 Unclassified 984
349 Ga0105249_10897032 3300009553 Bacteria 953
350 Ga0105249_11024298 3300009553 Bacteria 895
351 Ga0105249_11344408 3300009553 Unclassified 786
352 Ga0105249_11695204 3300009553 Unclassified 704
353 Ga0105249_12036321 3300009553 Unclassified 647
354 Ga0105249_12347366 3300009553 Unclassified 606
355 Ga0099796_10243783 3300010159 Unclassified 744
356 Ga0105239_10029577 3300010375 Bacteria 6023
357 Ga0105239_10302478 3300010375 Bacteria 1801
358 Ga0105239_11172436 3300010375 Unclassified 885
359 Ga0105246_10762317 3300011119 Unclassified 855
360 Ga0105246_11066594 3300011119 Bacteria 736
361 Ga0157345_1020075 3300012498 Unclassified 673
362 Ga0157373_10341878 3300013100 Unclassified 1067
363 Ga0157370_10095615 3300013104 Bacteria 2787
364 Ga0157370_10255611 3300013104 Bacteria 1620
365 Ga0157370_11209936 3300013104 Unclassified 681
366 Ga0157369_10010475 3300013105 Bacteria 10560
367 Ga0157369_10386305 3300013105 Bacteria 1453
368 Ga0157369_12287005 3300013105 Unclassified 548
369 Ga0157374_10090156 3300013296 Bacteria 2922
370 Ga0157374_10325062 3300013296 Bacteria 1525
371 Ga0157374_10488935 3300013296 Unclassified 1234
372 Ga0157374_10843957 3300013296 Unclassified 933
373 Ga0157374_11460446 3300013296 Unclassified 707
374 Ga0157378_10226566 3300013297 Bacteria 1779
375 Ga0157378_10805152 3300013297 Bacteria 965
376 Ga0157378_11239745 3300013297 Unclassified 786
377 Ga0157378_11506639 3300013297 Unclassified 717
378 Ga0157378_11914364 3300013297 Unclassified 642
379 Ga0163162_10008586 3300013306 Bacteria 9959
380 Ga0163162_10012175 3300013306 Bacteria 8396
381 Ga0163162_10012584 3300013306 Bacteria 8262
382 Ga0163162_10094707 3300013306 Bacteria 3073
383 Ga0163162_10393368 3300013306 Bacteria 1519
384 Ga0163162_10436571 3300013306 Unclassified 1441
385 Ga0163162_11950046 3300013306 Bacteria 672
386 Ga0163162_13104526 3300013306 Unclassified 533
387 Ga0157372_10016904 3300013307 Bacteria 7831
388 Ga0157372_10039046 3300013307 Bacteria 5239
389 Ga0157375_10001545 3300013308 Bacteria 19803
390 Ga0157375_10008862 3300013308 Bacteria 8807
391 Ga0157375_10081907 3300013308 Bacteria 3268
392 Ga0157375_10487214 3300013308 Bacteria 1398
393 Ga0157375_10592075 3300013308 Bacteria 1269
394 Ga0157375_11855447 3300013308 Bacteria 715
395 Ga0157375_11982413 3300013308 Unclassified 692
396 Ga0157375_12429222 3300013308 Unclassified 625
397 Ga0157375_12460960 3300013308 Bacteria 621
398 Ga0163163_10007882 3300014325 Bacteria 9415
399 Ga0163163_10090956 3300014325 Unclassified 3065
400 Ga0163163_10226311 3300014325 Bacteria 1919
401 Ga0163163_10904850 3300014325 Bacteria 946
402 Ga0163163_11285133 3300014325 Bacteria 794
403 Ga0163163_11362200 3300014325 Unclassified 771
404 Ga0163163_11897706 3300014325 Unclassified 656
405 Ga0157380_10029095 3300014326 Unclassified 4221
406 Ga0157380_10560241 3300014326 Unclassified 1123
407 Ga0157380_10585159 3300014326 Bacteria 1101
408 Ga0157380_11764318 3300014326 Unclassified 677
409 Ga0157380_11920112 3300014326 Unclassified 653
410 Ga0157380_11953778 3300014326 Unclassified 648
411 Ga0182008_10035121 3300014497 Bacteria 2513
412 Ga0157377_10163465 3300014745 Bacteria 1386
413 Ga0157377_10423428 3300014745 Unclassified 912
414 Ga0157377_10435147 3300014745 Unclassified 902
415 Ga0157377_10700305 3300014745 Unclassified 735
416 Ga0157379_10018917 3300014968 Bacteria 6078
417 Ga0157379_10267847 3300014968 Bacteria 1553
418 Ga0157379_10377169 3300014968 Unclassified 1301
419 Ga0157379_10411835 3300014968 Bacteria 1244
420 Ga0157379_10877181 3300014968 Bacteria 850
421 Ga0157379_11266050 3300014968 Bacteria 711
422 Ga0157379_12445070 3300014968 Bacteria 522
423 Ga0157376_10001440 3300014969 Bacteria 15645
424 Ga0157376_10003448 3300014969 Bacteria 10892
425 Ga0157376_10136478 3300014969 Unclassified 2196
426 Ga0157376_10171114 3300014969 Bacteria 1978
427 Ga0157376_10276977 3300014969 Bacteria 1578
428 Ga0157376_10431250 3300014969 Unclassified 1281
429 Ga0157376_10566622 3300014969 Unclassified 1126
430 Ga0157376_10951252 3300014969 Unclassified 879
431 Ga0157376_11786839 3300014969 Bacteria 651
432 Ga0163161_10293506 3300017792 Unclassified 1278
433 Ga0163161_10344345 3300017792 Bacteria 1183
434 Ga0163161_11575943 3300017792 Unclassified 579
435 Ga0154015_1623859 3300020610 Bacteria 656
436 Ga0207697_10072222 3300025315 Unclassified 1447
437 Ga0207697_10318934 3300025315 Unclassified 690
438 Ga0207697_10417204 3300025315 Unclassified 596
439 Ga0207656_10063405 3300025321 Bacteria 1627
440 Ga0207642_10106813 3300025899 Unclassified 1417
441 Ga0207642_10205918 3300025899 Unclassified 1090
442 Ga0207710_10065489 3300025900 Unclassified 1657
443 Ga0207688_10249364 3300025901 Unclassified 1075
444 Ga0207680_10012690 3300025903 Bacteria 4300
445 Ga0207680_10018329 3300025903 Bacteria 3719
446 Ga0207647_10000547 3300025904 Bacteria 29945
447 Ga0207685_10642333 3300025905 Unclassified 573
448 Ga0207645_10079544 3300025907 Unclassified 2101
449 Ga0207645_11113305 3300025907 Unclassified 532
450 Ga0207654_10241381 3300025911 Bacteria 1207
451 Ga0207707_10000021 3300025912 Bacteria 199548
452 Ga0207707_10000125 3300025912 Bacteria 79965
453 Ga0207707_10232313 3300025912 Bacteria 1604
454 Ga0207707_10275121 3300025912 Bacteria 1459
455 Ga0207707_10635348 3300025912 Unclassified 901
456 Ga0207707_10908107 3300025912 Bacteria 728
457 Ga0207695_10068626 3300025913 Bacteria 3632
458 Ga0207695_10080105 3300025913 Bacteria 3308
459 Ga0207695_10143122 3300025913 Bacteria 2337
460 Ga0207695_10380344 3300025913 Bacteria 1298
461 Ga0207671_10217397 3300025914 Bacteria 1496
462 Ga0207671_10409002 3300025914 Bacteria 1079
463 Ga0207671_10823447 3300025914 Unclassified 736
464 Ga0207663_10000002 3300025916 Bacteria 534155
465 Ga0207663_10164244 3300025916 Bacteria 1571
466 Ga0207660_10611740 3300025917 Bacteria 888
467 Ga0207660_10960600 3300025917 Bacteria 697
468 Ga0207660_11171621 3300025917 Bacteria 626
469 Ga0207662_10040400 3300025918 Bacteria 2742
470 Ga0207662_11302837 3300025918 Unclassified 516
471 Ga0207657_10008520 3300025919 Bacteria 10397
472 Ga0207649_10123772 3300025920 Bacteria 1747
473 Ga0207649_10350558 3300025920 Unclassified 1092
474 Ga0207649_10607044 3300025920 Unclassified 842
475 Ga0207649_10952231 3300025920 Bacteria 674
476 Ga0207652_10011466 3300025921 Bacteria 7145
477 Ga0207652_10084122 3300025921 Bacteria 2787
478 Ga0207652_10093547 3300025921 Bacteria 2645
479 Ga0207652_10124678 3300025921 Unclassified 2294
480 Ga0207652_10245743 3300025921 Bacteria 1613
481 Ga0207652_10668381 3300025921 Bacteria 928
482 Ga0207652_10867278 3300025921 Bacteria 799
483 Ga0207646_10338017 3300025922 Bacteria 1360
484 Ga0207646_10393161 3300025922 Bacteria 1252
485 Ga0207646_10941965 3300025922 Bacteria 765
486 Ga0207681_10086761 3300025923 Bacteria 2225
487 Ga0207681_10217023 3300025923 Unclassified 1478
488 Ga0207681_11280559 3300025923 Unclassified 616
489 Ga0207694_10091391 3300025924 Bacteria 2402
490 Ga0207694_10163944 3300025924 Unclassified 1797
491 Ga0207694_10217497 3300025924 Bacteria 1558
492 Ga0207694_10813667 3300025924 Unclassified 789
493 Ga0207694_11415734 3300025924 Unclassified 587
494 Ga0207650_10002523 3300025925 Bacteria 12700
495 Ga0207650_10007320 3300025925 Bacteria 7515
496 Ga0207650_10420629 3300025925 Unclassified 1109
497 Ga0207659_10022086 3300025926 Unclassified 4234
498 Ga0207659_10250903 3300025926 Bacteria 1436
499 Ga0207659_10312122 3300025926 Unclassified 1295
500 Ga0207659_10393558 3300025926 Unclassified 1158
501 Ga0207687_11636935 3300025927 Unclassified 552
502 Ga0207700_10034840 3300025928 Unclassified 3619
503 Ga0207700_10396795 3300025928 Bacteria 1208
504 Ga0207700_10946942 3300025928 Unclassified 771
505 Ga0207664_11582101 3300025929 Unclassified 577
506 Ga0207644_10037727 3300025931 Bacteria 3402
507 Ga0207644_10046153 3300025931 Bacteria 3102
508 Ga0207644_10078164 3300025931 Bacteria 2438
509 Ga0207644_10711806 3300025931 Unclassified 838
510 Ga0207644_10994791 3300025931 Unclassified 704
511 Ga0207690_10006797 3300025932 Bacteria 6783
512 Ga0207690_10335998 3300025932 Bacteria 1191
513 Ga0207706_10216529 3300025933 Bacteria 1678
514 Ga0207686_10027013 3300025934 Bacteria 3356
515 Ga0207686_10147597 3300025934 Bacteria 1633
516 Ga0207709_10639489 3300025935 Unclassified 846
517 Ga0207709_11463259 3300025935 Unclassified 566
518 Ga0207709_11826478 3300025935 Bacteria 506
519 Ga0207670_10235963 3300025936 Bacteria 1407
520 Ga0207670_10611816 3300025936 Bacteria 895
521 Ga0207669_10148573 3300025937 Bacteria 1638
522 Ga0207669_10459258 3300025937 Bacteria 1011
523 Ga0207669_10543172 3300025937 Bacteria 937
524 Ga0207669_10587066 3300025937 Bacteria 904
525 Ga0207704_10046495 3300025938 Bacteria 2587
526 Ga0207704_10057420 3300025938 Bacteria 2391
527 Ga0207704_10202730 3300025938 Bacteria 1453
528 Ga0207704_10466918 3300025938 Bacteria 1010
529 Ga0207665_10289987 3300025939 Bacteria 1220
530 Ga0207691_10014898 3300025940 Bacteria 7408
531 Ga0207691_10023330 3300025940 Bacteria 5824
532 Ga0207691_10033677 3300025940 Bacteria 4771
533 Ga0207691_11743898 3300025940 Bacteria 503
534 Ga0207711_10058759 3300025941 Bacteria 3310
535 Ga0207711_10093642 3300025941 Unclassified 2646
536 Ga0207711_10141809 3300025941 Bacteria 2163
537 Ga0207711_11084227 3300025941 Unclassified 742
538 Ga0207711_11128336 3300025941 Unclassified 725
539 Ga0207689_10116757 3300025942 Bacteria 2194
540 Ga0207689_10235497 3300025942 Bacteria 1513
541 Ga0207689_10509175 3300025942 Unclassified 1009
542 Ga0207689_10715740 3300025942 Bacteria 844
543 Ga0207689_11177520 3300025942 Unclassified 645
544 Ga0207661_10084451 3300025944 Bacteria 2630
545 Ga0207661_10124396 3300025944 Bacteria 2200
546 Ga0207661_10128475 3300025944 Unclassified 2167
547 Ga0207679_10104089 3300025945 Bacteria 2226
548 Ga0207667_10062259 3300025949 Bacteria 3902
549 Ga0207667_10781852 3300025949 Unclassified 952
550 Ga0207667_10793616 3300025949 Unclassified 944
551 Ga0207667_11203161 3300025949 Bacteria 737
552 Ga0207651_10066552 3300025960 Bacteria 2532
553 Ga0207651_10312223 3300025960 Bacteria 1311
554 Ga0207712_10030506 3300025961 Bacteria 3625
555 Ga0207712_10517630 3300025961 Unclassified 1022
556 Ga0207712_10700445 3300025961 Unclassified 884
557 Ga0207712_10772103 3300025961 Unclassified 843
558 Ga0207668_11178481 3300025972 Bacteria 688
559 Ga0207668_11184262 3300025972 Unclassified 686
560 Ga0207640_10137196 3300025981 Bacteria 1778
561 Ga0207640_10530009 3300025981 Bacteria 986
562 Ga0207640_11164046 3300025981 Unclassified 684
563 Ga0207658_10078039 3300025986 Bacteria 2529
564 Ga0207658_10115621 3300025986 Bacteria 2129
565 Ga0207658_10147234 3300025986 Bacteria 1914
566 Ga0207658_10819908 3300025986 Bacteria 845
567 Ga0207658_11056192 3300025986 Unclassified 741
568 Ga0207677_10004548 3300026023 Bacteria 7459
569 Ga0207677_10131867 3300026023 Unclassified 1899
570 Ga0207677_11042532 3300026023 Unclassified 743
571 Ga0207703_10020956 3300026035 Bacteria 5114
572 Ga0207703_10035581 3300026035 Unclassified 3957
573 Ga0207703_10426240 3300026035 Unclassified 1235
574 Ga0207703_10468844 3300026035 Unclassified 1179
575 Ga0207703_10856925 3300026035 Bacteria 869
