F486941
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 964 | 352 | 964 | 109 |
Family's Representative Sequence
| Representative Sequence | 3300031730|Ga0307516_10463298|Ga0307516_104632982 |
| Length | 125 |
| Sequence | LDYTTFITQGSLLINPKMDIEEKFSSIRKGMLEFLVLKIIAADQVYAADILKDLNATDFATQEGTLYPLLSKLRREELVDYEWKESESGPPRKYYKLTAKGREQLRDTLEHWQKIITTVKNLGQK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 91 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 190 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 191 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 192 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 194 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 195 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 196 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 204 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 206 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 207 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 210 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 211 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 212 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 213 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 214 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 216 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 218 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 219 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 220 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 221 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 222 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 229 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 231 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 233 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 234 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 236 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 238 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 240 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 241 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 244 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 245 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 246 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 247 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 248 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 249 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 250 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 251 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 252 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 253 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 254 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 255 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 256 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 257 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 258 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 259 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 260 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 290 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 291 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 292 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 293 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 294 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 296 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 297 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 298 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 299 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 300 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 301 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 302 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 303 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 335 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 344 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 345 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 346 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 347 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 348 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 349 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 350 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.69 |
| Metatranscriptomes | 0.31 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.24 |
| Nodule | 0 |
| Rhizoplane | 1.76 |
| Rhizosphere | 95.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10000244 | 3300003320 | Bacteria | 697651 |
| 2 | rootH2_10023934 | 3300003320 | Bacteria | 11461 |
| 3 | rootL2_10196664 | 3300003322 | Bacteria | 5843 |
| 4 | rootH1_10020346 | 3300003323 | Bacteria | 1837 |
| 5 | rootH1_10060084 | 3300003323 | Bacteria | 8904 |
| 6 | rootH1_10112671 | 3300003323 | Bacteria | 1119 |
| 7 | Ga0065716_1014350 | 3300005277 | Unclassified | 532 |
| 8 | Ga0065704_10149850 | 3300005289 | Bacteria | 1439 |
| 9 | Ga0065704_10755470 | 3300005289 | Unclassified | 540 |
| 10 | Ga0065715_10280599 | 3300005293 | Unclassified | 1076 |
| 11 | Ga0065715_10572473 | 3300005293 | Unclassified | 726 |
| 12 | Ga0065715_10597242 | 3300005293 | Unclassified | 709 |
| 13 | Ga0065715_10719566 | 3300005293 | Unclassified | 644 |
| 14 | Ga0065715_10763246 | 3300005293 | Bacteria | 616 |
| 15 | Ga0065707_10001068 | 3300005295 | Bacteria | 10689 |
| 16 | Ga0065707_10015406 | 3300005295 | Unclassified | 2169 |
| 17 | Ga0065707_10185580 | 3300005295 | Unclassified | 1391 |
| 18 | Ga0065707_10633634 | 3300005295 | Bacteria | 672 |
| 19 | Ga0065707_10914318 | 3300005295 | Bacteria | 562 |
| 20 | Ga0070676_10266597 | 3300005328 | Unclassified | 1149 |
| 21 | Ga0070676_10499738 | 3300005328 | Bacteria | 863 |
| 22 | Ga0070683_100033834 | 3300005329 | Bacteria | 4664 |
| 23 | Ga0070690_100004892 | 3300005330 | Bacteria | 7489 |
| 24 | Ga0070690_100428415 | 3300005330 | Bacteria | 977 |
| 25 | Ga0070670_100003854 | 3300005331 | Bacteria | 12507 |
| 26 | Ga0070670_100018306 | 3300005331 | Bacteria | 6009 |
| 27 | Ga0070670_100299315 | 3300005331 | Unclassified | 1407 |
| 28 | Ga0068869_100249480 | 3300005334 | Unclassified | 1417 |
| 29 | Ga0068869_101658879 | 3300005334 | Bacteria | 570 |
| 30 | Ga0068869_101767144 | 3300005334 | Bacteria | 553 |
| 31 | Ga0070666_10006236 | 3300005335 | Bacteria | 7337 |
| 32 | Ga0070666_10006373 | 3300005335 | Bacteria | 7258 |
| 33 | Ga0070666_10033093 | 3300005335 | Bacteria | 3419 |
| 34 | Ga0070680_100039578 | 3300005336 | Bacteria | 3814 |
| 35 | Ga0070680_100301662 | 3300005336 | Bacteria | 1358 |
| 36 | Ga0070680_100506432 | 3300005336 | Bacteria | 1033 |
| 37 | Ga0070680_101243610 | 3300005336 | Unclassified | 644 |
| 38 | Ga0070682_100275948 | 3300005337 | Unclassified | 1223 |
| 39 | Ga0070682_100645637 | 3300005337 | Unclassified | 842 |
| 40 | Ga0070682_101230659 | 3300005337 | Unclassified | 633 |
| 41 | Ga0068868_100004281 | 3300005338 | Bacteria | 9993 |
| 42 | Ga0068868_100154019 | 3300005338 | Unclassified | 1895 |
| 43 | Ga0068868_100355783 | 3300005338 | Unclassified | 1255 |
| 44 | Ga0068868_100748278 | 3300005338 | Bacteria | 878 |
| 45 | Ga0068868_101030630 | 3300005338 | Unclassified | 754 |
| 46 | Ga0068868_101901633 | 3300005338 | Unclassified | 563 |
| 47 | Ga0070660_101094279 | 3300005339 | Bacteria | 674 |
| 48 | Ga0070689_100290041 | 3300005340 | Bacteria | 1359 |
| 49 | Ga0070689_100609939 | 3300005340 | Bacteria | 946 |
| 50 | Ga0070689_100777763 | 3300005340 | Unclassified | 841 |
| 51 | Ga0070691_10227083 | 3300005341 | Bacteria | 992 |
| 52 | Ga0070691_10759396 | 3300005341 | Unclassified | 587 |
| 53 | Ga0070687_100046546 | 3300005343 | Unclassified | 2221 |
| 54 | Ga0070661_100017202 | 3300005344 | Bacteria | 5126 |
| 55 | Ga0070661_100225900 | 3300005344 | Bacteria | 1437 |
| 56 | Ga0070661_100457969 | 3300005344 | Bacteria | 1016 |
| 57 | Ga0070668_100873713 | 3300005347 | Unclassified | 802 |
| 58 | Ga0070668_102085394 | 3300005347 | Bacteria | 523 |
| 59 | Ga0070669_100105297 | 3300005353 | Bacteria | 2134 |
| 60 | Ga0070669_100183311 | 3300005353 | Unclassified | 1639 |
| 61 | Ga0070669_100940671 | 3300005353 | Unclassified | 739 |
| 62 | Ga0070669_101389514 | 3300005353 | Unclassified | 609 |
| 63 | Ga0070675_100057218 | 3300005354 | Unclassified | 3214 |
| 64 | Ga0070675_100429850 | 3300005354 | Bacteria | 1182 |
| 65 | Ga0070675_101219367 | 3300005354 | Unclassified | 693 |
| 66 | Ga0070675_101290714 | 3300005354 | Unclassified | 673 |
| 67 | Ga0070671_100120360 | 3300005355 | Bacteria | 2209 |
| 68 | Ga0070671_100147903 | 3300005355 | Bacteria | 1983 |
| 69 | Ga0070671_100187945 | 3300005355 | Bacteria | 1750 |
| 70 | Ga0070671_100195242 | 3300005355 | Bacteria | 1716 |
| 71 | Ga0070671_100589699 | 3300005355 | Unclassified | 960 |
| 72 | Ga0070674_100148600 | 3300005356 | Bacteria | 1766 |
| 73 | Ga0070674_100210809 | 3300005356 | Unclassified | 1505 |
| 74 | Ga0070674_100285170 | 3300005356 | Bacteria | 1310 |
| 75 | Ga0070674_100398185 | 3300005356 | Unclassified | 1124 |
| 76 | Ga0070674_100887973 | 3300005356 | Unclassified | 776 |
| 77 | Ga0070674_101140347 | 3300005356 | Unclassified | 690 |
| 78 | Ga0070673_100053464 | 3300005364 | Bacteria | 3172 |
| 79 | Ga0070673_100066369 | 3300005364 | Bacteria | 2882 |
| 80 | Ga0070673_100172803 | 3300005364 | Bacteria | 1845 |
| 81 | Ga0070673_102080628 | 3300005364 | Unclassified | 539 |
| 82 | Ga0070688_100503498 | 3300005365 | Unclassified | 914 |
| 83 | Ga0070688_100791409 | 3300005365 | Unclassified | 741 |
| 84 | Ga0070659_100259758 | 3300005366 | Unclassified | 1441 |
| 85 | Ga0070667_100001051 | 3300005367 | Bacteria | 25201 |
| 86 | Ga0070667_100006417 | 3300005367 | Bacteria | 9775 |
| 87 | Ga0070667_100128514 | 3300005367 | Bacteria | 2210 |
| 88 | Ga0070667_100138748 | 3300005367 | Bacteria | 2127 |
| 89 | Ga0070667_100341335 | 3300005367 | Bacteria | 1354 |
| 90 | Ga0070667_100655223 | 3300005367 | Bacteria | 969 |
| 91 | Ga0070667_101628835 | 3300005367 | Bacteria | 607 |
| 92 | Ga0070714_100626221 | 3300005435 | Unclassified | 1035 |
| 93 | Ga0070713_100832444 | 3300005436 | Bacteria | 886 |
| 94 | Ga0070713_100858290 | 3300005436 | Bacteria | 872 |
| 95 | Ga0070713_101282997 | 3300005436 | Bacteria | 709 |
| 96 | Ga0070710_10710368 | 3300005437 | Unclassified | 710 |
| 97 | Ga0070711_100000034 | 3300005439 | Bacteria | 95912 |
| 98 | Ga0070711_101281959 | 3300005439 | Unclassified | 635 |
| 99 | Ga0070705_100486604 | 3300005440 | Bacteria | 934 |
| 100 | Ga0070705_101348026 | 3300005440 | Bacteria | 593 |
| 101 | Ga0070705_101448893 | 3300005440 | Bacteria | 574 |
| 102 | Ga0070700_100485934 | 3300005441 | Bacteria | 947 |
| 103 | Ga0070700_100545334 | 3300005441 | Unclassified | 900 |
| 104 | Ga0070694_101254484 | 3300005444 | Unclassified | 622 |
| 105 | Ga0070694_101565399 | 3300005444 | Unclassified | 559 |
| 106 | Ga0070708_102060234 | 3300005445 | Unclassified | 528 |
| 107 | Ga0070663_101323533 | 3300005455 | Unclassified | 636 |
| 108 | Ga0070678_100146613 | 3300005456 | Bacteria | 1895 |
| 109 | Ga0070678_100274857 | 3300005456 | Bacteria | 1422 |
| 110 | Ga0070678_100297867 | 3300005456 | Bacteria | 1370 |
| 111 | Ga0070678_100569943 | 3300005456 | Unclassified | 1007 |
| 112 | Ga0070678_100807793 | 3300005456 | Unclassified | 852 |
| 113 | Ga0070678_100876573 | 3300005456 | Unclassified | 819 |
| 114 | Ga0070678_100921623 | 3300005456 | Unclassified | 800 |
| 115 | Ga0070662_100246788 | 3300005457 | Bacteria | 1434 |
| 116 | Ga0070662_100974513 | 3300005457 | Unclassified | 725 |
| 117 | Ga0070681_10000277 | 3300005458 | Bacteria | 41097 |
| 118 | Ga0070681_10013079 | 3300005458 | Bacteria | 8241 |
| 119 | Ga0070681_10146165 | 3300005458 | Unclassified | 2293 |
| 120 | Ga0070681_10225312 | 3300005458 | Unclassified | 1789 |
| 121 | Ga0070681_10321470 | 3300005458 | Bacteria | 1457 |
| 122 | Ga0070681_10509578 | 3300005458 | Unclassified | 1117 |
| 123 | Ga0070681_10793512 | 3300005458 | Unclassified | 864 |
| 124 | Ga0068867_100023104 | 3300005459 | Bacteria | 4451 |
| 125 | Ga0068867_100920797 | 3300005459 | Unclassified | 788 |
| 126 | Ga0068867_100935396 | 3300005459 | Unclassified | 782 |
| 127 | Ga0068867_102023105 | 3300005459 | Bacteria | 545 |
| 128 | Ga0070685_10218311 | 3300005466 | Unclassified | 1248 |
| 129 | Ga0070685_10258809 | 3300005466 | Unclassified | 1156 |
| 130 | Ga0070707_100150543 | 3300005468 | Bacteria | 2266 |
| 131 | Ga0070707_100459353 | 3300005468 | Bacteria | 1234 |
| 132 | Ga0070698_101156672 | 3300005471 | Unclassified | 723 |
| 133 | Ga0070679_100020411 | 3300005530 | Bacteria | 6460 |
| 134 | Ga0070679_100044245 | 3300005530 | Bacteria | 4436 |
| 135 | Ga0070679_100123695 | 3300005530 | Bacteria | 2570 |
| 136 | Ga0070679_100265620 | 3300005530 | Bacteria | 1671 |
| 137 | Ga0070679_100596242 | 3300005530 | Unclassified | 1048 |
| 138 | Ga0070679_100815721 | 3300005530 | Bacteria | 876 |
| 139 | Ga0070679_101037253 | 3300005530 | Unclassified | 764 |
| 140 | Ga0070679_101634845 | 3300005530 | Unclassified | 592 |
| 141 | Ga0070684_100004819 | 3300005535 | Bacteria | 10305 |
| 142 | Ga0070684_100097126 | 3300005535 | Unclassified | 2627 |
| 143 | Ga0070684_100122765 | 3300005535 | Bacteria | 2337 |
| 144 | Ga0070684_100783566 | 3300005535 | Bacteria | 891 |
| 145 | Ga0068853_100012063 | 3300005539 | Bacteria | 7032 |
| 146 | Ga0068853_100012521 | 3300005539 | Bacteria | 6901 |
| 147 | Ga0068853_100116728 | 3300005539 | Bacteria | 2377 |
| 148 | Ga0070672_100007574 | 3300005543 | Bacteria | 7379 |
| 149 | Ga0070672_100024871 | 3300005543 | Bacteria | 4433 |
| 150 | Ga0070672_100710995 | 3300005543 | Unclassified | 880 |
| 151 | Ga0070686_100013755 | 3300005544 | Unclassified | 4642 |
| 152 | Ga0070686_100204295 | 3300005544 | Bacteria | 1418 |
| 153 | Ga0070686_100272503 | 3300005544 | Unclassified | 1245 |
| 154 | Ga0070686_101947409 | 3300005544 | Bacteria | 502 |
| 155 | Ga0070695_101035505 | 3300005545 | Unclassified | 669 |
| 156 | Ga0070695_101124633 | 3300005545 | Unclassified | 644 |
| 157 | Ga0070696_100680782 | 3300005546 | Unclassified | 837 |
| 158 | Ga0070693_100007674 | 3300005547 | Bacteria | 5283 |
| 159 | Ga0070693_100739856 | 3300005547 | Unclassified | 724 |
| 160 | Ga0070665_100002424 | 3300005548 | Bacteria | 20557 |
| 161 | Ga0070665_100665322 | 3300005548 | Bacteria | 1054 |
| 162 | Ga0070665_102252951 | 3300005548 | Unclassified | 548 |
| 163 | Ga0070704_100457338 | 3300005549 | Unclassified | 1100 |
| 164 | Ga0068855_100140430 | 3300005563 | Bacteria | 2754 |
| 165 | Ga0068855_100282700 | 3300005563 | Bacteria | 1842 |
| 166 | Ga0068855_100327140 | 3300005563 | Bacteria | 1693 |
| 167 | Ga0068855_100741520 | 3300005563 | Bacteria | 1048 |
| 168 | Ga0070664_100037509 | 3300005564 | Bacteria | 4075 |
| 169 | Ga0070664_100080692 | 3300005564 | Unclassified | 2802 |
| 170 | Ga0070664_100720420 | 3300005564 | Unclassified | 930 |
| 171 | Ga0070664_102288591 | 3300005564 | Unclassified | 513 |
| 172 | Ga0068857_100009726 | 3300005577 | Bacteria | 8353 |
| 173 | Ga0068857_100042068 | 3300005577 | Bacteria | 4052 |
| 174 | Ga0068857_101375990 | 3300005577 | Unclassified | 686 |
| 175 | Ga0068854_100494337 | 3300005578 | Unclassified | 1029 |
| 176 | Ga0068854_101134136 | 3300005578 | Unclassified | 698 |
| 177 | Ga0068854_101328548 | 3300005578 | Bacteria | 648 |
| 178 | Ga0068856_100000001 | 3300005614 | Bacteria | 565602 |
| 179 | Ga0068856_100039095 | 3300005614 | Bacteria | 4658 |
| 180 | Ga0068856_100089561 | 3300005614 | Bacteria | 3060 |
| 181 | Ga0068856_100460069 | 3300005614 | Bacteria | 1293 |
| 182 | Ga0068856_102371587 | 3300005614 | Unclassified | 538 |
| 183 | Ga0070702_100147511 | 3300005615 | Bacteria | 1506 |
| 184 | Ga0068852_100314248 | 3300005616 | Bacteria | 1520 |
| 185 | Ga0068852_101066879 | 3300005616 | Unclassified | 827 |
| 186 | Ga0068852_101206836 | 3300005616 | Bacteria | 777 |
| 187 | Ga0068852_101831934 | 3300005616 | Unclassified | 629 |
| 188 | Ga0068859_100063322 | 3300005617 | Bacteria | 3729 |
| 189 | Ga0068859_100118199 | 3300005617 | Bacteria | 2717 |
| 190 | Ga0068859_100136174 | 3300005617 | Unclassified | 2529 |
| 191 | Ga0068859_100511565 | 3300005617 | Unclassified | 1296 |
| 192 | Ga0068859_100619623 | 3300005617 | Bacteria | 1175 |
| 193 | Ga0068859_100624571 | 3300005617 | Bacteria | 1170 |
| 194 | Ga0068859_101039449 | 3300005617 | Bacteria | 900 |
| 195 | Ga0068859_101125852 | 3300005617 | Bacteria | 864 |
| 196 | Ga0068859_101662287 | 3300005617 | Bacteria | 705 |
| 197 | Ga0068859_102725635 | 3300005617 | Unclassified | 543 |
| 198 | Ga0068864_100009805 | 3300005618 | Bacteria | 7898 |
| 199 | Ga0068864_100100119 | 3300005618 | Bacteria | 2569 |
| 200 | Ga0068864_100401574 | 3300005618 | Unclassified | 1302 |
| 201 | Ga0068864_101233103 | 3300005618 | Bacteria | 747 |
| 202 | Ga0068864_102519451 | 3300005618 | Unclassified | 520 |
| 203 | Ga0068866_10385685 | 3300005718 | Unclassified | 900 |
| 204 | Ga0068861_101017335 | 3300005719 | Unclassified | 792 |
| 205 | Ga0068851_10084221 | 3300005834 | Bacteria | 1665 |
| 206 | Ga0068870_10137638 | 3300005840 | Unclassified | 1425 |
| 207 | Ga0068870_10672591 | 3300005840 | Unclassified | 711 |
| 208 | Ga0068863_100000665 | 3300005841 | Bacteria | 34641 |
| 209 | Ga0068863_100018390 | 3300005841 | Bacteria | 6689 |
| 210 | Ga0068863_100038650 | 3300005841 | Bacteria | 4540 |
| 211 | Ga0068863_100091145 | 3300005841 | Bacteria | 2890 |
| 212 | Ga0068863_100107190 | 3300005841 | Unclassified | 2658 |
| 213 | Ga0068863_100139898 | 3300005841 | Unclassified | 2313 |
| 214 | Ga0068863_100231180 | 3300005841 | Bacteria | 1784 |
| 215 | Ga0068863_100311563 | 3300005841 | Unclassified | 1528 |
| 216 | Ga0068858_100008434 | 3300005842 | Bacteria | 9908 |
| 217 | Ga0068858_100114498 | 3300005842 | Unclassified | 2520 |
| 218 | Ga0068858_100142832 | 3300005842 | Bacteria | 2248 |
| 219 | Ga0068858_100199400 | 3300005842 | Bacteria | 1892 |
| 220 | Ga0068858_100741555 | 3300005842 | Unclassified | 957 |
| 221 | Ga0068858_101433318 | 3300005842 | Unclassified | 681 |
| 222 | Ga0068858_101718545 | 3300005842 | Bacteria | 620 |
| 223 | Ga0068860_100024709 | 3300005843 | Bacteria | 5803 |
| 224 | Ga0068860_100129405 | 3300005843 | Bacteria | 2421 |
| 225 | Ga0068860_100183298 | 3300005843 | Unclassified | 2024 |
| 226 | Ga0068860_100328041 | 3300005843 | Bacteria | 1503 |
| 227 | Ga0068860_101185949 | 3300005843 | Unclassified | 784 |
| 228 | Ga0068862_100024578 | 3300005844 | Bacteria | 5056 |
| 229 | Ga0068862_100192101 | 3300005844 | Unclassified | 1838 |
| 230 | Ga0068862_100517306 | 3300005844 | Bacteria | 1135 |
| 231 | Ga0081455_10024812 | 3300005937 | Bacteria | 5543 |
| 232 | Ga0081455_10433448 | 3300005937 | Unclassified | 903 |
| 233 | Ga0075368_10162061 | 3300006042 | Bacteria | 937 |
| 234 | Ga0075368_10245610 | 3300006042 | Unclassified | 764 |
| 235 | Ga0075364_10026629 | 3300006051 | Unclassified | 3690 |
| 236 | Ga0075364_10038708 | 3300006051 | Unclassified | 3090 |
| 237 | Ga0075432_10133411 | 3300006058 | Bacteria | 942 |
| 238 | Ga0070716_100229622 | 3300006173 | Bacteria | 1252 |
| 239 | Ga0070716_100244523 | 3300006173 | Bacteria | 1219 |
| 240 | Ga0097621_100011887 | 3300006237 | Bacteria | 6438 |
| 241 | Ga0097621_100016353 | 3300006237 | Bacteria | 5606 |
| 242 | Ga0097621_100051013 | 3300006237 | Bacteria | 3366 |
| 243 | Ga0097621_100129336 | 3300006237 | Bacteria | 2148 |
| 244 | Ga0097621_100195492 | 3300006237 | Unclassified | 1754 |
| 245 | Ga0097621_100916974 | 3300006237 | Unclassified | 817 |
| 246 | Ga0068871_100039347 | 3300006358 | Bacteria | 3783 |
| 247 | Ga0068871_100056075 | 3300006358 | Unclassified | 3202 |
| 248 | Ga0068871_100134365 | 3300006358 | Unclassified | 2100 |
| 249 | Ga0068871_100136777 | 3300006358 | Unclassified | 2081 |
| 250 | Ga0068871_100197298 | 3300006358 | Bacteria | 1736 |
| 251 | Ga0068871_100249390 | 3300006358 | Unclassified | 1546 |
| 252 | Ga0068871_100629206 | 3300006358 | Unclassified | 978 |
| 253 | Ga0068871_101185544 | 3300006358 | Bacteria | 716 |
| 254 | Ga0075428_100000574 | 3300006844 | Bacteria | 37525 |
| 255 | Ga0075428_100157590 | 3300006844 | Bacteria | 2465 |
| 256 | Ga0075428_100259211 | 3300006844 | Unclassified | 1872 |
| 257 | Ga0075430_100131173 | 3300006846 | Bacteria | 2088 |
| 258 | Ga0075431_100255474 | 3300006847 | Bacteria | 1780 |
| 259 | Ga0075431_100366964 | 3300006847 | Bacteria | 1445 |
| 260 | Ga0075433_10753686 | 3300006852 | Bacteria | 852 |
| 261 | Ga0075434_100122664 | 3300006871 | Bacteria | 2614 |
| 262 | Ga0075434_100150670 | 3300006871 | Bacteria | 2346 |
| 263 | Ga0075429_100082854 | 3300006880 | Bacteria | 2796 |
| 264 | Ga0075429_100091566 | 3300006880 | Bacteria | 2652 |
| 265 | Ga0068865_100002579 | 3300006881 | Bacteria | 10756 |
| 266 | Ga0068865_100029325 | 3300006881 | Bacteria | 3650 |
| 267 | Ga0068865_100070439 | 3300006881 | Bacteria | 2478 |
| 268 | Ga0068865_100152186 | 3300006881 | Bacteria | 1756 |
| 269 | Ga0068865_101743681 | 3300006881 | Bacteria | 562 |
| 270 | Ga0068865_102012575 | 3300006881 | Unclassified | 524 |
| 271 | Ga0075436_101524788 | 3300006914 | Bacteria | 508 |
| 272 | Ga0097620_100063325 | 3300006931 | Bacteria | 3729 |
| 273 | Ga0097620_100118198 | 3300006931 | Bacteria | 2717 |
| 274 | Ga0097620_100136168 | 3300006931 | Unclassified | 2529 |
| 275 | Ga0097620_100511578 | 3300006931 | Unclassified | 1296 |
| 276 | Ga0097620_100619708 | 3300006931 | Bacteria | 1175 |
| 277 | Ga0097620_100624583 | 3300006931 | Bacteria | 1170 |
| 278 | Ga0097620_101039573 | 3300006931 | Bacteria | 900 |
| 279 | Ga0097620_101125683 | 3300006931 | Bacteria | 864 |
| 280 | Ga0097620_101662098 | 3300006931 | Bacteria | 705 |
| 281 | Ga0097620_102725734 | 3300006931 | Unclassified | 543 |
| 282 | Ga0099795_10361773 | 3300007788 | Bacteria | 651 |
| 283 | Ga0105251_10325794 | 3300009011 | Bacteria | 698 |
| 284 | Ga0105240_10033308 | 3300009093 | Bacteria | 6659 |
| 285 | Ga0105240_10195764 | 3300009093 | Bacteria | 2373 |
| 286 | Ga0105240_10208043 | 3300009093 | Bacteria | 2288 |
| 287 | Ga0105240_10264741 | 3300009093 | Bacteria | 1982 |
| 288 | Ga0105240_10282646 | 3300009093 | Bacteria | 1905 |
| 289 | Ga0105240_10540088 | 3300009093 | Bacteria | 1291 |
| 290 | Ga0105240_11026932 | 3300009093 | Bacteria | 881 |
| 291 | Ga0105240_12123896 | 3300009093 | Unclassified | 583 |
| 292 | Ga0111539_10000282 | 3300009094 | Bacteria | 61040 |
| 293 | Ga0111539_10000811 | 3300009094 | Bacteria | 40581 |
| 294 | Ga0111539_10092584 | 3300009094 | Bacteria | 3552 |
| 295 | Ga0111539_10095837 | 3300009094 | Bacteria | 3485 |
| 296 | Ga0111539_10567516 | 3300009094 | Unclassified | 1322 |
| 297 | Ga0111539_13034792 | 3300009094 | Bacteria | 542 |
| 298 | Ga0105245_10538622 | 3300009098 | Bacteria | 1188 |
| 299 | Ga0105245_10725818 | 3300009098 | Bacteria | 1028 |
| 300 | Ga0105245_11513876 | 3300009098 | Bacteria | 722 |
| 301 | Ga0105245_12095569 | 3300009098 | Unclassified | 619 |
| 302 | Ga0105247_10187319 | 3300009101 | Bacteria | 1384 |
| 303 | Ga0105247_10226314 | 3300009101 | Unclassified | 1268 |
| 304 | Ga0105247_11123103 | 3300009101 | Bacteria | 621 |
| 305 | Ga0105247_11344490 | 3300009101 | Unclassified | 576 |
| 306 | Ga0114129_10000741 | 3300009147 | Bacteria | 41481 |
| 307 | Ga0114129_10075673 | 3300009147 | Bacteria | 4687 |
| 308 | Ga0114129_10158596 | 3300009147 | Bacteria | 3093 |
| 309 | Ga0114129_10785109 | 3300009147 | Bacteria | 1216 |
| 310 | Ga0114129_11329456 | 3300009147 | Bacteria | 890 |
| 311 | Ga0105243_10338676 | 3300009148 | Bacteria | 1377 |
| 312 | Ga0105243_10502515 | 3300009148 | Bacteria | 1149 |
| 313 | Ga0105243_11243149 | 3300009148 | Bacteria | 760 |
| 314 | Ga0105243_11543735 | 3300009148 | Unclassified | 689 |
| 315 | Ga0105243_12284170 | 3300009148 | Bacteria | 578 |
| 316 | Ga0105241_10012309 | 3300009174 | Bacteria | 6276 |
| 317 | Ga0105241_10386150 | 3300009174 | Bacteria | 1225 |
| 318 | Ga0105241_11402181 | 3300009174 | Unclassified | 669 |
| 319 | Ga0105241_11414968 | 3300009174 | Unclassified | 666 |
| 320 | Ga0105241_12312710 | 3300009174 | Unclassified | 535 |
| 321 | Ga0105242_10005186 | 3300009176 | Bacteria | 10060 |
| 322 | Ga0105242_10321088 | 3300009176 | Bacteria | 1420 |
| 323 | Ga0105242_10486745 | 3300009176 | Bacteria | 1170 |
| 324 | Ga0105242_12035086 | 3300009176 | Unclassified | 617 |
| 325 | Ga0105242_12574073 | 3300009176 | Unclassified | 558 |
| 326 | Ga0105242_12945088 | 3300009176 | Bacteria | 526 |
| 327 | Ga0105248_10033995 | 3300009177 | Bacteria | 5699 |
| 328 | Ga0105248_10079800 | 3300009177 | Bacteria | 3678 |
| 329 | Ga0105248_10172202 | 3300009177 | Unclassified | 2440 |
| 330 | Ga0105248_10641630 | 3300009177 | Bacteria | 1198 |
| 331 | Ga0105248_10691462 | 3300009177 | Bacteria | 1151 |
| 332 | Ga0105248_10909020 | 3300009177 | Unclassified | 994 |
| 333 | Ga0105248_12542943 | 3300009177 | Bacteria | 584 |
| 334 | Ga0105248_12826096 | 3300009177 | Bacteria | 554 |
| 335 | Ga0105237_10091701 | 3300009545 | Bacteria | 3028 |
| 336 | Ga0105237_10225794 | 3300009545 | Bacteria | 1873 |
| 337 | Ga0105237_10228044 | 3300009545 | Bacteria | 1863 |
| 338 | Ga0105237_10547063 | 3300009545 | Bacteria | 1164 |
| 339 | Ga0105238_10024332 | 3300009551 | Bacteria | 6172 |
| 340 | Ga0105238_10136472 | 3300009551 | Bacteria | 2431 |
| 341 | Ga0105238_10149432 | 3300009551 | Unclassified | 2312 |
| 342 | Ga0105238_10156998 | 3300009551 | Bacteria | 2250 |
| 343 | Ga0105238_10548458 | 3300009551 | Bacteria | 1160 |
| 344 | Ga0105238_10782973 | 3300009551 | Bacteria | 969 |
| 345 | Ga0105238_12389179 | 3300009551 | Unclassified | 564 |
| 346 | Ga0105249_10032077 | 3300009553 | Bacteria | 4752 |
| 347 | Ga0105249_10064664 | 3300009553 | Bacteria | 3364 |
| 348 | Ga0105249_10839179 | 3300009553 | Unclassified | 984 |
| 349 | Ga0105249_10897032 | 3300009553 | Bacteria | 953 |
| 350 | Ga0105249_11024298 | 3300009553 | Bacteria | 895 |
| 351 | Ga0105249_11344408 | 3300009553 | Unclassified | 786 |
| 352 | Ga0105249_11695204 | 3300009553 | Unclassified | 704 |
| 353 | Ga0105249_12036321 | 3300009553 | Unclassified | 647 |
| 354 | Ga0105249_12347366 | 3300009553 | Unclassified | 606 |
| 355 | Ga0099796_10243783 | 3300010159 | Unclassified | 744 |
| 356 | Ga0105239_10029577 | 3300010375 | Bacteria | 6023 |
| 357 | Ga0105239_10302478 | 3300010375 | Bacteria | 1801 |
| 358 | Ga0105239_11172436 | 3300010375 | Unclassified | 885 |
| 359 | Ga0105246_10762317 | 3300011119 | Unclassified | 855 |
| 360 | Ga0105246_11066594 | 3300011119 | Bacteria | 736 |
| 361 | Ga0157345_1020075 | 3300012498 | Unclassified | 673 |
| 362 | Ga0157373_10341878 | 3300013100 | Unclassified | 1067 |
| 363 | Ga0157370_10095615 | 3300013104 | Bacteria | 2787 |
| 364 | Ga0157370_10255611 | 3300013104 | Bacteria | 1620 |
| 365 | Ga0157370_11209936 | 3300013104 | Unclassified | 681 |
| 366 | Ga0157369_10010475 | 3300013105 | Bacteria | 10560 |
| 367 | Ga0157369_10386305 | 3300013105 | Bacteria | 1453 |
| 368 | Ga0157369_12287005 | 3300013105 | Unclassified | 548 |
| 369 | Ga0157374_10090156 | 3300013296 | Bacteria | 2922 |
| 370 | Ga0157374_10325062 | 3300013296 | Bacteria | 1525 |
| 371 | Ga0157374_10488935 | 3300013296 | Unclassified | 1234 |
| 372 | Ga0157374_10843957 | 3300013296 | Unclassified | 933 |
| 373 | Ga0157374_11460446 | 3300013296 | Unclassified | 707 |
| 374 | Ga0157378_10226566 | 3300013297 | Bacteria | 1779 |
| 375 | Ga0157378_10805152 | 3300013297 | Bacteria | 965 |
| 376 | Ga0157378_11239745 | 3300013297 | Unclassified | 786 |
| 377 | Ga0157378_11506639 | 3300013297 | Unclassified | 717 |
| 378 | Ga0157378_11914364 | 3300013297 | Unclassified | 642 |
| 379 | Ga0163162_10008586 | 3300013306 | Bacteria | 9959 |
| 380 | Ga0163162_10012175 | 3300013306 | Bacteria | 8396 |
| 381 | Ga0163162_10012584 | 3300013306 | Bacteria | 8262 |
| 382 | Ga0163162_10094707 | 3300013306 | Bacteria | 3073 |
| 383 | Ga0163162_10393368 | 3300013306 | Bacteria | 1519 |
| 384 | Ga0163162_10436571 | 3300013306 | Unclassified | 1441 |
| 385 | Ga0163162_11950046 | 3300013306 | Bacteria | 672 |
| 386 | Ga0163162_13104526 | 3300013306 | Unclassified | 533 |
| 387 | Ga0157372_10016904 | 3300013307 | Bacteria | 7831 |
| 388 | Ga0157372_10039046 | 3300013307 | Bacteria | 5239 |
| 389 | Ga0157375_10001545 | 3300013308 | Bacteria | 19803 |
| 390 | Ga0157375_10008862 | 3300013308 | Bacteria | 8807 |
| 391 | Ga0157375_10081907 | 3300013308 | Bacteria | 3268 |
| 392 | Ga0157375_10487214 | 3300013308 | Bacteria | 1398 |
| 393 | Ga0157375_10592075 | 3300013308 | Bacteria | 1269 |
| 394 | Ga0157375_11855447 | 3300013308 | Bacteria | 715 |
| 395 | Ga0157375_11982413 | 3300013308 | Unclassified | 692 |
| 396 | Ga0157375_12429222 | 3300013308 | Unclassified | 625 |
| 397 | Ga0157375_12460960 | 3300013308 | Bacteria | 621 |
| 398 | Ga0163163_10007882 | 3300014325 | Bacteria | 9415 |
| 399 | Ga0163163_10090956 | 3300014325 | Unclassified | 3065 |
| 400 | Ga0163163_10226311 | 3300014325 | Bacteria | 1919 |
| 401 | Ga0163163_10904850 | 3300014325 | Bacteria | 946 |
| 402 | Ga0163163_11285133 | 3300014325 | Bacteria | 794 |
| 403 | Ga0163163_11362200 | 3300014325 | Unclassified | 771 |
| 404 | Ga0163163_11897706 | 3300014325 | Unclassified | 656 |
| 405 | Ga0157380_10029095 | 3300014326 | Unclassified | 4221 |
| 406 | Ga0157380_10560241 | 3300014326 | Unclassified | 1123 |
| 407 | Ga0157380_10585159 | 3300014326 | Bacteria | 1101 |
| 408 | Ga0157380_11764318 | 3300014326 | Unclassified | 677 |
| 409 | Ga0157380_11920112 | 3300014326 | Unclassified | 653 |
| 410 | Ga0157380_11953778 | 3300014326 | Unclassified | 648 |
| 411 | Ga0182008_10035121 | 3300014497 | Bacteria | 2513 |
| 412 | Ga0157377_10163465 | 3300014745 | Bacteria | 1386 |
| 413 | Ga0157377_10423428 | 3300014745 | Unclassified | 912 |
| 414 | Ga0157377_10435147 | 3300014745 | Unclassified | 902 |
| 415 | Ga0157377_10700305 | 3300014745 | Unclassified | 735 |
| 416 | Ga0157379_10018917 | 3300014968 | Bacteria | 6078 |
| 417 | Ga0157379_10267847 | 3300014968 | Bacteria | 1553 |
| 418 | Ga0157379_10377169 | 3300014968 | Unclassified | 1301 |
| 419 | Ga0157379_10411835 | 3300014968 | Bacteria | 1244 |
| 420 | Ga0157379_10877181 | 3300014968 | Bacteria | 850 |
| 421 | Ga0157379_11266050 | 3300014968 | Bacteria | 711 |
| 422 | Ga0157379_12445070 | 3300014968 | Bacteria | 522 |
| 423 | Ga0157376_10001440 | 3300014969 | Bacteria | 15645 |
| 424 | Ga0157376_10003448 | 3300014969 | Bacteria | 10892 |
| 425 | Ga0157376_10136478 | 3300014969 | Unclassified | 2196 |
| 426 | Ga0157376_10171114 | 3300014969 | Bacteria | 1978 |
| 427 | Ga0157376_10276977 | 3300014969 | Bacteria | 1578 |
| 428 | Ga0157376_10431250 | 3300014969 | Unclassified | 1281 |
| 429 | Ga0157376_10566622 | 3300014969 | Unclassified | 1126 |
| 430 | Ga0157376_10951252 | 3300014969 | Unclassified | 879 |
| 431 | Ga0157376_11786839 | 3300014969 | Bacteria | 651 |
| 432 | Ga0163161_10293506 | 3300017792 | Unclassified | 1278 |
| 433 | Ga0163161_10344345 | 3300017792 | Bacteria | 1183 |
| 434 | Ga0163161_11575943 | 3300017792 | Unclassified | 579 |
| 435 | Ga0154015_1623859 | 3300020610 | Bacteria | 656 |
| 436 | Ga0207697_10072222 | 3300025315 | Unclassified | 1447 |
| 437 | Ga0207697_10318934 | 3300025315 | Unclassified | 690 |
| 438 | Ga0207697_10417204 | 3300025315 | Unclassified | 596 |
| 439 | Ga0207656_10063405 | 3300025321 | Bacteria | 1627 |
| 440 | Ga0207642_10106813 | 3300025899 | Unclassified | 1417 |
| 441 | Ga0207642_10205918 | 3300025899 | Unclassified | 1090 |
| 442 | Ga0207710_10065489 | 3300025900 | Unclassified | 1657 |
| 443 | Ga0207688_10249364 | 3300025901 | Unclassified | 1075 |
| 444 | Ga0207680_10012690 | 3300025903 | Bacteria | 4300 |
| 445 | Ga0207680_10018329 | 3300025903 | Bacteria | 3719 |
| 446 | Ga0207647_10000547 | 3300025904 | Bacteria | 29945 |
| 447 | Ga0207685_10642333 | 3300025905 | Unclassified | 573 |
| 448 | Ga0207645_10079544 | 3300025907 | Unclassified | 2101 |
| 449 | Ga0207645_11113305 | 3300025907 | Unclassified | 532 |
| 450 | Ga0207654_10241381 | 3300025911 | Bacteria | 1207 |
| 451 | Ga0207707_10000021 | 3300025912 | Bacteria | 199548 |
| 452 | Ga0207707_10000125 | 3300025912 | Bacteria | 79965 |
| 453 | Ga0207707_10232313 | 3300025912 | Bacteria | 1604 |
| 454 | Ga0207707_10275121 | 3300025912 | Bacteria | 1459 |
| 455 | Ga0207707_10635348 | 3300025912 | Unclassified | 901 |
| 456 | Ga0207707_10908107 | 3300025912 | Bacteria | 728 |
| 457 | Ga0207695_10068626 | 3300025913 | Bacteria | 3632 |
| 458 | Ga0207695_10080105 | 3300025913 | Bacteria | 3308 |
| 459 | Ga0207695_10143122 | 3300025913 | Bacteria | 2337 |
| 460 | Ga0207695_10380344 | 3300025913 | Bacteria | 1298 |
| 461 | Ga0207671_10217397 | 3300025914 | Bacteria | 1496 |
| 462 | Ga0207671_10409002 | 3300025914 | Bacteria | 1079 |
| 463 | Ga0207671_10823447 | 3300025914 | Unclassified | 736 |
| 464 | Ga0207663_10000002 | 3300025916 | Bacteria | 534155 |
| 465 | Ga0207663_10164244 | 3300025916 | Bacteria | 1571 |
| 466 | Ga0207660_10611740 | 3300025917 | Bacteria | 888 |
| 467 | Ga0207660_10960600 | 3300025917 | Bacteria | 697 |
| 468 | Ga0207660_11171621 | 3300025917 | Bacteria | 626 |
| 469 | Ga0207662_10040400 | 3300025918 | Bacteria | 2742 |
| 470 | Ga0207662_11302837 | 3300025918 | Unclassified | 516 |
| 471 | Ga0207657_10008520 | 3300025919 | Bacteria | 10397 |
| 472 | Ga0207649_10123772 | 3300025920 | Bacteria | 1747 |
| 473 | Ga0207649_10350558 | 3300025920 | Unclassified | 1092 |
| 474 | Ga0207649_10607044 | 3300025920 | Unclassified | 842 |