576 Ga0207703_11417275 3300026035 Unclassified 668
577 Ga0207703_11858570 3300026035 Bacteria 578
578 Ga0207639_10046521 3300026041 Bacteria 3274
579 Ga0207639_10298030 3300026041 Unclassified 1424
580 Ga0207639_10594021 3300026041 Bacteria 1020
581 Ga0207639_11409460 3300026041 Unclassified 654
582 Ga0207678_10906896 3300026067 Unclassified 779
583 Ga0207708_10378534 3300026075 Unclassified 1167
584 Ga0207708_10415785 3300026075 Bacteria 1114
585 Ga0207708_10879157 3300026075 Bacteria 775
586 Ga0207708_11184688 3300026075 Bacteria 668
587 Ga0207702_10000001 3300026078 Bacteria 895738
588 Ga0207702_10148597 3300026078 Bacteria 2129
589 Ga0207702_10182357 3300026078 Bacteria 1934
590 Ga0207702_10451802 3300026078 Bacteria 1247
591 Ga0207641_10002906 3300026088 Bacteria 15499
592 Ga0207641_10021290 3300026088 Bacteria 5331
593 Ga0207641_10054112 3300026088 Bacteria 3404
594 Ga0207641_10054759 3300026088 Unclassified 3386
595 Ga0207641_10075115 3300026088 Unclassified 2918
596 Ga0207641_10136726 3300026088 Unclassified 2207
597 Ga0207641_10278973 3300026088 Unclassified 1571
598 Ga0207641_10280731 3300026088 Bacteria 1566
599 Ga0207641_10551168 3300026088 Unclassified 1124
600 Ga0207641_11230550 3300026088 Unclassified 749
601 Ga0207648_10008756 3300026089 Bacteria 9753
602 Ga0207648_10290617 3300026089 Bacteria 1463
603 Ga0207648_11407997 3300026089 Bacteria 655
604 Ga0207648_11512079 3300026089 Unclassified 631
605 Ga0207676_10008407 3300026095 Bacteria 7338
606 Ga0207676_10009375 3300026095 Bacteria 6967
607 Ga0207676_10068273 3300026095 Bacteria 2843
608 Ga0207676_10220274 3300026095 Unclassified 1689
609 Ga0207676_10536569 3300026095 Bacteria 1116
610 Ga0207674_10003167 3300026116 Bacteria 20254
611 Ga0207674_10015346 3300026116 Bacteria 8418
612 Ga0207674_10287704 3300026116 Bacteria 1592
613 Ga0207674_11673198 3300026116 Bacteria 605
614 Ga0207675_100544863 3300026118 Bacteria 1159
615 Ga0207675_101385288 3300026118 Unclassified 724
616 Ga0207683_10001251 3300026121 Bacteria 23033
617 Ga0207683_10272937 3300026121 Unclassified 1545
618 Ga0207683_10574426 3300026121 Bacteria 1043
619 Ga0207683_10847248 3300026121 Bacteria 849
620 Ga0207683_10859600 3300026121 Unclassified 842
621 Ga0207698_10344366 3300026142 Unclassified 1405
622 Ga0207698_11178738 3300026142 Unclassified 780
623 Ga0209974_10006568 3300027876 Unclassified 4055
624 Ga0207428_10000195 3300027907 Bacteria 84698
625 Ga0207428_10062289 3300027907 Bacteria 2950
626 Ga0207428_10559590 3300027907 Bacteria 826
627 Ga0268266_10001574 3300028379 Bacteria 26660
628 Ga0268266_10649084 3300028379 Bacteria 1016
629 Ga0268265_10057738 3300028380 Bacteria 2960
630 Ga0268265_10184475 3300028380 Bacteria 1796
631 Ga0268265_10352273 3300028380 Bacteria 1345
632 Ga0268265_10694833 3300028380 Unclassified 982
633 Ga0268264_10022619 3300028381 Bacteria 5130
634 Ga0268264_10032907 3300028381 Bacteria 4255
635 Ga0268264_10205740 3300028381 Unclassified 1803
636 Ga0268264_10519397 3300028381 Unclassified 1164
637 Ga0268264_10973563 3300028381 Bacteria 854
638 Ga0268264_11397858 3300028381 Unclassified 710
639 Ga0268264_12393246 3300028381 Unclassified 534
640 Ga0268264_12666906 3300028381 Unclassified 504
641 Ga0265337_1007184 3300028556 Bacteria 4196
642 Ga0265337_1102511 3300028556 Bacteria 778
643 Ga0265337_1141953 3300028556 Unclassified 650
644 Ga0265326_10057864 3300028558 Unclassified 1097
645 Ga0265319_1043415 3300028563 Unclassified 1510
646 Ga0265319_1092719 3300028563 Unclassified 952
647 Ga0265319_1118415 3300028563 Unclassified 826
648 Ga0265334_10005346 3300028573 Bacteria 5611
649 Ga0265318_10000005 3300028577 Bacteria 303630
650 Ga0265318_10020875 3300028577 Bacteria 2636
651 Ga0265318_10350940 3300028577 Unclassified 538
652 Ga0265318_10396425 3300028577 Unclassified 504
653 Ga0265323_10000044 3300028653 Bacteria 68290
654 Ga0265323_10003744 3300028653 Bacteria 6651
655 Ga0265323_10011348 3300028653 Unclassified 3598
656 Ga0265322_10000802 3300028654 Bacteria 11305
657 Ga0265322_10008192 3300028654 Bacteria 3047
658 Ga0265336_10028611 3300028666 Bacteria 1741
659 Ga0265338_10001998 3300028800 Bacteria 31691
660 Ga0265338_10013448 3300028800 Bacteria 9242
661 Ga0265338_10115876 3300028800 Bacteria 2147
662 Ga0265338_10462021 3300028800 Bacteria 898
663 Ga0265324_10004265 3300029957 Bacteria 6527
664 Ga0265324_10009397 3300029957 Bacteria 3820
665 Ga0265762_1048152 3300030760 Bacteria 849
666 Ga0265760_10045719 3300031090 Bacteria 1312
667 Ga0265330_10000051 3300031235 Bacteria 102872
668 Ga0265330_10026862 3300031235 Bacteria 2602
669 Ga0265330_10044760 3300031235 Bacteria 1953
670 Ga0265330_10061446 3300031235 Bacteria 1634
671 Ga0265330_10076014 3300031235 Unclassified 1450
672 Ga0265332_10007763 3300031238 Bacteria 4844
673 Ga0265332_10051938 3300031238 Bacteria 1760
674 Ga0265328_10077856 3300031239 Bacteria 1221
675 Ga0265328_10362869 3300031239 Unclassified 565
676 Ga0265320_10013450 3300031240 Bacteria 4707
677 Ga0265320_10020179 3300031240 Bacteria 3621
678 Ga0265320_10091355 3300031240 Unclassified 1410
679 Ga0265320_10384724 3300031240 Bacteria 620
680 Ga0265325_10006322 3300031241 Bacteria 7204
681 Ga0265325_10017468 3300031241 Bacteria 3985
682 Ga0265325_10476340 3300031241 Unclassified 542
683 Ga0265340_10028083 3300031247 Bacteria 2832
684 Ga0265340_10100510 3300031247 Bacteria 1344
685 Ga0265339_10014992 3300031249 Bacteria 4659
686 Ga0265339_10073218 3300031249 Bacteria 1822
687 Ga0265339_10148431 3300031249 Bacteria 1188
688 Ga0265339_10198264 3300031249 Unclassified 992
689 Ga0265331_10018334 3300031250 Unclassified 3633
690 Ga0265331_10104462 3300031250 Bacteria 1302
691 Ga0265331_10113388 3300031250 Unclassified 1242
692 Ga0265331_10142309 3300031250 Bacteria 1090
693 Ga0265331_10208871 3300031250 Bacteria 879
694 Ga0265327_10001705 3300031251 Bacteria 26258
695 Ga0265327_10013021 3300031251 Bacteria 5558
696 Ga0265327_10101160 3300031251 Bacteria 1390
697 Ga0265316_10000323 3300031344 Bacteria 53060
698 Ga0265316_10002356 3300031344 Bacteria 19690
699 Ga0265316_10005906 3300031344 Bacteria 11797
700 Ga0265316_10038370 3300031344 Bacteria 3860
701 Ga0265316_10046666 3300031344 Bacteria 3431
702 Ga0265316_10099467 3300031344 Unclassified 2212
703 Ga0265316_10153481 3300031344 Unclassified 1724
704 Ga0265316_10257027 3300031344 Bacteria 1281
705 Ga0265316_10476006 3300031344 Bacteria 894
706 Ga0307513_10012270 3300031456 Bacteria 10589
707 Ga0307509_10622429 3300031507 Bacteria 750
708 Ga0307408_101251676 3300031548 Bacteria 694
709 Ga0265313_10002981 3300031595 Bacteria 14116
710 Ga0265313_10003767 3300031595 Bacteria 12033
711 Ga0265313_10006788 3300031595 Bacteria 8004
712 Ga0265313_10017903 3300031595 Bacteria 4001
713 Ga0307508_10000200 3300031616 Bacteria 71996
714 Ga0265314_10001653 3300031711 Bacteria 24386
715 Ga0265314_10016863 3300031711 Bacteria 5756
716 Ga0265314_10099912 3300031711 Bacteria 1867
717 Ga0265314_10160057 3300031711 Bacteria 1371
718 Ga0265342_10002344 3300031712 Bacteria 16449
719 Ga0265342_10010937 3300031712 Bacteria 6241
720 Ga0265342_10015932 3300031712 Unclassified 4929
721 Ga0265342_10041726 3300031712 Bacteria 2776
722 Ga0265342_10042248 3300031712 Bacteria 2755
723 Ga0265342_10108733 3300031712 Bacteria 1571
724 Ga0265342_10586951 3300031712 Bacteria 563
725 Ga0307516_10463298 3300031730 Unclassified 923
726 Ga0307413_10675967 3300031824 Unclassified 855
727 Ga0307413_11455888 3300031824 Unclassified 604
728 Ga0307416_100119838 3300032002 Unclassified 2342
729 Ga0307411_11298030 3300032005 Bacteria 663
730 Ga0373959_0000052 3300034820 Bacteria 26566
731 Ga0373934_0250637 3300035086 Bacteria 732
732 Ga0373944_0136029 3300035089 Bacteria 857
733 Ga0373951_0001334 3300035091 Bacteria 6491
734 Ga0373923_0210713 3300035111 Unclassified 901
735 Ga0373932_0147183 3300035112 Bacteria 805
736 Ga0373932_0269193 3300035112 Unclassified 627
737 Ga0373939_0020582 3300035114 Bacteria 1794
738 Ga0373954_0319629 3300035118 Unclassified 766
739 Ga0373957_0282621 3300035120 Bacteria 702
740 Ga0373955_0213835 3300035172 Bacteria 1150
741 Ga0373962_0090418 3300035242 Bacteria 942
742 Ga0373931_0623617 3300035691 Bacteria 707
743 Ga0373931_0658250 3300035691 Bacteria 689
744 Ga0373931_1116398 3300035691 Bacteria 537
745 Ga0373935_0579610 3300035692 Bacteria 819
746 Ga0373933_0647059 3300035724 Unclassified 695
747 Ga0373937_0014543 3300036401 Bacteria 6950
748 Ga0373937_0047248 3300036401 Bacteria 3938
749 Ga0373937_0103496 3300036401 Bacteria 2644
750 Ga0373937_0439158 3300036401 Bacteria 1239
751 Ga0373937_0551763 3300036401 Unclassified 1095
752 Ga0373937_0854538 3300036401 Bacteria 858
753 Ga0373937_1388153 3300036401 Bacteria 650
754 Ga0316582_0407470 3300036647 Bacteria 937
755 Ga0373925_0731168 3300037068 Unclassified 816
756 Ga0373925_0893285 3300037068 Bacteria 732
757 Ga0436365_0786779 3300039437 Bacteria 766
758 Ga0439453_0129000 3300041408 Bacteria 586
759 Ga0451789_1098755 3300041443 Unclassified 756
760 Ga0451795_1691563 3300041456 Bacteria 545
761 Ga0451853_1514882 3300041512 Bacteria 520
762 Ga0439462_0112593 3300042015 Unclassified 754
763 Ga0450921_000557 3300042123 Bacteria 1834
764 Ga0450888_026066 3300042126 Bacteria 766
765 Ga0439446_0262658 3300042156 Bacteria 598
766 Ga0439435_0000415 3300042436 Bacteria 6638
767 Ga0439435_0061637 3300042436 Unclassified 1094
768 Ga0439435_0068856 3300042436 Bacteria 1044
769 Ga0439444_0002121 3300042437 Unclassified 2674
770 Ga0450893_0030716 3300042532 Bacteria 957
771 Ga0451577_0126672 3300042876 Bacteria 2288
772 Ga0451577_0167901 3300042876 Bacteria 1977
773 Ga0451577_0904583 3300042876 Unclassified 795
774 Ga0453683_0002405 3300044673 Bacteria 14587
775 Ga0453683_0257203 3300044673 Bacteria 1113
776 Ga0466966_0244296 3300044684 Bacteria 1082
777 Ga0466966_0388372 3300044684 Unclassified 839
778 Ga0453684_0072992 3300044712 Bacteria 4328
779 Ga0453684_0358547 3300044712 Bacteria 1642
780 Ga0453684_0359331 3300044712 Unclassified 1640
781 Ga0453684_0480004 3300044712 Unclassified 1379
782 Ga0453684_1078628 3300044712 Unclassified 850
783 Ga0453684_1401854 3300044712 Unclassified 725
784 Ga0466971_0142089 3300044719 Bacteria 1118
785 Ga0466959_0121887 3300045049 Unclassified 1853
786 Ga0451576_0014826 3300045051 Bacteria 8663
787 Ga0451576_0019268 3300045051 Bacteria 7449
788 Ga0466958_0257203 3300045836 Bacteria 1117
789 Ga0466967_0003400 3300045976 Bacteria 10371
790 Ga0495592_0002149 3300046454 Bacteria 13880
791 Ga0495603_0231549 3300046455 Bacteria 1065
792 Ga0495591_080624 3300046458 Bacteria 830
793 Ga0495629_0207057 3300046459 Bacteria 1355
794 Ga0495582_0084677 3300046473 Bacteria 1763
795 Ga0495639_0038859 3300046475 Bacteria 2138
796 Ga0495594_0218157 3300046499 Bacteria 1088
797 Ga0495618_0042704 3300046514 Bacteria 2859
798 Ga0495628_0502538 3300046516 Unclassified 875
799 Ga0495630_0387973 3300046517 Unclassified 1070
800 Ga0495652_0608065 3300046529 Bacteria 745
801 Ga0495665_0060046 3300046531 Bacteria 2007
802 Ga0495586_0085694 3300046535 Bacteria 1736
803 Ga0495586_0351726 3300046535 Bacteria 846
804 Ga0495645_0202844 3300046543 Bacteria 1344
805 Ga0495645_0536783 3300046543 Unclassified 727