| 475 | Ga0207649_10952231 | 3300025920 | Bacteria | 674 |
| 476 | Ga0207652_10011466 | 3300025921 | Bacteria | 7145 |
| 477 | Ga0207652_10084122 | 3300025921 | Bacteria | 2787 |
| 478 | Ga0207652_10093547 | 3300025921 | Bacteria | 2645 |
| 479 | Ga0207652_10124678 | 3300025921 | Unclassified | 2294 |
| 480 | Ga0207652_10245743 | 3300025921 | Bacteria | 1613 |
| 481 | Ga0207652_10668381 | 3300025921 | Bacteria | 928 |
| 482 | Ga0207652_10867278 | 3300025921 | Bacteria | 799 |
| 483 | Ga0207646_10338017 | 3300025922 | Bacteria | 1360 |
| 484 | Ga0207646_10393161 | 3300025922 | Bacteria | 1252 |
| 485 | Ga0207646_10941965 | 3300025922 | Bacteria | 765 |
| 486 | Ga0207681_10086761 | 3300025923 | Bacteria | 2225 |
| 487 | Ga0207681_10217023 | 3300025923 | Unclassified | 1478 |
| 488 | Ga0207681_11280559 | 3300025923 | Unclassified | 616 |
| 489 | Ga0207694_10091391 | 3300025924 | Bacteria | 2402 |
| 490 | Ga0207694_10163944 | 3300025924 | Unclassified | 1797 |
| 491 | Ga0207694_10217497 | 3300025924 | Bacteria | 1558 |
| 492 | Ga0207694_10813667 | 3300025924 | Unclassified | 789 |
| 493 | Ga0207694_11415734 | 3300025924 | Unclassified | 587 |
| 494 | Ga0207650_10002523 | 3300025925 | Bacteria | 12700 |
| 495 | Ga0207650_10007320 | 3300025925 | Bacteria | 7515 |
| 496 | Ga0207650_10420629 | 3300025925 | Unclassified | 1109 |
| 497 | Ga0207659_10022086 | 3300025926 | Unclassified | 4234 |
| 498 | Ga0207659_10250903 | 3300025926 | Bacteria | 1436 |
| 499 | Ga0207659_10312122 | 3300025926 | Unclassified | 1295 |
| 500 | Ga0207659_10393558 | 3300025926 | Unclassified | 1158 |
| 501 | Ga0207687_11636935 | 3300025927 | Unclassified | 552 |
| 502 | Ga0207700_10034840 | 3300025928 | Unclassified | 3619 |
| 503 | Ga0207700_10396795 | 3300025928 | Bacteria | 1208 |
| 504 | Ga0207700_10946942 | 3300025928 | Unclassified | 771 |
| 505 | Ga0207664_11582101 | 3300025929 | Unclassified | 577 |
| 506 | Ga0207644_10037727 | 3300025931 | Bacteria | 3402 |
| 507 | Ga0207644_10046153 | 3300025931 | Bacteria | 3102 |
| 508 | Ga0207644_10078164 | 3300025931 | Bacteria | 2438 |
| 509 | Ga0207644_10711806 | 3300025931 | Unclassified | 838 |
| 510 | Ga0207644_10994791 | 3300025931 | Unclassified | 704 |
| 511 | Ga0207690_10006797 | 3300025932 | Bacteria | 6783 |
| 512 | Ga0207690_10335998 | 3300025932 | Bacteria | 1191 |
| 513 | Ga0207706_10216529 | 3300025933 | Bacteria | 1678 |
| 514 | Ga0207686_10027013 | 3300025934 | Bacteria | 3356 |
| 515 | Ga0207686_10147597 | 3300025934 | Bacteria | 1633 |
| 516 | Ga0207709_10639489 | 3300025935 | Unclassified | 846 |
| 517 | Ga0207709_11463259 | 3300025935 | Unclassified | 566 |
| 518 | Ga0207709_11826478 | 3300025935 | Bacteria | 506 |
| 519 | Ga0207670_10235963 | 3300025936 | Bacteria | 1407 |
| 520 | Ga0207670_10611816 | 3300025936 | Bacteria | 895 |
| 521 | Ga0207669_10148573 | 3300025937 | Bacteria | 1638 |
| 522 | Ga0207669_10459258 | 3300025937 | Bacteria | 1011 |
| 523 | Ga0207669_10543172 | 3300025937 | Bacteria | 937 |
| 524 | Ga0207669_10587066 | 3300025937 | Bacteria | 904 |
| 525 | Ga0207704_10046495 | 3300025938 | Bacteria | 2587 |
| 526 | Ga0207704_10057420 | 3300025938 | Bacteria | 2391 |
| 527 | Ga0207704_10202730 | 3300025938 | Bacteria | 1453 |
| 528 | Ga0207704_10466918 | 3300025938 | Bacteria | 1010 |
| 529 | Ga0207665_10289987 | 3300025939 | Bacteria | 1220 |
| 530 | Ga0207691_10014898 | 3300025940 | Bacteria | 7408 |
| 531 | Ga0207691_10023330 | 3300025940 | Bacteria | 5824 |
| 532 | Ga0207691_10033677 | 3300025940 | Bacteria | 4771 |
| 533 | Ga0207691_11743898 | 3300025940 | Bacteria | 503 |
| 534 | Ga0207711_10058759 | 3300025941 | Bacteria | 3310 |
| 535 | Ga0207711_10093642 | 3300025941 | Unclassified | 2646 |
| 536 | Ga0207711_10141809 | 3300025941 | Bacteria | 2163 |
| 537 | Ga0207711_11084227 | 3300025941 | Unclassified | 742 |
| 538 | Ga0207711_11128336 | 3300025941 | Unclassified | 725 |
| 539 | Ga0207689_10116757 | 3300025942 | Bacteria | 2194 |
| 540 | Ga0207689_10235497 | 3300025942 | Bacteria | 1513 |
| 541 | Ga0207689_10509175 | 3300025942 | Unclassified | 1009 |
| 542 | Ga0207689_10715740 | 3300025942 | Bacteria | 844 |
| 543 | Ga0207689_11177520 | 3300025942 | Unclassified | 645 |
| 544 | Ga0207661_10084451 | 3300025944 | Bacteria | 2630 |
| 545 | Ga0207661_10124396 | 3300025944 | Bacteria | 2200 |
| 546 | Ga0207661_10128475 | 3300025944 | Unclassified | 2167 |
| 547 | Ga0207679_10104089 | 3300025945 | Bacteria | 2226 |
| 548 | Ga0207667_10062259 | 3300025949 | Bacteria | 3902 |
| 549 | Ga0207667_10781852 | 3300025949 | Unclassified | 952 |
| 550 | Ga0207667_10793616 | 3300025949 | Unclassified | 944 |
| 551 | Ga0207667_11203161 | 3300025949 | Bacteria | 737 |
| 552 | Ga0207651_10066552 | 3300025960 | Bacteria | 2532 |
| 553 | Ga0207651_10312223 | 3300025960 | Bacteria | 1311 |
| 554 | Ga0207712_10030506 | 3300025961 | Bacteria | 3625 |
| 555 | Ga0207712_10517630 | 3300025961 | Unclassified | 1022 |
| 556 | Ga0207712_10700445 | 3300025961 | Unclassified | 884 |
| 557 | Ga0207712_10772103 | 3300025961 | Unclassified | 843 |
| 558 | Ga0207668_11178481 | 3300025972 | Bacteria | 688 |
| 559 | Ga0207668_11184262 | 3300025972 | Unclassified | 686 |
| 560 | Ga0207640_10137196 | 3300025981 | Bacteria | 1778 |
| 561 | Ga0207640_10530009 | 3300025981 | Bacteria | 986 |
| 562 | Ga0207640_11164046 | 3300025981 | Unclassified | 684 |
| 563 | Ga0207658_10078039 | 3300025986 | Bacteria | 2529 |
| 564 | Ga0207658_10115621 | 3300025986 | Bacteria | 2129 |
| 565 | Ga0207658_10147234 | 3300025986 | Bacteria | 1914 |
| 566 | Ga0207658_10819908 | 3300025986 | Bacteria | 845 |
| 567 | Ga0207658_11056192 | 3300025986 | Unclassified | 741 |
| 568 | Ga0207677_10004548 | 3300026023 | Bacteria | 7459 |
| 569 | Ga0207677_10131867 | 3300026023 | Unclassified | 1899 |
| 570 | Ga0207677_11042532 | 3300026023 | Unclassified | 743 |
| 571 | Ga0207703_10020956 | 3300026035 | Bacteria | 5114 |
| 572 | Ga0207703_10035581 | 3300026035 | Unclassified | 3957 |
| 573 | Ga0207703_10426240 | 3300026035 | Unclassified | 1235 |
| 574 | Ga0207703_10468844 | 3300026035 | Unclassified | 1179 |
| 575 | Ga0207703_10856925 | 3300026035 | Bacteria | 869 |
| 576 | Ga0207703_11417275 | 3300026035 | Unclassified | 668 |
| 577 | Ga0207703_11858570 | 3300026035 | Bacteria | 578 |
| 578 | Ga0207639_10046521 | 3300026041 | Bacteria | 3274 |
| 579 | Ga0207639_10298030 | 3300026041 | Unclassified | 1424 |
| 580 | Ga0207639_10594021 | 3300026041 | Bacteria | 1020 |
| 581 | Ga0207639_11409460 | 3300026041 | Unclassified | 654 |
| 582 | Ga0207678_10906896 | 3300026067 | Unclassified | 779 |
| 583 | Ga0207708_10378534 | 3300026075 | Unclassified | 1167 |
| 584 | Ga0207708_10415785 | 3300026075 | Bacteria | 1114 |
| 585 | Ga0207708_10879157 | 3300026075 | Bacteria | 775 |
| 586 | Ga0207708_11184688 | 3300026075 | Bacteria | 668 |
| 587 | Ga0207702_10000001 | 3300026078 | Bacteria | 895738 |
| 588 | Ga0207702_10148597 | 3300026078 | Bacteria | 2129 |
| 589 | Ga0207702_10182357 | 3300026078 | Bacteria | 1934 |
| 590 | Ga0207702_10451802 | 3300026078 | Bacteria | 1247 |
| 591 | Ga0207641_10002906 | 3300026088 | Bacteria | 15499 |
| 592 | Ga0207641_10021290 | 3300026088 | Bacteria | 5331 |
| 593 | Ga0207641_10054112 | 3300026088 | Bacteria | 3404 |
| 594 | Ga0207641_10054759 | 3300026088 | Unclassified | 3386 |
| 595 | Ga0207641_10075115 | 3300026088 | Unclassified | 2918 |
| 596 | Ga0207641_10136726 | 3300026088 | Unclassified | 2207 |
| 597 | Ga0207641_10278973 | 3300026088 | Unclassified | 1571 |
| 598 | Ga0207641_10280731 | 3300026088 | Bacteria | 1566 |
| 599 | Ga0207641_10551168 | 3300026088 | Unclassified | 1124 |
| 600 | Ga0207641_11230550 | 3300026088 | Unclassified | 749 |
| 601 | Ga0207648_10008756 | 3300026089 | Bacteria | 9753 |
| 602 | Ga0207648_10290617 | 3300026089 | Bacteria | 1463 |
| 603 | Ga0207648_11407997 | 3300026089 | Bacteria | 655 |
| 604 | Ga0207648_11512079 | 3300026089 | Unclassified | 631 |
| 605 | Ga0207676_10008407 | 3300026095 | Bacteria | 7338 |
| 606 | Ga0207676_10009375 | 3300026095 | Bacteria | 6967 |
| 607 | Ga0207676_10068273 | 3300026095 | Bacteria | 2843 |
| 608 | Ga0207676_10220274 | 3300026095 | Unclassified | 1689 |
| 609 | Ga0207676_10536569 | 3300026095 | Bacteria | 1116 |
| 610 | Ga0207674_10003167 | 3300026116 | Bacteria | 20254 |
| 611 | Ga0207674_10015346 | 3300026116 | Bacteria | 8418 |
| 612 | Ga0207674_10287704 | 3300026116 | Bacteria | 1592 |
| 613 | Ga0207674_11673198 | 3300026116 | Bacteria | 605 |
| 614 | Ga0207675_100544863 | 3300026118 | Bacteria | 1159 |
| 615 | Ga0207675_101385288 | 3300026118 | Unclassified | 724 |
| 616 | Ga0207683_10001251 | 3300026121 | Bacteria | 23033 |
| 617 | Ga0207683_10272937 | 3300026121 | Unclassified | 1545 |
| 618 | Ga0207683_10574426 | 3300026121 | Bacteria | 1043 |
| 619 | Ga0207683_10847248 | 3300026121 | Bacteria | 849 |
| 620 | Ga0207683_10859600 | 3300026121 | Unclassified | 842 |
| 621 | Ga0207698_10344366 | 3300026142 | Unclassified | 1405 |
| 622 | Ga0207698_11178738 | 3300026142 | Unclassified | 780 |
| 623 | Ga0209974_10006568 | 3300027876 | Unclassified | 4055 |
| 624 | Ga0207428_10000195 | 3300027907 | Bacteria | 84698 |
| 625 | Ga0207428_10062289 | 3300027907 | Bacteria | 2950 |
| 626 | Ga0207428_10559590 | 3300027907 | Bacteria | 826 |
| 627 | Ga0268266_10001574 | 3300028379 | Bacteria | 26660 |
| 628 | Ga0268266_10649084 | 3300028379 | Bacteria | 1016 |
| 629 | Ga0268265_10057738 | 3300028380 | Bacteria | 2960 |
| 630 | Ga0268265_10184475 | 3300028380 | Bacteria | 1796 |
| 631 | Ga0268265_10352273 | 3300028380 | Bacteria | 1345 |
| 632 | Ga0268265_10694833 | 3300028380 | Unclassified | 982 |
| 633 | Ga0268264_10022619 | 3300028381 | Bacteria | 5130 |
| 634 | Ga0268264_10032907 | 3300028381 | Bacteria | 4255 |
| 635 | Ga0268264_10205740 | 3300028381 | Unclassified | 1803 |
| 636 | Ga0268264_10519397 | 3300028381 | Unclassified | 1164 |
| 637 | Ga0268264_10973563 | 3300028381 | Bacteria | 854 |
| 638 | Ga0268264_11397858 | 3300028381 | Unclassified | 710 |
| 639 | Ga0268264_12393246 | 3300028381 | Unclassified | 534 |
| 640 | Ga0268264_12666906 | 3300028381 | Unclassified | 504 |
| 641 | Ga0265337_1007184 | 3300028556 | Bacteria | 4196 |
| 642 | Ga0265337_1102511 | 3300028556 | Bacteria | 778 |
| 643 | Ga0265337_1141953 | 3300028556 | Unclassified | 650 |
| 644 | Ga0265326_10057864 | 3300028558 | Unclassified | 1097 |
| 645 | Ga0265319_1043415 | 3300028563 | Unclassified | 1510 |
| 646 | Ga0265319_1092719 | 3300028563 | Unclassified | 952 |
| 647 | Ga0265319_1118415 | 3300028563 | Unclassified | 826 |
| 648 | Ga0265334_10005346 | 3300028573 | Bacteria | 5611 |
| 649 | Ga0265318_10000005 | 3300028577 | Bacteria | 303630 |
| 650 | Ga0265318_10020875 | 3300028577 | Bacteria | 2636 |
| 651 | Ga0265318_10350940 | 3300028577 | Unclassified | 538 |
| 652 | Ga0265318_10396425 | 3300028577 | Unclassified | 504 |
| 653 | Ga0265323_10000044 | 3300028653 | Bacteria | 68290 |
| 654 | Ga0265323_10003744 | 3300028653 | Bacteria | 6651 |
| 655 | Ga0265323_10011348 | 3300028653 | Unclassified | 3598 |
| 656 | Ga0265322_10000802 | 3300028654 | Bacteria | 11305 |
| 657 | Ga0265322_10008192 | 3300028654 | Bacteria | 3047 |
| 658 | Ga0265336_10028611 | 3300028666 | Bacteria | 1741 |
| 659 | Ga0265338_10001998 | 3300028800 | Bacteria | 31691 |
| 660 | Ga0265338_10013448 | 3300028800 | Bacteria | 9242 |
| 661 | Ga0265338_10115876 | 3300028800 | Bacteria | 2147 |
| 662 | Ga0265338_10462021 | 3300028800 | Bacteria | 898 |
| 663 | Ga0265324_10004265 | 3300029957 | Bacteria | 6527 |
| 664 | Ga0265324_10009397 | 3300029957 | Bacteria | 3820 |
| 665 | Ga0265762_1048152 | 3300030760 | Bacteria | 849 |
| 666 | Ga0265760_10045719 | 3300031090 | Bacteria | 1312 |
| 667 | Ga0265330_10000051 | 3300031235 | Bacteria | 102872 |
| 668 | Ga0265330_10026862 | 3300031235 | Bacteria | 2602 |
| 669 | Ga0265330_10044760 | 3300031235 | Bacteria | 1953 |
| 670 | Ga0265330_10061446 | 3300031235 | Bacteria | 1634 |
| 671 | Ga0265330_10076014 | 3300031235 | Unclassified | 1450 |
| 672 | Ga0265332_10007763 | 3300031238 | Bacteria | 4844 |
| 673 | Ga0265332_10051938 | 3300031238 | Bacteria | 1760 |
| 674 | Ga0265328_10077856 | 3300031239 | Bacteria | 1221 |
| 675 | Ga0265328_10362869 | 3300031239 | Unclassified | 565 |
| 676 | Ga0265320_10013450 | 3300031240 | Bacteria | 4707 |
| 677 | Ga0265320_10020179 | 3300031240 | Bacteria | 3621 |
| 678 | Ga0265320_10091355 | 3300031240 | Unclassified | 1410 |
| 679 | Ga0265320_10384724 | 3300031240 | Bacteria | 620 |
| 680 | Ga0265325_10006322 | 3300031241 | Bacteria | 7204 |
| 681 | Ga0265325_10017468 | 3300031241 | Bacteria | 3985 |
| 682 | Ga0265325_10476340 | 3300031241 | Unclassified | 542 |
| 683 | Ga0265340_10028083 | 3300031247 | Bacteria | 2832 |
| 684 | Ga0265340_10100510 | 3300031247 | Bacteria | 1344 |
| 685 | Ga0265339_10014992 | 3300031249 | Bacteria | 4659 |
| 686 | Ga0265339_10073218 | 3300031249 | Bacteria | 1822 |
| 687 | Ga0265339_10148431 | 3300031249 | Bacteria | 1188 |
| 688 | Ga0265339_10198264 | 3300031249 | Unclassified | 992 |
| 689 | Ga0265331_10018334 | 3300031250 | Unclassified | 3633 |
| 690 | Ga0265331_10104462 | 3300031250 | Bacteria | 1302 |
| 691 | Ga0265331_10113388 | 3300031250 | Unclassified | 1242 |
| 692 | Ga0265331_10142309 | 3300031250 | Bacteria | 1090 |
| 693 | Ga0265331_10208871 | 3300031250 | Bacteria | 879 |
| 694 | Ga0265327_10001705 | 3300031251 | Bacteria | 26258 |
| 695 | Ga0265327_10013021 | 3300031251 | Bacteria | 5558 |
| 696 | Ga0265327_10101160 | 3300031251 | Bacteria | 1390 |
| 697 | Ga0265316_10000323 | 3300031344 | Bacteria | 53060 |
| 698 | Ga0265316_10002356 | 3300031344 | Bacteria | 19690 |
| 699 | Ga0265316_10005906 | 3300031344 | Bacteria | 11797 |
| 700 | Ga0265316_10038370 | 3300031344 | Bacteria | 3860 |
| 701 | Ga0265316_10046666 | 3300031344 | Bacteria | 3431 |
| 702 | Ga0265316_10099467 | 3300031344 | Unclassified | 2212 |
| 703 | Ga0265316_10153481 | 3300031344 | Unclassified | 1724 |
| 704 | Ga0265316_10257027 | 3300031344 | Bacteria | 1281 |
| 705 | Ga0265316_10476006 | 3300031344 | Bacteria | 894 |
| 706 | Ga0307513_10012270 | 3300031456 | Bacteria | 10589 |
| 707 | Ga0307509_10622429 | 3300031507 | Bacteria | 750 |
| 708 | Ga0307408_101251676 | 3300031548 | Bacteria | 694 |
| 709 | Ga0265313_10002981 | 3300031595 | Bacteria | 14116 |
| 710 | Ga0265313_10003767 | 3300031595 | Bacteria | 12033 |
| 711 | Ga0265313_10006788 | 3300031595 | Bacteria | 8004 |
| 712 | Ga0265313_10017903 | 3300031595 | Bacteria | 4001 |
| 713 | Ga0307508_10000200 | 3300031616 | Bacteria | 71996 |
| 714 | Ga0265314_10001653 | 3300031711 | Bacteria | 24386 |
| 715 | Ga0265314_10016863 | 3300031711 | Bacteria | 5756 |
| 716 | Ga0265314_10099912 | 3300031711 | Bacteria | 1867 |
| 717 | Ga0265314_10160057 | 3300031711 | Bacteria | 1371 |
| 718 | Ga0265342_10002344 | 3300031712 | Bacteria | 16449 |
| 719 | Ga0265342_10010937 | 3300031712 | Bacteria | 6241 |
| 720 | Ga0265342_10015932 | 3300031712 | Unclassified | 4929 |
| 721 | Ga0265342_10041726 | 3300031712 | Bacteria | 2776 |
| 722 | Ga0265342_10042248 | 3300031712 | Bacteria | 2755 |
| 723 | Ga0265342_10108733 | 3300031712 | Bacteria | 1571 |
| 724 | Ga0265342_10586951 | 3300031712 | Bacteria | 563 |
| 725 | Ga0307516_10463298 | 3300031730 | Unclassified | 923 |
| 726 | Ga0307413_10675967 | 3300031824 | Unclassified | 855 |
| 727 | Ga0307413_11455888 | 3300031824 | Unclassified | 604 |
| 728 | Ga0307416_100119838 | 3300032002 | Unclassified | 2342 |
| 729 | Ga0307411_11298030 | 3300032005 | Bacteria | 663 |
| 730 | Ga0373959_0000052 | 3300034820 | Bacteria | 26566 |
| 731 | Ga0373934_0250637 | 3300035086 | Bacteria | 732 |
| 732 | Ga0373944_0136029 | 3300035089 | Bacteria | 857 |
| 733 | Ga0373951_0001334 | 3300035091 | Bacteria | 6491 |
| 734 | Ga0373923_0210713 | 3300035111 | Unclassified | 901 |
| 735 | Ga0373932_0147183 | 3300035112 | Bacteria | 805 |
| 736 | Ga0373932_0269193 | 3300035112 | Unclassified | 627 |
| 737 | Ga0373939_0020582 | 3300035114 | Bacteria | 1794 |
| 738 | Ga0373954_0319629 | 3300035118 | Unclassified | 766 |
| 739 | Ga0373957_0282621 | 3300035120 | Bacteria | 702 |
| 740 | Ga0373955_0213835 | 3300035172 | Bacteria | 1150 |
| 741 | Ga0373962_0090418 | 3300035242 | Bacteria | 942 |
| 742 | Ga0373931_0623617 | 3300035691 | Bacteria | 707 |
| 743 | Ga0373931_0658250 | 3300035691 | Bacteria | 689 |
| 744 | Ga0373931_1116398 | 3300035691 | Bacteria | 537 |
| 745 | Ga0373935_0579610 | 3300035692 | Bacteria | 819 |
| 746 | Ga0373933_0647059 | 3300035724 | Unclassified | 695 |
| 747 | Ga0373937_0014543 | 3300036401 | Bacteria | 6950 |
| 748 | Ga0373937_0047248 | 3300036401 | Bacteria | 3938 |
| 749 | Ga0373937_0103496 | 3300036401 | Bacteria | 2644 |
| 750 | Ga0373937_0439158 | 3300036401 | Bacteria | 1239 |
| 751 | Ga0373937_0551763 | 3300036401 | Unclassified | 1095 |
| 752 | Ga0373937_0854538 | 3300036401 | Bacteria | 858 |
| 753 | Ga0373937_1388153 | 3300036401 | Bacteria | 650 |
| 754 | Ga0316582_0407470 | 3300036647 | Bacteria | 937 |
| 755 | Ga0373925_0731168 | 3300037068 | Unclassified | 816 |
| 756 | Ga0373925_0893285 | 3300037068 | Bacteria | 732 |
| 757 | Ga0436365_0786779 | 3300039437 | Bacteria | 766 |
| 758 | Ga0439453_0129000 | 3300041408 | Bacteria | 586 |
| 759 | Ga0451789_1098755 | 3300041443 | Unclassified | 756 |
| 760 | Ga0451795_1691563 | 3300041456 | Bacteria | 545 |
| 761 | Ga0451853_1514882 | 3300041512 | Bacteria | 520 |
| 762 | Ga0439462_0112593 | 3300042015 | Unclassified | 754 |
| 763 | Ga0450921_000557 | 3300042123 | Bacteria | 1834 |
| 764 | Ga0450888_026066 | 3300042126 | Bacteria | 766 |
| 765 | Ga0439446_0262658 | 3300042156 | Bacteria | 598 |
| 766 | Ga0439435_0000415 | 3300042436 | Bacteria | 6638 |
| 767 | Ga0439435_0061637 | 3300042436 | Unclassified | 1094 |
| 768 | Ga0439435_0068856 | 3300042436 | Bacteria | 1044 |
| 769 | Ga0439444_0002121 | 3300042437 | Unclassified | 2674 |
| 770 | Ga0450893_0030716 | 3300042532 | Bacteria | 957 |
| 771 | Ga0451577_0126672 | 3300042876 | Bacteria | 2288 |
| 772 | Ga0451577_0167901 | 3300042876 | Bacteria | 1977 |
| 773 | Ga0451577_0904583 | 3300042876 | Unclassified | 795 |
| 774 | Ga0453683_0002405 | 3300044673 | Bacteria | 14587 |
| 775 | Ga0453683_0257203 | 3300044673 | Bacteria | 1113 |
| 776 | Ga0466966_0244296 | 3300044684 | Bacteria | 1082 |
| 777 | Ga0466966_0388372 | 3300044684 | Unclassified | 839 |
| 778 | Ga0453684_0072992 | 3300044712 | Bacteria | 4328 |
| 779 | Ga0453684_0358547 | 3300044712 | Bacteria | 1642 |
| 780 | Ga0453684_0359331 | 3300044712 | Unclassified | 1640 |
| 781 | Ga0453684_0480004 | 3300044712 | Unclassified | 1379 |
| 782 | Ga0453684_1078628 | 3300044712 | Unclassified | 850 |
| 783 | Ga0453684_1401854 | 3300044712 | Unclassified | 725 |
| 784 | Ga0466971_0142089 | 3300044719 | Bacteria | 1118 |
| 785 | Ga0466959_0121887 | 3300045049 | Unclassified | 1853 |
| 786 | Ga0451576_0014826 | 3300045051 | Bacteria | 8663 |
| 787 | Ga0451576_0019268 | 3300045051 | Bacteria | 7449 |
| 788 | Ga0466958_0257203 | 3300045836 | Bacteria | 1117 |
| 789 | Ga0466967_0003400 | 3300045976 | Bacteria | 10371 |
| 790 | Ga0495592_0002149 | 3300046454 | Bacteria | 13880 |
| 791 | Ga0495603_0231549 | 3300046455 | Bacteria | 1065 |
| 792 | Ga0495591_080624 | 3300046458 | Bacteria | 830 |
| 793 | Ga0495629_0207057 | 3300046459 | Bacteria | 1355 |
| 794 | Ga0495582_0084677 | 3300046473 | Bacteria | 1763 |
| 795 | Ga0495639_0038859 | 3300046475 | Bacteria | 2138 |
| 796 | Ga0495594_0218157 | 3300046499 | Bacteria | 1088 |
| 797 | Ga0495618_0042704 | 3300046514 | Bacteria | 2859 |
| 798 | Ga0495628_0502538 | 3300046516 | Unclassified | 875 |
| 799 | Ga0495630_0387973 | 3300046517 | Unclassified | 1070 |
| 800 | Ga0495652_0608065 | 3300046529 | Bacteria | 745 |
| 801 | Ga0495665_0060046 | 3300046531 | Bacteria | 2007 |
| 802 | Ga0495586_0085694 | 3300046535 | Bacteria | 1736 |
| 803 | Ga0495586_0351726 | 3300046535 | Bacteria | 846 |
| 804 | Ga0495645_0202844 | 3300046543 | Bacteria | 1344 |
| 805 | Ga0495645_0536783 | 3300046543 | Unclassified | 727 |
| 806 | Ga0495667_0000510 | 3300046559 | Bacteria | 24800 |
| 807 | Ga0495634_0023902 | 3300046642 | Bacteria | 4292 |
| 808 | Ga0495634_0099635 | 3300046642 | Bacteria | 1879 |
| 809 | Ga0495635_0202318 | 3300046663 | Bacteria | 1347 |
| 810 | Ga0495659_0125488 | 3300046664 | Bacteria | 1014 |
| 811 | Ga0495588_0417018 | 3300046674 | Bacteria | 705 |
| 812 | Ga0495657_0014486 | 3300046675 | Bacteria | 5788 |
| 813 | Ga0495657_0067720 | 3300046675 | Unclassified | 2342 |
| 814 | Ga0495599_0194811 | 3300046678 | Unclassified | 1246 |
| 815 | Ga0495647_0083367 | 3300046681 | Bacteria | 1300 |
| 816 | Ga0495658_0013257 | 3300046683 | Bacteria | 4194 |
| 817 | Ga0495658_0078285 | 3300046683 | Bacteria | 1935 |
| 818 | Ga0495669_0206396 | 3300046684 | Bacteria | 940 |
| 819 | Ga0495613_0042502 | 3300046689 | Bacteria | 3362 |
| 820 | Ga0495613_0537265 | 3300046689 | Bacteria | 784 |
| 821 | Ga0495613_0562630 | 3300046689 | Unclassified | 762 |
| 822 | Ga0495624_0565150 | 3300046690 | Bacteria | 679 |
| 823 | Ga0495684_0029353 | 3300047471 | Unclassified | 4221 |
| 824 | Ga0495684_0329830 | 3300047471 | Bacteria | 1089 |
| 825 | Ga0495684_0441291 | 3300047471 | Bacteria | 906 |
| 826 | Ga0495593_0167932 | 3300047673 | Bacteria | 1107 |
| 827 | Ga0495614_0413916 | 3300048089 | Bacteria | 635 |
| 828 | Ga0496102_1531441 | 3300048905 | Unclassified | 585 |
| 829 | Ga0496104_0000038 | 3300048907 | Bacteria | 178150 |
| 830 | Ga0496104_0019982 | 3300048907 | Bacteria | 6134 |
| 831 | Ga0496105_0000038 | 3300048908 | Bacteria | 118666 |
| 832 | Ga0496105_0449913 | 3300048908 | Unclassified | 1017 |
| 833 | Ga0496106_0397942 | 3300048909 | Bacteria | 1107 |
| 834 | Ga0496107_0177259 | 3300048910 | Bacteria | 1583 |
| 835 | Ga0496108_0009731 | 3300048911 | Bacteria | 7789 |
| 836 | Ga0496110_0862741 | 3300048913 | Bacteria | 811 |
| 837 | Ga0496111_0188644 | 3300048914 | Bacteria | 1533 |
| 838 | Ga0496112_0386727 | 3300048915 | Bacteria | 1340 |
| 839 | Ga0496113_0060084 | 3300048916 | Bacteria | 2864 |
| 840 | Ga0496114_0563099 | 3300048917 | Bacteria | 1006 |
| 841 | Ga0496114_0744754 | 3300048917 | Bacteria | 857 |
| 842 | Ga0496114_0945587 | 3300048917 | Unclassified | 744 |
| 843 | Ga0496121_0684847 | 3300048924 | Unclassified | 619 |
| 844 | Ga0496125_0558528 | 3300048928 | Unclassified | 633 |
| 845 | Ga0496126_0024934 | 3300048929 | Bacteria | 5766 |
| 846 | Ga0501031_0675619 | 3300049568 | Bacteria | 663 |
| 847 | Ga0501031_0689609 | 3300049568 | Unclassified | 656 |
| 848 | Ga0501032_0000381 | 3300049569 | Bacteria | 36644 |
| 849 | Ga0501032_0004210 | 3300049569 | Bacteria | 10892 |
| 850 | Ga0501032_0248686 | 3300049569 | Unclassified | 1154 |
| 851 | Ga0501032_0317876 | 3300049569 | Bacteria | 1005 |
| 852 | Ga0501033_0003173 | 3300049570 | Bacteria | 13640 |
| 853 | Ga0501033_0706233 | 3300049570 | Bacteria | 686 |
| 854 | Ga0501034_0003074 | 3300049571 | Bacteria | 19249 |
| 855 | Ga0501034_0006567 | 3300049571 | Bacteria | 12490 |
| 856 | Ga0501034_0019047 | 3300049571 | Bacteria | 7030 |
| 857 | Ga0501034_0025655 | 3300049571 | Bacteria | 6002 |
| 858 | Ga0501036_0002696 | 3300049572 | Bacteria | 14015 |
| 859 | Ga0501036_0019542 | 3300049572 | Bacteria | 5687 |
| 860 | Ga0501036_0057652 | 3300049572 | Bacteria | 3290 |
| 861 | Ga0501036_0096727 | 3300049572 | Unclassified | 2496 |
| 862 | Ga0501037_0035928 | 3300049573 | Bacteria | 3651 |
| 863 | Ga0501037_0686046 | 3300049573 | Unclassified | 682 |
| 864 | Ga0501037_0813060 | 3300049573 | Bacteria | 617 |
| 865 | Ga0501038_0006345 | 3300049574 | Bacteria | 10942 |
| 866 | Ga0501038_0108297 | 3300049574 | Unclassified | 2304 |
| 867 | Ga0501038_0628221 | 3300049574 | Unclassified | 810 |
| 868 | Ga0501039_0018596 | 3300049575 | Bacteria | 5334 |
| 869 | Ga0501039_0295614 | 3300049575 | Unclassified | 1273 |
| 870 | Ga0501040_0004831 | 3300049576 | Bacteria | 8733 |
| 871 | Ga0501040_0862451 | 3300049576 | Bacteria | 656 |
| 872 | Ga0501041_0001803 | 3300049577 | Bacteria | 12002 |
| 873 | Ga0501042_0027262 | 3300049578 | Unclassified | 4016 |
| 874 | Ga0501043_0005787 | 3300049579 | Bacteria | 9946 |
| 875 | Ga0501043_0040939 | 3300049579 | Bacteria | 3641 |
| 876 | Ga0501046_0006931 | 3300049580 | Bacteria | 9986 |
| 877 | Ga0501046_0007380 | 3300049580 | Bacteria | 9667 |
| 878 | Ga0501046_0046848 | 3300049580 | Bacteria | 3430 |
| 879 | Ga0501046_0310789 | 3300049580 | Bacteria | 1149 |
| 880 | Ga0501047_0000443 | 3300049581 | Bacteria | 45792 |
| 881 | Ga0501047_0001606 | 3300049581 | Bacteria | 22029 |
| 882 | Ga0501047_0010472 | 3300049581 | Bacteria | 8774 |
| 883 | Ga0501047_0026010 | 3300049581 | Bacteria | 5627 |
| 884 | Ga0501047_0081073 | 3300049581 | Bacteria | 3119 |
| 885 | Ga0501047_0551888 | 3300049581 | Unclassified | 976 |
| 886 | Ga0501047_0581328 | 3300049581 | Bacteria | 943 |
| 887 | Ga0501047_1194752 | 3300049581 | Unclassified | 574 |
| 888 | Ga0501047_1416202 | 3300049581 | Unclassified | 510 |
| 889 | Ga0501048_0026634 | 3300049582 | Bacteria | 4208 |
| 890 | Ga0501048_0207703 | 3300049582 | Bacteria | 1389 |
| 891 | Ga0501048_0442617 | 3300049582 | Bacteria | 930 |
| 892 | Ga0501068_0228635 | 3300049584 | Bacteria | 1183 |
| 893 | Ga0501070_0006414 | 3300049586 | Bacteria | 10012 |
| 894 | Ga0501070_0013617 | 3300049586 | Bacteria | 6854 |
| 895 | Ga0501070_0040045 | 3300049586 | Bacteria | 3909 |
| 896 | Ga0501070_0057235 | 3300049586 | Bacteria | 3231 |
| 897 | Ga0501071_0007915 | 3300049587 | Bacteria | 7009 |
| 898 | Ga0501072_0004526 | 3300049588 | Bacteria | 10566 |
| 899 | Ga0501072_0060387 | 3300049588 | Unclassified | 2989 |
| 900 | Ga0501072_0332576 | 3300049588 | Unclassified | 1207 |
| 901 | Ga0501073_0008464 | 3300049589 | Bacteria | 7629 |
| 902 | Ga0501073_0071909 | 3300049589 | Bacteria | 2409 |
| 903 | Ga0501073_0107679 | 3300049589 | Unclassified | 1934 |
| 904 | Ga0501074_0018167 | 3300049590 | Bacteria | 5108 |
| 905 | Ga0501074_0050646 | 3300049590 | Unclassified | 2998 |
| 906 | Ga0501074_0156580 | 3300049590 | Bacteria | 1627 |
| 907 | Ga0501074_0181701 | 3300049590 | Unclassified | 1500 |
| 908 | Ga0501075_0018923 | 3300049591 | Unclassified | 4991 |
| 909 | Ga0501076_0062813 | 3300049592 | Bacteria | 2958 |
| 910 | Ga0501076_0276088 | 3300049592 | Bacteria | 1376 |
| 911 | Ga0501077_0016382 | 3300049593 | Unclassified | 4670 |
| 912 | Ga0501079_0087814 | 3300049741 | Bacteria | 2407 |
| 913 | Ga0501079_0466482 | 3300049741 | Bacteria | 992 |
| 914 | Ga0501079_1201143 | 3300049741 | Unclassified | 597 |
| 915 | Ga0501080_0008657 | 3300049742 | Bacteria | 9239 |
| 916 | Ga0501080_0077605 | 3300049742 | Unclassified | 3089 |
| 917 | Ga0501080_0178197 | 3300049742 | Bacteria | 1957 |
| 918 | Ga0501080_0200486 | 3300049742 | Unclassified | 1832 |
| 919 | Ga0501081_0007373 | 3300049743 | Bacteria | 7137 |
| 920 | Ga0501081_0237308 | 3300049743 | Unclassified | 1329 |
| 921 | Ga0501083_0044409 | 3300049744 | Bacteria | 3008 |
| 922 | Ga0501083_0116569 | 3300049744 | Unclassified | 1753 |
| 923 | Ga0501035_0002291 | 3300049822 | Bacteria | 18921 |
| 924 | Ga0501035_0005985 | 3300049822 | Bacteria | 11454 |
| 925 | Ga0501044_0000245 | 3300049823 | Bacteria | 68850 |
| 926 | Ga0501044_0013568 | 3300049823 | Bacteria | 8805 |
| 927 | Ga0501044_0042338 | 3300049823 | Bacteria | 4737 |
| 928 | Ga0501044_0060812 | 3300049823 | Unclassified | 3866 |
| 929 | Ga0501045_0016582 | 3300049824 | Bacteria | 5234 |
| 930 | Ga0501045_0141021 | 3300049824 | Bacteria | 1792 |
| 931 | Ga0501045_0877046 | 3300049824 | Bacteria | 660 |
| 932 | nmdc:mga0yw44_14103_c1 | 3300050492 | Bacteria | 4231 |
| 933 | nmdc:mga05p37_199829_c1 | 3300050507 | Bacteria | 2422 |
| 934 | nmdc:mga05p37_4622_c1 | 3300050507 | Bacteria | 16094 |
| 935 | nmdc:mga05p37_5627_c1 | 3300050507 | Bacteria | 14726 |
| 936 | nmdc:mga09592_116656_c1 | 3300050508 | Bacteria | 2291 |
| 937 | nmdc:mga0qj67_97100_c1 | 3300050509 | Unclassified | 2372 |
| 938 | nmdc:mga08y16_18505_c1 | 3300050511 | Bacteria | 7339 |
| 939 | nmdc:mga08y16_253059_c1 | 3300050511 | Bacteria | 1820 |
| 940 | nmdc:mga08y16_25_c1 | 3300050511 | Bacteria | 235789 |
| 941 | nmdc:mga08y16_841979_c1 | 3300050511 | Bacteria | 907 |
| 942 | nmdc:mga0n895_2250903_c1 | 3300050512 | Unclassified | 500 |
| 943 | nmdc:mga0n895_464628_c1 | 3300050512 | Bacteria | 1277 |
| 944 | nmdc:mga0n895_6510_c1 | 3300050512 | Bacteria | 9934 |
| 945 | nmdc:mga0a205_14478_c1 | 3300050515 | Bacteria | 7357 |
| 946 | nmdc:mga0a205_16127_c1 | 3300050515 | Bacteria | 6995 |
| 947 | Ga0495601_0160063 | 3300053077 | Bacteria | 1471 |
| 948 | Ga0495601_0356567 | 3300053077 | Bacteria | 951 |
| 949 | Ga0495619_0533542 | 3300053085 | Unclassified | 806 |
| 950 | Ga0500595_044920 | 3300053119 | Bacteria | 1398 |
| 951 | Ga0500614_066252 | 3300053123 | Bacteria | 982 |
| 952 | Ga0500559_0482121 | 3300053136 | Unclassified | 571 |
| 953 | Ga0500568_0025482 | 3300053139 | Bacteria | 2495 |
| 954 | Ga0500622_0279326 | 3300053156 | Bacteria | 720 |
| 955 | Ga0500639_363859 | 3300053163 | Unclassified | 505 |
| 956 | Ga0500637_0116320 | 3300053178 | Bacteria | 1551 |
| 957 | Ga0501084_0001985 | 3300054114 | Bacteria | 16338 |
| 958 | Ga0501084_0007266 | 3300054114 | Bacteria | 9128 |
| 959 | Ga0501084_0812090 | 3300054114 | Unclassified | 787 |
| 960 | Ga0501082_0001294 | 3300060353 | Bacteria | 21939 |
| 961 | Ga0501082_0091161 | 3300060353 | Bacteria | 2632 |
| 962 | Ga0501082_0170320 | 3300060353 | Bacteria | 1893 |
| 963 | Ga0530510_0006290 | 3300061734 | Bacteria | 8264 |
| 964 | Ga0530510_0221821 | 3300061734 | Bacteria | 1405 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005364 | Ga0070673_102080628 | Ga0070673_1020806282 | 103 |
| 2 | 3300005458 | Ga0070681_10321470 | Ga0070681_103214702 | 104 |
| 3 | 3300025912 | Ga0207707_10275121 | Ga0207707_102751212 | 104 |
| 4 | 3300031235 | Ga0265330_10000051 | Ga0265330_1000005157 | 104 |
| 5 | 3300031241 | Ga0265325_10017468 | Ga0265325_100174683 | 104 |
| 6 | 3300031344 | Ga0265316_10000323 | Ga0265316_1000032325 | 104 |
| 7 | 3300031344 | Ga0265316_10257027 | Ga0265316_102570272 | 104 |
| 8 | 3300005331 | Ga0070670_100299315 | Ga0070670_1002993153 | 105 |
| 9 | 3300005334 | Ga0068869_100249480 | Ga0068869_1002494802 | 105 |
| 10 | 3300005335 | Ga0070666_10033093 | Ga0070666_100330934 | 105 |
| 11 | 3300005336 | Ga0070680_100506432 | Ga0070680_1005064322 | 105 |
| 12 | 3300005336 | Ga0070680_101243610 | Ga0070680_1012436101 | 105 |
| 13 | 3300005337 | Ga0070682_100645637 | Ga0070682_1006456372 | 105 |
| 14 | 3300005337 | Ga0070682_101230659 | Ga0070682_1012306591 | 105 |
| 15 | 3300005338 | Ga0068868_100355783 | Ga0068868_1003557832 | 105 |
| 16 | 3300005338 | Ga0068868_101901633 | Ga0068868_1019016331 | 105 |
| 17 | 3300005339 | Ga0070660_101094279 | Ga0070660_1010942791 | 105 |
| 18 | 3300005340 | Ga0070689_100777763 | Ga0070689_1007777632 | 105 |
| 19 | 3300005341 | Ga0070691_10759396 | Ga0070691_107593962 | 105 |
| 20 | 3300005344 | Ga0070661_100017202 | Ga0070661_1000172023 | 105 |
| 21 | 3300005344 | Ga0070661_100457969 | Ga0070661_1004579692 | 105 |
| 22 | 3300005347 | Ga0070668_100873713 | Ga0070668_1008737132 | 105 |
| 23 | 3300005354 | Ga0070675_100057218 | Ga0070675_1000572182 | 105 |
| 24 | 3300005354 | Ga0070675_101219367 | Ga0070675_1012193672 | 105 |
| 25 | 3300005355 | Ga0070671_100120360 | Ga0070671_1001203602 | 105 |
| 26 | 3300005355 | Ga0070671_100195242 | Ga0070671_1001952422 | 105 |
| 27 | 3300005356 | Ga0070674_100210809 | Ga0070674_1002108093 | 105 |
| 28 | 3300005364 | Ga0070673_100066369 | Ga0070673_1000663693 | 105 |
| 29 | 3300005365 | Ga0070688_100503498 | Ga0070688_1005034982 | 105 |
| 30 | 3300005366 | Ga0070659_100259758 | Ga0070659_1002597582 | 105 |
| 31 | 3300005367 | Ga0070667_100138748 | Ga0070667_1001387483 | 105 |
| 32 | 3300005367 | Ga0070667_100341335 | Ga0070667_1003413351 | 105 |
| 33 | 3300005367 | Ga0070667_100655223 | Ga0070667_1006552232 | 105 |
| 34 | 3300005367 | Ga0070667_101628835 | Ga0070667_1016288352 | 105 |
| 35 | 3300005436 | Ga0070713_100832444 | Ga0070713_1008324442 | 105 |
| 36 | 3300005437 | Ga0070710_10710368 | Ga0070710_107103681 | 105 |
| 37 | 3300005439 | Ga0070711_100000034 | Ga0070711_10000003489 | 105 |
| 38 | 3300005455 | Ga0070663_101323533 | Ga0070663_1013235332 | 105 |
| 39 | 3300005456 | Ga0070678_100146613 | Ga0070678_1001466132 | 105 |
| 40 | 3300005456 | Ga0070678_100297867 | Ga0070678_1002978672 | 105 |
| 41 | 3300005456 | Ga0070678_100921623 | Ga0070678_1009216231 | 105 |
| 42 | 3300005457 | Ga0070662_100246788 | Ga0070662_1002467882 | 105 |
| 43 | 3300005458 | Ga0070681_10225312 | Ga0070681_102253122 | 105 |
| 44 | 3300005458 | Ga0070681_10793512 | Ga0070681_107935121 | 105 |
| 45 | 3300005459 | Ga0068867_100023104 | Ga0068867_1000231044 | 105 |
| 46 | 3300005466 | Ga0070685_10218311 | Ga0070685_102183111 | 105 |
| 47 | 3300005530 | Ga0070679_100265620 | Ga0070679_1002656201 | 105 |
| 48 | 3300005530 | Ga0070679_101037253 | Ga0070679_1010372531 | 105 |
| 49 | 3300005530 | Ga0070679_101634845 | Ga0070679_1016348451 | 105 |
| 50 | 3300005535 | Ga0070684_100122765 | Ga0070684_1001227653 | 105 |
| 51 | 3300005535 | Ga0070684_100783566 | Ga0070684_1007835662 | 105 |
| 52 | 3300005539 | Ga0068853_100012063 | Ga0068853_1000120632 | 105 |
| 53 | 3300005539 | Ga0068853_100012521 | Ga0068853_1000125217 | 105 |
| 54 | 3300005539 | Ga0068853_100116728 | Ga0068853_1001167282 | 105 |