806 Ga0495667_0000510 3300046559 Bacteria 24800
807 Ga0495634_0023902 3300046642 Bacteria 4292
808 Ga0495634_0099635 3300046642 Bacteria 1879
809 Ga0495635_0202318 3300046663 Bacteria 1347
810 Ga0495659_0125488 3300046664 Bacteria 1014
811 Ga0495588_0417018 3300046674 Bacteria 705
812 Ga0495657_0014486 3300046675 Bacteria 5788
813 Ga0495657_0067720 3300046675 Unclassified 2342
814 Ga0495599_0194811 3300046678 Unclassified 1246
815 Ga0495647_0083367 3300046681 Bacteria 1300
816 Ga0495658_0013257 3300046683 Bacteria 4194
817 Ga0495658_0078285 3300046683 Bacteria 1935
818 Ga0495669_0206396 3300046684 Bacteria 940
819 Ga0495613_0042502 3300046689 Bacteria 3362
820 Ga0495613_0537265 3300046689 Bacteria 784
821 Ga0495613_0562630 3300046689 Unclassified 762
822 Ga0495624_0565150 3300046690 Bacteria 679
823 Ga0495684_0029353 3300047471 Unclassified 4221
824 Ga0495684_0329830 3300047471 Bacteria 1089
825 Ga0495684_0441291 3300047471 Bacteria 906
826 Ga0495593_0167932 3300047673 Bacteria 1107
827 Ga0495614_0413916 3300048089 Bacteria 635
828 Ga0496102_1531441 3300048905 Unclassified 585
829 Ga0496104_0000038 3300048907 Bacteria 178150
830 Ga0496104_0019982 3300048907 Bacteria 6134
831 Ga0496105_0000038 3300048908 Bacteria 118666
832 Ga0496105_0449913 3300048908 Unclassified 1017
833 Ga0496106_0397942 3300048909 Bacteria 1107
834 Ga0496107_0177259 3300048910 Bacteria 1583
835 Ga0496108_0009731 3300048911 Bacteria 7789
836 Ga0496110_0862741 3300048913 Bacteria 811
837 Ga0496111_0188644 3300048914 Bacteria 1533
838 Ga0496112_0386727 3300048915 Bacteria 1340
839 Ga0496113_0060084 3300048916 Bacteria 2864
840 Ga0496114_0563099 3300048917 Bacteria 1006
841 Ga0496114_0744754 3300048917 Bacteria 857
842 Ga0496114_0945587 3300048917 Unclassified 744
843 Ga0496121_0684847 3300048924 Unclassified 619
844 Ga0496125_0558528 3300048928 Unclassified 633
845 Ga0496126_0024934 3300048929 Bacteria 5766
846 Ga0501031_0675619 3300049568 Bacteria 663
847 Ga0501031_0689609 3300049568 Unclassified 656
848 Ga0501032_0000381 3300049569 Bacteria 36644
849 Ga0501032_0004210 3300049569 Bacteria 10892
850 Ga0501032_0248686 3300049569 Unclassified 1154
851 Ga0501032_0317876 3300049569 Bacteria 1005
852 Ga0501033_0003173 3300049570 Bacteria 13640
853 Ga0501033_0706233 3300049570 Bacteria 686
854 Ga0501034_0003074 3300049571 Bacteria 19249
855 Ga0501034_0006567 3300049571 Bacteria 12490
856 Ga0501034_0019047 3300049571 Bacteria 7030
857 Ga0501034_0025655 3300049571 Bacteria 6002
858 Ga0501036_0002696 3300049572 Bacteria 14015
859 Ga0501036_0019542 3300049572 Bacteria 5687
860 Ga0501036_0057652 3300049572 Bacteria 3290
861 Ga0501036_0096727 3300049572 Unclassified 2496
862 Ga0501037_0035928 3300049573 Bacteria 3651
863 Ga0501037_0686046 3300049573 Unclassified 682
864 Ga0501037_0813060 3300049573 Bacteria 617
865 Ga0501038_0006345 3300049574 Bacteria 10942
866 Ga0501038_0108297 3300049574 Unclassified 2304
867 Ga0501038_0628221 3300049574 Unclassified 810
868 Ga0501039_0018596 3300049575 Bacteria 5334
869 Ga0501039_0295614 3300049575 Unclassified 1273
870 Ga0501040_0004831 3300049576 Bacteria 8733
871 Ga0501040_0862451 3300049576 Bacteria 656
872 Ga0501041_0001803 3300049577 Bacteria 12002
873 Ga0501042_0027262 3300049578 Unclassified 4016
874 Ga0501043_0005787 3300049579 Bacteria 9946
875 Ga0501043_0040939 3300049579 Bacteria 3641
876 Ga0501046_0006931 3300049580 Bacteria 9986
877 Ga0501046_0007380 3300049580 Bacteria 9667
878 Ga0501046_0046848 3300049580 Bacteria 3430
879 Ga0501046_0310789 3300049580 Bacteria 1149
880 Ga0501047_0000443 3300049581 Bacteria 45792
881 Ga0501047_0001606 3300049581 Bacteria 22029
882 Ga0501047_0010472 3300049581 Bacteria 8774
883 Ga0501047_0026010 3300049581 Bacteria 5627
884 Ga0501047_0081073 3300049581 Bacteria 3119
885 Ga0501047_0551888 3300049581 Unclassified 976
886 Ga0501047_0581328 3300049581 Bacteria 943
887 Ga0501047_1194752 3300049581 Unclassified 574
888 Ga0501047_1416202 3300049581 Unclassified 510
889 Ga0501048_0026634 3300049582 Bacteria 4208
890 Ga0501048_0207703 3300049582 Bacteria 1389
891 Ga0501048_0442617 3300049582 Bacteria 930
892 Ga0501068_0228635 3300049584 Bacteria 1183
893 Ga0501070_0006414 3300049586 Bacteria 10012
894 Ga0501070_0013617 3300049586 Bacteria 6854
895 Ga0501070_0040045 3300049586 Bacteria 3909
896 Ga0501070_0057235 3300049586 Bacteria 3231
897 Ga0501071_0007915 3300049587 Bacteria 7009
898 Ga0501072_0004526 3300049588 Bacteria 10566
899 Ga0501072_0060387 3300049588 Unclassified 2989
900 Ga0501072_0332576 3300049588 Unclassified 1207
901 Ga0501073_0008464 3300049589 Bacteria 7629
902 Ga0501073_0071909 3300049589 Bacteria 2409
903 Ga0501073_0107679 3300049589 Unclassified 1934
904 Ga0501074_0018167 3300049590 Bacteria 5108
905 Ga0501074_0050646 3300049590 Unclassified 2998
906 Ga0501074_0156580 3300049590 Bacteria 1627
907 Ga0501074_0181701 3300049590 Unclassified 1500
908 Ga0501075_0018923 3300049591 Unclassified 4991
909 Ga0501076_0062813 3300049592 Bacteria 2958
910 Ga0501076_0276088 3300049592 Bacteria 1376
911 Ga0501077_0016382 3300049593 Unclassified 4670
912 Ga0501079_0087814 3300049741 Bacteria 2407
913 Ga0501079_0466482 3300049741 Bacteria 992
914 Ga0501079_1201143 3300049741 Unclassified 597
915 Ga0501080_0008657 3300049742 Bacteria 9239
916 Ga0501080_0077605 3300049742 Unclassified 3089
917 Ga0501080_0178197 3300049742 Bacteria 1957
918 Ga0501080_0200486 3300049742 Unclassified 1832
919 Ga0501081_0007373 3300049743 Bacteria 7137
920 Ga0501081_0237308 3300049743 Unclassified 1329
921 Ga0501083_0044409 3300049744 Bacteria 3008
922 Ga0501083_0116569 3300049744 Unclassified 1753
923 Ga0501035_0002291 3300049822 Bacteria 18921
924 Ga0501035_0005985 3300049822 Bacteria 11454
925 Ga0501044_0000245 3300049823 Bacteria 68850
926 Ga0501044_0013568 3300049823 Bacteria 8805
927 Ga0501044_0042338 3300049823 Bacteria 4737
928 Ga0501044_0060812 3300049823 Unclassified 3866
929 Ga0501045_0016582 3300049824 Bacteria 5234
930 Ga0501045_0141021 3300049824 Bacteria 1792
931 Ga0501045_0877046 3300049824 Bacteria 660
932 nmdc:mga0yw44_14103_c1 3300050492 Bacteria 4231
933 nmdc:mga05p37_199829_c1 3300050507 Bacteria 2422
934 nmdc:mga05p37_4622_c1 3300050507 Bacteria 16094
935 nmdc:mga05p37_5627_c1 3300050507 Bacteria 14726
936 nmdc:mga09592_116656_c1 3300050508 Bacteria 2291
937 nmdc:mga0qj67_97100_c1 3300050509 Unclassified 2372
938 nmdc:mga08y16_18505_c1 3300050511 Bacteria 7339
939 nmdc:mga08y16_253059_c1 3300050511 Bacteria 1820
940 nmdc:mga08y16_25_c1 3300050511 Bacteria 235789
941 nmdc:mga08y16_841979_c1 3300050511 Bacteria 907
942 nmdc:mga0n895_2250903_c1 3300050512 Unclassified 500
943 nmdc:mga0n895_464628_c1 3300050512 Bacteria 1277
944 nmdc:mga0n895_6510_c1 3300050512 Bacteria 9934
945 nmdc:mga0a205_14478_c1 3300050515 Bacteria 7357
946 nmdc:mga0a205_16127_c1 3300050515 Bacteria 6995
947 Ga0495601_0160063 3300053077 Bacteria 1471
948 Ga0495601_0356567 3300053077 Bacteria 951
949 Ga0495619_0533542 3300053085 Unclassified 806
950 Ga0500595_044920 3300053119 Bacteria 1398
951 Ga0500614_066252 3300053123 Bacteria 982
952 Ga0500559_0482121 3300053136 Unclassified 571
953 Ga0500568_0025482 3300053139 Bacteria 2495
954 Ga0500622_0279326 3300053156 Bacteria 720
955 Ga0500639_363859 3300053163 Unclassified 505
956 Ga0500637_0116320 3300053178 Bacteria 1551
957 Ga0501084_0001985 3300054114 Bacteria 16338
958 Ga0501084_0007266 3300054114 Bacteria 9128
959 Ga0501084_0812090 3300054114 Unclassified 787
960 Ga0501082_0001294 3300060353 Bacteria 21939
961 Ga0501082_0091161 3300060353 Bacteria 2632
962 Ga0501082_0170320 3300060353 Bacteria 1893
963 Ga0530510_0006290 3300061734 Bacteria 8264
964 Ga0530510_0221821 3300061734 Bacteria 1405

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005364 Ga0070673_102080628 Ga0070673_1020806282 103
2 3300005458 Ga0070681_10321470 Ga0070681_103214702 104
3 3300025912 Ga0207707_10275121 Ga0207707_102751212 104
4 3300031235 Ga0265330_10000051 Ga0265330_1000005157 104
5 3300031241 Ga0265325_10017468 Ga0265325_100174683 104
6 3300031344 Ga0265316_10000323 Ga0265316_1000032325 104
7 3300031344 Ga0265316_10257027 Ga0265316_102570272 104
8 3300005331 Ga0070670_100299315 Ga0070670_1002993153 105
9 3300005334 Ga0068869_100249480 Ga0068869_1002494802 105
10 3300005335 Ga0070666_10033093 Ga0070666_100330934 105
11 3300005336 Ga0070680_100506432 Ga0070680_1005064322 105
12 3300005336 Ga0070680_101243610 Ga0070680_1012436101 105
13 3300005337 Ga0070682_100645637 Ga0070682_1006456372 105
14 3300005337 Ga0070682_101230659 Ga0070682_1012306591 105
15 3300005338 Ga0068868_100355783 Ga0068868_1003557832 105
16 3300005338 Ga0068868_101901633 Ga0068868_1019016331 105
17 3300005339 Ga0070660_101094279 Ga0070660_1010942791 105
18 3300005340 Ga0070689_100777763 Ga0070689_1007777632 105
19 3300005341 Ga0070691_10759396 Ga0070691_107593962 105
20 3300005344 Ga0070661_100017202 Ga0070661_1000172023 105
21 3300005344 Ga0070661_100457969 Ga0070661_1004579692 105
22 3300005347 Ga0070668_100873713 Ga0070668_1008737132 105
23 3300005354 Ga0070675_100057218 Ga0070675_1000572182 105
24 3300005354 Ga0070675_101219367 Ga0070675_1012193672 105
25 3300005355 Ga0070671_100120360 Ga0070671_1001203602 105
26 3300005355 Ga0070671_100195242 Ga0070671_1001952422 105
27 3300005356 Ga0070674_100210809 Ga0070674_1002108093 105
28 3300005364 Ga0070673_100066369 Ga0070673_1000663693 105
29 3300005365 Ga0070688_100503498 Ga0070688_1005034982 105
30 3300005366 Ga0070659_100259758 Ga0070659_1002597582 105
31 3300005367 Ga0070667_100138748 Ga0070667_1001387483 105
32 3300005367 Ga0070667_100341335 Ga0070667_1003413351 105
33 3300005367 Ga0070667_100655223 Ga0070667_1006552232 105
34 3300005367 Ga0070667_101628835 Ga0070667_1016288352 105
35 3300005436 Ga0070713_100832444 Ga0070713_1008324442 105
36 3300005437 Ga0070710_10710368 Ga0070710_107103681 105
37 3300005439 Ga0070711_100000034 Ga0070711_10000003489 105
38 3300005455 Ga0070663_101323533 Ga0070663_1013235332 105
39 3300005456 Ga0070678_100146613 Ga0070678_1001466132 105
40 3300005456 Ga0070678_100297867 Ga0070678_1002978672 105
41 3300005456 Ga0070678_100921623 Ga0070678_1009216231 105
42 3300005457 Ga0070662_100246788 Ga0070662_1002467882 105
43 3300005458 Ga0070681_10225312 Ga0070681_102253122 105
44 3300005458 Ga0070681_10793512 Ga0070681_107935121 105
45 3300005459 Ga0068867_100023104 Ga0068867_1000231044 105
46 3300005466 Ga0070685_10218311 Ga0070685_102183111 105
47 3300005530 Ga0070679_100265620 Ga0070679_1002656201 105
48 3300005530 Ga0070679_101037253 Ga0070679_1010372531 105
49 3300005530 Ga0070679_101634845 Ga0070679_1016348451 105
50 3300005535 Ga0070684_100122765 Ga0070684_1001227653 105
51 3300005535 Ga0070684_100783566 Ga0070684_1007835662 105
52 3300005539 Ga0068853_100012063 Ga0068853_1000120632 105
53 3300005539 Ga0068853_100012521 Ga0068853_1000125217 105
54 3300005539 Ga0068853_100116728 Ga0068853_1001167282 105
55 3300005543 Ga0070672_100024871 Ga0070672_1000248715 105
56 3300005544 Ga0070686_100272503 Ga0070686_1002725033 105
57 3300005547 Ga0070693_100007674 Ga0070693_1000076746 105
58 3300005547 Ga0070693_100739856 Ga0070693_1007398562 105