| 55 | 3300005543 | Ga0070672_100024871 | Ga0070672_1000248715 | 105 |
| 56 | 3300005544 | Ga0070686_100272503 | Ga0070686_1002725033 | 105 |
| 57 | 3300005547 | Ga0070693_100007674 | Ga0070693_1000076746 | 105 |
| 58 | 3300005547 | Ga0070693_100739856 | Ga0070693_1007398562 | 105 |
| 59 | 3300005548 | Ga0070665_100665322 | Ga0070665_1006653222 | 105 |
| 60 | 3300005563 | Ga0068855_100327140 | Ga0068855_1003271402 | 105 |
| 61 | 3300005577 | Ga0068857_100042068 | Ga0068857_1000420683 | 105 |
| 62 | 3300005578 | Ga0068854_101134136 | Ga0068854_1011341362 | 105 |
| 63 | 3300005614 | Ga0068856_100039095 | Ga0068856_1000390953 | 105 |
| 64 | 3300005614 | Ga0068856_100089561 | Ga0068856_1000895613 | 105 |
| 65 | 3300005616 | Ga0068852_100314248 | Ga0068852_1003142483 | 105 |
| 66 | 3300005616 | Ga0068852_101066879 | Ga0068852_1010668791 | 105 |
| 67 | 3300005616 | Ga0068852_101206836 | Ga0068852_1012068362 | 105 |
| 68 | 3300005617 | Ga0068859_100619623 | Ga0068859_1006196232 | 105 |
| 69 | 3300005617 | Ga0068859_100624571 | Ga0068859_1006245712 | 105 |
| 70 | 3300005718 | Ga0068866_10385685 | Ga0068866_103856852 | 105 |
| 71 | 3300005834 | Ga0068851_10084221 | Ga0068851_100842212 | 105 |
| 72 | 3300005841 | Ga0068863_100038650 | Ga0068863_1000386505 | 105 |
| 73 | 3300005841 | Ga0068863_100139898 | Ga0068863_1001398983 | 105 |
| 74 | 3300005841 | Ga0068863_100231180 | Ga0068863_1002311802 | 105 |
| 75 | 3300005842 | Ga0068858_100142832 | Ga0068858_1001428321 | 105 |
| 76 | 3300005842 | Ga0068858_100199400 | Ga0068858_1001994004 | 105 |
| 77 | 3300005843 | Ga0068860_100024709 | Ga0068860_1000247092 | 105 |
| 78 | 3300005844 | Ga0068862_100517306 | Ga0068862_1005173063 | 105 |
| 79 | 3300006173 | Ga0070716_100244523 | Ga0070716_1002445232 | 105 |
| 80 | 3300006237 | Ga0097621_100011887 | Ga0097621_1000118874 | 105 |
| 81 | 3300006237 | Ga0097621_100016353 | Ga0097621_1000163532 | 105 |
| 82 | 3300006358 | Ga0068871_100039347 | Ga0068871_1000393472 | 105 |
| 83 | 3300006358 | Ga0068871_100136777 | Ga0068871_1001367772 | 105 |
| 84 | 3300006358 | Ga0068871_100197298 | Ga0068871_1001972982 | 105 |
| 85 | 3300006844 | Ga0075428_100157590 | Ga0075428_1001575903 | 105 |
| 86 | 3300006846 | Ga0075430_100131173 | Ga0075430_1001311732 | 105 |
| 87 | 3300006847 | Ga0075431_100255474 | Ga0075431_1002554742 | 105 |
| 88 | 3300006847 | Ga0075431_100366964 | Ga0075431_1003669641 | 105 |
| 89 | 3300006871 | Ga0075434_100150670 | Ga0075434_1001506701 | 105 |
| 90 | 3300006880 | Ga0075429_100091566 | Ga0075429_1000915663 | 105 |
| 91 | 3300006881 | Ga0068865_100002579 | Ga0068865_1000025794 | 105 |
| 92 | 3300006881 | Ga0068865_100029325 | Ga0068865_1000293253 | 105 |
| 93 | 3300006881 | Ga0068865_100070439 | Ga0068865_1000704392 | 105 |
| 94 | 3300006881 | Ga0068865_100152186 | Ga0068865_1001521862 | 105 |
| 95 | 3300006931 | Ga0097620_100619708 | Ga0097620_1006197082 | 105 |
| 96 | 3300006931 | Ga0097620_100624583 | Ga0097620_1006245832 | 105 |
| 97 | 3300009011 | Ga0105251_10325794 | Ga0105251_103257942 | 105 |
| 98 | 3300009093 | Ga0105240_10264741 | Ga0105240_102647411 | 105 |
| 99 | 3300009094 | Ga0111539_10092584 | Ga0111539_100925844 | 105 |
| 100 | 3300009098 | Ga0105245_10538622 | Ga0105245_105386222 | 105 |
| 101 | 3300009098 | Ga0105245_10725818 | Ga0105245_107258182 | 105 |
| 102 | 3300009148 | Ga0105243_10338676 | Ga0105243_103386762 | 105 |
| 103 | 3300009174 | Ga0105241_10012309 | Ga0105241_1001230910 | 105 |
| 104 | 3300009174 | Ga0105241_11414968 | Ga0105241_114149682 | 105 |
| 105 | 3300009176 | Ga0105242_10005186 | Ga0105242_100051867 | 105 |
| 106 | 3300009176 | Ga0105242_10321088 | Ga0105242_103210883 | 105 |
| 107 | 3300009177 | Ga0105248_10079800 | Ga0105248_100798005 | 105 |
| 108 | 3300009545 | Ga0105237_10228044 | Ga0105237_102280443 | 105 |
| 109 | 3300009551 | Ga0105238_10024332 | Ga0105238_1002433210 | 105 |
| 110 | 3300009551 | Ga0105238_10548458 | Ga0105238_105484582 | 105 |
| 111 | 3300009551 | Ga0105238_12389179 | Ga0105238_123891791 | 105 |
| 112 | 3300009553 | Ga0105249_10064664 | Ga0105249_100646642 | 105 |
| 113 | 3300009553 | Ga0105249_10897032 | Ga0105249_108970322 | 105 |
| 114 | 3300009553 | Ga0105249_11024298 | Ga0105249_110242982 | 105 |
| 115 | 3300009553 | Ga0105249_11344408 | Ga0105249_113444082 | 105 |
| 116 | 3300010375 | Ga0105239_10302478 | Ga0105239_103024783 | 105 |
| 117 | 3300011119 | Ga0105246_10762317 | Ga0105246_107623172 | 105 |
| 118 | 3300012498 | Ga0157345_1020075 | Ga0157345_10200751 | 105 |
| 119 | 3300013100 | Ga0157373_10341878 | Ga0157373_103418782 | 105 |
| 120 | 3300013104 | Ga0157370_10095615 | Ga0157370_100956152 | 105 |
| 121 | 3300013104 | Ga0157370_11209936 | Ga0157370_112099362 | 105 |
| 122 | 3300013105 | Ga0157369_10010475 | Ga0157369_1001047512 | 105 |
| 123 | 3300013105 | Ga0157369_10386305 | Ga0157369_103863052 | 105 |
| 124 | 3300013296 | Ga0157374_10090156 | Ga0157374_100901563 | 105 |
| 125 | 3300013296 | Ga0157374_10325062 | Ga0157374_103250622 | 105 |
| 126 | 3300013297 | Ga0157378_11506639 | Ga0157378_115066392 | 105 |
| 127 | 3300013306 | Ga0163162_10008586 | Ga0163162_100085868 | 105 |
| 128 | 3300013306 | Ga0163162_10012175 | Ga0163162_100121755 | 105 |
| 129 | 3300013306 | Ga0163162_10012584 | Ga0163162_100125847 | 105 |
| 130 | 3300013306 | Ga0163162_10393368 | Ga0163162_103933682 | 105 |
| 131 | 3300013306 | Ga0163162_10436571 | Ga0163162_104365712 | 105 |
| 132 | 3300013306 | Ga0163162_11950046 | Ga0163162_119500461 | 105 |
| 133 | 3300013306 | Ga0163162_13104526 | Ga0163162_131045261 | 105 |
| 134 | 3300013307 | Ga0157372_10016904 | Ga0157372_100169043 | 105 |
| 135 | 3300013307 | Ga0157372_10039046 | Ga0157372_100390463 | 105 |
| 136 | 3300013308 | Ga0157375_10001545 | Ga0157375_100015459 | 105 |
| 137 | 3300013308 | Ga0157375_10008862 | Ga0157375_100088629 | 105 |
| 138 | 3300013308 | Ga0157375_10592075 | Ga0157375_105920753 | 105 |
| 139 | 3300013308 | Ga0157375_11855447 | Ga0157375_118554472 | 105 |
| 140 | 3300013308 | Ga0157375_11982413 | Ga0157375_119824132 | 105 |
| 141 | 3300014325 | Ga0163163_10904850 | Ga0163163_109048502 | 105 |
| 142 | 3300014325 | Ga0163163_11362200 | Ga0163163_113622002 | 105 |
| 143 | 3300014325 | Ga0163163_11897706 | Ga0163163_118977061 | 105 |
| 144 | 3300014326 | Ga0157380_11953778 | Ga0157380_119537781 | 105 |
| 145 | 3300014497 | Ga0182008_10035121 | Ga0182008_100351213 | 105 |
| 146 | 3300014745 | Ga0157377_10700305 | Ga0157377_107003052 | 105 |
| 147 | 3300014968 | Ga0157379_10267847 | Ga0157379_102678471 | 105 |
| 148 | 3300014968 | Ga0157379_10877181 | Ga0157379_108771812 | 105 |
| 149 | 3300014968 | Ga0157379_11266050 | Ga0157379_112660502 | 105 |
| 150 | 3300014968 | Ga0157379_12445070 | Ga0157379_124450702 | 105 |
| 151 | 3300014969 | Ga0157376_10001440 | Ga0157376_1000144010 | 105 |
| 152 | 3300014969 | Ga0157376_10003448 | Ga0157376_100034482 | 105 |
| 153 | 3300014969 | Ga0157376_10136478 | Ga0157376_101364784 | 105 |
| 154 | 3300014969 | Ga0157376_10276977 | Ga0157376_102769772 | 105 |
| 155 | 3300014969 | Ga0157376_11786839 | Ga0157376_117868391 | 105 |
| 156 | 3300017792 | Ga0163161_10293506 | Ga0163161_102935062 | 105 |
| 157 | 3300017792 | Ga0163161_10344345 | Ga0163161_103443453 | 105 |
| 158 | 3300025315 | Ga0207697_10417204 | Ga0207697_104172041 | 105 |
| 159 | 3300025321 | Ga0207656_10063405 | Ga0207656_100634052 | 105 |
| 160 | 3300025899 | Ga0207642_10106813 | Ga0207642_101068132 | 105 |
| 161 | 3300025904 | Ga0207647_10000547 | Ga0207647_1000054724 | 105 |
| 162 | 3300025912 | Ga0207707_10232313 | Ga0207707_102323132 | 105 |
| 163 | 3300025912 | Ga0207707_10635348 | Ga0207707_106353482 | 105 |
| 164 | 3300025913 | Ga0207695_10380344 | Ga0207695_103803442 | 105 |
| 165 | 3300025914 | Ga0207671_10823447 | Ga0207671_108234472 | 105 |
| 166 | 3300025916 | Ga0207663_10000002 | Ga0207663_10000002277 | 105 |
| 167 | 3300025916 | Ga0207663_10164244 | Ga0207663_101642442 | 105 |
| 168 | 3300025919 | Ga0207657_10008520 | Ga0207657_100085209 | 105 |
| 169 | 3300025920 | Ga0207649_10350558 | Ga0207649_103505582 | 105 |
| 170 | 3300025921 | Ga0207652_10084122 | Ga0207652_100841222 | 105 |
| 171 | 3300025921 | Ga0207652_10245743 | Ga0207652_102457432 | 105 |
| 172 | 3300025924 | Ga0207694_10217497 | Ga0207694_102174972 | 105 |
| 173 | 3300025925 | Ga0207650_10420629 | Ga0207650_104206292 | 105 |
| 174 | 3300025926 | Ga0207659_10312122 | Ga0207659_103121222 | 105 |
| 175 | 3300025926 | Ga0207659_10393558 | Ga0207659_103935582 | 105 |
| 176 | 3300025928 | Ga0207700_10946942 | Ga0207700_109469422 | 105 |
| 177 | 3300025931 | Ga0207644_10037727 | Ga0207644_100377275 | 105 |
| 178 | 3300025931 | Ga0207644_10711806 | Ga0207644_107118061 | 105 |
| 179 | 3300025931 | Ga0207644_10994791 | Ga0207644_109947911 | 105 |
| 180 | 3300025932 | Ga0207690_10006797 | Ga0207690_1000679710 | 105 |
| 181 | 3300025933 | Ga0207706_10216529 | Ga0207706_102165292 | 105 |
| 182 | 3300025934 | Ga0207686_10027013 | Ga0207686_100270132 | 105 |
| 183 | 3300025934 | Ga0207686_10147597 | Ga0207686_101475973 | 105 |
| 184 | 3300025935 | Ga0207709_10639489 | Ga0207709_106394892 | 105 |
| 185 | 3300025937 | Ga0207669_10148573 | Ga0207669_101485733 | 105 |
| 186 | 3300025938 | Ga0207704_10046495 | Ga0207704_100464952 | 105 |
| 187 | 3300025938 | Ga0207704_10057420 | Ga0207704_100574202 | 105 |
| 188 | 3300025938 | Ga0207704_10202730 | Ga0207704_102027302 | 105 |
| 189 | 3300025938 | Ga0207704_10466918 | Ga0207704_104669181 | 105 |
| 190 | 3300025939 | Ga0207665_10289987 | Ga0207665_102899872 | 105 |
| 191 | 3300025940 | Ga0207691_10033677 | Ga0207691_100336775 | 105 |
| 192 | 3300025941 | Ga0207711_10058759 | Ga0207711_100587595 | 105 |
| 193 | 3300025942 | Ga0207689_10116757 | Ga0207689_101167573 | 105 |
| 194 | 3300025942 | Ga0207689_10509175 | Ga0207689_105091752 | 105 |
| 195 | 3300025944 | Ga0207661_10124396 | Ga0207661_101243962 | 105 |
| 196 | 3300025949 | Ga0207667_10062259 | Ga0207667_100622592 | 105 |
| 197 | 3300025949 | Ga0207667_10781852 | Ga0207667_107818522 | 105 |
| 198 | 3300025960 | Ga0207651_10066552 | Ga0207651_100665522 | 105 |
| 199 | 3300025961 | Ga0207712_10517630 | Ga0207712_105176302 | 105 |
| 200 | 3300025961 | Ga0207712_10772103 | Ga0207712_107721032 | 105 |
| 201 | 3300025972 | Ga0207668_11184262 | Ga0207668_111842621 | 105 |
| 202 | 3300025981 | Ga0207640_11164046 | Ga0207640_111640462 | 105 |
| 203 | 3300025986 | Ga0207658_10147234 | Ga0207658_101472342 | 105 |
| 204 | 3300025986 | Ga0207658_10819908 | Ga0207658_108199081 | 105 |
| 205 | 3300025986 | Ga0207658_11056192 | Ga0207658_110561921 | 105 |
| 206 | 3300026023 | Ga0207677_11042532 | Ga0207677_110425322 | 105 |
| 207 | 3300026035 | Ga0207703_10468844 | Ga0207703_104688442 | 105 |
| 208 | 3300026035 | Ga0207703_10856925 | Ga0207703_108569252 | 105 |
| 209 | 3300026041 | Ga0207639_10046521 | Ga0207639_100465213 | 105 |
| 210 | 3300026041 | Ga0207639_10298030 | Ga0207639_102980302 | 105 |
| 211 | 3300026041 | Ga0207639_10594021 | Ga0207639_105940212 | 105 |
| 212 | 3300026067 | Ga0207678_10906896 | Ga0207678_109068962 | 105 |
| 213 | 3300026078 | Ga0207702_10148597 | Ga0207702_101485972 | 105 |
| 214 | 3300026088 | Ga0207641_10054112 | Ga0207641_100541122 | 105 |
| 215 | 3300026088 | Ga0207641_10280731 | Ga0207641_102807313 | 105 |
| 216 | 3300026088 | Ga0207641_10551168 | Ga0207641_105511682 | 105 |
| 217 | 3300026088 | Ga0207641_11230550 | Ga0207641_112305502 | 105 |
| 218 | 3300026089 | Ga0207648_10008756 | Ga0207648_100087563 | 105 |
| 219 | 3300026095 | Ga0207676_10220274 | Ga0207676_102202741 | 105 |
| 220 | 3300026095 | Ga0207676_10536569 | Ga0207676_105365692 | 105 |
| 221 | 3300026116 | Ga0207674_10003167 | Ga0207674_1000316718 | 105 |
| 222 | 3300026121 | Ga0207683_10001251 | Ga0207683_100012513 | 105 |
| 223 | 3300026121 | Ga0207683_10272937 | Ga0207683_102729372 | 105 |
| 224 | 3300026121 | Ga0207683_10847248 | Ga0207683_108472482 | 105 |
| 225 | 3300026142 | Ga0207698_10344366 | Ga0207698_103443663 | 105 |
| 226 | 3300027876 | Ga0209974_10006568 | Ga0209974_100065681 | 105 |
| 227 | 3300028379 | Ga0268266_10649084 | Ga0268266_106490842 | 105 |
| 228 | 3300028380 | Ga0268265_10184475 | Ga0268265_101844752 | 105 |
| 229 | 3300028380 | Ga0268265_10352273 | Ga0268265_103522732 | 105 |
| 230 | 3300028381 | Ga0268264_10022619 | Ga0268264_100226199 | 105 |
| 231 | 3300028381 | Ga0268264_12666906 | Ga0268264_126669062 | 105 |
| 232 | 3300031241 | Ga0265325_10476340 | Ga0265325_104763402 | 105 |
| 233 | 3300031824 | Ga0307413_11455888 | Ga0307413_114558881 | 105 |
| 234 | 3300035089 | Ga0373944_0136029 | Ga0373944_0136029_104_439 | 105 |
| 235 | 3300035691 | Ga0373931_1116398 | Ga0373931_1116398_133_468 | 105 |
| 236 | 3300035692 | Ga0373935_0579610 | Ga0373935_0579610_432_767 | 105 |
| 237 | 3300037068 | Ga0373925_0731168 | Ga0373925_0731168_254_589 | 105 |
| 238 | 3300041408 | Ga0439453_0129000 | Ga0439453_0129000_135_452 | 105 |
| 239 | 3300041443 | Ga0451789_1098755 | Ga0451789_1098755_284_607 | 105 |
| 240 | 3300042123 | Ga0450921_000557 | Ga0450921_000557_111_428 | 105 |
| 241 | 3300042126 | Ga0450888_026066 | Ga0450888_026066_35_352 | 105 |
| 242 | 3300042436 | Ga0439435_0000415 | Ga0439435_0000415_455_772 | 105 |
| 243 | 3300042436 | Ga0439435_0061637 | Ga0439435_0061637_417_734 | 105 |
| 244 | 3300042437 | Ga0439444_0002121 | Ga0439444_0002121_2009_2326 | 105 |
| 245 | 3300042532 | Ga0450893_0030716 | Ga0450893_0030716_39_356 | 105 |
| 246 | 3300042876 | Ga0451577_0126672 | Ga0451577_0126672_1713_2030 | 105 |
| 247 | 3300044712 | Ga0453684_0072992 | Ga0453684_0072992_1965_2282 | 105 |
| 248 | 3300044712 | Ga0453684_0359331 | Ga0453684_0359331_114_431 | 105 |
| 249 | 3300045051 | Ga0451576_0014826 | Ga0451576_0014826_7816_8133 | 105 |
| 250 | 3300046473 | Ga0495582_0084677 | Ga0495582_0084677_439_774 | 105 |
| 251 | 3300046475 | Ga0495639_0038859 | Ga0495639_0038859_94_429 | 105 |
| 252 | 3300046531 | Ga0495665_0060046 | Ga0495665_0060046_1567_1902 | 105 |
| 253 | 3300046535 | Ga0495586_0351726 | Ga0495586_0351726_123_458 | 105 |
| 254 | 3300046543 | Ga0495645_0202844 | Ga0495645_0202844_738_1073 | 105 |
| 255 | 3300046663 | Ga0495635_0202318 | Ga0495635_0202318_533_868 | 105 |
| 256 | 3300046675 | Ga0495657_0067720 | Ga0495657_0067720_1881_2216 | 105 |
| 257 | 3300046681 | Ga0495647_0083367 | Ga0495647_0083367_800_1135 | 105 |
| 258 | 3300046683 | Ga0495658_0013257 | Ga0495658_0013257_635_970 | 105 |
| 259 | 3300046689 | Ga0495613_0537265 | Ga0495613_0537265_319_654 | 105 |
| 260 | 3300047471 | Ga0495684_0441291 | Ga0495684_0441291_10_345 | 105 |
| 261 | 3300047673 | Ga0495593_0167932 | Ga0495593_0167932_541_876 | 105 |
| 262 | 3300048089 | Ga0495614_0413916 | Ga0495614_0413916_122_457 | 105 |
| 263 | 3300048907 | Ga0496104_0000038 | Ga0496104_0000038_172233_172568 | 105 |
| 264 | 3300048908 | Ga0496105_0000038 | Ga0496105_0000038_5543_5878 | 105 |
| 265 | 3300048917 | Ga0496114_0744754 | Ga0496114_0744754_162_497 | 105 |
| 266 | 3300049569 | Ga0501032_0248686 | Ga0501032_0248686_231_557 | 105 |
| 267 | 3300049570 | Ga0501033_0706233 | Ga0501033_0706233_111_428 | 105 |
| 268 | 3300049571 | Ga0501034_0003074 | Ga0501034_0003074_11473_11799 | 105 |
| 269 | 3300049571 | Ga0501034_0006567 | Ga0501034_0006567_5272_5598 | 105 |
| 270 | 3300049571 | Ga0501034_0019047 | Ga0501034_0019047_394_720 | 105 |
| 271 | 3300049572 | Ga0501036_0019542 | Ga0501036_0019542_4924_5241 | 105 |
| 272 | 3300049572 | Ga0501036_0096727 | Ga0501036_0096727_41_367 | 105 |
| 273 | 3300049573 | Ga0501037_0813060 | Ga0501037_0813060_235_561 | 105 |
| 274 | 3300049574 | Ga0501038_0108297 | Ga0501038_0108297_1228_1554 | 105 |
| 275 | 3300049574 | Ga0501038_0628221 | Ga0501038_0628221_238_555 | 105 |
| 276 | 3300049575 | Ga0501039_0295614 | Ga0501039_0295614_606_923 | 105 |
| 277 | 3300049576 | Ga0501040_0004831 | Ga0501040_0004831_3134_3451 | 105 |
| 278 | 3300049576 | Ga0501040_0862451 | Ga0501040_0862451_21_347 | 105 |
| 279 | 3300049577 | Ga0501041_0001803 | Ga0501041_0001803_5246_5563 | 105 |
| 280 | 3300049578 | Ga0501042_0027262 | Ga0501042_0027262_1350_1667 | 105 |
| 281 | 3300049579 | Ga0501043_0040939 | Ga0501043_0040939_2859_3185 | 105 |
| 282 | 3300049580 | Ga0501046_0046848 | Ga0501046_0046848_2446_2772 | 105 |
| 283 | 3300049581 | Ga0501047_0001606 | Ga0501047_0001606_8731_9057 | 105 |
| 284 | 3300049581 | Ga0501047_0551888 | Ga0501047_0551888_475_801 | 105 |
| 285 | 3300049582 | Ga0501048_0207703 | Ga0501048_0207703_739_1065 | 105 |
| 286 | 3300049586 | Ga0501070_0006414 | Ga0501070_0006414_2144_2470 | 105 |
| 287 | 3300049586 | Ga0501070_0013617 | Ga0501070_0013617_5658_5984 | 105 |
| 288 | 3300049586 | Ga0501070_0057235 | Ga0501070_0057235_1211_1537 | 105 |
| 289 | 3300049587 | Ga0501071_0007915 | Ga0501071_0007915_3041_3358 | 105 |
| 290 | 3300049588 | Ga0501072_0004526 | Ga0501072_0004526_8362_8688 | 105 |
| 291 | 3300049588 | Ga0501072_0060387 | Ga0501072_0060387_524_841 | 105 |
| 292 | 3300049589 | Ga0501073_0008464 | Ga0501073_0008464_4228_4554 | 105 |
| 293 | 3300049589 | Ga0501073_0071909 | Ga0501073_0071909_111_437 | 105 |
| 294 | 3300049589 | Ga0501073_0107679 | Ga0501073_0107679_303_626 | 105 |
| 295 | 3300049590 | Ga0501074_0018167 | Ga0501074_0018167_4579_4905 | 105 |
| 296 | 3300049590 | Ga0501074_0050646 | Ga0501074_0050646_2029_2346 | 105 |
| 297 | 3300049590 | Ga0501074_0156580 | Ga0501074_0156580_811_1137 | 105 |
| 298 | 3300049590 | Ga0501074_0181701 | Ga0501074_0181701_917_1243 | 105 |
| 299 | 3300049591 | Ga0501075_0018923 | Ga0501075_0018923_534_851 | 105 |
| 300 | 3300049592 | Ga0501076_0062813 | Ga0501076_0062813_466_783 | 105 |
| 301 | 3300049593 | Ga0501077_0016382 | Ga0501077_0016382_2390_2707 | 105 |
| 302 | 3300049741 | Ga0501079_0087814 | Ga0501079_0087814_328_645 | 105 |
| 303 | 3300049741 | Ga0501079_1201143 | Ga0501079_1201143_200_517 | 105 |
| 304 | 3300049742 | Ga0501080_0008657 | Ga0501080_0008657_2920_3246 | 105 |
| 305 | 3300049742 | Ga0501080_0077605 | Ga0501080_0077605_146_472 | 105 |
| 306 | 3300049742 | Ga0501080_0178197 | Ga0501080_0178197_66_383 | 105 |
| 307 | 3300049743 | Ga0501081_0007373 | Ga0501081_0007373_1735_2052 | 105 |
| 308 | 3300049744 | Ga0501083_0044409 | Ga0501083_0044409_2110_2436 | 105 |
| 309 | 3300049823 | Ga0501044_0042338 | Ga0501044_0042338_2933_3259 | 105 |
| 310 | 3300049823 | Ga0501044_0060812 | Ga0501044_0060812_3129_3455 | 105 |
| 311 | 3300049824 | Ga0501045_0016582 | Ga0501045_0016582_4261_4578 | 105 |
| 312 | 3300050511 | nmdc:mga08y16_253059_c1 | nmdc:mga08y16_253059_c1_673_990 | 105 |
| 313 | 3300050512 | nmdc:mga0n895_464628_c1 | nmdc:mga0n895_464628_c1_346_681 | 105 |
| 314 | 3300053077 | Ga0495601_0160063 | Ga0495601_0160063_693_1028 | 105 |
| 315 | 3300053085 | Ga0495619_0533542 | Ga0495619_0533542_113_448 | 105 |
| 316 | 3300053123 | Ga0500614_066252 | Ga0500614_066252_77_412 | 105 |
| 317 | 3300054114 | Ga0501084_0007266 | Ga0501084_0007266_440_757 | 105 |
| 318 | 3300054114 | Ga0501084_0812090 | Ga0501084_0812090_303_629 | 105 |
| 319 | 3300060353 | Ga0501082_0001294 | Ga0501082_0001294_539_856 | 105 |
| 320 | 3300060353 | Ga0501082_0091161 | Ga0501082_0091161_2040_2366 | 105 |
| 321 | 3300061734 | Ga0530510_0006290 | Ga0530510_0006290_1950_2267 | 105 |
| 322 | 3300005458 | Ga0070681_10013079 | Ga0070681_1001307913 | 106 |
| 323 | 3300005458 | Ga0070681_10146165 | Ga0070681_101461653 | 106 |
| 324 | 3300005530 | Ga0070679_100020411 | Ga0070679_1000204114 | 106 |
| 325 | 3300005530 | Ga0070679_100044245 | Ga0070679_1000442453 | 106 |
| 326 | 3300005563 | Ga0068855_100140430 | Ga0068855_1001404303 | 106 |
| 327 | 3300005563 | Ga0068855_100282700 | Ga0068855_1002827003 | 106 |
| 328 | 3300006042 | Ga0075368_10245610 | Ga0075368_102456102 | 106 |
| 329 | 3300006844 | Ga0075428_100000574 | Ga0075428_1000005748 | 106 |
| 330 | 3300006880 | Ga0075429_100082854 | Ga0075429_1000828544 | 106 |
| 331 | 3300009093 | Ga0105240_10540088 | Ga0105240_105400882 | 106 |
| 332 | 3300009094 | Ga0111539_10000811 | Ga0111539_1000081119 | 106 |
| 333 | 3300009148 | Ga0105243_11243149 | Ga0105243_112431492 | 106 |
| 334 | 3300013308 | Ga0157375_12429222 | Ga0157375_124292222 | 106 |
| 335 | 3300025912 | Ga0207707_10000021 | Ga0207707_1000002126 | 106 |
| 336 | 3300025912 | Ga0207707_10908107 | Ga0207707_109081071 | 106 |
| 337 | 3300025921 | Ga0207652_10124678 | Ga0207652_101246781 | 106 |
| 338 | 3300025921 | Ga0207652_10668381 | Ga0207652_106683813 | 106 |
| 339 | 3300025949 | Ga0207667_10793616 | Ga0207667_107936163 | 106 |
| 340 | 3300027907 | Ga0207428_10000195 | Ga0207428_1000019522 | 106 |
| 341 | 3300028800 | Ga0265338_10462021 | Ga0265338_104620212 | 106 |
| 342 | 3300031548 | Ga0307408_101251676 | Ga0307408_1012516762 | 106 |
| 343 | 3300031824 | Ga0307413_10675967 | Ga0307413_106759672 | 106 |
| 344 | 3300032002 | Ga0307416_100119838 | Ga0307416_1001198384 | 106 |
| 345 | 3300042436 | Ga0439435_0068856 | Ga0439435_0068856_440_775 | 106 |
| 346 | 3300049568 | Ga0501031_0675619 | Ga0501031_0675619_279_629 | 106 |
| 347 | 3300049569 | Ga0501032_0317876 | Ga0501032_0317876_240_590 | 106 |
| 348 | 3300049588 | Ga0501072_0332576 | Ga0501072_0332576_747_1097 | 106 |
| 349 | 3300049592 | Ga0501076_0276088 | Ga0501076_0276088_110_460 | 106 |
| 350 | 3300049741 | Ga0501079_0466482 | Ga0501079_0466482_268_618 | 106 |
| 351 | 3300049743 | Ga0501081_0237308 | Ga0501081_0237308_200_550 | 106 |
| 352 | 3300049824 | Ga0501045_0141021 | Ga0501045_0141021_529_879 | 106 |
| 353 | 3300050508 | nmdc:mga09592_116656_c1 | nmdc:mga09592_116656_c1_1400_1735 | 106 |
| 354 | 3300050509 | nmdc:mga0qj67_97100_c1 | nmdc:mga0qj67_97100_c1_522_857 | 106 |
| 355 | 3300050511 | nmdc:mga08y16_25_c1 | nmdc:mga08y16_25_c1_158209_158544 | 106 |
| 356 | 3300054114 | Ga0501084_0001985 | Ga0501084_0001985_12277_12606 | 106 |
| 357 | 3300060353 | Ga0501082_0170320 | Ga0501082_0170320_463_813 | 106 |
| 358 | 3300061734 | Ga0530510_0221821 | Ga0530510_0221821_356_706 | 106 |
| 359 | 3300003320 | rootH2_10000244 | rootH2_10000244182 | 107 |
| 360 | 3300003320 | rootH2_10023934 | rootH2_1002393410 | 107 |
| 361 | 3300003322 | rootL2_10196664 | rootL2_101966642 | 107 |
| 362 | 3300003323 | rootH1_10020346 | rootH1_100203461 | 107 |
| 363 | 3300003323 | rootH1_10060084 | rootH1_100600845 | 107 |
| 364 | 3300003323 | rootH1_10112671 | rootH1_101126713 | 107 |
| 365 | 3300005277 | Ga0065716_1014350 | Ga0065716_10143502 | 107 |
| 366 | 3300005289 | Ga0065704_10149850 | Ga0065704_101498502 | 107 |
| 367 | 3300005289 | Ga0065704_10755470 | Ga0065704_107554702 | 107 |
| 368 | 3300005293 | Ga0065715_10280599 | Ga0065715_102805992 | 107 |
| 369 | 3300005293 | Ga0065715_10572473 | Ga0065715_105724731 | 107 |
| 370 | 3300005293 | Ga0065715_10597242 | Ga0065715_105972422 | 107 |
| 371 | 3300005293 | Ga0065715_10719566 | Ga0065715_107195661 | 107 |
| 372 | 3300005293 | Ga0065715_10763246 | Ga0065715_107632461 | 107 |
| 373 | 3300005295 | Ga0065707_10001068 | Ga0065707_100010688 | 107 |
| 374 | 3300005295 | Ga0065707_10015406 | Ga0065707_100154063 | 107 |
| 375 | 3300005295 | Ga0065707_10185580 | Ga0065707_101855802 | 107 |
| 376 | 3300005295 | Ga0065707_10633634 | Ga0065707_106336342 | 107 |
| 377 | 3300005295 | Ga0065707_10914318 | Ga0065707_109143182 | 107 |
| 378 | 3300005328 | Ga0070676_10266597 | Ga0070676_102665972 | 107 |
| 379 | 3300005328 | Ga0070676_10499738 | Ga0070676_104997382 | 107 |
| 380 | 3300005329 | Ga0070683_100033834 | Ga0070683_1000338342 | 107 |
| 381 | 3300005330 | Ga0070690_100004892 | Ga0070690_1000048926 | 107 |
| 382 | 3300005330 | Ga0070690_100428415 | Ga0070690_1004284152 | 107 |
| 383 | 3300005331 | Ga0070670_100003854 | Ga0070670_1000038549 | 107 |
| 384 | 3300005331 | Ga0070670_100018306 | Ga0070670_1000183065 | 107 |
| 385 | 3300005334 | Ga0068869_101658879 | Ga0068869_1016588791 | 107 |
| 386 | 3300005334 | Ga0068869_101767144 | Ga0068869_1017671441 | 107 |
| 387 | 3300005335 | Ga0070666_10006236 | Ga0070666_100062362 | 107 |
| 388 | 3300005335 | Ga0070666_10006373 | Ga0070666_100063732 | 107 |
| 389 | 3300005336 | Ga0070680_100039578 | Ga0070680_1000395784 | 107 |
| 390 | 3300005336 | Ga0070680_100301662 | Ga0070680_1003016623 | 107 |
| 391 | 3300005337 | Ga0070682_100275948 | Ga0070682_1002759482 | 107 |
| 392 | 3300005338 | Ga0068868_100004281 | Ga0068868_1000042818 | 107 |
| 393 | 3300005338 | Ga0068868_100154019 | Ga0068868_1001540193 | 107 |
| 394 | 3300005338 | Ga0068868_100748278 | Ga0068868_1007482781 | 107 |
| 395 | 3300005338 | Ga0068868_101030630 | Ga0068868_1010306301 | 107 |
| 396 | 3300005340 | Ga0070689_100290041 | Ga0070689_1002900411 | 107 |
| 397 | 3300005340 | Ga0070689_100609939 | Ga0070689_1006099392 | 107 |
| 398 | 3300005341 | Ga0070691_10227083 | Ga0070691_102270832 | 107 |
| 399 | 3300005343 | Ga0070687_100046546 | Ga0070687_1000465462 | 107 |
| 400 | 3300005344 | Ga0070661_100225900 | Ga0070661_1002259002 | 107 |
| 401 | 3300005347 | Ga0070668_102085394 | Ga0070668_1020853941 | 107 |
| 402 | 3300005353 | Ga0070669_100105297 | Ga0070669_1001052973 | 107 |
| 403 | 3300005353 | Ga0070669_100183311 | Ga0070669_1001833112 | 107 |
| 404 | 3300005353 | Ga0070669_100940671 | Ga0070669_1009406712 | 107 |
| 405 | 3300005353 | Ga0070669_101389514 | Ga0070669_1013895142 | 107 |
| 406 | 3300005354 | Ga0070675_100429850 | Ga0070675_1004298502 | 107 |
| 407 | 3300005354 | Ga0070675_101290714 | Ga0070675_1012907142 | 107 |
| 408 | 3300005355 | Ga0070671_100147903 | Ga0070671_1001479032 | 107 |
| 409 | 3300005355 | Ga0070671_100187945 | Ga0070671_1001879452 | 107 |
| 410 | 3300005355 | Ga0070671_100589699 | Ga0070671_1005896992 | 107 |
| 411 | 3300005356 | Ga0070674_100148600 | Ga0070674_1001486002 | 107 |
| 412 | 3300005356 | Ga0070674_100285170 | Ga0070674_1002851702 | 107 |
| 413 | 3300005356 | Ga0070674_100398185 | Ga0070674_1003981852 | 107 |
| 414 | 3300005356 | Ga0070674_100887973 | Ga0070674_1008879731 | 107 |
| 415 | 3300005356 | Ga0070674_101140347 | Ga0070674_1011403472 | 107 |
| 416 | 3300005364 | Ga0070673_100053464 | Ga0070673_1000534642 | 107 |
| 417 | 3300005364 | Ga0070673_100172803 | Ga0070673_1001728034 | 107 |
| 418 | 3300005365 | Ga0070688_100791409 | Ga0070688_1007914091 | 107 |
| 419 | 3300005367 | Ga0070667_100001051 | Ga0070667_10000105117 | 107 |
| 420 | 3300005367 | Ga0070667_100006417 | Ga0070667_10000641710 | 107 |
| 421 | 3300005367 | Ga0070667_100128514 | Ga0070667_1001285142 | 107 |
| 422 | 3300005435 | Ga0070714_100626221 | Ga0070714_1006262211 | 107 |
| 423 | 3300005436 | Ga0070713_100858290 | Ga0070713_1008582902 | 107 |
| 424 | 3300005436 | Ga0070713_101282997 | Ga0070713_1012829972 | 107 |
| 425 | 3300005439 | Ga0070711_101281959 | Ga0070711_1012819592 | 107 |
| 426 | 3300005440 | Ga0070705_100486604 | Ga0070705_1004866042 | 107 |
| 427 | 3300005440 | Ga0070705_101348026 | Ga0070705_1013480262 | 107 |
| 428 | 3300005440 | Ga0070705_101448893 | Ga0070705_1014488931 | 107 |
| 429 | 3300005441 | Ga0070700_100485934 | Ga0070700_1004859342 | 107 |
| 430 | 3300005441 | Ga0070700_100545334 | Ga0070700_1005453342 | 107 |
| 431 | 3300005444 | Ga0070694_101254484 | Ga0070694_1012544841 | 107 |
| 432 | 3300005444 | Ga0070694_101565399 | Ga0070694_1015653991 | 107 |
| 433 | 3300005445 | Ga0070708_102060234 | Ga0070708_1020602341 | 107 |
| 434 | 3300005456 | Ga0070678_100274857 | Ga0070678_1002748572 | 107 |
| 435 | 3300005456 | Ga0070678_100569943 | Ga0070678_1005699432 | 107 |
| 436 | 3300005456 | Ga0070678_100807793 | Ga0070678_1008077931 | 107 |
| 437 | 3300005456 | Ga0070678_100876573 | Ga0070678_1008765731 | 107 |
| 438 | 3300005457 | Ga0070662_100974513 | Ga0070662_1009745132 | 107 |
| 439 | 3300005458 | Ga0070681_10000277 | Ga0070681_1000027728 | 107 |
| 440 | 3300005458 | Ga0070681_10509578 | Ga0070681_105095781 | 107 |
| 441 | 3300005459 | Ga0068867_100920797 | Ga0068867_1009207972 | 107 |
| 442 | 3300005459 | Ga0068867_100935396 | Ga0068867_1009353961 | 107 |
| 443 | 3300005459 | Ga0068867_102023105 | Ga0068867_1020231051 | 107 |
| 444 | 3300005466 | Ga0070685_10258809 | Ga0070685_102588092 | 107 |
| 445 | 3300005468 | Ga0070707_100150543 | Ga0070707_1001505432 | 107 |
| 446 | 3300005468 | Ga0070707_100459353 | Ga0070707_1004593531 | 107 |
| 447 | 3300005471 | Ga0070698_101156672 | Ga0070698_1011566721 | 107 |
| 448 | 3300005530 | Ga0070679_100123695 | Ga0070679_1001236953 | 107 |
| 449 | 3300005530 | Ga0070679_100596242 | Ga0070679_1005962421 | 107 |
| 450 | 3300005530 | Ga0070679_100815721 | Ga0070679_1008157211 | 107 |
| 451 | 3300005535 | Ga0070684_100004819 | Ga0070684_10000481913 | 107 |
| 452 | 3300005535 | Ga0070684_100097126 | Ga0070684_1000971262 | 107 |
| 453 | 3300005543 | Ga0070672_100007574 | Ga0070672_1000075746 | 107 |
| 454 | 3300005543 | Ga0070672_100710995 | Ga0070672_1007109951 | 107 |
| 455 | 3300005544 | Ga0070686_100013755 | Ga0070686_1000137552 | 107 |
| 456 | 3300005544 | Ga0070686_100204295 | Ga0070686_1002042952 | 107 |
| 457 | 3300005544 | Ga0070686_101947409 | Ga0070686_1019474092 | 107 |
| 458 | 3300005545 | Ga0070695_101035505 | Ga0070695_1010355052 | 107 |
| 459 | 3300005545 | Ga0070695_101124633 | Ga0070695_1011246332 | 107 |
| 460 | 3300005546 | Ga0070696_100680782 | Ga0070696_1006807821 | 107 |
| 461 | 3300005548 | Ga0070665_100002424 | Ga0070665_1000024243 | 107 |
| 462 | 3300005548 | Ga0070665_102252951 | Ga0070665_1022529511 | 107 |
| 463 | 3300005549 | Ga0070704_100457338 | Ga0070704_1004573382 | 107 |
| 464 | 3300005563 | Ga0068855_100741520 | Ga0068855_1007415202 | 107 |
| 465 | 3300005564 | Ga0070664_100037509 | Ga0070664_1000375094 | 107 |
| 466 | 3300005564 | Ga0070664_100080692 | Ga0070664_1000806922 | 107 |
| 467 | 3300005564 | Ga0070664_100720420 | Ga0070664_1007204202 | 107 |
| 468 | 3300005564 | Ga0070664_102288591 | Ga0070664_1022885911 | 107 |
| 469 | 3300005577 | Ga0068857_100009726 | Ga0068857_10000972611 | 107 |
| 470 | 3300005577 | Ga0068857_101375990 | Ga0068857_1013759902 | 107 |
| 471 | 3300005578 | Ga0068854_100494337 | Ga0068854_1004943372 | 107 |
| 472 | 3300005578 | Ga0068854_101328548 | Ga0068854_1013285482 | 107 |
| 473 | 3300005614 | Ga0068856_100000001 | Ga0068856_100000001187 | 107 |
| 474 | 3300005614 | Ga0068856_100460069 | Ga0068856_1004600693 | 107 |
| 475 | 3300005614 | Ga0068856_102371587 | Ga0068856_1023715871 | 107 |
| 476 | 3300005615 | Ga0070702_100147511 | Ga0070702_1001475112 | 107 |
| 477 | 3300005616 | Ga0068852_101831934 | Ga0068852_1018319342 | 107 |
| 478 | 3300005617 | Ga0068859_100063322 | Ga0068859_1000633222 | 107 |
| 479 | 3300005617 | Ga0068859_100118199 | Ga0068859_1001181991 | 107 |
| 480 | 3300005617 | Ga0068859_100136174 | Ga0068859_1001361742 | 107 |
| 481 | 3300005617 | Ga0068859_100511565 | Ga0068859_1005115652 | 107 |
| 482 | 3300005617 | Ga0068859_101039449 | Ga0068859_1010394491 | 107 |
| 483 | 3300005617 | Ga0068859_101125852 | Ga0068859_1011258522 | 107 |
| 484 | 3300005617 | Ga0068859_101662287 | Ga0068859_1016622871 | 107 |
| 485 | 3300005617 | Ga0068859_102725635 | Ga0068859_1027256351 | 107 |
| 486 | 3300005618 | Ga0068864_100009805 | Ga0068864_1000098056 | 107 |
| 487 | 3300005618 | Ga0068864_100100119 | Ga0068864_1001001192 | 107 |
| 488 | 3300005618 | Ga0068864_100401574 | Ga0068864_1004015742 | 107 |
| 489 | 3300005618 | Ga0068864_101233103 | Ga0068864_1012331032 | 107 |
| 490 | 3300005618 | Ga0068864_102519451 | Ga0068864_1025194512 | 107 |
| 491 | 3300005719 | Ga0068861_101017335 | Ga0068861_1010173352 | 107 |
| 492 | 3300005840 | Ga0068870_10137638 | Ga0068870_101376383 | 107 |
| 493 | 3300005840 | Ga0068870_10672591 | Ga0068870_106725912 | 107 |
| 494 | 3300005841 | Ga0068863_100000665 | Ga0068863_1000006657 | 107 |
| 495 | 3300005841 | Ga0068863_100018390 | Ga0068863_1000183904 | 107 |
| 496 | 3300005841 | Ga0068863_100091145 | Ga0068863_1000911454 | 107 |
| 497 | 3300005841 | Ga0068863_100107190 | Ga0068863_1001071904 | 107 |
| 498 | 3300005841 | Ga0068863_100311563 | Ga0068863_1003115632 | 107 |
| 499 | 3300005842 | Ga0068858_100008434 | Ga0068858_1000084346 | 107 |
| 500 | 3300005842 | Ga0068858_100114498 | Ga0068858_1001144984 | 107 |
| 501 | 3300005842 | Ga0068858_100741555 | Ga0068858_1007415552 | 107 |
| 502 | 3300005842 | Ga0068858_101433318 | Ga0068858_1014333181 | 107 |
| 503 | 3300005842 | Ga0068858_101718545 | Ga0068858_1017185452 | 107 |
| 504 | 3300005843 | Ga0068860_100129405 | Ga0068860_1001294052 | 107 |
| 505 | 3300005843 | Ga0068860_100183298 | Ga0068860_1001832982 | 107 |
| 506 | 3300005843 | Ga0068860_100328041 | Ga0068860_1003280412 | 107 |
| 507 | 3300005843 | Ga0068860_101185949 | Ga0068860_1011859491 | 107 |
| 508 | 3300005844 | Ga0068862_100024578 | Ga0068862_1000245785 | 107 |
| 509 | 3300005844 | Ga0068862_100192101 | Ga0068862_1001921012 | 107 |
| 510 | 3300005937 | Ga0081455_10024812 | Ga0081455_100248122 | 107 |
| 511 | 3300005937 | Ga0081455_10433448 | Ga0081455_104334481 | 107 |
| 512 | 3300006042 | Ga0075368_10162061 | Ga0075368_101620612 | 107 |
| 513 | 3300006051 | Ga0075364_10026629 | Ga0075364_100266294 | 107 |
| 514 | 3300006051 | Ga0075364_10038708 | Ga0075364_100387084 | 107 |
| 515 | 3300006058 | Ga0075432_10133411 | Ga0075432_101334112 | 107 |
| 516 | 3300006173 | Ga0070716_100229622 | Ga0070716_1002296222 | 107 |
| 517 | 3300006237 | Ga0097621_100051013 | Ga0097621_1000510132 | 107 |
| 518 | 3300006237 | Ga0097621_100129336 | Ga0097621_1001293362 | 107 |
| 519 | 3300006237 | Ga0097621_100195492 | Ga0097621_1001954922 | 107 |
| 520 | 3300006237 | Ga0097621_100916974 | Ga0097621_1009169741 | 107 |
| 521 | 3300006358 | Ga0068871_100056075 | Ga0068871_1000560755 | 107 |