59 3300005548 Ga0070665_100665322 Ga0070665_1006653222 105
60 3300005563 Ga0068855_100327140 Ga0068855_1003271402 105
61 3300005577 Ga0068857_100042068 Ga0068857_1000420683 105
62 3300005578 Ga0068854_101134136 Ga0068854_1011341362 105
63 3300005614 Ga0068856_100039095 Ga0068856_1000390953 105
64 3300005614 Ga0068856_100089561 Ga0068856_1000895613 105
65 3300005616 Ga0068852_100314248 Ga0068852_1003142483 105
66 3300005616 Ga0068852_101066879 Ga0068852_1010668791 105
67 3300005616 Ga0068852_101206836 Ga0068852_1012068362 105
68 3300005617 Ga0068859_100619623 Ga0068859_1006196232 105
69 3300005617 Ga0068859_100624571 Ga0068859_1006245712 105
70 3300005718 Ga0068866_10385685 Ga0068866_103856852 105
71 3300005834 Ga0068851_10084221 Ga0068851_100842212 105
72 3300005841 Ga0068863_100038650 Ga0068863_1000386505 105
73 3300005841 Ga0068863_100139898 Ga0068863_1001398983 105
74 3300005841 Ga0068863_100231180 Ga0068863_1002311802 105
75 3300005842 Ga0068858_100142832 Ga0068858_1001428321 105
76 3300005842 Ga0068858_100199400 Ga0068858_1001994004 105
77 3300005843 Ga0068860_100024709 Ga0068860_1000247092 105
78 3300005844 Ga0068862_100517306 Ga0068862_1005173063 105
79 3300006173 Ga0070716_100244523 Ga0070716_1002445232 105
80 3300006237 Ga0097621_100011887 Ga0097621_1000118874 105
81 3300006237 Ga0097621_100016353 Ga0097621_1000163532 105
82 3300006358 Ga0068871_100039347 Ga0068871_1000393472 105
83 3300006358 Ga0068871_100136777 Ga0068871_1001367772 105
84 3300006358 Ga0068871_100197298 Ga0068871_1001972982 105
85 3300006844 Ga0075428_100157590 Ga0075428_1001575903 105
86 3300006846 Ga0075430_100131173 Ga0075430_1001311732 105
87 3300006847 Ga0075431_100255474 Ga0075431_1002554742 105
88 3300006847 Ga0075431_100366964 Ga0075431_1003669641 105
89 3300006871 Ga0075434_100150670 Ga0075434_1001506701 105
90 3300006880 Ga0075429_100091566 Ga0075429_1000915663 105
91 3300006881 Ga0068865_100002579 Ga0068865_1000025794 105
92 3300006881 Ga0068865_100029325 Ga0068865_1000293253 105
93 3300006881 Ga0068865_100070439 Ga0068865_1000704392 105
94 3300006881 Ga0068865_100152186 Ga0068865_1001521862 105
95 3300006931 Ga0097620_100619708 Ga0097620_1006197082 105
96 3300006931 Ga0097620_100624583 Ga0097620_1006245832 105
97 3300009011 Ga0105251_10325794 Ga0105251_103257942 105
98 3300009093 Ga0105240_10264741 Ga0105240_102647411 105
99 3300009094 Ga0111539_10092584 Ga0111539_100925844 105
100 3300009098 Ga0105245_10538622 Ga0105245_105386222 105
101 3300009098 Ga0105245_10725818 Ga0105245_107258182 105
102 3300009148 Ga0105243_10338676 Ga0105243_103386762 105
103 3300009174 Ga0105241_10012309 Ga0105241_1001230910 105
104 3300009174 Ga0105241_11414968 Ga0105241_114149682 105
105 3300009176 Ga0105242_10005186 Ga0105242_100051867 105
106 3300009176 Ga0105242_10321088 Ga0105242_103210883 105
107 3300009177 Ga0105248_10079800 Ga0105248_100798005 105
108 3300009545 Ga0105237_10228044 Ga0105237_102280443 105
109 3300009551 Ga0105238_10024332 Ga0105238_1002433210 105
110 3300009551 Ga0105238_10548458 Ga0105238_105484582 105
111 3300009551 Ga0105238_12389179 Ga0105238_123891791 105
112 3300009553 Ga0105249_10064664 Ga0105249_100646642 105
113 3300009553 Ga0105249_10897032 Ga0105249_108970322 105
114 3300009553 Ga0105249_11024298 Ga0105249_110242982 105
115 3300009553 Ga0105249_11344408 Ga0105249_113444082 105
116 3300010375 Ga0105239_10302478 Ga0105239_103024783 105
117 3300011119 Ga0105246_10762317 Ga0105246_107623172 105
118 3300012498 Ga0157345_1020075 Ga0157345_10200751 105
119 3300013100 Ga0157373_10341878 Ga0157373_103418782 105
120 3300013104 Ga0157370_10095615 Ga0157370_100956152 105
121 3300013104 Ga0157370_11209936 Ga0157370_112099362 105
122 3300013105 Ga0157369_10010475 Ga0157369_1001047512 105
123 3300013105 Ga0157369_10386305 Ga0157369_103863052 105
124 3300013296 Ga0157374_10090156 Ga0157374_100901563 105
125 3300013296 Ga0157374_10325062 Ga0157374_103250622 105
126 3300013297 Ga0157378_11506639 Ga0157378_115066392 105
127 3300013306 Ga0163162_10008586 Ga0163162_100085868 105
128 3300013306 Ga0163162_10012175 Ga0163162_100121755 105
129 3300013306 Ga0163162_10012584 Ga0163162_100125847 105
130 3300013306 Ga0163162_10393368 Ga0163162_103933682 105
131 3300013306 Ga0163162_10436571 Ga0163162_104365712 105
132 3300013306 Ga0163162_11950046 Ga0163162_119500461 105
133 3300013306 Ga0163162_13104526 Ga0163162_131045261 105
134 3300013307 Ga0157372_10016904 Ga0157372_100169043 105
135 3300013307 Ga0157372_10039046 Ga0157372_100390463 105
136 3300013308 Ga0157375_10001545 Ga0157375_100015459 105
137 3300013308 Ga0157375_10008862 Ga0157375_100088629 105
138 3300013308 Ga0157375_10592075 Ga0157375_105920753 105
139 3300013308 Ga0157375_11855447 Ga0157375_118554472 105
140 3300013308 Ga0157375_11982413 Ga0157375_119824132 105
141 3300014325 Ga0163163_10904850 Ga0163163_109048502 105
142 3300014325 Ga0163163_11362200 Ga0163163_113622002 105
143 3300014325 Ga0163163_11897706 Ga0163163_118977061 105
144 3300014326 Ga0157380_11953778 Ga0157380_119537781 105
145 3300014497 Ga0182008_10035121 Ga0182008_100351213 105
146 3300014745 Ga0157377_10700305 Ga0157377_107003052 105
147 3300014968 Ga0157379_10267847 Ga0157379_102678471 105
148 3300014968 Ga0157379_10877181 Ga0157379_108771812 105
149 3300014968 Ga0157379_11266050 Ga0157379_112660502 105
150 3300014968 Ga0157379_12445070 Ga0157379_124450702 105
151 3300014969 Ga0157376_10001440 Ga0157376_1000144010 105
152 3300014969 Ga0157376_10003448 Ga0157376_100034482 105
153 3300014969 Ga0157376_10136478 Ga0157376_101364784 105
154 3300014969 Ga0157376_10276977 Ga0157376_102769772 105
155 3300014969 Ga0157376_11786839 Ga0157376_117868391 105
156 3300017792 Ga0163161_10293506 Ga0163161_102935062 105
157 3300017792 Ga0163161_10344345 Ga0163161_103443453 105
158 3300025315 Ga0207697_10417204 Ga0207697_104172041 105
159 3300025321 Ga0207656_10063405 Ga0207656_100634052 105
160 3300025899 Ga0207642_10106813 Ga0207642_101068132 105
161 3300025904 Ga0207647_10000547 Ga0207647_1000054724 105
162 3300025912 Ga0207707_10232313 Ga0207707_102323132 105
163 3300025912 Ga0207707_10635348 Ga0207707_106353482 105
164 3300025913 Ga0207695_10380344 Ga0207695_103803442 105
165 3300025914 Ga0207671_10823447 Ga0207671_108234472 105
166 3300025916 Ga0207663_10000002 Ga0207663_10000002277 105
167 3300025916 Ga0207663_10164244 Ga0207663_101642442 105
168 3300025919 Ga0207657_10008520 Ga0207657_100085209 105
169 3300025920 Ga0207649_10350558 Ga0207649_103505582 105
170 3300025921 Ga0207652_10084122 Ga0207652_100841222 105
171 3300025921 Ga0207652_10245743 Ga0207652_102457432 105
172 3300025924 Ga0207694_10217497 Ga0207694_102174972 105
173 3300025925 Ga0207650_10420629 Ga0207650_104206292 105
174 3300025926 Ga0207659_10312122 Ga0207659_103121222 105
175 3300025926 Ga0207659_10393558 Ga0207659_103935582 105
176 3300025928 Ga0207700_10946942 Ga0207700_109469422 105
177 3300025931 Ga0207644_10037727 Ga0207644_100377275 105
178 3300025931 Ga0207644_10711806 Ga0207644_107118061 105
179 3300025931 Ga0207644_10994791 Ga0207644_109947911 105
180 3300025932 Ga0207690_10006797 Ga0207690_1000679710 105
181 3300025933 Ga0207706_10216529 Ga0207706_102165292 105
182 3300025934 Ga0207686_10027013 Ga0207686_100270132 105
183 3300025934 Ga0207686_10147597 Ga0207686_101475973 105
184 3300025935 Ga0207709_10639489 Ga0207709_106394892 105
185 3300025937 Ga0207669_10148573 Ga0207669_101485733 105
186 3300025938 Ga0207704_10046495 Ga0207704_100464952 105
187 3300025938 Ga0207704_10057420 Ga0207704_100574202 105
188 3300025938 Ga0207704_10202730 Ga0207704_102027302 105
189 3300025938 Ga0207704_10466918 Ga0207704_104669181 105
190 3300025939 Ga0207665_10289987 Ga0207665_102899872 105
191 3300025940 Ga0207691_10033677 Ga0207691_100336775 105
192 3300025941 Ga0207711_10058759 Ga0207711_100587595 105
193 3300025942 Ga0207689_10116757 Ga0207689_101167573 105
194 3300025942 Ga0207689_10509175 Ga0207689_105091752 105
195 3300025944 Ga0207661_10124396 Ga0207661_101243962 105
196 3300025949 Ga0207667_10062259 Ga0207667_100622592 105
197 3300025949 Ga0207667_10781852 Ga0207667_107818522 105
198 3300025960 Ga0207651_10066552 Ga0207651_100665522 105
199 3300025961 Ga0207712_10517630 Ga0207712_105176302 105
200 3300025961 Ga0207712_10772103 Ga0207712_107721032 105
201 3300025972 Ga0207668_11184262 Ga0207668_111842621 105
202 3300025981 Ga0207640_11164046 Ga0207640_111640462 105
203 3300025986 Ga0207658_10147234 Ga0207658_101472342 105
204 3300025986 Ga0207658_10819908 Ga0207658_108199081 105
205 3300025986 Ga0207658_11056192 Ga0207658_110561921 105
206 3300026023 Ga0207677_11042532 Ga0207677_110425322 105
207 3300026035 Ga0207703_10468844 Ga0207703_104688442 105
208 3300026035 Ga0207703_10856925 Ga0207703_108569252 105
209 3300026041 Ga0207639_10046521 Ga0207639_100465213 105
210 3300026041 Ga0207639_10298030 Ga0207639_102980302 105
211 3300026041 Ga0207639_10594021 Ga0207639_105940212 105
212 3300026067 Ga0207678_10906896 Ga0207678_109068962 105
213 3300026078 Ga0207702_10148597 Ga0207702_101485972 105
214 3300026088 Ga0207641_10054112 Ga0207641_100541122 105
215 3300026088 Ga0207641_10280731 Ga0207641_102807313 105
216 3300026088 Ga0207641_10551168 Ga0207641_105511682 105
217 3300026088 Ga0207641_11230550 Ga0207641_112305502 105
218 3300026089 Ga0207648_10008756 Ga0207648_100087563 105
219 3300026095 Ga0207676_10220274 Ga0207676_102202741 105
220 3300026095 Ga0207676_10536569 Ga0207676_105365692 105
221 3300026116 Ga0207674_10003167 Ga0207674_1000316718 105
222 3300026121 Ga0207683_10001251 Ga0207683_100012513 105
223 3300026121 Ga0207683_10272937 Ga0207683_102729372 105
224 3300026121 Ga0207683_10847248 Ga0207683_108472482 105
225 3300026142 Ga0207698_10344366 Ga0207698_103443663 105
226 3300027876 Ga0209974_10006568 Ga0209974_100065681 105
227 3300028379 Ga0268266_10649084 Ga0268266_106490842 105
228 3300028380 Ga0268265_10184475 Ga0268265_101844752 105
229 3300028380 Ga0268265_10352273 Ga0268265_103522732 105
230 3300028381 Ga0268264_10022619 Ga0268264_100226199 105
231 3300028381 Ga0268264_12666906 Ga0268264_126669062 105
232 3300031241 Ga0265325_10476340 Ga0265325_104763402 105
233 3300031824 Ga0307413_11455888 Ga0307413_114558881 105
234 3300035089 Ga0373944_0136029 Ga0373944_0136029_104_439 105
235 3300035691 Ga0373931_1116398 Ga0373931_1116398_133_468 105
236 3300035692 Ga0373935_0579610 Ga0373935_0579610_432_767 105
237 3300037068 Ga0373925_0731168 Ga0373925_0731168_254_589 105
238 3300041408 Ga0439453_0129000 Ga0439453_0129000_135_452 105
239 3300041443 Ga0451789_1098755 Ga0451789_1098755_284_607 105
240 3300042123 Ga0450921_000557 Ga0450921_000557_111_428 105
241 3300042126 Ga0450888_026066 Ga0450888_026066_35_352 105
242 3300042436 Ga0439435_0000415 Ga0439435_0000415_455_772 105
243 3300042436 Ga0439435_0061637 Ga0439435_0061637_417_734 105
244 3300042437 Ga0439444_0002121 Ga0439444_0002121_2009_2326 105
245 3300042532 Ga0450893_0030716 Ga0450893_0030716_39_356 105
246 3300042876 Ga0451577_0126672 Ga0451577_0126672_1713_2030 105
247 3300044712 Ga0453684_0072992 Ga0453684_0072992_1965_2282 105
248 3300044712 Ga0453684_0359331 Ga0453684_0359331_114_431 105
249 3300045051 Ga0451576_0014826 Ga0451576_0014826_7816_8133 105