| 522 | 3300006358 | Ga0068871_100134365 | Ga0068871_1001343653 | 107 |
| 523 | 3300006358 | Ga0068871_100249390 | Ga0068871_1002493902 | 107 |
| 524 | 3300006358 | Ga0068871_100629206 | Ga0068871_1006292062 | 107 |
| 525 | 3300006358 | Ga0068871_101185544 | Ga0068871_1011855441 | 107 |
| 526 | 3300006844 | Ga0075428_100259211 | Ga0075428_1002592112 | 107 |
| 527 | 3300006852 | Ga0075433_10753686 | Ga0075433_107536862 | 107 |
| 528 | 3300006871 | Ga0075434_100122664 | Ga0075434_1001226643 | 107 |
| 529 | 3300006881 | Ga0068865_101743681 | Ga0068865_1017436812 | 107 |
| 530 | 3300006881 | Ga0068865_102012575 | Ga0068865_1020125751 | 107 |
| 531 | 3300006914 | Ga0075436_101524788 | Ga0075436_1015247881 | 107 |
| 532 | 3300006931 | Ga0097620_100063325 | Ga0097620_1000633255 | 107 |
| 533 | 3300006931 | Ga0097620_100118198 | Ga0097620_1001181983 | 107 |
| 534 | 3300006931 | Ga0097620_100136168 | Ga0097620_1001361682 | 107 |
| 535 | 3300006931 | Ga0097620_100511578 | Ga0097620_1005115782 | 107 |
| 536 | 3300006931 | Ga0097620_101039573 | Ga0097620_1010395732 | 107 |
| 537 | 3300006931 | Ga0097620_101125683 | Ga0097620_1011256832 | 107 |
| 538 | 3300006931 | Ga0097620_101662098 | Ga0097620_1016620981 | 107 |
| 539 | 3300006931 | Ga0097620_102725734 | Ga0097620_1027257341 | 107 |
| 540 | 3300007788 | Ga0099795_10361773 | Ga0099795_103617731 | 107 |
| 541 | 3300009093 | Ga0105240_10033308 | Ga0105240_100333082 | 107 |
| 542 | 3300009093 | Ga0105240_10195764 | Ga0105240_101957642 | 107 |
| 543 | 3300009093 | Ga0105240_10208043 | Ga0105240_102080432 | 107 |
| 544 | 3300009093 | Ga0105240_10282646 | Ga0105240_102826462 | 107 |
| 545 | 3300009093 | Ga0105240_11026932 | Ga0105240_110269322 | 107 |
| 546 | 3300009093 | Ga0105240_12123896 | Ga0105240_121238961 | 107 |
| 547 | 3300009094 | Ga0111539_10000282 | Ga0111539_1000028250 | 107 |
| 548 | 3300009094 | Ga0111539_10095837 | Ga0111539_100958374 | 107 |
| 549 | 3300009094 | Ga0111539_10567516 | Ga0111539_105675162 | 107 |
| 550 | 3300009094 | Ga0111539_13034792 | Ga0111539_130347922 | 107 |
| 551 | 3300009098 | Ga0105245_11513876 | Ga0105245_115138762 | 107 |
| 552 | 3300009098 | Ga0105245_12095569 | Ga0105245_120955692 | 107 |
| 553 | 3300009101 | Ga0105247_10187319 | Ga0105247_101873191 | 107 |
| 554 | 3300009101 | Ga0105247_10226314 | Ga0105247_102263142 | 107 |
| 555 | 3300009101 | Ga0105247_11123103 | Ga0105247_111231031 | 107 |
| 556 | 3300009101 | Ga0105247_11344490 | Ga0105247_113444901 | 107 |
| 557 | 3300009147 | Ga0114129_10000741 | Ga0114129_1000074121 | 107 |
| 558 | 3300009147 | Ga0114129_10075673 | Ga0114129_100756733 | 107 |
| 559 | 3300009147 | Ga0114129_10158596 | Ga0114129_101585964 | 107 |
| 560 | 3300009147 | Ga0114129_10785109 | Ga0114129_107851093 | 107 |
| 561 | 3300009147 | Ga0114129_11329456 | Ga0114129_113294561 | 107 |
| 562 | 3300009148 | Ga0105243_10502515 | Ga0105243_105025151 | 107 |
| 563 | 3300009148 | Ga0105243_11543735 | Ga0105243_115437352 | 107 |
| 564 | 3300009148 | Ga0105243_12284170 | Ga0105243_122841702 | 107 |
| 565 | 3300009174 | Ga0105241_10386150 | Ga0105241_103861502 | 107 |
| 566 | 3300009174 | Ga0105241_11402181 | Ga0105241_114021812 | 107 |
| 567 | 3300009174 | Ga0105241_12312710 | Ga0105241_123127101 | 107 |
| 568 | 3300009176 | Ga0105242_10486745 | Ga0105242_104867452 | 107 |
| 569 | 3300009176 | Ga0105242_12035086 | Ga0105242_120350861 | 107 |
| 570 | 3300009176 | Ga0105242_12574073 | Ga0105242_125740731 | 107 |
| 571 | 3300009176 | Ga0105242_12945088 | Ga0105242_129450881 | 107 |
| 572 | 3300009177 | Ga0105248_10033995 | Ga0105248_100339955 | 107 |
| 573 | 3300009177 | Ga0105248_10172202 | Ga0105248_101722022 | 107 |
| 574 | 3300009177 | Ga0105248_10641630 | Ga0105248_106416302 | 107 |
| 575 | 3300009177 | Ga0105248_10691462 | Ga0105248_106914623 | 107 |
| 576 | 3300009177 | Ga0105248_10909020 | Ga0105248_109090202 | 107 |
| 577 | 3300009177 | Ga0105248_12542943 | Ga0105248_125429432 | 107 |
| 578 | 3300009177 | Ga0105248_12826096 | Ga0105248_128260962 | 107 |
| 579 | 3300009545 | Ga0105237_10091701 | Ga0105237_100917014 | 107 |
| 580 | 3300009545 | Ga0105237_10225794 | Ga0105237_102257942 | 107 |
| 581 | 3300009545 | Ga0105237_10547063 | Ga0105237_105470631 | 107 |
| 582 | 3300009551 | Ga0105238_10136472 | Ga0105238_101364722 | 107 |
| 583 | 3300009551 | Ga0105238_10149432 | Ga0105238_101494323 | 107 |
| 584 | 3300009551 | Ga0105238_10156998 | Ga0105238_101569982 | 107 |
| 585 | 3300009551 | Ga0105238_10782973 | Ga0105238_107829732 | 107 |
| 586 | 3300009553 | Ga0105249_10032077 | Ga0105249_100320775 | 107 |
| 587 | 3300009553 | Ga0105249_10839179 | Ga0105249_108391792 | 107 |
| 588 | 3300009553 | Ga0105249_11695204 | Ga0105249_116952041 | 107 |
| 589 | 3300009553 | Ga0105249_12036321 | Ga0105249_120363212 | 107 |
| 590 | 3300009553 | Ga0105249_12347366 | Ga0105249_123473661 | 107 |
| 591 | 3300010159 | Ga0099796_10243783 | Ga0099796_102437832 | 107 |
| 592 | 3300010375 | Ga0105239_10029577 | Ga0105239_100295772 | 107 |
| 593 | 3300010375 | Ga0105239_11172436 | Ga0105239_111724361 | 107 |
| 594 | 3300011119 | Ga0105246_11066594 | Ga0105246_110665941 | 107 |
| 595 | 3300013104 | Ga0157370_10255611 | Ga0157370_102556112 | 107 |
| 596 | 3300013105 | Ga0157369_12287005 | Ga0157369_122870051 | 107 |
| 597 | 3300013296 | Ga0157374_10488935 | Ga0157374_104889352 | 107 |
| 598 | 3300013296 | Ga0157374_10843957 | Ga0157374_108439572 | 107 |
| 599 | 3300013296 | Ga0157374_11460446 | Ga0157374_114604461 | 107 |
| 600 | 3300013297 | Ga0157378_10226566 | Ga0157378_102265663 | 107 |
| 601 | 3300013297 | Ga0157378_10805152 | Ga0157378_108051521 | 107 |
| 602 | 3300013297 | Ga0157378_11239745 | Ga0157378_112397452 | 107 |
| 603 | 3300013297 | Ga0157378_11914364 | Ga0157378_119143641 | 107 |
| 604 | 3300013306 | Ga0163162_10094707 | Ga0163162_100947075 | 107 |
| 605 | 3300013308 | Ga0157375_10081907 | Ga0157375_100819073 | 107 |
| 606 | 3300013308 | Ga0157375_10487214 | Ga0157375_104872142 | 107 |
| 607 | 3300013308 | Ga0157375_12460960 | Ga0157375_124609601 | 107 |
| 608 | 3300014325 | Ga0163163_10007882 | Ga0163163_100078823 | 107 |
| 609 | 3300014325 | Ga0163163_10090956 | Ga0163163_100909563 | 107 |
| 610 | 3300014325 | Ga0163163_10226311 | Ga0163163_102263112 | 107 |
| 611 | 3300014325 | Ga0163163_11285133 | Ga0163163_112851332 | 107 |
| 612 | 3300014326 | Ga0157380_10029095 | Ga0157380_100290952 | 107 |
| 613 | 3300014326 | Ga0157380_10560241 | Ga0157380_105602412 | 107 |
| 614 | 3300014326 | Ga0157380_10585159 | Ga0157380_105851593 | 107 |
| 615 | 3300014326 | Ga0157380_11764318 | Ga0157380_117643181 | 107 |
| 616 | 3300014326 | Ga0157380_11920112 | Ga0157380_119201122 | 107 |
| 617 | 3300014745 | Ga0157377_10163465 | Ga0157377_101634652 | 107 |
| 618 | 3300014745 | Ga0157377_10423428 | Ga0157377_104234282 | 107 |
| 619 | 3300014745 | Ga0157377_10435147 | Ga0157377_104351472 | 107 |
| 620 | 3300014968 | Ga0157379_10018917 | Ga0157379_100189177 | 107 |
| 621 | 3300014968 | Ga0157379_10377169 | Ga0157379_103771692 | 107 |
| 622 | 3300014968 | Ga0157379_10411835 | Ga0157379_104118352 | 107 |
| 623 | 3300014969 | Ga0157376_10171114 | Ga0157376_101711143 | 107 |
| 624 | 3300014969 | Ga0157376_10431250 | Ga0157376_104312502 | 107 |
| 625 | 3300014969 | Ga0157376_10566622 | Ga0157376_105666223 | 107 |
| 626 | 3300014969 | Ga0157376_10951252 | Ga0157376_109512522 | 107 |
| 627 | 3300017792 | Ga0163161_11575943 | Ga0163161_115759432 | 107 |
| 628 | 3300020610 | Ga0154015_1623859 | Ga0154015_16238591 | 107 |
| 629 | 3300025315 | Ga0207697_10072222 | Ga0207697_100722221 | 107 |
| 630 | 3300025315 | Ga0207697_10318934 | Ga0207697_103189342 | 107 |
| 631 | 3300025899 | Ga0207642_10205918 | Ga0207642_102059182 | 107 |
| 632 | 3300025900 | Ga0207710_10065489 | Ga0207710_100654892 | 107 |
| 633 | 3300025901 | Ga0207688_10249364 | Ga0207688_102493642 | 107 |
| 634 | 3300025903 | Ga0207680_10012690 | Ga0207680_100126903 | 107 |
| 635 | 3300025903 | Ga0207680_10018329 | Ga0207680_100183293 | 107 |
| 636 | 3300025905 | Ga0207685_10642333 | Ga0207685_106423332 | 107 |
| 637 | 3300025907 | Ga0207645_10079544 | Ga0207645_100795444 | 107 |
| 638 | 3300025907 | Ga0207645_11113305 | Ga0207645_111133052 | 107 |
| 639 | 3300025911 | Ga0207654_10241381 | Ga0207654_102413813 | 107 |
| 640 | 3300025912 | Ga0207707_10000125 | Ga0207707_1000012527 | 107 |
| 641 | 3300025913 | Ga0207695_10068626 | Ga0207695_100686261 | 107 |
| 642 | 3300025913 | Ga0207695_10080105 | Ga0207695_100801052 | 107 |
| 643 | 3300025913 | Ga0207695_10143122 | Ga0207695_101431222 | 107 |
| 644 | 3300025914 | Ga0207671_10217397 | Ga0207671_102173972 | 107 |
| 645 | 3300025914 | Ga0207671_10409002 | Ga0207671_104090022 | 107 |
| 646 | 3300025917 | Ga0207660_10611740 | Ga0207660_106117401 | 107 |
| 647 | 3300025917 | Ga0207660_10960600 | Ga0207660_109606001 | 107 |
| 648 | 3300025917 | Ga0207660_11171621 | Ga0207660_111716211 | 107 |
| 649 | 3300025918 | Ga0207662_10040400 | Ga0207662_100404002 | 107 |
| 650 | 3300025918 | Ga0207662_11302837 | Ga0207662_113028372 | 107 |
| 651 | 3300025920 | Ga0207649_10123772 | Ga0207649_101237722 | 107 |
| 652 | 3300025920 | Ga0207649_10607044 | Ga0207649_106070442 | 107 |
| 653 | 3300025920 | Ga0207649_10952231 | Ga0207649_109522311 | 107 |
| 654 | 3300025921 | Ga0207652_10011466 | Ga0207652_100114663 | 107 |
| 655 | 3300025921 | Ga0207652_10093547 | Ga0207652_100935472 | 107 |
| 656 | 3300025921 | Ga0207652_10867278 | Ga0207652_108672781 | 107 |
| 657 | 3300025922 | Ga0207646_10338017 | Ga0207646_103380172 | 107 |
| 658 | 3300025922 | Ga0207646_10393161 | Ga0207646_103931612 | 107 |
| 659 | 3300025922 | Ga0207646_10941965 | Ga0207646_109419651 | 107 |
| 660 | 3300025923 | Ga0207681_10086761 | Ga0207681_100867613 | 107 |
| 661 | 3300025923 | Ga0207681_10217023 | Ga0207681_102170232 | 107 |
| 662 | 3300025923 | Ga0207681_11280559 | Ga0207681_112805591 | 107 |
| 663 | 3300025924 | Ga0207694_10091391 | Ga0207694_100913913 | 107 |
| 664 | 3300025924 | Ga0207694_10163944 | Ga0207694_101639443 | 107 |
| 665 | 3300025924 | Ga0207694_10813667 | Ga0207694_108136672 | 107 |
| 666 | 3300025924 | Ga0207694_11415734 | Ga0207694_114157342 | 107 |
| 667 | 3300025925 | Ga0207650_10002523 | Ga0207650_100025237 | 107 |
| 668 | 3300025925 | Ga0207650_10007320 | Ga0207650_100073202 | 107 |
| 669 | 3300025926 | Ga0207659_10022086 | Ga0207659_100220862 | 107 |
| 670 | 3300025926 | Ga0207659_10250903 | Ga0207659_102509033 | 107 |
| 671 | 3300025927 | Ga0207687_11636935 | Ga0207687_116369351 | 107 |
| 672 | 3300025928 | Ga0207700_10034840 | Ga0207700_100348404 | 107 |
| 673 | 3300025928 | Ga0207700_10396795 | Ga0207700_103967952 | 107 |
| 674 | 3300025929 | Ga0207664_11582101 | Ga0207664_115821011 | 107 |
| 675 | 3300025931 | Ga0207644_10046153 | Ga0207644_100461533 | 107 |
| 676 | 3300025931 | Ga0207644_10078164 | Ga0207644_100781643 | 107 |
| 677 | 3300025932 | Ga0207690_10335998 | Ga0207690_103359982 | 107 |
| 678 | 3300025935 | Ga0207709_11463259 | Ga0207709_114632592 | 107 |
| 679 | 3300025935 | Ga0207709_11826478 | Ga0207709_118264781 | 107 |
| 680 | 3300025936 | Ga0207670_10235963 | Ga0207670_102359632 | 107 |
| 681 | 3300025936 | Ga0207670_10611816 | Ga0207670_106118162 | 107 |
| 682 | 3300025937 | Ga0207669_10459258 | Ga0207669_104592582 | 107 |
| 683 | 3300025937 | Ga0207669_10543172 | Ga0207669_105431722 | 107 |
| 684 | 3300025937 | Ga0207669_10587066 | Ga0207669_105870661 | 107 |
| 685 | 3300025940 | Ga0207691_10014898 | Ga0207691_100148986 | 107 |
| 686 | 3300025940 | Ga0207691_10023330 | Ga0207691_100233302 | 107 |
| 687 | 3300025940 | Ga0207691_11743898 | Ga0207691_117438982 | 107 |
| 688 | 3300025941 | Ga0207711_10093642 | Ga0207711_100936422 | 107 |
| 689 | 3300025941 | Ga0207711_10141809 | Ga0207711_101418093 | 107 |
| 690 | 3300025941 | Ga0207711_11084227 | Ga0207711_110842271 | 107 |
| 691 | 3300025941 | Ga0207711_11128336 | Ga0207711_111283362 | 107 |
| 692 | 3300025942 | Ga0207689_10235497 | Ga0207689_102354971 | 107 |
| 693 | 3300025942 | Ga0207689_10715740 | Ga0207689_107157402 | 107 |
| 694 | 3300025942 | Ga0207689_11177520 | Ga0207689_111775201 | 107 |
| 695 | 3300025944 | Ga0207661_10084451 | Ga0207661_100844512 | 107 |
| 696 | 3300025944 | Ga0207661_10128475 | Ga0207661_101284751 | 107 |
| 697 | 3300025945 | Ga0207679_10104089 | Ga0207679_101040893 | 107 |
| 698 | 3300025949 | Ga0207667_11203161 | Ga0207667_112031612 | 107 |
| 699 | 3300025960 | Ga0207651_10312223 | Ga0207651_103122232 | 107 |
| 700 | 3300025961 | Ga0207712_10030506 | Ga0207712_100305062 | 107 |
| 701 | 3300025961 | Ga0207712_10700445 | Ga0207712_107004452 | 107 |
| 702 | 3300025972 | Ga0207668_11178481 | Ga0207668_111784811 | 107 |
| 703 | 3300025981 | Ga0207640_10137196 | Ga0207640_101371962 | 107 |
| 704 | 3300025981 | Ga0207640_10530009 | Ga0207640_105300091 | 107 |
| 705 | 3300025986 | Ga0207658_10078039 | Ga0207658_100780392 | 107 |
| 706 | 3300025986 | Ga0207658_10115621 | Ga0207658_101156212 | 107 |
| 707 | 3300026023 | Ga0207677_10004548 | Ga0207677_100045484 | 107 |
| 708 | 3300026023 | Ga0207677_10131867 | Ga0207677_101318673 | 107 |
| 709 | 3300026035 | Ga0207703_10020956 | Ga0207703_100209564 | 107 |
| 710 | 3300026035 | Ga0207703_10035581 | Ga0207703_100355812 | 107 |
| 711 | 3300026035 | Ga0207703_10426240 | Ga0207703_104262402 | 107 |
| 712 | 3300026035 | Ga0207703_11417275 | Ga0207703_114172751 | 107 |
| 713 | 3300026035 | Ga0207703_11858570 | Ga0207703_118585702 | 107 |
| 714 | 3300026041 | Ga0207639_11409460 | Ga0207639_114094602 | 107 |
| 715 | 3300026075 | Ga0207708_10378534 | Ga0207708_103785342 | 107 |
| 716 | 3300026075 | Ga0207708_10415785 | Ga0207708_104157852 | 107 |
| 717 | 3300026075 | Ga0207708_10879157 | Ga0207708_108791571 | 107 |
| 718 | 3300026075 | Ga0207708_11184688 | Ga0207708_111846881 | 107 |
| 719 | 3300026078 | Ga0207702_10000001 | Ga0207702_10000001736 | 107 |
| 720 | 3300026078 | Ga0207702_10182357 | Ga0207702_101823572 | 107 |
| 721 | 3300026078 | Ga0207702_10451802 | Ga0207702_104518022 | 107 |
| 722 | 3300026088 | Ga0207641_10002906 | Ga0207641_1000290611 | 107 |
| 723 | 3300026088 | Ga0207641_10021290 | Ga0207641_100212902 | 107 |
| 724 | 3300026088 | Ga0207641_10054759 | Ga0207641_100547592 | 107 |
| 725 | 3300026088 | Ga0207641_10075115 | Ga0207641_100751153 | 107 |
| 726 | 3300026088 | Ga0207641_10136726 | Ga0207641_101367262 | 107 |
| 727 | 3300026088 | Ga0207641_10278973 | Ga0207641_102789733 | 107 |
| 728 | 3300026089 | Ga0207648_10290617 | Ga0207648_102906172 | 107 |
| 729 | 3300026089 | Ga0207648_11407997 | Ga0207648_114079972 | 107 |
| 730 | 3300026089 | Ga0207648_11512079 | Ga0207648_115120792 | 107 |
| 731 | 3300026095 | Ga0207676_10008407 | Ga0207676_100084072 | 107 |
| 732 | 3300026095 | Ga0207676_10009375 | Ga0207676_100093755 | 107 |
| 733 | 3300026095 | Ga0207676_10068273 | Ga0207676_100682732 | 107 |
| 734 | 3300026116 | Ga0207674_10015346 | Ga0207674_100153462 | 107 |
| 735 | 3300026116 | Ga0207674_10287704 | Ga0207674_102877042 | 107 |
| 736 | 3300026116 | Ga0207674_11673198 | Ga0207674_116731982 | 107 |
| 737 | 3300026118 | Ga0207675_100544863 | Ga0207675_1005448632 | 107 |
| 738 | 3300026118 | Ga0207675_101385288 | Ga0207675_1013852882 | 107 |
| 739 | 3300026121 | Ga0207683_10574426 | Ga0207683_105744262 | 107 |
| 740 | 3300026121 | Ga0207683_10859600 | Ga0207683_108596001 | 107 |
| 741 | 3300026142 | Ga0207698_11178738 | Ga0207698_111787381 | 107 |
| 742 | 3300027907 | Ga0207428_10062289 | Ga0207428_100622893 | 107 |
| 743 | 3300027907 | Ga0207428_10559590 | Ga0207428_105595902 | 107 |
| 744 | 3300028379 | Ga0268266_10001574 | Ga0268266_1000157415 | 107 |
| 745 | 3300028380 | Ga0268265_10057738 | Ga0268265_100577385 | 107 |
| 746 | 3300028380 | Ga0268265_10694833 | Ga0268265_106948332 | 107 |
| 747 | 3300028381 | Ga0268264_10032907 | Ga0268264_100329073 | 107 |
| 748 | 3300028381 | Ga0268264_10205740 | Ga0268264_102057402 | 107 |
| 749 | 3300028381 | Ga0268264_10519397 | Ga0268264_105193972 | 107 |
| 750 | 3300028381 | Ga0268264_10973563 | Ga0268264_109735632 | 107 |
| 751 | 3300028381 | Ga0268264_11397858 | Ga0268264_113978581 | 107 |
| 752 | 3300028381 | Ga0268264_12393246 | Ga0268264_123932461 | 107 |
| 753 | 3300028556 | Ga0265337_1007184 | Ga0265337_10071844 | 107 |
| 754 | 3300028556 | Ga0265337_1102511 | Ga0265337_11025111 | 107 |
| 755 | 3300028556 | Ga0265337_1141953 | Ga0265337_11419532 | 107 |
| 756 | 3300028558 | Ga0265326_10057864 | Ga0265326_100578641 | 107 |
| 757 | 3300028563 | Ga0265319_1043415 | Ga0265319_10434152 | 107 |
| 758 | 3300028563 | Ga0265319_1092719 | Ga0265319_10927191 | 107 |
| 759 | 3300028563 | Ga0265319_1118415 | Ga0265319_11184152 | 107 |
| 760 | 3300028573 | Ga0265334_10005346 | Ga0265334_100053462 | 107 |
| 761 | 3300028577 | Ga0265318_10000005 | Ga0265318_1000000577 | 107 |