250 3300046473 Ga0495582_0084677 Ga0495582_0084677_439_774 105
251 3300046475 Ga0495639_0038859 Ga0495639_0038859_94_429 105
252 3300046531 Ga0495665_0060046 Ga0495665_0060046_1567_1902 105
253 3300046535 Ga0495586_0351726 Ga0495586_0351726_123_458 105
254 3300046543 Ga0495645_0202844 Ga0495645_0202844_738_1073 105
255 3300046663 Ga0495635_0202318 Ga0495635_0202318_533_868 105
256 3300046675 Ga0495657_0067720 Ga0495657_0067720_1881_2216 105
257 3300046681 Ga0495647_0083367 Ga0495647_0083367_800_1135 105
258 3300046683 Ga0495658_0013257 Ga0495658_0013257_635_970 105
259 3300046689 Ga0495613_0537265 Ga0495613_0537265_319_654 105
260 3300047471 Ga0495684_0441291 Ga0495684_0441291_10_345 105
261 3300047673 Ga0495593_0167932 Ga0495593_0167932_541_876 105
262 3300048089 Ga0495614_0413916 Ga0495614_0413916_122_457 105
263 3300048907 Ga0496104_0000038 Ga0496104_0000038_172233_172568 105
264 3300048908 Ga0496105_0000038 Ga0496105_0000038_5543_5878 105
265 3300048917 Ga0496114_0744754 Ga0496114_0744754_162_497 105
266 3300049569 Ga0501032_0248686 Ga0501032_0248686_231_557 105
267 3300049570 Ga0501033_0706233 Ga0501033_0706233_111_428 105
268 3300049571 Ga0501034_0003074 Ga0501034_0003074_11473_11799 105
269 3300049571 Ga0501034_0006567 Ga0501034_0006567_5272_5598 105
270 3300049571 Ga0501034_0019047 Ga0501034_0019047_394_720 105
271 3300049572 Ga0501036_0019542 Ga0501036_0019542_4924_5241 105
272 3300049572 Ga0501036_0096727 Ga0501036_0096727_41_367 105
273 3300049573 Ga0501037_0813060 Ga0501037_0813060_235_561 105
274 3300049574 Ga0501038_0108297 Ga0501038_0108297_1228_1554 105
275 3300049574 Ga0501038_0628221 Ga0501038_0628221_238_555 105
276 3300049575 Ga0501039_0295614 Ga0501039_0295614_606_923 105
277 3300049576 Ga0501040_0004831 Ga0501040_0004831_3134_3451 105
278 3300049576 Ga0501040_0862451 Ga0501040_0862451_21_347 105
279 3300049577 Ga0501041_0001803 Ga0501041_0001803_5246_5563 105
280 3300049578 Ga0501042_0027262 Ga0501042_0027262_1350_1667 105
281 3300049579 Ga0501043_0040939 Ga0501043_0040939_2859_3185 105
282 3300049580 Ga0501046_0046848 Ga0501046_0046848_2446_2772 105
283 3300049581 Ga0501047_0001606 Ga0501047_0001606_8731_9057 105
284 3300049581 Ga0501047_0551888 Ga0501047_0551888_475_801 105
285 3300049582 Ga0501048_0207703 Ga0501048_0207703_739_1065 105
286 3300049586 Ga0501070_0006414 Ga0501070_0006414_2144_2470 105
287 3300049586 Ga0501070_0013617 Ga0501070_0013617_5658_5984 105
288 3300049586 Ga0501070_0057235 Ga0501070_0057235_1211_1537 105
289 3300049587 Ga0501071_0007915 Ga0501071_0007915_3041_3358 105
290 3300049588 Ga0501072_0004526 Ga0501072_0004526_8362_8688 105
291 3300049588 Ga0501072_0060387 Ga0501072_0060387_524_841 105
292 3300049589 Ga0501073_0008464 Ga0501073_0008464_4228_4554 105
293 3300049589 Ga0501073_0071909 Ga0501073_0071909_111_437 105
294 3300049589 Ga0501073_0107679 Ga0501073_0107679_303_626 105
295 3300049590 Ga0501074_0018167 Ga0501074_0018167_4579_4905 105
296 3300049590 Ga0501074_0050646 Ga0501074_0050646_2029_2346 105
297 3300049590 Ga0501074_0156580 Ga0501074_0156580_811_1137 105
298 3300049590 Ga0501074_0181701 Ga0501074_0181701_917_1243 105
299 3300049591 Ga0501075_0018923 Ga0501075_0018923_534_851 105
300 3300049592 Ga0501076_0062813 Ga0501076_0062813_466_783 105
301 3300049593 Ga0501077_0016382 Ga0501077_0016382_2390_2707 105
302 3300049741 Ga0501079_0087814 Ga0501079_0087814_328_645 105
303 3300049741 Ga0501079_1201143 Ga0501079_1201143_200_517 105
304 3300049742 Ga0501080_0008657 Ga0501080_0008657_2920_3246 105
305 3300049742 Ga0501080_0077605 Ga0501080_0077605_146_472 105
306 3300049742 Ga0501080_0178197 Ga0501080_0178197_66_383 105
307 3300049743 Ga0501081_0007373 Ga0501081_0007373_1735_2052 105
308 3300049744 Ga0501083_0044409 Ga0501083_0044409_2110_2436 105
309 3300049823 Ga0501044_0042338 Ga0501044_0042338_2933_3259 105
310 3300049823 Ga0501044_0060812 Ga0501044_0060812_3129_3455 105
311 3300049824 Ga0501045_0016582 Ga0501045_0016582_4261_4578 105
312 3300050511 nmdc:mga08y16_253059_c1 nmdc:mga08y16_253059_c1_673_990 105
313 3300050512 nmdc:mga0n895_464628_c1 nmdc:mga0n895_464628_c1_346_681 105
314 3300053077 Ga0495601_0160063 Ga0495601_0160063_693_1028 105
315 3300053085 Ga0495619_0533542 Ga0495619_0533542_113_448 105
316 3300053123 Ga0500614_066252 Ga0500614_066252_77_412 105
317 3300054114 Ga0501084_0007266 Ga0501084_0007266_440_757 105
318 3300054114 Ga0501084_0812090 Ga0501084_0812090_303_629 105
319 3300060353 Ga0501082_0001294 Ga0501082_0001294_539_856 105
320 3300060353 Ga0501082_0091161 Ga0501082_0091161_2040_2366 105
321 3300061734 Ga0530510_0006290 Ga0530510_0006290_1950_2267 105
322 3300005458 Ga0070681_10013079 Ga0070681_1001307913 106
323 3300005458 Ga0070681_10146165 Ga0070681_101461653 106
324 3300005530 Ga0070679_100020411 Ga0070679_1000204114 106
325 3300005530 Ga0070679_100044245 Ga0070679_1000442453 106
326 3300005563 Ga0068855_100140430 Ga0068855_1001404303 106
327 3300005563 Ga0068855_100282700 Ga0068855_1002827003 106
328 3300006042 Ga0075368_10245610 Ga0075368_102456102 106
329 3300006844 Ga0075428_100000574 Ga0075428_1000005748 106
330 3300006880 Ga0075429_100082854 Ga0075429_1000828544 106
331 3300009093 Ga0105240_10540088 Ga0105240_105400882 106
332 3300009094 Ga0111539_10000811 Ga0111539_1000081119 106
333 3300009148 Ga0105243_11243149 Ga0105243_112431492 106
334 3300013308 Ga0157375_12429222 Ga0157375_124292222 106
335 3300025912 Ga0207707_10000021 Ga0207707_1000002126 106
336 3300025912 Ga0207707_10908107 Ga0207707_109081071 106
337 3300025921 Ga0207652_10124678 Ga0207652_101246781 106
338 3300025921 Ga0207652_10668381 Ga0207652_106683813 106
339 3300025949 Ga0207667_10793616 Ga0207667_107936163 106
340 3300027907 Ga0207428_10000195 Ga0207428_1000019522 106
341 3300028800 Ga0265338_10462021 Ga0265338_104620212 106
342 3300031548 Ga0307408_101251676 Ga0307408_1012516762 106
343 3300031824 Ga0307413_10675967 Ga0307413_106759672 106
344 3300032002 Ga0307416_100119838 Ga0307416_1001198384 106
345 3300042436 Ga0439435_0068856 Ga0439435_0068856_440_775 106
346 3300049568 Ga0501031_0675619 Ga0501031_0675619_279_629 106
347 3300049569 Ga0501032_0317876 Ga0501032_0317876_240_590 106
348 3300049588 Ga0501072_0332576 Ga0501072_0332576_747_1097 106
349 3300049592 Ga0501076_0276088 Ga0501076_0276088_110_460 106
350 3300049741 Ga0501079_0466482 Ga0501079_0466482_268_618 106
351 3300049743 Ga0501081_0237308 Ga0501081_0237308_200_550 106
352 3300049824 Ga0501045_0141021 Ga0501045_0141021_529_879 106
353 3300050508 nmdc:mga09592_116656_c1 nmdc:mga09592_116656_c1_1400_1735 106
354 3300050509 nmdc:mga0qj67_97100_c1 nmdc:mga0qj67_97100_c1_522_857 106
355 3300050511 nmdc:mga08y16_25_c1 nmdc:mga08y16_25_c1_158209_158544 106
356 3300054114 Ga0501084_0001985 Ga0501084_0001985_12277_12606 106
357 3300060353 Ga0501082_0170320 Ga0501082_0170320_463_813 106
358 3300061734 Ga0530510_0221821 Ga0530510_0221821_356_706 106
359 3300003320 rootH2_10000244 rootH2_10000244182 107
360 3300003320 rootH2_10023934 rootH2_1002393410 107
361 3300003322 rootL2_10196664 rootL2_101966642 107
362 3300003323 rootH1_10020346 rootH1_100203461 107
363 3300003323 rootH1_10060084 rootH1_100600845 107
364 3300003323 rootH1_10112671 rootH1_101126713 107
365 3300005277 Ga0065716_1014350 Ga0065716_10143502 107
366 3300005289 Ga0065704_10149850 Ga0065704_101498502 107
367 3300005289 Ga0065704_10755470 Ga0065704_107554702 107
368 3300005293 Ga0065715_10280599 Ga0065715_102805992 107
369 3300005293 Ga0065715_10572473 Ga0065715_105724731 107
370 3300005293 Ga0065715_10597242 Ga0065715_105972422 107
371 3300005293 Ga0065715_10719566 Ga0065715_107195661 107
372 3300005293 Ga0065715_10763246 Ga0065715_107632461 107
373 3300005295 Ga0065707_10001068 Ga0065707_100010688 107
374 3300005295 Ga0065707_10015406 Ga0065707_100154063 107
375 3300005295 Ga0065707_10185580 Ga0065707_101855802 107
376 3300005295 Ga0065707_10633634 Ga0065707_106336342 107
377 3300005295 Ga0065707_10914318 Ga0065707_109143182 107
378 3300005328 Ga0070676_10266597 Ga0070676_102665972 107
379 3300005328 Ga0070676_10499738 Ga0070676_104997382 107
380 3300005329 Ga0070683_100033834 Ga0070683_1000338342 107
381 3300005330 Ga0070690_100004892 Ga0070690_1000048926 107
382 3300005330 Ga0070690_100428415 Ga0070690_1004284152 107
383 3300005331 Ga0070670_100003854 Ga0070670_1000038549 107
384 3300005331 Ga0070670_100018306 Ga0070670_1000183065 107
385 3300005334 Ga0068869_101658879 Ga0068869_1016588791 107
386 3300005334 Ga0068869_101767144 Ga0068869_1017671441 107
387 3300005335 Ga0070666_10006236 Ga0070666_100062362 107
388 3300005335 Ga0070666_10006373 Ga0070666_100063732 107
389 3300005336 Ga0070680_100039578 Ga0070680_1000395784 107
390 3300005336 Ga0070680_100301662 Ga0070680_1003016623 107
391 3300005337 Ga0070682_100275948 Ga0070682_1002759482 107
392 3300005338 Ga0068868_100004281 Ga0068868_1000042818 107
393 3300005338 Ga0068868_100154019 Ga0068868_1001540193 107
394 3300005338 Ga0068868_100748278 Ga0068868_1007482781 107
395 3300005338 Ga0068868_101030630 Ga0068868_1010306301 107
396 3300005340 Ga0070689_100290041 Ga0070689_1002900411 107
397 3300005340 Ga0070689_100609939 Ga0070689_1006099392 107
398 3300005341 Ga0070691_10227083 Ga0070691_102270832 107
399 3300005343 Ga0070687_100046546 Ga0070687_1000465462 107
400 3300005344 Ga0070661_100225900 Ga0070661_1002259002 107
401 3300005347 Ga0070668_102085394 Ga0070668_1020853941 107
402 3300005353 Ga0070669_100105297 Ga0070669_1001052973 107
403 3300005353 Ga0070669_100183311 Ga0070669_1001833112 107
404 3300005353 Ga0070669_100940671 Ga0070669_1009406712 107
405 3300005353 Ga0070669_101389514 Ga0070669_1013895142 107
406 3300005354 Ga0070675_100429850 Ga0070675_1004298502 107
407 3300005354 Ga0070675_101290714 Ga0070675_1012907142 107
408 3300005355 Ga0070671_100147903 Ga0070671_1001479032 107
409 3300005355 Ga0070671_100187945 Ga0070671_1001879452 107
410 3300005355 Ga0070671_100589699 Ga0070671_1005896992 107
411 3300005356 Ga0070674_100148600 Ga0070674_1001486002 107
412 3300005356 Ga0070674_100285170 Ga0070674_1002851702 107
413 3300005356 Ga0070674_100398185 Ga0070674_1003981852 107
414 3300005356 Ga0070674_100887973 Ga0070674_1008879731 107
415 3300005356 Ga0070674_101140347 Ga0070674_1011403472 107
416 3300005364 Ga0070673_100053464 Ga0070673_1000534642 107
417 3300005364 Ga0070673_100172803 Ga0070673_1001728034 107
418 3300005365 Ga0070688_100791409 Ga0070688_1007914091 107
419 3300005367 Ga0070667_100001051 Ga0070667_10000105117 107
420 3300005367 Ga0070667_100006417 Ga0070667_10000641710 107
421 3300005367 Ga0070667_100128514 Ga0070667_1001285142 107
422 3300005435 Ga0070714_100626221 Ga0070714_1006262211 107
423 3300005436 Ga0070713_100858290 Ga0070713_1008582902 107
424 3300005436 Ga0070713_101282997 Ga0070713_1012829972 107
425 3300005439 Ga0070711_101281959 Ga0070711_1012819592 107
426 3300005440 Ga0070705_100486604 Ga0070705_1004866042 107
427 3300005440 Ga0070705_101348026 Ga0070705_1013480262 107
428 3300005440 Ga0070705_101448893 Ga0070705_1014488931 107
429 3300005441 Ga0070700_100485934 Ga0070700_1004859342 107
430 3300005441 Ga0070700_100545334 Ga0070700_1005453342 107
431 3300005444 Ga0070694_101254484 Ga0070694_1012544841 107
432 3300005444 Ga0070694_101565399 Ga0070694_1015653991 107
433 3300005445 Ga0070708_102060234 Ga0070708_1020602341 107
434 3300005456 Ga0070678_100274857 Ga0070678_1002748572 107
435 3300005456 Ga0070678_100569943 Ga0070678_1005699432 107
436 3300005456 Ga0070678_100807793 Ga0070678_1008077931 107
437 3300005456 Ga0070678_100876573 Ga0070678_1008765731 107
438 3300005457 Ga0070662_100974513 Ga0070662_1009745132 107
439 3300005458 Ga0070681_10000277 Ga0070681_1000027728 107
440 3300005458 Ga0070681_10509578 Ga0070681_105095781 107
441 3300005459 Ga0068867_100920797 Ga0068867_1009207972 107
442 3300005459 Ga0068867_100935396 Ga0068867_1009353961 107
443 3300005459 Ga0068867_102023105 Ga0068867_1020231051 107
444 3300005466 Ga0070685_10258809 Ga0070685_102588092 107
445 3300005468 Ga0070707_100150543 Ga0070707_1001505432 107
446 3300005468 Ga0070707_100459353 Ga0070707_1004593531 107
447 3300005471 Ga0070698_101156672 Ga0070698_1011566721 107
448 3300005530 Ga0070679_100123695 Ga0070679_1001236953 107
449 3300005530 Ga0070679_100596242 Ga0070679_1005962421 107
450 3300005530 Ga0070679_100815721 Ga0070679_1008157211 107
451 3300005535 Ga0070684_100004819 Ga0070684_10000481913 107
452 3300005535 Ga0070684_100097126 Ga0070684_1000971262 107
453 3300005543 Ga0070672_100007574 Ga0070672_1000075746 107
454 3300005543 Ga0070672_100710995 Ga0070672_1007109951 107
455 3300005544 Ga0070686_100013755 Ga0070686_1000137552 107
456 3300005544 Ga0070686_100204295 Ga0070686_1002042952 107
457 3300005544 Ga0070686_101947409 Ga0070686_1019474092 107
458 3300005545 Ga0070695_101035505 Ga0070695_1010355052 107
459 3300005545 Ga0070695_101124633 Ga0070695_1011246332 107
460 3300005546 Ga0070696_100680782 Ga0070696_1006807821 107
461 3300005548 Ga0070665_100002424 Ga0070665_1000024243 107
462 3300005548 Ga0070665_102252951 Ga0070665_1022529511 107
463 3300005549 Ga0070704_100457338 Ga0070704_1004573382 107
464 3300005563 Ga0068855_100741520 Ga0068855_1007415202 107
465 3300005564 Ga0070664_100037509 Ga0070664_1000375094 107
466 3300005564 Ga0070664_100080692 Ga0070664_1000806922 107
467 3300005564 Ga0070664_100720420 Ga0070664_1007204202 107
468 3300005564 Ga0070664_102288591 Ga0070664_1022885911 107
469 3300005577 Ga0068857_100009726 Ga0068857_10000972611 107
470 3300005577 Ga0068857_101375990 Ga0068857_1013759902 107
471 3300005578 Ga0068854_100494337 Ga0068854_1004943372 107
472 3300005578 Ga0068854_101328548 Ga0068854_1013285482 107
473 3300005614 Ga0068856_100000001 Ga0068856_100000001187 107
474 3300005614 Ga0068856_100460069 Ga0068856_1004600693 107
475 3300005614 Ga0068856_102371587 Ga0068856_1023715871 107
476 3300005615 Ga0070702_100147511 Ga0070702_1001475112 107
477 3300005616 Ga0068852_101831934 Ga0068852_1018319342 107
478 3300005617 Ga0068859_100063322 Ga0068859_1000633222 107
479 3300005617 Ga0068859_100118199 Ga0068859_1001181991 107
480 3300005617 Ga0068859_100136174 Ga0068859_1001361742 107
481 3300005617 Ga0068859_100511565 Ga0068859_1005115652 107
482 3300005617 Ga0068859_101039449 Ga0068859_1010394491 107
483 3300005617 Ga0068859_101125852 Ga0068859_1011258522 107
484 3300005617 Ga0068859_101662287 Ga0068859_1016622871 107
485 3300005617 Ga0068859_102725635 Ga0068859_1027256351 107
486 3300005618 Ga0068864_100009805 Ga0068864_1000098056 107
487 3300005618 Ga0068864_100100119 Ga0068864_1001001192 107
488 3300005618 Ga0068864_100401574 Ga0068864_1004015742 107
489 3300005618 Ga0068864_101233103 Ga0068864_1012331032 107
490 3300005618 Ga0068864_102519451 Ga0068864_1025194512 107
491 3300005719 Ga0068861_101017335 Ga0068861_1010173352 107
492 3300005840 Ga0068870_10137638 Ga0068870_101376383 107
493 3300005840 Ga0068870_10672591 Ga0068870_106725912 107
494 3300005841 Ga0068863_100000665 Ga0068863_1000006657 107
495 3300005841 Ga0068863_100018390 Ga0068863_1000183904 107
496 3300005841 Ga0068863_100091145 Ga0068863_1000911454 107
497 3300005841 Ga0068863_100107190 Ga0068863_1001071904 107
498 3300005841 Ga0068863_100311563 Ga0068863_1003115632 107
499 3300005842 Ga0068858_100008434 Ga0068858_1000084346 107
500 3300005842 Ga0068858_100114498 Ga0068858_1001144984 107
501 3300005842 Ga0068858_100741555 Ga0068858_1007415552 107
502 3300005842 Ga0068858_101433318 Ga0068858_1014333181 107
503 3300005842 Ga0068858_101718545 Ga0068858_1017185452 107
504 3300005843 Ga0068860_100129405 Ga0068860_1001294052 107
505 3300005843 Ga0068860_100183298 Ga0068860_1001832982 107
506 3300005843 Ga0068860_100328041 Ga0068860_1003280412 107
507 3300005843 Ga0068860_101185949 Ga0068860_1011859491 107
508 3300005844 Ga0068862_100024578 Ga0068862_1000245785 107
509 3300005844 Ga0068862_100192101 Ga0068862_1001921012 107
510 3300005937 Ga0081455_10024812 Ga0081455_100248122 107
511 3300005937 Ga0081455_10433448 Ga0081455_104334481 107
512 3300006042 Ga0075368_10162061 Ga0075368_101620612 107
513 3300006051 Ga0075364_10026629 Ga0075364_100266294 107
514 3300006051 Ga0075364_10038708 Ga0075364_100387084 107
515 3300006058 Ga0075432_10133411 Ga0075432_101334112 107
516 3300006173 Ga0070716_100229622 Ga0070716_1002296222 107
517 3300006237 Ga0097621_100051013 Ga0097621_1000510132 107
518 3300006237 Ga0097621_100129336 Ga0097621_1001293362 107
519 3300006237 Ga0097621_100195492 Ga0097621_1001954922 107
520 3300006237 Ga0097621_100916974 Ga0097621_1009169741 107
521 3300006358 Ga0068871_100056075 Ga0068871_1000560755 107
522 3300006358 Ga0068871_100134365 Ga0068871_1001343653 107
523 3300006358 Ga0068871_100249390 Ga0068871_1002493902 107
524 3300006358 Ga0068871_100629206 Ga0068871_1006292062 107
525 3300006358 Ga0068871_101185544 Ga0068871_1011855441 107
526 3300006844 Ga0075428_100259211 Ga0075428_1002592112 107
527 3300006852 Ga0075433_10753686 Ga0075433_107536862 107
528 3300006871 Ga0075434_100122664 Ga0075434_1001226643 107
529 3300006881 Ga0068865_101743681 Ga0068865_1017436812 107
530 3300006881 Ga0068865_102012575 Ga0068865_1020125751 107
531 3300006914 Ga0075436_101524788 Ga0075436_1015247881 107
532 3300006931 Ga0097620_100063325 Ga0097620_1000633255 107
533 3300006931 Ga0097620_100118198 Ga0097620_1001181983 107
534 3300006931 Ga0097620_100136168 Ga0097620_1001361682 107
535 3300006931 Ga0097620_100511578 Ga0097620_1005115782 107
536 3300006931 Ga0097620_101039573 Ga0097620_1010395732 107
537 3300006931 Ga0097620_101125683 Ga0097620_1011256832 107
538 3300006931 Ga0097620_101662098 Ga0097620_1016620981 107
539 3300006931 Ga0097620_102725734 Ga0097620_1027257341 107
540 3300007788 Ga0099795_10361773 Ga0099795_103617731 107
541 3300009093 Ga0105240_10033308 Ga0105240_100333082 107
542 3300009093 Ga0105240_10195764 Ga0105240_101957642 107
543 3300009093 Ga0105240_10208043 Ga0105240_102080432 107
544 3300009093 Ga0105240_10282646 Ga0105240_102826462 107
545 3300009093 Ga0105240_11026932 Ga0105240_110269322 107
546 3300009093 Ga0105240_12123896 Ga0105240_121238961 107
547 3300009094 Ga0111539_10000282 Ga0111539_1000028250 107
548 3300009094 Ga0111539_10095837 Ga0111539_100958374 107
549 3300009094 Ga0111539_10567516 Ga0111539_105675162 107
550 3300009094 Ga0111539_13034792 Ga0111539_130347922 107
551 3300009098 Ga0105245_11513876 Ga0105245_115138762 107
552 3300009098 Ga0105245_12095569 Ga0105245_120955692 107
553 3300009101 Ga0105247_10187319 Ga0105247_101873191 107
554 3300009101 Ga0105247_10226314 Ga0105247_102263142 107
555 3300009101 Ga0105247_11123103 Ga0105247_111231031 107
556 3300009101 Ga0105247_11344490 Ga0105247_113444901 107
557 3300009147 Ga0114129_10000741 Ga0114129_1000074121 107
558 3300009147 Ga0114129_10075673 Ga0114129_100756733 107
559 3300009147 Ga0114129_10158596 Ga0114129_101585964 107
560 3300009147 Ga0114129_10785109 Ga0114129_107851093 107
561 3300009147 Ga0114129_11329456 Ga0114129_113294561 107
562 3300009148 Ga0105243_10502515 Ga0105243_105025151 107
563 3300009148 Ga0105243_11543735 Ga0105243_115437352 107
564 3300009148 Ga0105243_12284170 Ga0105243_122841702 107
565 3300009174 Ga0105241_10386150 Ga0105241_103861502 107
566 3300009174 Ga0105241_11402181 Ga0105241_114021812 107
567 3300009174 Ga0105241_12312710 Ga0105241_123127101 107
568 3300009176 Ga0105242_10486745 Ga0105242_104867452 107
569 3300009176 Ga0105242_12035086 Ga0105242_120350861 107
570 3300009176 Ga0105242_12574073 Ga0105242_125740731 107
571 3300009176 Ga0105242_12945088 Ga0105242_129450881 107
572 3300009177 Ga0105248_10033995 Ga0105248_100339955 107
573 3300009177 Ga0105248_10172202 Ga0105248_101722022 107
574 3300009177 Ga0105248_10641630 Ga0105248_106416302 107
575 3300009177 Ga0105248_10691462 Ga0105248_106914623 107
576 3300009177 Ga0105248_10909020 Ga0105248_109090202 107
577 3300009177 Ga0105248_12542943 Ga0105248_125429432 107
578 3300009177 Ga0105248_12826096 Ga0105248_128260962 107
579 3300009545 Ga0105237_10091701 Ga0105237_100917014 107
580 3300009545 Ga0105237_10225794 Ga0105237_102257942 107
581 3300009545 Ga0105237_10547063 Ga0105237_105470631 107
582 3300009551 Ga0105238_10136472 Ga0105238_101364722 107
583 3300009551 Ga0105238_10149432 Ga0105238_101494323 107
584 3300009551 Ga0105238_10156998 Ga0105238_101569982 107
585 3300009551 Ga0105238_10782973 Ga0105238_107829732 107
586 3300009553 Ga0105249_10032077 Ga0105249_100320775 107
587 3300009553 Ga0105249_10839179 Ga0105249_108391792 107
588 3300009553 Ga0105249_11695204 Ga0105249_116952041 107
589 3300009553 Ga0105249_12036321 Ga0105249_120363212 107
590 3300009553 Ga0105249_12347366 Ga0105249_123473661 107
591 3300010159 Ga0099796_10243783 Ga0099796_102437832 107
592 3300010375 Ga0105239_10029577 Ga0105239_100295772 107
593 3300010375 Ga0105239_11172436 Ga0105239_111724361 107
594 3300011119 Ga0105246_11066594 Ga0105246_110665941 107
595 3300013104 Ga0157370_10255611 Ga0157370_102556112 107
596 3300013105 Ga0157369_12287005 Ga0157369_122870051 107
597 3300013296 Ga0157374_10488935 Ga0157374_104889352 107
598 3300013296 Ga0157374_10843957 Ga0157374_108439572 107
599 3300013296 Ga0157374_11460446 Ga0157374_114604461 107
600 3300013297 Ga0157378_10226566 Ga0157378_102265663 107
601 3300013297 Ga0157378_10805152 Ga0157378_108051521 107
602 3300013297 Ga0157378_11239745 Ga0157378_112397452 107
603 3300013297 Ga0157378_11914364 Ga0157378_119143641 107
604 3300013306 Ga0163162_10094707 Ga0163162_100947075 107
605 3300013308 Ga0157375_10081907 Ga0157375_100819073 107
606 3300013308 Ga0157375_10487214 Ga0157375_104872142 107
607 3300013308 Ga0157375_12460960 Ga0157375_124609601 107
608 3300014325 Ga0163163_10007882 Ga0163163_100078823 107
609 3300014325 Ga0163163_10090956 Ga0163163_100909563 107
610 3300014325 Ga0163163_10226311 Ga0163163_102263112 107
611 3300014325 Ga0163163_11285133 Ga0163163_112851332 107
612 3300014326 Ga0157380_10029095 Ga0157380_100290952 107
613 3300014326 Ga0157380_10560241 Ga0157380_105602412 107
614 3300014326 Ga0157380_10585159 Ga0157380_105851593 107
615 3300014326 Ga0157380_11764318 Ga0157380_117643181 107
616 3300014326 Ga0157380_11920112 Ga0157380_119201122 107
617 3300014745 Ga0157377_10163465 Ga0157377_101634652 107
618 3300014745 Ga0157377_10423428 Ga0157377_104234282 107
619 3300014745 Ga0157377_10435147 Ga0157377_104351472 107
620 3300014968 Ga0157379_10018917 Ga0157379_100189177 107
621 3300014968 Ga0157379_10377169 Ga0157379_103771692 107
622 3300014968 Ga0157379_10411835 Ga0157379_104118352 107
623 3300014969 Ga0157376_10171114 Ga0157376_101711143 107
624 3300014969 Ga0157376_10431250 Ga0157376_104312502 107
625 3300014969 Ga0157376_10566622 Ga0157376_105666223 107
626 3300014969 Ga0157376_10951252 Ga0157376_109512522 107
627 3300017792 Ga0163161_11575943 Ga0163161_115759432 107
628 3300020610 Ga0154015_1623859 Ga0154015_16238591 107
629 3300025315 Ga0207697_10072222 Ga0207697_100722221 107
630 3300025315 Ga0207697_10318934 Ga0207697_103189342 107
631 3300025899 Ga0207642_10205918 Ga0207642_102059182 107
632 3300025900 Ga0207710_10065489 Ga0207710_100654892 107
633 3300025901 Ga0207688_10249364 Ga0207688_102493642 107
634 3300025903 Ga0207680_10012690 Ga0207680_100126903 107
635 3300025903 Ga0207680_10018329 Ga0207680_100183293 107
636 3300025905 Ga0207685_10642333 Ga0207685_106423332 107
637 3300025907 Ga0207645_10079544 Ga0207645_100795444 107
638 3300025907 Ga0207645_11113305 Ga0207645_111133052 107
639 3300025911 Ga0207654_10241381 Ga0207654_102413813 107
640 3300025912 Ga0207707_10000125 Ga0207707_1000012527 107
641 3300025913 Ga0207695_10068626 Ga0207695_100686261 107
642 3300025913 Ga0207695_10080105 Ga0207695_100801052 107
643 3300025913 Ga0207695_10143122 Ga0207695_101431222 107
644 3300025914 Ga0207671_10217397 Ga0207671_102173972 107
645 3300025914 Ga0207671_10409002 Ga0207671_104090022 107
646 3300025917 Ga0207660_10611740 Ga0207660_106117401 107
647 3300025917 Ga0207660_10960600 Ga0207660_109606001 107
648 3300025917 Ga0207660_11171621 Ga0207660_111716211 107
649 3300025918 Ga0207662_10040400 Ga0207662_100404002 107
650 3300025918 Ga0207662_11302837 Ga0207662_113028372 107
651 3300025920 Ga0207649_10123772 Ga0207649_101237722 107
652 3300025920 Ga0207649_10607044 Ga0207649_106070442 107
653 3300025920 Ga0207649_10952231 Ga0207649_109522311 107
654 3300025921 Ga0207652_10011466 Ga0207652_100114663 107
655 3300025921 Ga0207652_10093547 Ga0207652_100935472 107
656 3300025921 Ga0207652_10867278 Ga0207652_108672781 107
657 3300025922 Ga0207646_10338017 Ga0207646_103380172 107
658 3300025922 Ga0207646_10393161 Ga0207646_103931612 107
659 3300025922 Ga0207646_10941965 Ga0207646_109419651 107
660 3300025923 Ga0207681_10086761 Ga0207681_100867613 107
661 3300025923 Ga0207681_10217023 Ga0207681_102170232 107
662 3300025923 Ga0207681_11280559 Ga0207681_112805591 107
663 3300025924 Ga0207694_10091391 Ga0207694_100913913 107
664 3300025924 Ga0207694_10163944 Ga0207694_101639443 107
665 3300025924 Ga0207694_10813667 Ga0207694_108136672 107
666 3300025924 Ga0207694_11415734 Ga0207694_114157342 107
667 3300025925 Ga0207650_10002523 Ga0207650_100025237 107
668 3300025925 Ga0207650_10007320 Ga0207650_100073202 107
669 3300025926 Ga0207659_10022086 Ga0207659_100220862 107
670 3300025926 Ga0207659_10250903 Ga0207659_102509033 107
671 3300025927 Ga0207687_11636935 Ga0207687_116369351 107
672 3300025928 Ga0207700_10034840 Ga0207700_100348404 107
673 3300025928 Ga0207700_10396795 Ga0207700_103967952 107
674 3300025929 Ga0207664_11582101 Ga0207664_115821011 107
675 3300025931 Ga0207644_10046153 Ga0207644_100461533 107
676 3300025931 Ga0207644_10078164 Ga0207644_100781643 107
677 3300025932 Ga0207690_10335998 Ga0207690_103359982 107
678 3300025935 Ga0207709_11463259 Ga0207709_114632592 107
679 3300025935 Ga0207709_11826478 Ga0207709_118264781 107
680 3300025936 Ga0207670_10235963 Ga0207670_102359632 107
681 3300025936 Ga0207670_10611816 Ga0207670_106118162 107
682 3300025937 Ga0207669_10459258 Ga0207669_104592582 107
683 3300025937 Ga0207669_10543172 Ga0207669_105431722 107
684 3300025937 Ga0207669_10587066 Ga0207669_105870661 107
685 3300025940 Ga0207691_10014898 Ga0207691_100148986 107
686 3300025940 Ga0207691_10023330 Ga0207691_100233302 107
687 3300025940 Ga0207691_11743898 Ga0207691_117438982 107
688 3300025941 Ga0207711_10093642 Ga0207711_100936422 107
689 3300025941 Ga0207711_10141809 Ga0207711_101418093 107
690 3300025941 Ga0207711_11084227 Ga0207711_110842271 107
691 3300025941 Ga0207711_11128336 Ga0207711_111283362 107
692 3300025942 Ga0207689_10235497 Ga0207689_102354971 107
693 3300025942 Ga0207689_10715740 Ga0207689_107157402 107
694 3300025942 Ga0207689_11177520 Ga0207689_111775201 107
695 3300025944 Ga0207661_10084451 Ga0207661_100844512 107
696 3300025944 Ga0207661_10128475 Ga0207661_101284751 107
697 3300025945 Ga0207679_10104089 Ga0207679_101040893 107
698 3300025949 Ga0207667_11203161 Ga0207667_112031612 107
699 3300025960 Ga0207651_10312223 Ga0207651_103122232 107
700 3300025961 Ga0207712_10030506 Ga0207712_100305062 107
701 3300025961 Ga0207712_10700445 Ga0207712_107004452 107
702 3300025972 Ga0207668_11178481 Ga0207668_111784811 107
703 3300025981 Ga0207640_10137196 Ga0207640_101371962 107
704 3300025981 Ga0207640_10530009 Ga0207640_105300091 107
705 3300025986 Ga0207658_10078039 Ga0207658_100780392 107
706 3300025986 Ga0207658_10115621 Ga0207658_101156212 107
707 3300026023 Ga0207677_10004548 Ga0207677_100045484 107
708 3300026023 Ga0207677_10131867 Ga0207677_101318673 107
709 3300026035 Ga0207703_10020956 Ga0207703_100209564 107
710 3300026035 Ga0207703_10035581 Ga0207703_100355812 107
711 3300026035 Ga0207703_10426240 Ga0207703_104262402 107
712 3300026035 Ga0207703_11417275 Ga0207703_114172751 107
713 3300026035 Ga0207703_11858570 Ga0207703_118585702 107
714 3300026041 Ga0207639_11409460 Ga0207639_114094602 107
715 3300026075 Ga0207708_10378534 Ga0207708_103785342 107
716 3300026075 Ga0207708_10415785 Ga0207708_104157852 107
717 3300026075 Ga0207708_10879157 Ga0207708_108791571 107
718 3300026075 Ga0207708_11184688 Ga0207708_111846881 107
719 3300026078 Ga0207702_10000001 Ga0207702_10000001736 107
720 3300026078 Ga0207702_10182357 Ga0207702_101823572 107
721 3300026078 Ga0207702_10451802 Ga0207702_104518022 107
722 3300026088 Ga0207641_10002906 Ga0207641_1000290611 107
723 3300026088 Ga0207641_10021290 Ga0207641_100212902 107
724 3300026088 Ga0207641_10054759 Ga0207641_100547592 107
725 3300026088 Ga0207641_10075115 Ga0207641_100751153 107
726 3300026088 Ga0207641_10136726 Ga0207641_101367262 107
727 3300026088 Ga0207641_10278973 Ga0207641_102789733 107
728 3300026089 Ga0207648_10290617 Ga0207648_102906172 107
729 3300026089 Ga0207648_11407997 Ga0207648_114079972 107
730 3300026089 Ga0207648_11512079 Ga0207648_115120792 107
731 3300026095 Ga0207676_10008407 Ga0207676_100084072 107
732 3300026095 Ga0207676_10009375 Ga0207676_100093755 107
733 3300026095 Ga0207676_10068273 Ga0207676_100682732 107
734 3300026116 Ga0207674_10015346 Ga0207674_100153462 107
735 3300026116 Ga0207674_10287704 Ga0207674_102877042 107
736 3300026116 Ga0207674_11673198 Ga0207674_116731982 107
737 3300026118 Ga0207675_100544863 Ga0207675_1005448632 107
738 3300026118 Ga0207675_101385288 Ga0207675_1013852882 107
739 3300026121 Ga0207683_10574426 Ga0207683_105744262 107
740 3300026121 Ga0207683_10859600 Ga0207683_108596001 107
741 3300026142 Ga0207698_11178738 Ga0207698_111787381 107
742 3300027907 Ga0207428_10062289 Ga0207428_100622893 107
743 3300027907 Ga0207428_10559590 Ga0207428_105595902 107
744 3300028379 Ga0268266_10001574 Ga0268266_1000157415 107
745 3300028380 Ga0268265_10057738 Ga0268265_100577385 107
746 3300028380 Ga0268265_10694833 Ga0268265_106948332 107
747 3300028381 Ga0268264_10032907 Ga0268264_100329073 107
748 3300028381 Ga0268264_10205740 Ga0268264_102057402 107
749 3300028381 Ga0268264_10519397 Ga0268264_105193972 107
750 3300028381 Ga0268264_10973563 Ga0268264_109735632 107
751 3300028381 Ga0268264_11397858 Ga0268264_113978581 107
752 3300028381 Ga0268264_12393246 Ga0268264_123932461 107
753 3300028556 Ga0265337_1007184 Ga0265337_10071844 107
754 3300028556 Ga0265337_1102511 Ga0265337_11025111 107
755 3300028556 Ga0265337_1141953 Ga0265337_11419532 107
756 3300028558 Ga0265326_10057864 Ga0265326_100578641 107
757 3300028563 Ga0265319_1043415 Ga0265319_10434152 107
758 3300028563 Ga0265319_1092719 Ga0265319_10927191 107
759 3300028563 Ga0265319_1118415 Ga0265319_11184152 107
760 3300028573 Ga0265334_10005346 Ga0265334_100053462 107
761 3300028577 Ga0265318_10000005 Ga0265318_1000000577 107
762 3300028577 Ga0265318_10020875 Ga0265318_100208751 107
763 3300028577 Ga0265318_10350940 Ga0265318_103509401 107
764 3300028577 Ga0265318_10396425 Ga0265318_103964251 107
765 3300028653 Ga0265323_10000044 Ga0265323_100000446 107
766 3300028653 Ga0265323_10003744 Ga0265323_100037444 107
767 3300028653 Ga0265323_10011348 Ga0265323_100113484 107
768 3300028654 Ga0265322_10000802 Ga0265322_100008024 107
769 3300028654 Ga0265322_10008192 Ga0265322_100081924 107
770 3300028666 Ga0265336_10028611 Ga0265336_100286113 107
771 3300028800 Ga0265338_10001998 Ga0265338_100019983 107
772 3300028800 Ga0265338_10013448 Ga0265338_100134485 107
773 3300028800 Ga0265338_10115876 Ga0265338_101158763 107
774 3300029957 Ga0265324_10004265 Ga0265324_100042655 107
775 3300029957 Ga0265324_10009397 Ga0265324_100093972 107
776 3300030760 Ga0265762_1048152 Ga0265762_10481522 107
777 3300031090 Ga0265760_10045719 Ga0265760_100457192 107
778 3300031235 Ga0265330_10026862 Ga0265330_100268623 107
779 3300031235 Ga0265330_10044760 Ga0265330_100447602 107
780 3300031235 Ga0265330_10061446 Ga0265330_100614462 107
781 3300031235 Ga0265330_10076014 Ga0265330_100760142 107
782 3300031238 Ga0265332_10007763 Ga0265332_100077635 107
783 3300031238 Ga0265332_10051938 Ga0265332_100519381 107
784 3300031239 Ga0265328_10077856 Ga0265328_100778562 107
785 3300031239 Ga0265328_10362869 Ga0265328_103628691 107
786 3300031240 Ga0265320_10013450 Ga0265320_100134504 107
787 3300031240 Ga0265320_10020179 Ga0265320_100201793 107
788 3300031240 Ga0265320_10091355 Ga0265320_100913552 107
789 3300031240 Ga0265320_10384724 Ga0265320_103847241 107
790 3300031241 Ga0265325_10006322 Ga0265325_100063225 107
791 3300031247 Ga0265340_10028083 Ga0265340_100280833 107
792 3300031247 Ga0265340_10100510 Ga0265340_101005102 107
793 3300031249 Ga0265339_10014992 Ga0265339_100149922 107
794 3300031249 Ga0265339_10073218 Ga0265339_100732181 107
795 3300031249 Ga0265339_10148431 Ga0265339_101484312 107
796 3300031249 Ga0265339_10198264 Ga0265339_101982641 107
797 3300031250 Ga0265331_10018334 Ga0265331_100183342 107
798 3300031250 Ga0265331_10104462 Ga0265331_101044622 107
799 3300031250 Ga0265331_10113388 Ga0265331_101133882 107
800 3300031250 Ga0265331_10142309 Ga0265331_101423092 107
801 3300031250 Ga0265331_10208871 Ga0265331_102088712 107
802 3300031251 Ga0265327_10001705 Ga0265327_1000170520 107
803 3300031251 Ga0265327_10013021 Ga0265327_100130212 107
804 3300031251 Ga0265327_10101160 Ga0265327_101011602 107
805 3300031344 Ga0265316_10002356 Ga0265316_1000235612 107
806 3300031344 Ga0265316_10005906 Ga0265316_100059067 107
807 3300031344 Ga0265316_10038370 Ga0265316_100383703 107
808 3300031344 Ga0265316_10046666 Ga0265316_100466663 107
809 3300031344 Ga0265316_10099467 Ga0265316_100994672 107
810 3300031344 Ga0265316_10153481 Ga0265316_101534812 107
811 3300031344 Ga0265316_10476006 Ga0265316_104760062 107
812 3300031456 Ga0307513_10012270 Ga0307513_1001227012 107
813 3300031507 Ga0307509_10622429 Ga0307509_106224292 107
814 3300031595 Ga0265313_10002981 Ga0265313_1000298111 107
815 3300031595 Ga0265313_10003767 Ga0265313_100037679 107
816 3300031595 Ga0265313_10006788 Ga0265313_100067882 107
817 3300031595 Ga0265313_10017903 Ga0265313_100179033 107
818 3300031616 Ga0307508_10000200 Ga0307508_100002008 107
819 3300031711 Ga0265314_10001653 Ga0265314_1000165310 107
820 3300031711 Ga0265314_10016863 Ga0265314_100168635 107
821 3300031711 Ga0265314_10099912 Ga0265314_100999123 107
822 3300031711 Ga0265314_10160057 Ga0265314_101600572 107
823 3300031712 Ga0265342_10002344 Ga0265342_1000234411 107
824 3300031712 Ga0265342_10010937 Ga0265342_100109371 107
825 3300031712 Ga0265342_10015932 Ga0265342_100159324 107
826 3300031712 Ga0265342_10041726 Ga0265342_100417263 107
827 3300031712 Ga0265342_10042248 Ga0265342_100422481 107
828 3300031712 Ga0265342_10108733 Ga0265342_101087332 107
829 3300031712 Ga0265342_10586951 Ga0265342_105869512 107
830 3300031730 Ga0307516_10463298 Ga0307516_104632982 107
831 3300032005 Ga0307411_11298030 Ga0307411_112980302 107
832 3300034820 Ga0373959_0000052 Ga0373959_0000052_194_523 107
833 3300035086 Ga0373934_0250637 Ga0373934_0250637_183_506 107
834 3300035091 Ga0373951_0001334 Ga0373951_0001334_5012_5335 107
835 3300035111 Ga0373923_0210713 Ga0373923_0210713_150_473 107
836 3300035112 Ga0373932_0147183 Ga0373932_0147183_377_703 107
837 3300035112 Ga0373932_0269193 Ga0373932_0269193_51_374 107
838 3300035114 Ga0373939_0020582 Ga0373939_0020582_1444_1767 107
839 3300035118 Ga0373954_0319629 Ga0373954_0319629_241_567 107
840 3300035120 Ga0373957_0282621 Ga0373957_0282621_234_557 107
841 3300035172 Ga0373955_0213835 Ga0373955_0213835_333_662 107
842 3300035242 Ga0373962_0090418 Ga0373962_0090418_608_931 107
843 3300035691 Ga0373931_0623617 Ga0373931_0623617_356_685 107
844 3300035691 Ga0373931_0658250 Ga0373931_0658250_265_588 107
845 3300035724 Ga0373933_0647059 Ga0373933_0647059_310_633 107
846 3300036401 Ga0373937_0014543 Ga0373937_0014543_6568_6891 107
847 3300036401 Ga0373937_0047248 Ga0373937_0047248_951_1280 107
848 3300036401 Ga0373937_0103496 Ga0373937_0103496_2178_2504 107
849 3300036401 Ga0373937_0439158 Ga0373937_0439158_226_549 107
850 3300036401 Ga0373937_0551763 Ga0373937_0551763_429_755 107
851 3300036401 Ga0373937_0854538 Ga0373937_0854538_442_771 107
852 3300036401 Ga0373937_1388153 Ga0373937_1388153_204_527 107
853 3300036647 Ga0316582_0407470 Ga0316582_0407470_74_397 107
854 3300037068 Ga0373925_0893285 Ga0373925_0893285_157_504 107
855 3300039437 Ga0436365_0786779 Ga0436365_0786779_28_351 107
856 3300041456 Ga0451795_1691563 Ga0451795_1691563_71_394 107
857 3300041512 Ga0451853_1514882 Ga0451853_1514882_144_470 107
858 3300042015 Ga0439462_0112593 Ga0439462_0112593_337_660 107
859 3300042156 Ga0439446_0262658 Ga0439446_0262658_40_378 107
860 3300042876 Ga0451577_0167901 Ga0451577_0167901_1361_1693 107
861 3300042876 Ga0451577_0904583 Ga0451577_0904583_416_739 107
862 3300044673 Ga0453683_0002405 Ga0453683_0002405_12920_13252 107
863 3300044673 Ga0453683_0257203 Ga0453683_0257203_372_704 107
864 3300044684 Ga0466966_0244296 Ga0466966_0244296_588_914 107
865 3300044684 Ga0466966_0388372 Ga0466966_0388372_62_391 107
866 3300044712 Ga0453684_0358547 Ga0453684_0358547_643_975 107
867 3300044712 Ga0453684_0480004 Ga0453684_0480004_610_936 107
868 3300044712 Ga0453684_1078628 Ga0453684_1078628_459_794 107
869 3300044712 Ga0453684_1401854 Ga0453684_1401854_53_376 107
870 3300044719 Ga0466971_0142089 Ga0466971_0142089_59_385 107
871 3300045049 Ga0466959_0121887 Ga0466959_0121887_463_789 107
872 3300045051 Ga0451576_0019268 Ga0451576_0019268_874_1206 107
873 3300045836 Ga0466958_0257203 Ga0466958_0257203_601_927 107
874 3300045976 Ga0466967_0003400 Ga0466967_0003400_9974_10300 107
875 3300046454 Ga0495592_0002149 Ga0495592_0002149_13181_13504 107
876 3300046455 Ga0495603_0231549 Ga0495603_0231549_151_474 107
877 3300046458 Ga0495591_080624 Ga0495591_080624_386_709 107
878 3300046459 Ga0495629_0207057 Ga0495629_0207057_14_337 107
879 3300046499 Ga0495594_0218157 Ga0495594_0218157_148_477 107
880 3300046514 Ga0495618_0042704 Ga0495618_0042704_773_1096 107
881 3300046516 Ga0495628_0502538 Ga0495628_0502538_100_423 107
882 3300046517 Ga0495630_0387973 Ga0495630_0387973_77_400 107
883 3300046529 Ga0495652_0608065 Ga0495652_0608065_73_396 107
884 3300046535 Ga0495586_0085694 Ga0495586_0085694_613_936 107
885 3300046543 Ga0495645_0536783 Ga0495645_0536783_95_418 107
886 3300046559 Ga0495667_0000510 Ga0495667_0000510_17889_18212 107
887 3300046642 Ga0495634_0023902 Ga0495634_0023902_3893_4219 107
888 3300046642 Ga0495634_0099635 Ga0495634_0099635_558_881 107
889 3300046664 Ga0495659_0125488 Ga0495659_0125488_508_831 107
890 3300046674 Ga0495588_0417018 Ga0495588_0417018_245_568 107
891 3300046675 Ga0495657_0014486 Ga0495657_0014486_5383_5706 107
892 3300046678 Ga0495599_0194811 Ga0495599_0194811_145_468 107
893 3300046683 Ga0495658_0078285 Ga0495658_0078285_986_1309 107
894 3300046684 Ga0495669_0206396 Ga0495669_0206396_537_860 107
895 3300046689 Ga0495613_0042502 Ga0495613_0042502_2999_3322 107
896 3300046689 Ga0495613_0562630 Ga0495613_0562630_210_536 107
897 3300046690 Ga0495624_0565150 Ga0495624_0565150_104_427 107
898 3300047471 Ga0495684_0029353 Ga0495684_0029353_1343_1666 107
899 3300047471 Ga0495684_0329830 Ga0495684_0329830_753_1076 107
900 3300048905 Ga0496102_1531441 Ga0496102_1531441_123_446 107
901 3300048907 Ga0496104_0019982 Ga0496104_0019982_278_601 107
902 3300048908 Ga0496105_0449913 Ga0496105_0449913_449_778 107
903 3300048909 Ga0496106_0397942 Ga0496106_0397942_44_367 107
904 3300048910 Ga0496107_0177259 Ga0496107_0177259_1134_1463 107
905 3300048911 Ga0496108_0009731 Ga0496108_0009731_4668_4991 107
906 3300048913 Ga0496110_0862741 Ga0496110_0862741_367_690 107
907 3300048914 Ga0496111_0188644 Ga0496111_0188644_605_934 107
908 3300048915 Ga0496112_0386727 Ga0496112_0386727_541_870 107
909 3300048916 Ga0496113_0060084 Ga0496113_0060084_1785_2108 107
910 3300048917 Ga0496114_0563099 Ga0496114_0563099_193_516 107
911 3300048917 Ga0496114_0945587 Ga0496114_0945587_33_362 107
912 3300048924 Ga0496121_0684847 Ga0496121_0684847_157_480 107
913 3300048928 Ga0496125_0558528 Ga0496125_0558528_232_561 107
914 3300048929 Ga0496126_0024934 Ga0496126_0024934_104_433 107
915 3300049568 Ga0501031_0689609 Ga0501031_0689609_232_561 107
916 3300049569 Ga0501032_0000381 Ga0501032_0000381_33131_33466 107
917 3300049569 Ga0501032_0004210 Ga0501032_0004210_7905_8231 107
918 3300049570 Ga0501033_0003173 Ga0501033_0003173_906_1241 107
919 3300049571 Ga0501034_0025655 Ga0501034_0025655_3138_3473 107
920 3300049572 Ga0501036_0002696 Ga0501036_0002696_1281_1616 107
921 3300049572 Ga0501036_0057652 Ga0501036_0057652_2373_2699 107
922 3300049573 Ga0501037_0035928 Ga0501037_0035928_2758_3093 107
923 3300049573 Ga0501037_0686046 Ga0501037_0686046_36_365 107
924 3300049574 Ga0501038_0006345 Ga0501038_0006345_81_416 107
925 3300049575 Ga0501039_0018596 Ga0501039_0018596_835_1170 107
926 3300049579 Ga0501043_0005787 Ga0501043_0005787_81_416 107
927 3300049580 Ga0501046_0006931 Ga0501046_0006931_5078_5404 107
928 3300049580 Ga0501046_0007380 Ga0501046_0007380_5072_5398 107
929 3300049580 Ga0501046_0310789 Ga0501046_0310789_456_791 107
930 3300049581 Ga0501047_0000443 Ga0501047_0000443_2445_2768 107
931 3300049581 Ga0501047_0010472 Ga0501047_0010472_5792_6118 107
932 3300049581 Ga0501047_0026010 Ga0501047_0026010_2622_2957 107
933 3300049581 Ga0501047_0081073 Ga0501047_0081073_725_1051 107
934 3300049581 Ga0501047_0581328 Ga0501047_0581328_513_836 107
935 3300049581 Ga0501047_1194752 Ga0501047_1194752_229_552 107
936 3300049581 Ga0501047_1416202 Ga0501047_1416202_10_339 107
937 3300049582 Ga0501048_0026634 Ga0501048_0026634_529_864 107
938 3300049582 Ga0501048_0442617 Ga0501048_0442617_576_902 107
939 3300049584 Ga0501068_0228635 Ga0501068_0228635_48_383 107
940 3300049586 Ga0501070_0040045 Ga0501070_0040045_1127_1462 107
941 3300049742 Ga0501080_0200486 Ga0501080_0200486_1201_1524 107
942 3300049744 Ga0501083_0116569 Ga0501083_0116569_198_521 107
943 3300049822 Ga0501035_0002291 Ga0501035_0002291_5503_5838 107
944 3300049822 Ga0501035_0005985 Ga0501035_0005985_8472_8798 107
945 3300049823 Ga0501044_0000245 Ga0501044_0000245_21852_22178 107
946 3300049823 Ga0501044_0013568 Ga0501044_0013568_4060_4395 107
947 3300049824 Ga0501045_0877046 Ga0501045_0877046_233_568 107
948 3300050492 nmdc:mga0yw44_14103_c1 nmdc:mga0yw44_14103_c1_523_852 107
949 3300050507 nmdc:mga05p37_199829_c1 nmdc:mga05p37_199829_c1_733_1056 107
950 3300050507 nmdc:mga05p37_4622_c1 nmdc:mga05p37_4622_c1_9931_10254 107
951 3300050507 nmdc:mga05p37_5627_c1 nmdc:mga05p37_5627_c1_262_585 107
952 3300050511 nmdc:mga08y16_18505_c1 nmdc:mga08y16_18505_c1_2565_2888 107
953 3300050511 nmdc:mga08y16_841979_c1 nmdc:mga08y16_841979_c1_450_773 107
954 3300050512 nmdc:mga0n895_2250903_c1 nmdc:mga0n895_2250903_c1_128_451 107
955 3300050512 nmdc:mga0n895_6510_c1 nmdc:mga0n895_6510_c1_7731_8054 107
956 3300050515 nmdc:mga0a205_14478_c1 nmdc:mga0a205_14478_c1_4434_4757 107
957 3300050515 nmdc:mga0a205_16127_c1 nmdc:mga0a205_16127_c1_5533_5856 107
958 3300053077 Ga0495601_0356567 Ga0495601_0356567_524_847 107
959 3300053119 Ga0500595_044920 Ga0500595_044920_503_832 107
960 3300053136 Ga0500559_0482121 Ga0500559_0482121_232_561 107
961 3300053139 Ga0500568_0025482 Ga0500568_0025482_568_894 107
962 3300053156 Ga0500622_0279326 Ga0500622_0279326_221_547 107
963 3300053163 Ga0500639_363859 Ga0500639_363859_34_363 107
964 3300053178 Ga0500637_0116320 Ga0500637_0116320_932_1261 107

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

36

107

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6abt-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9444 12 105
4ejo-assembly1.cif.gz_A-2 crystal structure of padr family transcriptional regulator from eggerthella lenta dsm 2243 0.9285 3 105
6abq-assembly1.cif.gz_B crystal structure of transcription factor from listeria monocytogenes 0.9112 7 105
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9075 9 105
5x11-assembly1.cif.gz_B crystal structure of bacillus subtilis padr in complex with operator dna 0.9054 14 91
ID Description Score Start End Superfamily
af_Q57807_1_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9403 16 96 1.10.10.10
af_O50432_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9343 15 93 1.10.10.10
4ejoA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9274 5 105 1.10.10.10
3hhhA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9104 9 104 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9071 9 106 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7T9QK77-F1-model_v4 deleted 0.9818 5 107
AF-A0A3L7WC70-F1-model_v4 PadR family transcriptional regulator 0.9786 7 106
AF-A0A5C9E194-F1-model_v4 Transcription regulator PadR N-terminal domain-containing protein 0.9776 8 107
AF-A0A1V5WUT6-F1-model_v4 Lineage-specific thermal regulator protein 0.9699 5 107
AF-A0A2N2YRN4-F1-model_v4 PadR family transcriptional regulator 0.9694 5 105 GO:0005737

Feature Viewer

pLDDT pTM Quality
93.23 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map