| 762 | 3300028577 | Ga0265318_10020875 | Ga0265318_100208751 | 107 |
| 763 | 3300028577 | Ga0265318_10350940 | Ga0265318_103509401 | 107 |
| 764 | 3300028577 | Ga0265318_10396425 | Ga0265318_103964251 | 107 |
| 765 | 3300028653 | Ga0265323_10000044 | Ga0265323_100000446 | 107 |
| 766 | 3300028653 | Ga0265323_10003744 | Ga0265323_100037444 | 107 |
| 767 | 3300028653 | Ga0265323_10011348 | Ga0265323_100113484 | 107 |
| 768 | 3300028654 | Ga0265322_10000802 | Ga0265322_100008024 | 107 |
| 769 | 3300028654 | Ga0265322_10008192 | Ga0265322_100081924 | 107 |
| 770 | 3300028666 | Ga0265336_10028611 | Ga0265336_100286113 | 107 |
| 771 | 3300028800 | Ga0265338_10001998 | Ga0265338_100019983 | 107 |
| 772 | 3300028800 | Ga0265338_10013448 | Ga0265338_100134485 | 107 |
| 773 | 3300028800 | Ga0265338_10115876 | Ga0265338_101158763 | 107 |
| 774 | 3300029957 | Ga0265324_10004265 | Ga0265324_100042655 | 107 |
| 775 | 3300029957 | Ga0265324_10009397 | Ga0265324_100093972 | 107 |
| 776 | 3300030760 | Ga0265762_1048152 | Ga0265762_10481522 | 107 |
| 777 | 3300031090 | Ga0265760_10045719 | Ga0265760_100457192 | 107 |
| 778 | 3300031235 | Ga0265330_10026862 | Ga0265330_100268623 | 107 |
| 779 | 3300031235 | Ga0265330_10044760 | Ga0265330_100447602 | 107 |
| 780 | 3300031235 | Ga0265330_10061446 | Ga0265330_100614462 | 107 |
| 781 | 3300031235 | Ga0265330_10076014 | Ga0265330_100760142 | 107 |
| 782 | 3300031238 | Ga0265332_10007763 | Ga0265332_100077635 | 107 |
| 783 | 3300031238 | Ga0265332_10051938 | Ga0265332_100519381 | 107 |
| 784 | 3300031239 | Ga0265328_10077856 | Ga0265328_100778562 | 107 |
| 785 | 3300031239 | Ga0265328_10362869 | Ga0265328_103628691 | 107 |
| 786 | 3300031240 | Ga0265320_10013450 | Ga0265320_100134504 | 107 |
| 787 | 3300031240 | Ga0265320_10020179 | Ga0265320_100201793 | 107 |
| 788 | 3300031240 | Ga0265320_10091355 | Ga0265320_100913552 | 107 |
| 789 | 3300031240 | Ga0265320_10384724 | Ga0265320_103847241 | 107 |
| 790 | 3300031241 | Ga0265325_10006322 | Ga0265325_100063225 | 107 |
| 791 | 3300031247 | Ga0265340_10028083 | Ga0265340_100280833 | 107 |
| 792 | 3300031247 | Ga0265340_10100510 | Ga0265340_101005102 | 107 |
| 793 | 3300031249 | Ga0265339_10014992 | Ga0265339_100149922 | 107 |
| 794 | 3300031249 | Ga0265339_10073218 | Ga0265339_100732181 | 107 |
| 795 | 3300031249 | Ga0265339_10148431 | Ga0265339_101484312 | 107 |
| 796 | 3300031249 | Ga0265339_10198264 | Ga0265339_101982641 | 107 |
| 797 | 3300031250 | Ga0265331_10018334 | Ga0265331_100183342 | 107 |
| 798 | 3300031250 | Ga0265331_10104462 | Ga0265331_101044622 | 107 |
| 799 | 3300031250 | Ga0265331_10113388 | Ga0265331_101133882 | 107 |
| 800 | 3300031250 | Ga0265331_10142309 | Ga0265331_101423092 | 107 |
| 801 | 3300031250 | Ga0265331_10208871 | Ga0265331_102088712 | 107 |
| 802 | 3300031251 | Ga0265327_10001705 | Ga0265327_1000170520 | 107 |
| 803 | 3300031251 | Ga0265327_10013021 | Ga0265327_100130212 | 107 |
| 804 | 3300031251 | Ga0265327_10101160 | Ga0265327_101011602 | 107 |
| 805 | 3300031344 | Ga0265316_10002356 | Ga0265316_1000235612 | 107 |
| 806 | 3300031344 | Ga0265316_10005906 | Ga0265316_100059067 | 107 |
| 807 | 3300031344 | Ga0265316_10038370 | Ga0265316_100383703 | 107 |
| 808 | 3300031344 | Ga0265316_10046666 | Ga0265316_100466663 | 107 |
| 809 | 3300031344 | Ga0265316_10099467 | Ga0265316_100994672 | 107 |
| 810 | 3300031344 | Ga0265316_10153481 | Ga0265316_101534812 | 107 |
| 811 | 3300031344 | Ga0265316_10476006 | Ga0265316_104760062 | 107 |
| 812 | 3300031456 | Ga0307513_10012270 | Ga0307513_1001227012 | 107 |
| 813 | 3300031507 | Ga0307509_10622429 | Ga0307509_106224292 | 107 |
| 814 | 3300031595 | Ga0265313_10002981 | Ga0265313_1000298111 | 107 |
| 815 | 3300031595 | Ga0265313_10003767 | Ga0265313_100037679 | 107 |
| 816 | 3300031595 | Ga0265313_10006788 | Ga0265313_100067882 | 107 |
| 817 | 3300031595 | Ga0265313_10017903 | Ga0265313_100179033 | 107 |
| 818 | 3300031616 | Ga0307508_10000200 | Ga0307508_100002008 | 107 |
| 819 | 3300031711 | Ga0265314_10001653 | Ga0265314_1000165310 | 107 |
| 820 | 3300031711 | Ga0265314_10016863 | Ga0265314_100168635 | 107 |
| 821 | 3300031711 | Ga0265314_10099912 | Ga0265314_100999123 | 107 |
| 822 | 3300031711 | Ga0265314_10160057 | Ga0265314_101600572 | 107 |
| 823 | 3300031712 | Ga0265342_10002344 | Ga0265342_1000234411 | 107 |
| 824 | 3300031712 | Ga0265342_10010937 | Ga0265342_100109371 | 107 |
| 825 | 3300031712 | Ga0265342_10015932 | Ga0265342_100159324 | 107 |
| 826 | 3300031712 | Ga0265342_10041726 | Ga0265342_100417263 | 107 |
| 827 | 3300031712 | Ga0265342_10042248 | Ga0265342_100422481 | 107 |
| 828 | 3300031712 | Ga0265342_10108733 | Ga0265342_101087332 | 107 |
| 829 | 3300031712 | Ga0265342_10586951 | Ga0265342_105869512 | 107 |
| 830 | 3300031730 | Ga0307516_10463298 | Ga0307516_104632982 | 107 |
| 831 | 3300032005 | Ga0307411_11298030 | Ga0307411_112980302 | 107 |
| 832 | 3300034820 | Ga0373959_0000052 | Ga0373959_0000052_194_523 | 107 |
| 833 | 3300035086 | Ga0373934_0250637 | Ga0373934_0250637_183_506 | 107 |
| 834 | 3300035091 | Ga0373951_0001334 | Ga0373951_0001334_5012_5335 | 107 |
| 835 | 3300035111 | Ga0373923_0210713 | Ga0373923_0210713_150_473 | 107 |
| 836 | 3300035112 | Ga0373932_0147183 | Ga0373932_0147183_377_703 | 107 |
| 837 | 3300035112 | Ga0373932_0269193 | Ga0373932_0269193_51_374 | 107 |
| 838 | 3300035114 | Ga0373939_0020582 | Ga0373939_0020582_1444_1767 | 107 |
| 839 | 3300035118 | Ga0373954_0319629 | Ga0373954_0319629_241_567 | 107 |
| 840 | 3300035120 | Ga0373957_0282621 | Ga0373957_0282621_234_557 | 107 |
| 841 | 3300035172 | Ga0373955_0213835 | Ga0373955_0213835_333_662 | 107 |
| 842 | 3300035242 | Ga0373962_0090418 | Ga0373962_0090418_608_931 | 107 |
| 843 | 3300035691 | Ga0373931_0623617 | Ga0373931_0623617_356_685 | 107 |
| 844 | 3300035691 | Ga0373931_0658250 | Ga0373931_0658250_265_588 | 107 |
| 845 | 3300035724 | Ga0373933_0647059 | Ga0373933_0647059_310_633 | 107 |
| 846 | 3300036401 | Ga0373937_0014543 | Ga0373937_0014543_6568_6891 | 107 |
| 847 | 3300036401 | Ga0373937_0047248 | Ga0373937_0047248_951_1280 | 107 |
| 848 | 3300036401 | Ga0373937_0103496 | Ga0373937_0103496_2178_2504 | 107 |
| 849 | 3300036401 | Ga0373937_0439158 | Ga0373937_0439158_226_549 | 107 |
| 850 | 3300036401 | Ga0373937_0551763 | Ga0373937_0551763_429_755 | 107 |
| 851 | 3300036401 | Ga0373937_0854538 | Ga0373937_0854538_442_771 | 107 |
| 852 | 3300036401 | Ga0373937_1388153 | Ga0373937_1388153_204_527 | 107 |
| 853 | 3300036647 | Ga0316582_0407470 | Ga0316582_0407470_74_397 | 107 |
| 854 | 3300037068 | Ga0373925_0893285 | Ga0373925_0893285_157_504 | 107 |
| 855 | 3300039437 | Ga0436365_0786779 | Ga0436365_0786779_28_351 | 107 |
| 856 | 3300041456 | Ga0451795_1691563 | Ga0451795_1691563_71_394 | 107 |
| 857 | 3300041512 | Ga0451853_1514882 | Ga0451853_1514882_144_470 | 107 |
| 858 | 3300042015 | Ga0439462_0112593 | Ga0439462_0112593_337_660 | 107 |
| 859 | 3300042156 | Ga0439446_0262658 | Ga0439446_0262658_40_378 | 107 |
| 860 | 3300042876 | Ga0451577_0167901 | Ga0451577_0167901_1361_1693 | 107 |
| 861 | 3300042876 | Ga0451577_0904583 | Ga0451577_0904583_416_739 | 107 |
| 862 | 3300044673 | Ga0453683_0002405 | Ga0453683_0002405_12920_13252 | 107 |
| 863 | 3300044673 | Ga0453683_0257203 | Ga0453683_0257203_372_704 | 107 |
| 864 | 3300044684 | Ga0466966_0244296 | Ga0466966_0244296_588_914 | 107 |
| 865 | 3300044684 | Ga0466966_0388372 | Ga0466966_0388372_62_391 | 107 |
| 866 | 3300044712 | Ga0453684_0358547 | Ga0453684_0358547_643_975 | 107 |
| 867 | 3300044712 | Ga0453684_0480004 | Ga0453684_0480004_610_936 | 107 |
| 868 | 3300044712 | Ga0453684_1078628 | Ga0453684_1078628_459_794 | 107 |
| 869 | 3300044712 | Ga0453684_1401854 | Ga0453684_1401854_53_376 | 107 |
| 870 | 3300044719 | Ga0466971_0142089 | Ga0466971_0142089_59_385 | 107 |
| 871 | 3300045049 | Ga0466959_0121887 | Ga0466959_0121887_463_789 | 107 |
| 872 | 3300045051 | Ga0451576_0019268 | Ga0451576_0019268_874_1206 | 107 |
| 873 | 3300045836 | Ga0466958_0257203 | Ga0466958_0257203_601_927 | 107 |
| 874 | 3300045976 | Ga0466967_0003400 | Ga0466967_0003400_9974_10300 | 107 |
| 875 | 3300046454 | Ga0495592_0002149 | Ga0495592_0002149_13181_13504 | 107 |
| 876 | 3300046455 | Ga0495603_0231549 | Ga0495603_0231549_151_474 | 107 |
| 877 | 3300046458 | Ga0495591_080624 | Ga0495591_080624_386_709 | 107 |
| 878 | 3300046459 | Ga0495629_0207057 | Ga0495629_0207057_14_337 | 107 |
| 879 | 3300046499 | Ga0495594_0218157 | Ga0495594_0218157_148_477 | 107 |
| 880 | 3300046514 | Ga0495618_0042704 | Ga0495618_0042704_773_1096 | 107 |
| 881 | 3300046516 | Ga0495628_0502538 | Ga0495628_0502538_100_423 | 107 |
| 882 | 3300046517 | Ga0495630_0387973 | Ga0495630_0387973_77_400 | 107 |
| 883 | 3300046529 | Ga0495652_0608065 | Ga0495652_0608065_73_396 | 107 |
| 884 | 3300046535 | Ga0495586_0085694 | Ga0495586_0085694_613_936 | 107 |
| 885 | 3300046543 | Ga0495645_0536783 | Ga0495645_0536783_95_418 | 107 |
| 886 | 3300046559 | Ga0495667_0000510 | Ga0495667_0000510_17889_18212 | 107 |
| 887 | 3300046642 | Ga0495634_0023902 | Ga0495634_0023902_3893_4219 | 107 |
| 888 | 3300046642 | Ga0495634_0099635 | Ga0495634_0099635_558_881 | 107 |
| 889 | 3300046664 | Ga0495659_0125488 | Ga0495659_0125488_508_831 | 107 |
| 890 | 3300046674 | Ga0495588_0417018 | Ga0495588_0417018_245_568 | 107 |
| 891 | 3300046675 | Ga0495657_0014486 | Ga0495657_0014486_5383_5706 | 107 |
| 892 | 3300046678 | Ga0495599_0194811 | Ga0495599_0194811_145_468 | 107 |
| 893 | 3300046683 | Ga0495658_0078285 | Ga0495658_0078285_986_1309 | 107 |
| 894 | 3300046684 | Ga0495669_0206396 | Ga0495669_0206396_537_860 | 107 |
| 895 | 3300046689 | Ga0495613_0042502 | Ga0495613_0042502_2999_3322 | 107 |
| 896 | 3300046689 | Ga0495613_0562630 | Ga0495613_0562630_210_536 | 107 |
| 897 | 3300046690 | Ga0495624_0565150 | Ga0495624_0565150_104_427 | 107 |
| 898 | 3300047471 | Ga0495684_0029353 | Ga0495684_0029353_1343_1666 | 107 |
| 899 | 3300047471 | Ga0495684_0329830 | Ga0495684_0329830_753_1076 | 107 |
| 900 | 3300048905 | Ga0496102_1531441 | Ga0496102_1531441_123_446 | 107 |
| 901 | 3300048907 | Ga0496104_0019982 | Ga0496104_0019982_278_601 | 107 |
| 902 | 3300048908 | Ga0496105_0449913 | Ga0496105_0449913_449_778 | 107 |
| 903 | 3300048909 | Ga0496106_0397942 | Ga0496106_0397942_44_367 | 107 |
| 904 | 3300048910 | Ga0496107_0177259 | Ga0496107_0177259_1134_1463 | 107 |
| 905 | 3300048911 | Ga0496108_0009731 | Ga0496108_0009731_4668_4991 | 107 |
| 906 | 3300048913 | Ga0496110_0862741 | Ga0496110_0862741_367_690 | 107 |
| 907 | 3300048914 | Ga0496111_0188644 | Ga0496111_0188644_605_934 | 107 |
| 908 | 3300048915 | Ga0496112_0386727 | Ga0496112_0386727_541_870 | 107 |
| 909 | 3300048916 | Ga0496113_0060084 | Ga0496113_0060084_1785_2108 | 107 |
| 910 | 3300048917 | Ga0496114_0563099 | Ga0496114_0563099_193_516 | 107 |
| 911 | 3300048917 | Ga0496114_0945587 | Ga0496114_0945587_33_362 | 107 |
| 912 | 3300048924 | Ga0496121_0684847 | Ga0496121_0684847_157_480 | 107 |
| 913 | 3300048928 | Ga0496125_0558528 | Ga0496125_0558528_232_561 | 107 |
| 914 | 3300048929 | Ga0496126_0024934 | Ga0496126_0024934_104_433 | 107 |
| 915 | 3300049568 | Ga0501031_0689609 | Ga0501031_0689609_232_561 | 107 |
| 916 | 3300049569 | Ga0501032_0000381 | Ga0501032_0000381_33131_33466 | 107 |
| 917 | 3300049569 | Ga0501032_0004210 | Ga0501032_0004210_7905_8231 | 107 |
| 918 | 3300049570 | Ga0501033_0003173 | Ga0501033_0003173_906_1241 | 107 |
| 919 | 3300049571 | Ga0501034_0025655 | Ga0501034_0025655_3138_3473 | 107 |
| 920 | 3300049572 | Ga0501036_0002696 | Ga0501036_0002696_1281_1616 | 107 |
| 921 | 3300049572 | Ga0501036_0057652 | Ga0501036_0057652_2373_2699 | 107 |
| 922 | 3300049573 | Ga0501037_0035928 | Ga0501037_0035928_2758_3093 | 107 |
| 923 | 3300049573 | Ga0501037_0686046 | Ga0501037_0686046_36_365 | 107 |
| 924 | 3300049574 | Ga0501038_0006345 | Ga0501038_0006345_81_416 | 107 |
| 925 | 3300049575 | Ga0501039_0018596 | Ga0501039_0018596_835_1170 | 107 |
| 926 | 3300049579 | Ga0501043_0005787 | Ga0501043_0005787_81_416 | 107 |
| 927 | 3300049580 | Ga0501046_0006931 | Ga0501046_0006931_5078_5404 | 107 |
| 928 | 3300049580 | Ga0501046_0007380 | Ga0501046_0007380_5072_5398 | 107 |
| 929 | 3300049580 | Ga0501046_0310789 | Ga0501046_0310789_456_791 | 107 |
| 930 | 3300049581 | Ga0501047_0000443 | Ga0501047_0000443_2445_2768 | 107 |
| 931 | 3300049581 | Ga0501047_0010472 | Ga0501047_0010472_5792_6118 | 107 |
| 932 | 3300049581 | Ga0501047_0026010 | Ga0501047_0026010_2622_2957 | 107 |
| 933 | 3300049581 | Ga0501047_0081073 | Ga0501047_0081073_725_1051 | 107 |
| 934 | 3300049581 | Ga0501047_0581328 | Ga0501047_0581328_513_836 | 107 |
| 935 | 3300049581 | Ga0501047_1194752 | Ga0501047_1194752_229_552 | 107 |
| 936 | 3300049581 | Ga0501047_1416202 | Ga0501047_1416202_10_339 | 107 |
| 937 | 3300049582 | Ga0501048_0026634 | Ga0501048_0026634_529_864 | 107 |
| 938 | 3300049582 | Ga0501048_0442617 | Ga0501048_0442617_576_902 | 107 |
| 939 | 3300049584 | Ga0501068_0228635 | Ga0501068_0228635_48_383 | 107 |
| 940 | 3300049586 | Ga0501070_0040045 | Ga0501070_0040045_1127_1462 | 107 |
| 941 | 3300049742 | Ga0501080_0200486 | Ga0501080_0200486_1201_1524 | 107 |
| 942 | 3300049744 | Ga0501083_0116569 | Ga0501083_0116569_198_521 | 107 |
| 943 | 3300049822 | Ga0501035_0002291 | Ga0501035_0002291_5503_5838 | 107 |
| 944 | 3300049822 | Ga0501035_0005985 | Ga0501035_0005985_8472_8798 | 107 |
| 945 | 3300049823 | Ga0501044_0000245 | Ga0501044_0000245_21852_22178 | 107 |
| 946 | 3300049823 | Ga0501044_0013568 | Ga0501044_0013568_4060_4395 | 107 |
| 947 | 3300049824 | Ga0501045_0877046 | Ga0501045_0877046_233_568 | 107 |
| 948 | 3300050492 | nmdc:mga0yw44_14103_c1 | nmdc:mga0yw44_14103_c1_523_852 | 107 |
| 949 | 3300050507 | nmdc:mga05p37_199829_c1 | nmdc:mga05p37_199829_c1_733_1056 | 107 |
| 950 | 3300050507 | nmdc:mga05p37_4622_c1 | nmdc:mga05p37_4622_c1_9931_10254 | 107 |
| 951 | 3300050507 | nmdc:mga05p37_5627_c1 | nmdc:mga05p37_5627_c1_262_585 | 107 |
| 952 | 3300050511 | nmdc:mga08y16_18505_c1 | nmdc:mga08y16_18505_c1_2565_2888 | 107 |
| 953 | 3300050511 | nmdc:mga08y16_841979_c1 | nmdc:mga08y16_841979_c1_450_773 | 107 |
| 954 | 3300050512 | nmdc:mga0n895_2250903_c1 | nmdc:mga0n895_2250903_c1_128_451 | 107 |
| 955 | 3300050512 | nmdc:mga0n895_6510_c1 | nmdc:mga0n895_6510_c1_7731_8054 | 107 |
| 956 | 3300050515 | nmdc:mga0a205_14478_c1 | nmdc:mga0a205_14478_c1_4434_4757 | 107 |
| 957 | 3300050515 | nmdc:mga0a205_16127_c1 | nmdc:mga0a205_16127_c1_5533_5856 | 107 |
| 958 | 3300053077 | Ga0495601_0356567 | Ga0495601_0356567_524_847 | 107 |
| 959 | 3300053119 | Ga0500595_044920 | Ga0500595_044920_503_832 | 107 |
| 960 | 3300053136 | Ga0500559_0482121 | Ga0500559_0482121_232_561 | 107 |
| 961 | 3300053139 | Ga0500568_0025482 | Ga0500568_0025482_568_894 | 107 |
| 962 | 3300053156 | Ga0500622_0279326 | Ga0500622_0279326_221_547 | 107 |
| 963 | 3300053163 | Ga0500639_363859 | Ga0500639_363859_34_363 | 107 |
| 964 | 3300053178 | Ga0500637_0116320 | Ga0500637_0116320_932_1261 | 107 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6abt-assembly1.cif.gz_A | crystal structure of transcription factor from listeria monocytogenes | 0.9444 | 12 | 105 |
| 4ejo-assembly1.cif.gz_A-2 | crystal structure of padr family transcriptional regulator from eggerthella lenta dsm 2243 | 0.9285 | 3 | 105 |
| 6abq-assembly1.cif.gz_B | crystal structure of transcription factor from listeria monocytogenes | 0.9112 | 7 | 105 |
| 3hhh-assembly1.cif.gz_A | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.9075 | 9 | 105 |
| 5x11-assembly1.cif.gz_B | crystal structure of bacillus subtilis padr in complex with operator dna | 0.9054 | 14 | 91 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57807_1_92_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9403 | 16 | 96 | 1.10.10.10 |
| af_O50432_1_88_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9343 | 15 | 93 | 1.10.10.10 |
| 4ejoA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9274 | 5 | 105 | 1.10.10.10 |
| 3hhhA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9104 | 9 | 104 | 1.10.10.10 |
| af_Q2FUS4_1_110_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9071 | 9 | 106 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7T9QK77-F1-model_v4 | deleted | 0.9818 | 5 | 107 |
|
| AF-A0A3L7WC70-F1-model_v4 | PadR family transcriptional regulator | 0.9786 | 7 | 106 |
|
| AF-A0A5C9E194-F1-model_v4 | Transcription regulator PadR N-terminal domain-containing protein | 0.9776 | 8 | 107 |
|
| AF-A0A1V5WUT6-F1-model_v4 | Lineage-specific thermal regulator protein | 0.9699 | 5 | 107 |
|
| AF-A0A2N2YRN4-F1-model_v4 | PadR family transcriptional regulator | 0.9694 | 5 | 105 |
GO:0005737
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar