F486856

General Info

Members Datasets Scaffolds Average Seq Length
961 313 961 63

Family's Representative Sequence

Representative Sequence 3300005365|Ga0070688_101543178|Ga0070688_1015431781
Length 65
Sequence MAQRCDVCGKGPSVGHKISHAHNVTKRRWLANLVSLRGKIGAAGVVQRLRVCTRCLKAGKVTKVV

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
88 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
91 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
107 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
139 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
202 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
203 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
204 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
205 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
206 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
207 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
208 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
209 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
210 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
212 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
213 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
214 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
215 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
216 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
217 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
218 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
219 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
220 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
221 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
222 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
223 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
224 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
225 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
226 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
227 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
228 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
229 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
230 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
231 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
232 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
233 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
234 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
237 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
238 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
241 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
242 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
243 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
244 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
247 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
248 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
249 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
250 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
251 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
252 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
253 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
254 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
255 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
256 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
257 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
258 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
259 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
260 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
261 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
262 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
263 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
264 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
265 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
287 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
288 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
289 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
290 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
291 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
292 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
293 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
294 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
295 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
296 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
297 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
298 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
302 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
303 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
304 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
305 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
306 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
307 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
308 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
309 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
310 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
311 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
312 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
313 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.66
Rhizosphere 98.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1001299 3300000546 Bacteria 3690
2 JGI24747J21853_1005708 3300001978 Bacteria 1157
3 JGI24737J22298_10107498 3300001990 Unclassified 826
4 JGI24743J22301_10007173 3300001991 Bacteria 1924
5 JGI24751J29686_10001058 3300002459 Bacteria 5974
6 Ga0058863_10163623 3300004799 Bacteria 725
7 Ga0058861_10095151 3300004800 Bacteria 860
8 Ga0058861_10169578 3300004800 Unclassified 722
9 Ga0058861_10171377 3300004800 Bacteria 1260
10 Ga0058862_10211581 3300004803 Bacteria 1177
11 Ga0065712_10047790 3300005290 Bacteria 714
12 Ga0065712_10312758 3300005290 Bacteria 841
13 Ga0065715_10310948 3300005293 Bacteria 1021
14 Ga0065707_10208242 3300005295 Bacteria 1278
15 Ga0065707_10360330 3300005295 Bacteria 905
16 Ga0065707_10993216 3300005295 Bacteria 541
17 Ga0070658_10139618 3300005327 Bacteria 2023
18 Ga0070658_10925189 3300005327 Bacteria 758
19 Ga0070676_10006901 3300005328 Bacteria 6078
20 Ga0070676_10104744 3300005328 Bacteria 1753
21 Ga0070676_10125676 3300005328 Bacteria 1615
22 Ga0070676_10266258 3300005328 Bacteria 1149
23 Ga0070683_100012082 3300005329 Bacteria 7492
24 Ga0070683_100021104 3300005329 Bacteria 5809
25 Ga0070683_100045056 3300005329 Bacteria 4071
26 Ga0070683_100074278 3300005329 Bacteria 3175
27 Ga0070683_100562402 3300005329 Unclassified 1091
28 Ga0070683_100903325 3300005329 Unclassified 847
29 Ga0070690_100028368 3300005330 Bacteria 3466
30 Ga0070690_100255065 3300005330 Bacteria 1242
31 Ga0070690_100842191 3300005330 Bacteria 714
32 Ga0070670_100017818 3300005331 Bacteria 6094
33 Ga0070670_100026236 3300005331 Bacteria 5016
34 Ga0070670_100092204 3300005331 Bacteria 2605
35 Ga0070670_100130819 3300005331 Bacteria 2167
36 Ga0070677_10011875 3300005333 Bacteria 3014
37 Ga0070677_10155180 3300005333 Unclassified 1069
38 Ga0070677_10356520 3300005333 Bacteria 759
39 Ga0068869_100002767 3300005334 Bacteria 10622
40 Ga0068869_100004989 3300005334 Bacteria 8308
41 Ga0068869_100029661 3300005334 Bacteria 3835
42 Ga0068869_100187938 3300005334 Bacteria 1623
43 Ga0070680_100011932 3300005336 Bacteria 6740
44 Ga0070680_100209933 3300005336 Bacteria 1643
45 Ga0070680_100212672 3300005336 Bacteria 1631
46 Ga0070680_100258169 3300005336 Unclassified 1474
47 Ga0070680_100481586 3300005336 Bacteria 1061
48 Ga0070680_100844665 3300005336 Unclassified 789
49 Ga0070680_101743522 3300005336 Bacteria 540
50 Ga0070682_100001205 3300005337 Bacteria 14746
51 Ga0070682_100079880 3300005337 Bacteria 2113
52 Ga0070682_100130021 3300005337 Bacteria 1703
53 Ga0070682_100236723 3300005337 Unclassified 1309
54 Ga0070682_101946233 3300005337 Unclassified 516
55 Ga0068868_100009424 3300005338 Bacteria 7025
56 Ga0068868_100020041 3300005338 Bacteria 5018
57 Ga0068868_100026898 3300005338 Bacteria 4386
58 Ga0068868_100116967 3300005338 Bacteria 2171
59 Ga0068868_100134719 3300005338 Bacteria 2024
60 Ga0068868_100749167 3300005338 Bacteria 877
61 Ga0070660_100000332 3300005339 Bacteria 31219
62 Ga0070660_100339242 3300005339 Bacteria 1236
63 Ga0070660_101080180 3300005339 Bacteria 679
64 Ga0070689_100031084 3300005340 Bacteria 4057
65 Ga0070689_100045532 3300005340 Bacteria 3379
66 Ga0070689_100055190 3300005340 Bacteria 3078
67 Ga0070689_100065539 3300005340 Unclassified 2829
68 Ga0070689_100174407 3300005340 Bacteria 1743
69 Ga0070691_10007841 3300005341 Bacteria 4884
70 Ga0070687_100058180 3300005343 Bacteria 2030
71 Ga0070687_100070845 3300005343 Bacteria 1871
72 Ga0070687_100112656 3300005343 Bacteria 1542
73 Ga0070661_100008004 3300005344 Bacteria 7301
74 Ga0070661_100010213 3300005344 Bacteria 6522
75 Ga0070661_100366338 3300005344 Unclassified 1133
76 Ga0070661_100563713 3300005344 Bacteria 918
77 Ga0070692_10039660 3300005345 Bacteria 2405
78 Ga0070692_10146528 3300005345 Bacteria 1341
79 Ga0070692_10408458 3300005345 Bacteria 859
80 Ga0070668_100024248 3300005347 Bacteria 4594
81 Ga0070668_102154891 3300005347 Unclassified 515
82 Ga0070669_100093849 3300005353 Bacteria 2254
83 Ga0070669_100096286 3300005353 Bacteria 2227
84 Ga0070669_100256695 3300005353 Bacteria 1393
85 Ga0070669_100412395 3300005353 Unclassified 1107
86 Ga0070669_100444189 3300005353 Unclassified 1068
87 Ga0070669_100616655 3300005353 Bacteria 910
88 Ga0070675_100008040 3300005354 Bacteria 8177
89 Ga0070675_100092835 3300005354 Bacteria 2531
90 Ga0070671_100288645 3300005355 Bacteria 1396
91 Ga0070671_100369219 3300005355 Bacteria 1225
92 Ga0070674_100195372 3300005356 Bacteria 1559
93 Ga0070673_100013321 3300005364 Bacteria 5683
94 Ga0070673_100190955 3300005364 Bacteria 1759
95 Ga0070673_100305270 3300005364 Bacteria 1402
96 Ga0070673_100808425 3300005364 Unclassified 866
97 Ga0070688_100101502 3300005365 Unclassified 1898
98 Ga0070688_100428583 3300005365 Bacteria 984
99 Ga0070688_100525199 3300005365 Unclassified 896
100 Ga0070688_101026319 3300005365 Bacteria 656
101 Ga0070688_101543178 3300005365 Bacteria 541
102 Ga0070688_101701286 3300005365 Bacteria 516
103 Ga0070659_100007889 3300005366 Bacteria 7751
104 Ga0070659_100054477 3300005366 Unclassified 3150
105 Ga0070667_100075152 3300005367 Bacteria 2884
106 Ga0070667_100163470 3300005367 Bacteria 1962
107 Ga0070667_100248515 3300005367 Unclassified 1590
108 Ga0070667_100860083 3300005367 Unclassified 843
109 Ga0070667_101454837 3300005367 Bacteria 643
110 Ga0070667_102063811 3300005367 Unclassified 537
111 Ga0070703_10065721 3300005406 Bacteria 1198
112 Ga0070703_10111366 3300005406 Unclassified 980
113 Ga0070703_10178194 3300005406 Bacteria 819
114 Ga0070709_10119517 3300005434 Unclassified 1784
115 Ga0070709_10204332 3300005434 Bacteria 1401
116 Ga0070709_10582266 3300005434 Bacteria 860
117 Ga0070709_10827973 3300005434 Bacteria 728
118 Ga0070714_101819508 3300005435 Bacteria 595
119 Ga0070713_100293088 3300005436 Bacteria 1496
120 Ga0070713_100391922 3300005436 Bacteria 1296
121 Ga0070713_100603944 3300005436 Bacteria 1042
122 Ga0070713_100854147 3300005436 Unclassified 874
123 Ga0070713_101550899 3300005436 Unclassified 643
124 Ga0070710_10061249 3300005437 Bacteria 2143
125 Ga0070710_10199474 3300005437 Bacteria 1263
126 Ga0070710_10336814 3300005437 Bacteria 995
127 Ga0070710_11076953 3300005437 Unclassified 589
128 Ga0070701_10041473 3300005438 Bacteria 2346
129 Ga0070701_10095361 3300005438 Bacteria 1638
130 Ga0070701_10309427 3300005438 Bacteria 974
131 Ga0070711_100009216 3300005439 Bacteria 6068
132 Ga0070711_100041508 3300005439 Bacteria 3108
133 Ga0070711_101791610 3300005439 Unclassified 539
134 Ga0070705_100010715 3300005440 Bacteria 4599
135 Ga0070705_100018219 3300005440 Bacteria 3677
136 Ga0070705_100049436 3300005440 Bacteria 2441
137 Ga0070705_100051447 3300005440 Unclassified 2402
138 Ga0070705_100054300 3300005440 Bacteria 2349
139 Ga0070705_100524476 3300005440 Bacteria 903
140 Ga0070705_100631361 3300005440 Bacteria 833
141 Ga0070700_100834854 3300005441 Bacteria 745
142 Ga0070700_101284512 3300005441 Unclassified 614
143 Ga0070694_100000758 3300005444 Bacteria 18068
144 Ga0070694_100004529 3300005444 Bacteria 8358
145 Ga0070694_100012156 3300005444 Bacteria 5348
146 Ga0070694_100133588 3300005444 Bacteria 1795
147 Ga0070694_100405344 3300005444 Bacteria 1068
148 Ga0070694_100621181 3300005444 Bacteria 872
149 Ga0070694_100779407 3300005444 Bacteria 783
150 Ga0070694_100785232 3300005444 Bacteria 780
151 Ga0070708_100030979 3300005445 Bacteria 4627
152 Ga0070708_100037363 3300005445 Bacteria 4236
153 Ga0070708_100160636 3300005445 Bacteria 2094
154 Ga0070708_100236987 3300005445 Bacteria 1713
155 Ga0070708_100325665 3300005445 Unclassified 1447
156 Ga0070708_100394414 3300005445 Bacteria 1305
157 Ga0070708_100527572 3300005445 Bacteria 1114
158 Ga0070708_100883351 3300005445 Bacteria 839
159 Ga0070708_101754478 3300005445 Unclassified 577
160 Ga0070708_102075156 3300005445 Unclassified 526
161 Ga0070663_100013971 3300005455 Bacteria 5140
162 Ga0070663_100076133 3300005455 Bacteria 2453
163 Ga0070678_100045303 3300005456 Bacteria 3146
164 Ga0070678_100762820 3300005456 Bacteria 876
165 Ga0070662_100006301 3300005457 Bacteria 7644
166 Ga0070662_100072724 3300005457 Unclassified 2539
167 Ga0070662_100078017 3300005457 Bacteria 2459
168 Ga0070662_100344527 3300005457 Unclassified 1220
169 Ga0070662_101788583 3300005457 Bacteria 531
170 Ga0070681_10000049 3300005458 Bacteria 82355
171 Ga0070681_10031207 3300005458 Bacteria 5348
172 Ga0070681_10093480 3300005458 Bacteria 2956
173 Ga0070681_10300789 3300005458 Unclassified 1514
174 Ga0070681_10306625 3300005458 Bacteria 1497
175 Ga0070681_10345291 3300005458 Bacteria 1399
176 Ga0070681_10384050 3300005458 Bacteria 1315
177 Ga0070681_10557517 3300005458 Bacteria 1060
178 Ga0070681_10753527 3300005458 Bacteria 890
179 Ga0070681_11219084 3300005458 Unclassified 674
180 Ga0068867_100006250 3300005459 Bacteria 8426
181 Ga0068867_100045512 3300005459 Bacteria 3219
182 Ga0068867_100067037 3300005459 Bacteria 2674
183 Ga0068867_100092127 3300005459 Bacteria 2301
184 Ga0068867_100138524 3300005459 Bacteria 1900
185 Ga0070685_10037976 3300005466 Bacteria 2729
186 Ga0070685_10546377 3300005466 Bacteria 826
187 Ga0070706_100052747 3300005467 Bacteria 3753
188 Ga0070706_100064589 3300005467 Bacteria 3383
189 Ga0070706_100134914 3300005467 Bacteria 2304
190 Ga0070706_100303431 3300005467 Unclassified 1489
191 Ga0070706_100489498 3300005467 Bacteria 1144
192 Ga0070706_100773818 3300005467 Bacteria 889
193 Ga0070706_100891251 3300005467 Bacteria 822
194 Ga0070706_101448583 3300005467 Bacteria 628
195 Ga0070707_100020638 3300005468 Bacteria 6217
196 Ga0070707_100041460 3300005468 Bacteria 4406
197 Ga0070707_100046260 3300005468 Bacteria 4164
198 Ga0070707_100142023 3300005468 Unclassified 2337
199 Ga0070707_100147765 3300005468 Bacteria 2287
200 Ga0070707_100156849 3300005468 Bacteria 2217
201 Ga0070707_100228679 3300005468 Unclassified 1811
202 Ga0070707_100273772 3300005468 Bacteria 1641
203 Ga0070707_100351472 3300005468 Bacteria 1432
204 Ga0070707_100534165 3300005468 Unclassified 1135
205 Ga0070707_100773465 3300005468 Bacteria 924
206 Ga0070707_102217388 3300005468 Unclassified 517
207 Ga0070698_100073943 3300005471 Bacteria 3414
208 Ga0070698_100081517 3300005471 Bacteria 3229
209 Ga0070698_100156046 3300005471 Bacteria 2228
210 Ga0070698_100180111 3300005471 Bacteria 2052
211 Ga0070698_100488118 3300005471 Bacteria 1169
212 Ga0070699_100015236 3300005518 Bacteria 6606
213 Ga0070699_100024343 3300005518 Bacteria 5217
214 Ga0070699_100031808 3300005518 Bacteria 4556
215 Ga0070699_100087879 3300005518 Bacteria 2714
216 Ga0070699_100180595 3300005518 Bacteria 1872
217 Ga0070699_100280425 3300005518 Bacteria 1493
218 Ga0070699_100414717 3300005518 Bacteria 1218
219 Ga0070699_100484254 3300005518 Unclassified 1123
220 Ga0070699_100543444 3300005518 Unclassified 1057
221 Ga0070699_100901548 3300005518 Unclassified 810
222 Ga0070699_100932255 3300005518 Bacteria 796
223 Ga0070679_100010981 3300005530 Bacteria 8607
224 Ga0070679_100016005 3300005530 Bacteria 7223
225 Ga0070679_100032821 3300005530 Bacteria 5139
226 Ga0070679_100121256 3300005530 Bacteria 2599
227 Ga0070679_100317595 3300005530 Bacteria 1507
228 Ga0070679_100545269 3300005530 Bacteria 1103
229 Ga0070679_100823282 3300005530 Unclassified 871
230 Ga0070679_100898779 3300005530 Bacteria 829
231 Ga0070679_101225210 3300005530 Bacteria 696
232 Ga0070684_100003237 3300005535 Bacteria 12180
233 Ga0070684_100017079 3300005535 Bacteria 5948
234 Ga0070684_100019566 3300005535 Bacteria 5603
235 Ga0070684_100038467 3300005535 Bacteria 4110
236 Ga0070697_100002024 3300005536 Bacteria 15517
237 Ga0070697_100008817 3300005536 Bacteria 7872
238 Ga0070697_100059567 3300005536 Bacteria 3109
239 Ga0070697_100086515 3300005536 Bacteria 2587
240 Ga0070697_100167675 3300005536 Bacteria 1857
241 Ga0070697_100178520 3300005536 Bacteria 1799
242 Ga0070697_100306883 3300005536 Bacteria 1365
243 Ga0070697_100431897 3300005536 Unclassified 1145
244 Ga0070697_100478343 3300005536 Bacteria 1087
245 Ga0070697_100617582 3300005536 Bacteria 953
246 Ga0070697_101167728 3300005536 Bacteria 686
247 Ga0070697_101507375 3300005536 Unclassified 601
248 Ga0070697_101758029 3300005536 Bacteria 555
249 Ga0068853_100001362 3300005539 Bacteria 17619
250 Ga0068853_100009355 3300005539 Bacteria 7900
251 Ga0068853_100045276 3300005539 Unclassified 3768
252 Ga0068853_100209570 3300005539 Bacteria 1776
253 Ga0068853_100238266 3300005539 Bacteria 1667
254 Ga0068853_101503431 3300005539 Unclassified 652
255 Ga0068853_102277838 3300005539 Bacteria 525
256 Ga0070672_100273511 3300005543 Unclassified 1427
257 Ga0070672_100654159 3300005543 Bacteria 918
258 Ga0070686_100199398 3300005544 Bacteria 1434
259 Ga0070686_101285714 3300005544 Unclassified 610
260 Ga0070695_100001464 3300005545 Bacteria 13072
261 Ga0070695_100002045 3300005545 Bacteria 11528
262 Ga0070695_100003725 3300005545 Bacteria 8892
263 Ga0070695_100057401 3300005545 Bacteria 2515
264 Ga0070695_100880859 3300005545 Bacteria 722
265 Ga0070695_101421262 3300005545 Bacteria 576
266 Ga0070696_100004074 3300005546 Bacteria 9751
267 Ga0070696_100043583 3300005546 Bacteria 3105
268 Ga0070696_100125285 3300005546 Bacteria 1863
269 Ga0070696_100277587 3300005546 Bacteria 1276
270 Ga0070696_100310312 3300005546 Unclassified 1211
271 Ga0070696_100674362 3300005546 Bacteria 840
272 Ga0070693_100000325 3300005547 Bacteria 21855
273 Ga0070693_100022242 3300005547 Bacteria 3368
274 Ga0070693_100114053 3300005547 Bacteria 1667
275 Ga0070693_100318921 3300005547 Bacteria 1054
276 Ga0070693_100330005 3300005547 Unclassified 1038
277 Ga0070665_100095438 3300005548 Bacteria 2979
278 Ga0070665_100138558 3300005548 Bacteria 2436
279 Ga0070665_100251379 3300005548 Bacteria 1769
280 Ga0070665_101658729 3300005548 Unclassified 647
281 Ga0070704_100085995 3300005549 Bacteria 2329
282 Ga0070704_100125505 3300005549 Unclassified 1980
283 Ga0070704_100168418 3300005549 Unclassified 1739
284 Ga0070704_100242137 3300005549 Bacteria 1477
285 Ga0070704_101042207 3300005549 Bacteria 741
286 Ga0070704_101807375 3300005549 Bacteria 566
287 Ga0070704_102238146 3300005549 Unclassified 508
288 Ga0068855_100000397 3300005563 Bacteria 53677
289 Ga0068855_100033033 3300005563 Bacteria 6177
290 Ga0068855_100042404 3300005563 Bacteria 5391
291 Ga0068855_100120875 3300005563 Bacteria 2998
292 Ga0068855_100464676 3300005563 Bacteria 1379
293 Ga0068855_101807250 3300005563 Unclassified 621
294 Ga0068855_102080773 3300005563 Bacteria 572
295 Ga0068855_102114808 3300005563 Bacteria 567
296 Ga0068855_102421408 3300005563 Unclassified 524
297 Ga0070664_100000468 3300005564 Bacteria 30654
298 Ga0070664_100043549 3300005564 Bacteria 3787
299 Ga0070664_100082370 3300005564 Unclassified 2775
300 Ga0070664_100127967 3300005564 Unclassified 2229
301 Ga0068857_100000474 3300005577 Bacteria 28698
302 Ga0068857_100011453 3300005577 Bacteria 7718
303 Ga0068857_100014168 3300005577 Bacteria 6942
304 Ga0068857_100061177 3300005577 Bacteria 3345
305 Ga0068857_100486882 3300005577 Bacteria 1156
306 Ga0068857_101017927 3300005577 Unclassified 798
307 Ga0068854_100000353 3300005578 Bacteria 29520
308 Ga0068854_100037036 3300005578 Unclassified 3422
309 Ga0068854_100054791 3300005578 Bacteria 2869
310 Ga0068854_100209085 3300005578 Unclassified 1538
311 Ga0068854_100210627 3300005578 Bacteria 1533
312 Ga0068854_100426306 3300005578 Bacteria 1103
313 Ga0068856_100000475 3300005614 Bacteria 44356
314 Ga0068856_100003466 3300005614 Bacteria 15940
315 Ga0068856_100021766 3300005614 Bacteria 6231
316 Ga0068856_100086827 3300005614 Unclassified 3109
317 Ga0068856_101783989 3300005614 Unclassified 627
318 Ga0068856_102372466 3300005614 Unclassified 538
319 Ga0070702_100462419 3300005615 Bacteria 923
320 Ga0070702_100635949 3300005615 Unclassified 805
321 Ga0068852_100053578 3300005616 Bacteria 3473
322 Ga0068852_100085266 3300005616 Bacteria 2814
323 Ga0068852_100676904 3300005616 Bacteria 1041
324 Ga0068852_101951648 3300005616 Unclassified 609
325 Ga0068859_100000610 3300005617 Bacteria 35815
326 Ga0068859_100002575 3300005617 Bacteria 18433
327 Ga0068859_100028604 3300005617 Bacteria 5588
328 Ga0068859_100184913 3300005617 Bacteria 2167
329 Ga0068859_100208042 3300005617 Bacteria 2042
330 Ga0068859_100214834 3300005617 Bacteria 2010
331 Ga0068859_101388817 3300005617 Bacteria 774
332 Ga0068859_102081566 3300005617 Bacteria 626
333 Ga0068864_100000254 3300005618 Bacteria 47729
334 Ga0068864_100157963 3300005618 Bacteria 2059
335 Ga0068864_100794644 3300005618 Bacteria 929
336 Ga0068866_10016681 3300005718 Unclassified 3289
337 Ga0068866_10027467 3300005718 Bacteria 2699
338 Ga0068866_10298050 3300005718 Bacteria 1006
339 Ga0068861_100033261 3300005719 Bacteria 3802
340 Ga0068861_100081024 3300005719 Bacteria 2540
341 Ga0068861_100132403 3300005719 Bacteria 2025
342 Ga0068861_100239767 3300005719 Bacteria 1542
343 Ga0068851_10125339 3300005834 Bacteria 1384
344 Ga0068851_10221315 3300005834 Bacteria 1064
345 Ga0068870_10001907 3300005840 Bacteria 8603
346 Ga0068870_10025433 3300005840 Unclassified 2938
347 Ga0068870_10619510 3300005840 Unclassified 737
348 Ga0068863_100007896 3300005841 Bacteria 10405
349 Ga0068863_100025704 3300005841 Bacteria 5615
350 Ga0068863_100135541 3300005841 Bacteria 2352
351 Ga0068863_100286444 3300005841 Bacteria 1597
352 Ga0068863_100292226 3300005841 Bacteria 1580
353 Ga0068863_100313048 3300005841 Bacteria 1524
354 Ga0068863_100700374 3300005841 Bacteria 1007
355 Ga0068858_100002296 3300005842 Bacteria 19355
356 Ga0068858_100059167 3300005842 Unclassified 3542
357 Ga0068858_100139449 3300005842 Bacteria 2276
358 Ga0068858_100158022 3300005842 Bacteria 2134
359 Ga0068858_100416577 3300005842 Unclassified 1292
360 Ga0068858_100705093 3300005842 Bacteria 982
361 Ga0068858_100933324 3300005842 Bacteria 849
362 Ga0068860_100004896 3300005843 Bacteria 13649
363 Ga0068860_100047220 3300005843 Bacteria 4105
364 Ga0068860_100074193 3300005843 Unclassified 3235
365 Ga0068860_100192621 3300005843 Bacteria 1973
366 Ga0068860_100193740 3300005843 Bacteria 1967
367 Ga0068860_100318712 3300005843 Bacteria 1526
368 Ga0068860_100433184 3300005843 Bacteria 1305
369 Ga0068860_100687079 3300005843 Bacteria 1033
370 Ga0068860_101333512 3300005843 Bacteria 738
371 Ga0068860_101364035 3300005843 Bacteria 730
372 Ga0068862_100036298 3300005844 Bacteria 4178
373 Ga0068862_100047247 3300005844 Bacteria 3673
374 Ga0068862_100050690 3300005844 Bacteria 3548
375 Ga0068862_100051172 3300005844 Bacteria 3532
376 Ga0068862_100231353 3300005844 Bacteria 1677
377 Ga0068862_100417647 3300005844 Bacteria 1258
378 Ga0068862_100762560 3300005844 Bacteria 942
379 Ga0068862_101612735 3300005844 Unclassified 656
380 Ga0081455_10067085 3300005937 Bacteria 2991
381 Ga0081455_10080439 3300005937 Bacteria 2671
382 Ga0081455_10498329 3300005937 Unclassified 819
383 Ga0081538_10006559 3300005981 Bacteria 10220
384 Ga0081540_1023348 3300005983 Bacteria 3620
385 Ga0081540_1047673 3300005983 Bacteria 2152
386 Ga0070717_10000962 3300006028 Bacteria 19214
387 Ga0070717_10001900 3300006028 Bacteria 14613
388 Ga0070717_10004828 3300006028 Bacteria 9810
389 Ga0070717_10014769 3300006028 Bacteria 6007
390 Ga0070717_10073416 3300006028 Unclassified 2859
391 Ga0070717_10187116 3300006028 Bacteria 1808
392 Ga0070717_10331915 3300006028 Unclassified 1357
393 Ga0070717_11613848 3300006028 Unclassified 588
394 Ga0070717_11883817 3300006028 Bacteria 540
395 Ga0075432_10201831 3300006058 Bacteria 787
396 Ga0070715_10035877 3300006163 Unclassified 2042
397 Ga0070715_10126718 3300006163 Bacteria 1224
398 Ga0070715_10385128 3300006163 Bacteria 775
399 Ga0070716_100002702 3300006173 Bacteria 8212
400 Ga0070716_100087343 3300006173 Unclassified 1878
401 Ga0070716_100131091 3300006173 Unclassified 1585
402 Ga0070716_100350917 3300006173 Unclassified 1044
403 Ga0070716_100393190 3300006173 Bacteria 995
404 Ga0070716_100929509 3300006173 Bacteria 683
405 Ga0070716_101146886 3300006173 Bacteria 622
406 Ga0070716_101673684 3300006173 Bacteria 524
407 Ga0070712_100001521 3300006175 Bacteria 14157
408 Ga0070712_100006037 3300006175 Bacteria 7499
409 Ga0070712_100093001 3300006175 Bacteria 2213
410 Ga0070712_100226384 3300006175 Archaea 1483
411 Ga0070712_100561451 3300006175 Bacteria 963
412 Ga0070712_100683559 3300006175 Bacteria 874
413 Ga0097621_100016488 3300006237 Bacteria 5587
414 Ga0097621_100021907 3300006237 Unclassified 4952
415 Ga0097621_100037196 3300006237 Bacteria 3898
416 Ga0097621_100200954 3300006237 Bacteria 1730
417 Ga0097621_101600454 3300006237 Unclassified 619
418 Ga0068871_100001677 3300006358 Bacteria 14885
419 Ga0068871_100016064 3300006358 Bacteria 5625
420 Ga0068871_100056014 3300006358 Bacteria 3203
421 Ga0068871_100263617 3300006358 Unclassified 1504
422 Ga0068871_100939352 3300006358 Bacteria 803
423 Ga0075428_100018251 3300006844 Bacteria 7753
424 Ga0075428_100189398 3300006844 Bacteria 2225
425 Ga0075428_100351045 3300006844 Bacteria 1583
426 Ga0075428_100789867 3300006844 Bacteria 1009
427 Ga0075430_100292378 3300006846 Unclassified 1348
428 Ga0075430_101623503 3300006846 Unclassified 531
429 Ga0075431_100004465 3300006847 Bacteria 13728
430 Ga0075431_100072796 3300006847 Bacteria 3546
431 Ga0075431_100224811 3300006847 Bacteria 1914
432 Ga0075431_102012259 3300006847 Unclassified 533
433 Ga0075433_10002435 3300006852 Bacteria 14167
434 Ga0075433_10019734 3300006852 Bacteria 5624
435 Ga0075433_10031282 3300006852 Bacteria 4549
436 Ga0075433_10052378 3300006852 Bacteria 3556
437 Ga0075433_11951929 3300006852 Unclassified 503
438 Ga0075434_100008438 3300006871 Bacteria 9581
439 Ga0075434_100011622 3300006871 Bacteria 8313
440 Ga0075434_100044987 3300006871 Bacteria 4379
441 Ga0075434_100064385 3300006871 Bacteria 3650
442 Ga0075434_100230258 3300006871 Bacteria 1872
443 Ga0075434_100453317 3300006871 Bacteria 1304
444 Ga0075434_101225506 3300006871 Unclassified 762
445 Ga0075434_101234983 3300006871 Bacteria 759
446 Ga0075434_101700812 3300006871 Bacteria 639
447 Ga0075429_100004231 3300006880 Bacteria 12298
448 Ga0075429_100069584 3300006880 Bacteria 3064
449 Ga0075429_100610590 3300006880 Archaea 956
450 Ga0068865_100005497 3300006881 Bacteria 7689
451 Ga0068865_100072574 3300006881 Bacteria 2445
452 Ga0068865_100237746 3300006881 Bacteria 1432
453 Ga0068865_100555537 3300006881 Bacteria 965
454 Ga0068865_101152444 3300006881 Unclassified 685
455 Ga0068865_101844124 3300006881 Unclassified 547
456 Ga0075436_100025990 3300006914 Bacteria 4031
457 Ga0075436_100078023 3300006914 Bacteria 2294
458 Ga0075436_100090721 3300006914 Unclassified 2124
459 Ga0075436_100165673 3300006914 Bacteria 1559
460 Ga0097620_100000610 3300006931 Bacteria 35815
461 Ga0097620_100002575 3300006931 Bacteria 18433
462 Ga0097620_100028602 3300006931 Bacteria 5588
463 Ga0097620_100184910 3300006931 Bacteria 2167
464 Ga0097620_100208042 3300006931 Bacteria 2042
465 Ga0097620_100214821 3300006931 Bacteria 2010
466 Ga0097620_101388779 3300006931 Bacteria 774
467 Ga0097620_102081574 3300006931 Bacteria 626
468 Ga0075435_100034942 3300007076 Bacteria 3987
469 Ga0075435_100698580 3300007076 Bacteria 881
470 Ga0075435_101704959 3300007076 Unclassified 553
471 Ga0099794_10125645 3300007265 Bacteria 1293
472 Ga0099794_10273023 3300007265 Bacteria 874
473 Ga0099795_10607814 3300007788 Bacteria 521
474 Ga0105240_10000631 3300009093 Bacteria 65015
475 Ga0105240_10286085 3300009093 Bacteria 1892
476 Ga0105240_10361418 3300009093 Unclassified 1644
477 Ga0105240_10443611 3300009093 Bacteria 1454
478 Ga0105240_10660850 3300009093 Unclassified 1144
479 Ga0105240_11507845 3300009093 Bacteria 705
480 Ga0111539_10000370 3300009094 Bacteria 55548
481 Ga0111539_10282400 3300009094 Bacteria 1932
482 Ga0111539_11549685 3300009094 Bacteria 768
483 Ga0105245_10014746 3300009098 Bacteria 6806
484 Ga0105245_10570905 3300009098 Unclassified 1155
485 Ga0105247_10146799 3300009101 Bacteria 1551
486 Ga0105247_10270397 3300009101 Unclassified 1169
487 Ga0105247_10321849 3300009101 Unclassified 1079
488 Ga0105247_10750871 3300009101 Bacteria 739
489 Ga0114129_10042842 3300009147 Bacteria 6370
490 Ga0114129_10098402 3300009147 Bacteria 4049
491 Ga0114129_10158670 3300009147 Bacteria 3092
492 Ga0114129_10209010 3300009147 Bacteria 2640
493 Ga0114129_10514167 3300009147 Unclassified 1562
494 Ga0114129_10998282 3300009147 Unclassified 1054
495 Ga0105243_10128102 3300009148 Bacteria 2150
496 Ga0105243_10788243 3300009148 Bacteria 935
497 Ga0105243_11150977 3300009148 Bacteria 787
498 Ga0105243_12332465 3300009148 Bacteria 573
499 Ga0105241_10000218 3300009174 Bacteria 43050
500 Ga0105241_10622006 3300009174 Bacteria 978
501 Ga0105241_10981328 3300009174 Unclassified 789
502 Ga0105241_11064906 3300009174 Bacteria 760
503 Ga0105241_11107263 3300009174 Bacteria 746
504 Ga0105241_11346610 3300009174 Unclassified 681
505 Ga0105242_10301640 3300009176 Bacteria 1462
506 Ga0105242_10531097 3300009176 Unclassified 1124
507 Ga0105242_10625792 3300009176 Bacteria 1043
508 Ga0105242_10716087 3300009176 Bacteria 981
509 Ga0105242_11483690 3300009176 Bacteria 708
510 Ga0105248_10000003 3300009177 Bacteria 1019601
511 Ga0105248_10059326 3300009177 Bacteria 4298
512 Ga0105248_10206787 3300009177 Unclassified 2212
513 Ga0105248_10437759 3300009177 Bacteria 1473
514 Ga0105248_10486124 3300009177 Unclassified 1391
515 Ga0105248_10490679 3300009177 Bacteria 1385
516 Ga0105248_10758461 3300009177 Bacteria 1095
517 Ga0105248_11534571 3300009177 Unclassified 754
518 Ga0105248_11980191 3300009177 Bacteria 662
519 Ga0105237_10038178 3300009545 Bacteria 4851
520 Ga0105237_10135744 3300009545 Unclassified 2455
521 Ga0105237_10859458 3300009545 Bacteria 914
522 Ga0105237_11037160 3300009545 Bacteria 827
523 Ga0105237_12185466 3300009545 Unclassified 563
524 Ga0105237_12364970 3300009545 Unclassified 541
525 Ga0105238_10000330 3300009551 Bacteria 51705
526 Ga0105238_10375897 3300009551 Unclassified 1412
527 Ga0105238_11075153 3300009551 Bacteria 827
528 Ga0105238_11728110 3300009551 Unclassified 657
529 Ga0105238_12923362 3300009551 Bacteria 514
530 Ga0105249_10045686 3300009553 Bacteria 3984
531 Ga0105249_10081138 3300009553 Bacteria 3014
532 Ga0105249_10808275 3300009553 Bacteria 1002
533 Ga0105249_11319496 3300009553 Bacteria 793
534 Ga0105249_12237989 3300009553 Unclassified 619
535 Ga0105249_12515443 3300009553 Unclassified 587
536 Ga0099796_10577339 3300010159 Unclassified 506
537 Ga0105239_10017447 3300010375 Bacteria 7939
538 Ga0105239_10136702 3300010375 Bacteria 2729
539 Ga0105239_10490350 3300010375 Bacteria 1396
540 Ga0105239_11237154 3300010375 Bacteria 861
541 Ga0105239_11763757 3300010375 Unclassified 717
542 Ga0105239_13635464 3300010375 Unclassified 501
543 Ga0105246_10100913 3300011119 Bacteria 2101
544 Ga0105246_10141582 3300011119 Bacteria 1809
545 Ga0105246_10894702 3300011119 Bacteria 796
546 Ga0105246_10944710 3300011119 Bacteria 777
547 Ga0157373_10007747 3300013100 Bacteria 7984
548 Ga0157373_10278390 3300013100 Bacteria 1185
549 Ga0157373_10377827 3300013100 Bacteria 1013
550 Ga0157373_10522220 3300013100 Bacteria 859
551 Ga0157373_10977092 3300013100 Bacteria 631
552 Ga0157371_10104300 3300013102 Bacteria 2012
553 Ga0157371_10528594 3300013102 Bacteria 873
554 Ga0157371_10715378 3300013102 Bacteria 750
555 Ga0157371_11253077 3300013102 Unclassified 573
556 Ga0157370_10297526 3300013104 Unclassified 1490
557 Ga0157370_11124992 3300013104 Bacteria 709
558 Ga0157370_11708890 3300013104 Unclassified 565
559 Ga0157369_10000860 3300013105 Bacteria 38699
560 Ga0157369_10036835 3300013105 Bacteria 5358
561 Ga0157369_10038485 3300013105 Bacteria 5230
562 Ga0157369_10039385 3300013105 Bacteria 5165
563 Ga0157369_10042353 3300013105 Bacteria 4967
564 Ga0157369_10057516 3300013105 Bacteria 4195
565 Ga0157369_10091723 3300013105 Bacteria 3242
566 Ga0157369_10475544 3300013105 Bacteria 1293
567 Ga0157369_10648666 3300013105 Bacteria 1089
568 Ga0157369_10718574 3300013105 Unclassified 1028
569 Ga0157369_10744943 3300013105 Bacteria 1008
570 Ga0157369_11275170 3300013105 Bacteria 749
571 Ga0157369_11901950 3300013105 Unclassified 604
572 Ga0157374_10000623 3300013296 Bacteria 31137
573 Ga0157374_10001096 3300013296 Bacteria 23321
574 Ga0157374_10068368 3300013296 Bacteria 3342
575 Ga0157374_10207287 3300013296 Bacteria 1921
576 Ga0157374_11343491 3300013296 Unclassified 737
577 Ga0157378_10001737 3300013297 Bacteria 19543
578 Ga0157378_10004369 3300013297 Bacteria 12440
579 Ga0157378_10095679 3300013297 Bacteria 2705
580 Ga0157378_10562822 3300013297 Unclassified 1147
581 Ga0157378_11334226 3300013297 Bacteria 759
582 Ga0157378_12571293 3300013297 Unclassified 561
583 Ga0163162_10001630 3300013306 Bacteria 20998
584 Ga0163162_10225317 3300013306 Bacteria 2004
585 Ga0163162_10842400 3300013306 Bacteria 1032
586 Ga0163162_11506763 3300013306 Bacteria 766
587 Ga0163162_11714965 3300013306 Bacteria 717
588 Ga0163162_12114399 3300013306 Bacteria 646
589 Ga0163162_12383620 3300013306 Unclassified 608
590 Ga0163162_13095874 3300013306 Unclassified 534
591 Ga0157372_10002736 3300013307 Bacteria 19044
592 Ga0157372_10006133 3300013307 Bacteria 12777
593 Ga0157372_10015841 3300013307 Bacteria 8088
594 Ga0157372_10034967 3300013307 Bacteria 5529
595 Ga0157372_10071734 3300013307 Bacteria 3901
596 Ga0157372_10139785 3300013307 Bacteria 2789
597 Ga0157372_10206201 3300013307 Unclassified 2278
598 Ga0157372_10470821 3300013307 Bacteria 1464
599 Ga0157372_10540767 3300013307 Unclassified 1358
600 Ga0157372_11024480 3300013307 Unclassified 956
601 Ga0157372_11039895 3300013307 Bacteria 948
602 Ga0157375_10258654 3300013308 Unclassified 1902
603 Ga0157375_10440063 3300013308 Bacteria 1469
604 Ga0157375_11030670 3300013308 Bacteria 961
605 Ga0157375_11710345 3300013308 Bacteria 745
606 Ga0163163_10203524 3300014325 Bacteria 2028
607 Ga0163163_10482239 3300014325 Bacteria 1301
608 Ga0163163_11221169 3300014325 Bacteria 814
609 Ga0157380_10427492 3300014326 Bacteria 1265
610 Ga0157380_10950765 3300014326 Bacteria 889
611 Ga0182008_10056847 3300014497 Unclassified 1932
612 Ga0157377_10039326 3300014745 Unclassified 2616
613 Ga0157377_10124565 3300014745 Unclassified 1566
614 Ga0157379_10025795 3300014968 Bacteria 5225
615 Ga0157379_10059338 3300014968 Bacteria 3421
616 Ga0157379_10103084 3300014968 Bacteria 2560
617 Ga0157379_10596177 3300014968 Unclassified 1031
618 Ga0157376_10133813 3300014969 Unclassified 2216
619 Ga0157376_10182867 3300014969 Bacteria 1917
620 Ga0157376_10261252 3300014969 Bacteria 1622
621 Ga0157376_10346467 3300014969 Bacteria 1420
622 Ga0157376_12108704 3300014969 Bacteria 602
623 Ga0182007_10040446 3300015262 Bacteria 1557
624 Ga0206354_10273109 3300020081 Unclassified 707
625 Ga0206353_11476773 3300020082 Unclassified 2067
626 Ga0207653_10039108 3300025885 Bacteria 1552
627 Ga0207653_10045081 3300025885 Bacteria 1456
628 Ga0207653_10087152 3300025885 Bacteria 1089
629 Ga0207682_10209462 3300025893 Unclassified 899
630 Ga0207692_10287538 3300025898 Unclassified 996
631 Ga0207710_10021562 3300025900 Bacteria 2762
632 Ga0207647_10215025 3300025904 Unclassified 1109
633 Ga0207685_10277766 3300025905 Bacteria 821
634 Ga0207699_10187793 3300025906 Bacteria 1393
635 Ga0207645_10001324 3300025907 Bacteria 20346
636 Ga0207645_10192689 3300025907 Bacteria 1340
637 Ga0207643_10000157 3300025908 Bacteria 46902
638 Ga0207684_10008133 3300025910 Bacteria 9350
639 Ga0207684_10010283 3300025910 Bacteria 8236
640 Ga0207684_10014651 3300025910 Bacteria 6754
641 Ga0207684_10088487 3300025910 Bacteria 2638
642 Ga0207684_10170081 3300025910 Bacteria 1878
643 Ga0207684_10387218 3300025910 Bacteria 1202
644 Ga0207684_10423134 3300025910 Unclassified 1144
645 Ga0207654_10026891 3300025911 Bacteria 3122
646 Ga0207654_11059643 3300025911 Bacteria 590
647 Ga0207707_10000258 3300025912 Bacteria 57257
648 Ga0207707_10174070 3300025912 Bacteria 1880
649 Ga0207707_10582329 3300025912 Unclassified 948
650 Ga0207707_11663668 3300025912 Bacteria 501
651 Ga0207695_10006130 3300025913 Bacteria 15682
652 Ga0207695_10472289 3300025913 Unclassified 1137
653 Ga0207671_10241288 3300025914 Bacteria 1419
654 Ga0207693_10001303 3300025915 Bacteria 22126
655 Ga0207693_10142219 3300025915 Bacteria 1886
656 Ga0207663_10052807 3300025916 Bacteria 2536
657 Ga0207660_10224521 3300025917 Unclassified 1475
658 Ga0207660_10414539 3300025917 Unclassified 1086
659 Ga0207660_11131258 3300025917 Bacteria 638
660 Ga0207662_10080195 3300025918 Bacteria 1990
661 Ga0207657_10000373 3300025919 Bacteria 47375
662 Ga0207649_10006286 3300025920 Bacteria 6452
663 Ga0207652_10004142 3300025921 Bacteria 11838
664 Ga0207652_10141140 3300025921 Bacteria 2154
665 Ga0207646_10004675 3300025922 Bacteria 14754
666 Ga0207646_10044552 3300025922 Bacteria 3982
667 Ga0207646_10047209 3300025922 Bacteria 3863
668 Ga0207646_10051594 3300025922 Bacteria 3680
669 Ga0207646_10065789 3300025922 Bacteria 3236
670 Ga0207646_10105489 3300025922 Bacteria 2527
671 Ga0207646_10233756 3300025922 Bacteria 1661
672 Ga0207646_10490945 3300025922 Unclassified 1107
673 Ga0207681_10088200 3300025923 Bacteria 2209
674 Ga0207694_11837595 3300025924 Bacteria 509
675 Ga0207650_10076533 3300025925 Unclassified 2528
676 Ga0207659_10176184 3300025926 Unclassified 1690
677 Ga0207687_11484018 3300025927 Unclassified 582
678 Ga0207690_10095350 3300025932 Unclassified 2113
679 Ga0207706_10001857 3300025933 Bacteria 20682
680 Ga0207706_10008929 3300025933 Bacteria 9225
681 Ga0207706_10864532 3300025933 Bacteria 765
682 Ga0207686_10339234 3300025934 Bacteria 1128
683 Ga0207686_11157419 3300025934 Bacteria 632
684 Ga0207709_10115773 3300025935 Unclassified 1801
685 Ga0207709_11127613 3300025935 Bacteria 645
686 Ga0207670_10028434 3300025936 Bacteria 3550
687 Ga0207670_10036465 3300025936 Bacteria 3198
688 Ga0207670_11267801 3300025936 Bacteria 625
689 Ga0207704_10384794 3300025938 Bacteria 1102
690 Ga0207704_10598929 3300025938 Unclassified 902
691 Ga0207665_10005743 3300025939 Bacteria 8257
692 Ga0207665_10657713 3300025939 Bacteria 822
693 Ga0207691_11411252 3300025940 Unclassified 572
694 Ga0207711_11300423 3300025941 Unclassified 669
695 Ga0207689_10000975 3300025942 Bacteria 27466
696 Ga0207689_10002812 3300025942 Bacteria 16083
697 Ga0207661_10257351 3300025944 Unclassified 1554
698 Ga0207679_10000779 3300025945 Bacteria 20862
699 Ga0207667_10000857 3300025949 Bacteria 39178
700 Ga0207667_10327367 3300025949 Unclassified 1564
701 Ga0207667_10977281 3300025949 Unclassified 835
702 Ga0207712_10058438 3300025961 Bacteria 2725
703 Ga0207712_10274100 3300025961 Unclassified 1374
704 Ga0207712_10552620 3300025961 Bacteria 990
705 Ga0207640_10032375 3300025981 Bacteria 3241
706 Ga0207658_11341873 3300025986 Bacteria 654
707 Ga0207658_12040675 3300025986 Unclassified 522
708 Ga0207677_10011276 3300026023 Bacteria 5088
709 Ga0207703_10199610 3300026035 Bacteria 1777
710 Ga0207703_10366062 3300026035 Unclassified 1331
711 Ga0207703_11318259 3300026035 Bacteria 694
712 Ga0207703_11951730 3300026035 Bacteria 563
713 Ga0207639_10042698 3300026041 Unclassified 3399
714 Ga0207678_10002143 3300026067 Bacteria 17878
715 Ga0207708_10089290 3300026075 Bacteria 2375
716 Ga0207708_10211569 3300026075 Bacteria 1550
717 Ga0207708_10415349 3300026075 Bacteria 1115
718 Ga0207708_10918024 3300026075 Unclassified 758
719 Ga0207702_10001041 3300026078 Bacteria 28384
720 Ga0207641_10110682 3300026088 Bacteria 2434
721 Ga0207641_10134689 3300026088 Unclassified 2222
722 Ga0207641_10470644 3300026088 Unclassified 1217
723 Ga0207648_10027225 3300026089 Bacteria 5078
724 Ga0207648_10513436 3300026089 Bacteria 1097
725 Ga0207676_10005775 3300026095 Bacteria 8752
726 Ga0207676_10835249 3300026095 Bacteria 900
727 Ga0207674_10008510 3300026116 Bacteria 11845
728 Ga0207674_10197920 3300026116 Bacteria 1959
729 Ga0207675_100028715 3300026118 Bacteria 5182
730 Ga0207675_100041467 3300026118 Bacteria 4299
731 Ga0207675_100241559 3300026118 Bacteria 1745
732 Ga0207698_11209964 3300026142 Bacteria 769
733 Ga0209971_1086318 3300027682 Unclassified 765
734 Ga0209974_10080257 3300027876 Bacteria 1122
735 Ga0209974_10215543 3300027876 Unclassified 713
736 Ga0207428_10000409 3300027907 Bacteria 53318
737 Ga0207428_10055666 3300027907 Bacteria 3144
738 Ga0268265_10012391 3300028380 Bacteria 5778
739 Ga0268265_10039330 3300028380 Bacteria 3486
740 Ga0268265_10183974 3300028380 Bacteria 1798
741 Ga0268265_10613472 3300028380 Bacteria 1041
742 Ga0268265_11470376 3300028380 Unclassified 684
743 Ga0268264_10020556 3300028381 Bacteria 5394
744 Ga0268264_10184885 3300028381 Bacteria 1895
745 Ga0268264_10279165 3300028381 Bacteria 1564
746 Ga0265338_10900391 3300028800 Unclassified 602
747 Ga0373930_0037196 3300034816 Bacteria 1024
748 Ga0373948_0031154 3300034817 Unclassified 1076
749 Ga0373959_0010060 3300034820 Bacteria 1646
750 Ga0373929_0012726 3300035085 Unclassified 1603
751 Ga0373934_0152402 3300035086 Unclassified 947
752 Ga0373949_0041100 3300035090 Bacteria 1137
753 Ga0373949_0214466 3300035090 Unclassified 583
754 Ga0373951_0181220 3300035091 Unclassified 605
755 Ga0373952_0163889 3300035092 Bacteria 631
756 Ga0373936_0563372 3300035113 Unclassified 533
757 Ga0373941_0307983 3300035115 Unclassified 634
758 Ga0373953_0022081 3300035117 Bacteria 2396
759 Ga0373956_0167277 3300035119 Bacteria 1037
760 Ga0373960_0125478 3300035121 Bacteria 856
761 Ga0373961_0023387 3300035241 Unclassified 1662
762 Ga0373962_0095026 3300035242 Bacteria 923
763 Ga0316584_0721120 3300036712 Bacteria 682
764 Ga0395905_0393256 3300037471 Bacteria 1281
765 Ga0242420_137901 3300038996 Unclassified 541
766 Ga0436362_0536511 3300039453 Unclassified 520
767 Ga0436362_0750444 3300039453 Bacteria 3396
768 Ga0439443_103721 3300042003 Unclassified 546
769 Ga0439448_0123190 3300042005 Bacteria 890
770 Ga0439450_019674 3300042008 Unclassified 1433
771 Ga0439455_0061480 3300042012 Unclassified 997
772 Ga0450914_059757 3300042118 Bacteria 515
773 Ga0439458_0084944 3300042157 Unclassified 810
774 Ga0439459_0015470 3300042438 Unclassified 1398
775 Ga0439464_0001377 3300042439 Bacteria 5694
776 Ga0439464_0287693 3300042439 Unclassified 535
777 Ga0439460_0004434 3300042461 Bacteria 3421
778 Ga0439460_0098969 3300042461 Unclassified 935
779 Ga0451577_0003197 3300042876 Bacteria 18404
780 Ga0451577_0017287 3300042876 Bacteria 6665
781 Ga0451577_0678249 3300042876 Unclassified 934
782 Ga0451577_0888856 3300042876 Unclassified 802
783 Ga0439440_0080245 3300042993 Unclassified 862
784 Ga0439440_0111873 3300042993 Bacteria 752
785 Ga0439440_0171081 3300042993 Unclassified 632
786 Ga0453683_0032136 3300044673 Bacteria 3313
787 Ga0453683_0048690 3300044673 Bacteria 2658
788 Ga0466963_0255477 3300044694 Bacteria 1230
789 Ga0466963_0397232 3300044694 Unclassified 972
790 Ga0453684_0051544 3300044712 Bacteria 5392
791 Ga0453684_0176401 3300044712 Bacteria 2513
792 Ga0453684_1756387 3300044712 Unclassified 632
793 Ga0451576_0016285 3300045051 Bacteria 8210
794 Ga0451576_0021455 3300045051 Bacteria 7019
795 Ga0451576_0109256 3300045051 Bacteria 2878
796 Ga0451576_0374364 3300045051 Bacteria 1492
797 Ga0451576_1819223 3300045051 Unclassified 629
798 Ga0466958_0362224 3300045836 Bacteria 934
799 Ga0466958_0387879 3300045836 Bacteria 901
800 Ga0495603_0151546 3300046455 Bacteria 1347
801 Ga0495651_0802509 3300046462 Bacteria 581
802 Ga0495580_0142533 3300046472 Bacteria 1661
803 Ga0495605_0386270 3300046474 Bacteria 584
804 Ga0495662_0188767 3300046476 Bacteria 1016
805 Ga0495664_0110358 3300046477 Bacteria 1660
806 Ga0495584_0105366 3300046491 Bacteria 1426
807 Ga0495594_0185997 3300046499 Bacteria 1183
808 Ga0495628_0924417 3300046516 Bacteria 604
809 Ga0495642_0040523 3300046528 Bacteria 1892
810 Ga0495665_0150775 3300046531 Bacteria 1214
811 Ga0495665_0280743 3300046531 Bacteria 854
812 Ga0495586_0152297 3300046535 Bacteria 1301
813 Ga0495587_0549160 3300046536 Bacteria 637
814 Ga0495645_0084383 3300046543 Bacteria 2275
815 Ga0495588_0153989 3300046674 Unclassified 1215
816 Ga0495657_0702546 3300046675 Bacteria 581
817 Ga0495599_0625873 3300046678 Bacteria 625
818 Ga0495623_0145129 3300046679 Bacteria 1408
819 Ga0495669_0172550 3300046684 Unclassified 1029
820 Ga0495600_0235295 3300046809 Unclassified 1168
821 Ga0495581_0348250 3300047315 Bacteria 865
822 Ga0495581_0701533 3300047315 Bacteria 584
823 Ga0495604_0097872 3300047317 Bacteria 2163
824 Ga0495636_0700550 3300047318 Bacteria 500
825 Ga0495683_0346110 3300047323 Unclassified 628
826 Ga0495675_0236553 3300047444 Bacteria 1100
827 Ga0495677_0125595 3300047445 Unclassified 980
828 Ga0495602_0906776 3300048088 Bacteria 586
829 Ga0495614_0214934 3300048089 Bacteria 873
830 Ga0496102_1182226 3300048905 Bacteria 684
831 Ga0496104_0684301 3300048907 Unclassified 934
832 Ga0496104_0969422 3300048907 Bacteria 755
833 Ga0496106_0518118 3300048909 Bacteria 958
834 Ga0496107_0602822 3300048910 Unclassified 812
835 Ga0496108_0529524 3300048911 Bacteria 1029
836 Ga0496108_1750826 3300048911 Unclassified 510
837 Ga0496109_0475554 3300048912 Unclassified 1180
838 Ga0496109_0993790 3300048912 Bacteria 777
839 Ga0496110_0876434 3300048913 Unclassified 803
840 Ga0496112_0735378 3300048915 Unclassified 913
841 Ga0496112_0993179 3300048915 Unclassified 759
842 Ga0496113_0103521 3300048916 Bacteria 2208
843 Ga0496113_1117253 3300048916 Bacteria 618
844 Ga0496113_1350575 3300048916 Unclassified 553
845 Ga0496115_0028275 3300048918 Bacteria 4394
846 Ga0501032_0271872 3300049569 Unclassified 1098
847 Ga0501033_0064984 3300049570 Unclassified 2684
848 Ga0501033_0260019 3300049570 Bacteria 1229
849 Ga0501036_0307362 3300049572 Unclassified 1326
850 Ga0501036_0514743 3300049572 Bacteria 995
851 Ga0501036_0629317 3300049572 Bacteria 889
852 Ga0501036_1305803 3300049572 Unclassified 590
853 Ga0501038_0150053 3300049574 Unclassified 1901
854 Ga0501038_0191815 3300049574 Unclassified 1644
855 Ga0501039_0079790 3300049575 Unclassified 2546
856 Ga0501039_0305461 3300049575 Bacteria 1251
857 Ga0501040_0003451 3300049576 Bacteria 10205
858 Ga0501040_0041964 3300049576 Bacteria 3116
859 Ga0501040_0136829 3300049576 Bacteria 1725
860 Ga0501040_0192808 3300049576 Bacteria 1446
861 Ga0501041_0003300 3300049577 Bacteria 9278
862 Ga0501041_0233225 3300049577 Bacteria 1156
863 Ga0501042_0009827 3300049578 Bacteria 6390
864 Ga0501042_0105895 3300049578 Bacteria 2024
865 Ga0501042_1321187 3300049578 Bacteria 526
866 Ga0501043_0188199 3300049579 Unclassified 1606
867 Ga0501043_0276229 3300049579 Bacteria 1289
868 Ga0501046_0000607 3300049580 Bacteria 35214
869 Ga0501046_0073675 3300049580 Bacteria 2650
870 Ga0501046_0896204 3300049580 Bacteria 619
871 Ga0501048_0189964 3300049582 Bacteria 1455
872 Ga0501067_0576000 3300049583 Bacteria 631
873 Ga0501068_0318313 3300049584 Unclassified 997
874 Ga0501068_0562728 3300049584 Bacteria 742
875 Ga0501069_0138456 3300049585 Bacteria 1396
876 Ga0501069_0554619 3300049585 Bacteria 688
877 Ga0501071_0247162 3300049587 Bacteria 1346
878 Ga0501071_0626163 3300049587 Unclassified 828
879 Ga0501072_0119308 3300049588 Bacteria 2102
880 Ga0501072_0215305 3300049588 Bacteria 1531
881 Ga0501073_0537600 3300049589 Bacteria 808
882 Ga0501074_0171986 3300049590 Bacteria 1546
883 Ga0501074_0286895 3300049590 Unclassified 1170
884 Ga0501075_0315584 3300049591 Unclassified 1191
885 Ga0501075_0668076 3300049591 Unclassified 792
886 Ga0501076_0003696 3300049592 Bacteria 10761
887 Ga0501076_0181203 3300049592 Unclassified 1717
888 Ga0501076_0221552 3300049592 Unclassified 1546
889 Ga0501076_0744962 3300049592 Bacteria 808
890 Ga0501076_1525842 3300049592 Unclassified 548
891 Ga0501077_0023484 3300049593 Bacteria 3911
892 Ga0501077_0128880 3300049593 Bacteria 1604
893 Ga0501077_0129556 3300049593 Bacteria 1599
894 Ga0501077_0338062 3300049593 Bacteria 960
895 Ga0501079_0009586 3300049741 Bacteria 7342
896 Ga0501079_0022016 3300049741 Bacteria 4883
897 Ga0501079_0722716 3300049741 Bacteria 784
898 Ga0501079_1042496 3300049741 Unclassified 644
899 Ga0501080_0028717 3300049742 Bacteria 5178
900 Ga0501080_0390477 3300049742 Bacteria 1253
901 Ga0501080_0568033 3300049742 Bacteria 1009
902 Ga0501081_0018275 3300049743 Bacteria 4653
903 Ga0501081_0060230 3300049743 Bacteria 2630
904 Ga0501081_0183134 3300049743 Unclassified 1515
905 Ga0501081_0443008 3300049743 Unclassified 964
906 Ga0501083_0186803 3300049744 Bacteria 1353
907 Ga0501083_0321280 3300049744 Bacteria 1007
908 Ga0501035_0391223 3300049822 Unclassified 1158
909 Ga0501045_0090523 3300049824 Bacteria 2261
910 Ga0501045_0112285 3300049824 Bacteria 2021
911 Ga0501045_0250114 3300049824 Bacteria 1319
912 Ga0501045_0501717 3300049824 Bacteria 901
913 nmdc:mga05p37_1068125_c1 3300050507 Bacteria 849
914 nmdc:mga05p37_131447_c1 3300050507 Bacteria 3071
915 nmdc:mga05p37_1343294_c1 3300050507 Unclassified 725
916 nmdc:mga05p37_261175_c2 3300050507 Bacteria 1603
917 nmdc:mga05p37_286830_c1 3300050507 Unclassified 1961
918 nmdc:mga05p37_40058_c1 3300050507 Bacteria 5754
919 nmdc:mga05p37_43249_c1 3300050507 Bacteria 5540
920 nmdc:mga05p37_465902_c1 3300050507 Bacteria 1459
921 nmdc:mga05p37_70128_c1 3300050507 Bacteria 4311
922 nmdc:mga09592_11878_c1 3300050508 Bacteria 7084
923 nmdc:mga09592_147685_c1 3300050508 Unclassified 2027
924 nmdc:mga09592_84995_c1 3300050508 Unclassified 2699
925 nmdc:mga0qj67_1363606_c1 3300050509 Unclassified 548
926 nmdc:mga06r32_2118_c1 3300050510 Bacteria 17775
927 nmdc:mga06r32_402829_c1 3300050510 Bacteria 1350
928 nmdc:mga06r32_545350_c1 3300050510 Bacteria 1134
929 nmdc:mga08y16_14948_c1 3300050511 Bacteria 8164
930 nmdc:mga08y16_872768_c1 3300050511 Bacteria 888
931 nmdc:mga0n895_1147262_c1 3300050512 Unclassified 753
932 nmdc:mga0n895_12241_c1 3300050512 Bacteria 7688
933 nmdc:mga0n895_1752318_c1 3300050512 Bacteria 583
934 nmdc:mga0n895_22280_c1 3300050512 Bacteria 5939
935 nmdc:mga0n895_236999_c1 3300050512 Unclassified 1852
936 nmdc:mga0n895_659279_c1 3300050512 Bacteria 1045
937 nmdc:mga0n895_774714_c1 3300050512 Bacteria 951
938 nmdc:mga0n895_796590_c1 3300050512 Unclassified 936
939 nmdc:mga0rr50_1393201_c1 3300050513 Unclassified 594
940 nmdc:mga0rr50_39532_c1 3300050513 Bacteria 3423
941 nmdc:mga0rr50_4563_c1 3300050513 Bacteria 8150
942 nmdc:mga0rr50_884105_c1 3300050513 Unclassified 762
943 nmdc:mga08x19_15303_c1 3300050514 Bacteria 4667
944 nmdc:mga08x19_185061_c1 3300050514 Unclassified 1423
945 nmdc:mga0a205_332583_c1 3300050515 Unclassified 1389
946 nmdc:mga0a205_48721_c1 3300050515 Bacteria 4090
947 nmdc:mga0a205_74174_c1 3300050515 Bacteria 3288
948 nmdc:mga0a205_84734_c1 3300050515 Bacteria 3062
949 nmdc:mga0a205_9635_c1 3300050515 Bacteria 8843
950 nmdc:mga0a205_989509_c1 3300050515 Bacteria 688
951 Ga0501084_0012880 3300054114 Bacteria 6927
952 Ga0501084_0046613 3300054114 Bacteria 3632
953 Ga0501084_0110288 3300054114 Bacteria 2312
954 Ga0501084_0113395 3300054114 Bacteria 2279
955 Ga0501082_0001321 3300060353 Bacteria 21707
956 Ga0501082_0105974 3300060353 Bacteria 2432
957 Ga0501082_0293158 3300060353 Unclassified 1416
958 Ga0530510_0047065 3300061734 Unclassified 3116
959 Ga0530510_0707923 3300061734 Unclassified 767
960 Ga0530510_1420814 3300061734 Unclassified 532
961 Ga0530510_1463227 3300061734 Unclassified 524

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005444 Ga0070694_100133588 Ga0070694_1001335882 61
2 3300005445 Ga0070708_100394414 Ga0070708_1003944142 61
3 3300005468 Ga0070707_100020638 Ga0070707_1000206382 61
4 3300005468 Ga0070707_102217388 Ga0070707_1022173881 61
5 3300005471 Ga0070698_100180111 Ga0070698_1001801112 61
6 3300005549 Ga0070704_101807375 Ga0070704_1018073751 61
7 3300006847 Ga0075431_100224811 Ga0075431_1002248112 61
8 3300025922 Ga0207646_10233756 Ga0207646_102337562 61
9 3300047318 Ga0495636_0700550 Ga0495636_0700550_248_439 61
10 3300050507 nmdc:mga05p37_1068125_c1 nmdc:mga05p37_1068125_c1_600_791 61
11 3300050510 nmdc:mga06r32_402829_c1 nmdc:mga06r32_402829_c1_835_1026 61
12 3300000546 LJNas_1001299 LJNas_10012992 62
13 3300001978 JGI24747J21853_1005708 JGI24747J21853_10057083 62
14 3300001990 JGI24737J22298_10107498 JGI24737J22298_101074982 62
15 3300001991 JGI24743J22301_10007173 JGI24743J22301_100071732 62
16 3300002459 JGI24751J29686_10001058 JGI24751J29686_100010583 62
17 3300004799 Ga0058863_10163623 Ga0058863_101636231 62
18 3300004800 Ga0058861_10095151 Ga0058861_100951511 62
19 3300004800 Ga0058861_10169578 Ga0058861_101695782 62
20 3300004800 Ga0058861_10171377 Ga0058861_101713773 62
21 3300004803 Ga0058862_10211581 Ga0058862_102115812 62
22 3300005290 Ga0065712_10047790 Ga0065712_100477902 62
23 3300005290 Ga0065712_10312758 Ga0065712_103127581 62
24 3300005293 Ga0065715_10310948 Ga0065715_103109481 62
25 3300005295 Ga0065707_10208242 Ga0065707_102082422 62
26 3300005295 Ga0065707_10360330 Ga0065707_103603303 62
27 3300005295 Ga0065707_10993216 Ga0065707_109932162 62
28 3300005327 Ga0070658_10139618 Ga0070658_101396181 62
29 3300005327 Ga0070658_10925189 Ga0070658_109251891 62
30 3300005328 Ga0070676_10006901 Ga0070676_100069012 62
31 3300005328 Ga0070676_10104744 Ga0070676_101047441 62
32 3300005328 Ga0070676_10125676 Ga0070676_101256762 62
33 3300005328 Ga0070676_10266258 Ga0070676_102662582 62
34 3300005329 Ga0070683_100012082 Ga0070683_1000120825 62
35 3300005329 Ga0070683_100021104 Ga0070683_1000211044 62
36 3300005329 Ga0070683_100045056 Ga0070683_1000450566 62
37 3300005329 Ga0070683_100074278 Ga0070683_1000742784 62
38 3300005329 Ga0070683_100562402 Ga0070683_1005624021 62
39 3300005329 Ga0070683_100903325 Ga0070683_1009033252 62
40 3300005330 Ga0070690_100028368 Ga0070690_1000283683 62
41 3300005330 Ga0070690_100255065 Ga0070690_1002550651 62
42 3300005330 Ga0070690_100842191 Ga0070690_1008421911 62
43 3300005331 Ga0070670_100017818 Ga0070670_1000178182 62
44 3300005331 Ga0070670_100026236 Ga0070670_1000262365 62
45 3300005331 Ga0070670_100092204 Ga0070670_1000922041 62
46 3300005331 Ga0070670_100130819 Ga0070670_1001308193 62
47 3300005333 Ga0070677_10011875 Ga0070677_100118754 62
48 3300005333 Ga0070677_10155180 Ga0070677_101551802 62
49 3300005333 Ga0070677_10356520 Ga0070677_103565202 62
50 3300005334 Ga0068869_100002767 Ga0068869_1000027672 62
51 3300005334 Ga0068869_100004989 Ga0068869_1000049895 62
52 3300005334 Ga0068869_100029661 Ga0068869_1000296613 62
53 3300005334 Ga0068869_100187938 Ga0068869_1001879383 62
54 3300005336 Ga0070680_100011932 Ga0070680_1000119328 62
55 3300005336 Ga0070680_100209933 Ga0070680_1002099332 62
56 3300005336 Ga0070680_100212672 Ga0070680_1002126723 62
57 3300005336 Ga0070680_100258169 Ga0070680_1002581692 62
58 3300005336 Ga0070680_100481586 Ga0070680_1004815862 62
59 3300005336 Ga0070680_100844665 Ga0070680_1008446651 62
60 3300005336 Ga0070680_101743522 Ga0070680_1017435221 62
61 3300005337 Ga0070682_100001205 Ga0070682_1000012057 62
62 3300005337 Ga0070682_100079880 Ga0070682_1000798803 62
63 3300005337 Ga0070682_100130021 Ga0070682_1001300213 62
64 3300005337 Ga0070682_100236723 Ga0070682_1002367232 62
65 3300005337 Ga0070682_101946233 Ga0070682_1019462331 62
66 3300005338 Ga0068868_100009424 Ga0068868_1000094241 62
67 3300005338 Ga0068868_100020041 Ga0068868_1000200412 62
68 3300005338 Ga0068868_100026898 Ga0068868_1000268983 62
69 3300005338 Ga0068868_100116967 Ga0068868_1001169671 62
70 3300005338 Ga0068868_100134719 Ga0068868_1001347193 62
71 3300005338 Ga0068868_100749167 Ga0068868_1007491672 62
72 3300005339 Ga0070660_100000332 Ga0070660_10000033217 62
73 3300005339 Ga0070660_100339242 Ga0070660_1003392423 62
74 3300005339 Ga0070660_101080180 Ga0070660_1010801802 62
75 3300005340 Ga0070689_100031084 Ga0070689_1000310844 62
76 3300005340 Ga0070689_100045532 Ga0070689_1000455323 62
77 3300005340 Ga0070689_100055190 Ga0070689_1000551902 62
78 3300005340 Ga0070689_100065539 Ga0070689_1000655393 62
79 3300005340 Ga0070689_100174407 Ga0070689_1001744072 62
80 3300005341 Ga0070691_10007841 Ga0070691_100078415 62
81 3300005343 Ga0070687_100058180 Ga0070687_1000581801 62
82 3300005343 Ga0070687_100070845 Ga0070687_1000708454 62
83 3300005343 Ga0070687_100112656 Ga0070687_1001126562 62
84 3300005344 Ga0070661_100008004 Ga0070661_1000080047 62
85 3300005344 Ga0070661_100010213 Ga0070661_1000102138 62
86 3300005344 Ga0070661_100366338 Ga0070661_1003663382 62
87 3300005344 Ga0070661_100563713 Ga0070661_1005637132 62
88 3300005345 Ga0070692_10039660 Ga0070692_100396601 62
89 3300005345 Ga0070692_10146528 Ga0070692_101465282 62
90 3300005345 Ga0070692_10408458 Ga0070692_104084582 62
91 3300005347 Ga0070668_100024248 Ga0070668_1000242483 62
92 3300005347 Ga0070668_102154891 Ga0070668_1021548911 62
93 3300005353 Ga0070669_100093849 Ga0070669_1000938492 62
94 3300005353 Ga0070669_100096286 Ga0070669_1000962862 62
95 3300005353 Ga0070669_100256695 Ga0070669_1002566953 62
96 3300005353 Ga0070669_100412395 Ga0070669_1004123952 62
97 3300005353 Ga0070669_100444189 Ga0070669_1004441891 62
98 3300005353 Ga0070669_100616655 Ga0070669_1006166553 62
99 3300005354 Ga0070675_100008040 Ga0070675_1000080404 62
100 3300005354 Ga0070675_100092835 Ga0070675_1000928354 62
101 3300005355 Ga0070671_100288645 Ga0070671_1002886451 62
102 3300005355 Ga0070671_100369219 Ga0070671_1003692192 62
103 3300005356 Ga0070674_100195372 Ga0070674_1001953722 62
104 3300005364 Ga0070673_100013321 Ga0070673_1000133215 62
105 3300005364 Ga0070673_100190955 Ga0070673_1001909553 62
106 3300005364 Ga0070673_100305270 Ga0070673_1003052701 62
107 3300005364 Ga0070673_100808425 Ga0070673_1008084251 62
108 3300005365 Ga0070688_100101502 Ga0070688_1001015023 62
109 3300005365 Ga0070688_100428583 Ga0070688_1004285832 62
110 3300005365 Ga0070688_100525199 Ga0070688_1005251992 62
111 3300005365 Ga0070688_101026319 Ga0070688_1010263191 62
112 3300005365 Ga0070688_101543178 Ga0070688_1015431781 62
113 3300005365 Ga0070688_101701286 Ga0070688_1017012862 62
114 3300005366 Ga0070659_100007889 Ga0070659_1000078898 62
115 3300005366 Ga0070659_100054477 Ga0070659_1000544772 62
116 3300005367 Ga0070667_100075152 Ga0070667_1000751523 62
117 3300005367 Ga0070667_100163470 Ga0070667_1001634704 62
118 3300005367 Ga0070667_100248515 Ga0070667_1002485153 62
119 3300005367 Ga0070667_100860083 Ga0070667_1008600832 62
120 3300005367 Ga0070667_101454837 Ga0070667_1014548372 62
121 3300005367 Ga0070667_102063811 Ga0070667_1020638111 62
122 3300005406 Ga0070703_10065721 Ga0070703_100657211 62
123 3300005406 Ga0070703_10111366 Ga0070703_101113661 62
124 3300005406 Ga0070703_10178194 Ga0070703_101781942 62
125 3300005434 Ga0070709_10119517 Ga0070709_101195172 62
126 3300005434 Ga0070709_10204332 Ga0070709_102043323 62
127 3300005434 Ga0070709_10582266 Ga0070709_105822661 62
128 3300005434 Ga0070709_10827973 Ga0070709_108279732 62
129 3300005435 Ga0070714_101819508 Ga0070714_1018195082 62
130 3300005436 Ga0070713_100293088 Ga0070713_1002930883 62
131 3300005436 Ga0070713_100391922 Ga0070713_1003919222 62
132 3300005436 Ga0070713_100603944 Ga0070713_1006039442 62
133 3300005436 Ga0070713_100854147 Ga0070713_1008541472 62
134 3300005436 Ga0070713_101550899 Ga0070713_1015508991 62
135 3300005437 Ga0070710_10061249 Ga0070710_100612492 62
136 3300005437 Ga0070710_10199474 Ga0070710_101994742 62
137 3300005437 Ga0070710_10336814 Ga0070710_103368141 62
138 3300005437 Ga0070710_11076953 Ga0070710_110769532 62
139 3300005438 Ga0070701_10041473 Ga0070701_100414732 62
140 3300005438 Ga0070701_10095361 Ga0070701_100953611 62
141 3300005438 Ga0070701_10309427 Ga0070701_103094272 62
142 3300005439 Ga0070711_100009216 Ga0070711_1000092164 62
143 3300005439 Ga0070711_100041508 Ga0070711_1000415082 62
144 3300005439 Ga0070711_101791610 Ga0070711_1017916101 62
145 3300005440 Ga0070705_100010715 Ga0070705_1000107154 62
146 3300005440 Ga0070705_100018219 Ga0070705_1000182193 62
147 3300005440 Ga0070705_100049436 Ga0070705_1000494363 62
148 3300005440 Ga0070705_100051447 Ga0070705_1000514471 62
149 3300005440 Ga0070705_100054300 Ga0070705_1000543002 62
150 3300005440 Ga0070705_100524476 Ga0070705_1005244762 62
151 3300005440 Ga0070705_100631361 Ga0070705_1006313611 62
152 3300005441 Ga0070700_100834854 Ga0070700_1008348541 62
153 3300005441 Ga0070700_101284512 Ga0070700_1012845121 62
154 3300005444 Ga0070694_100000758 Ga0070694_1000007583 62
155 3300005444 Ga0070694_100004529 Ga0070694_1000045298 62
156 3300005444 Ga0070694_100012156 Ga0070694_1000121564 62
157 3300005444 Ga0070694_100405344 Ga0070694_1004053442 62
158 3300005444 Ga0070694_100621181 Ga0070694_1006211812 62
159 3300005444 Ga0070694_100779407 Ga0070694_1007794071 62
160 3300005444 Ga0070694_100785232 Ga0070694_1007852321 62
161 3300005445 Ga0070708_100030979 Ga0070708_1000309795 62
162 3300005445 Ga0070708_100037363 Ga0070708_1000373634 62
163 3300005445 Ga0070708_100160636 Ga0070708_1001606362 62
164 3300005445 Ga0070708_100236987 Ga0070708_1002369871 62
165 3300005445 Ga0070708_100325665 Ga0070708_1003256652 62
166 3300005445 Ga0070708_100527572 Ga0070708_1005275722 62
167 3300005445 Ga0070708_100883351 Ga0070708_1008833511 62
168 3300005445 Ga0070708_101754478 Ga0070708_1017544782 62
169 3300005445 Ga0070708_102075156 Ga0070708_1020751561 62
170 3300005455 Ga0070663_100013971 Ga0070663_1000139714 62
171 3300005455 Ga0070663_100076133 Ga0070663_1000761332 62
172 3300005456 Ga0070678_100045303 Ga0070678_1000453033 62
173 3300005456 Ga0070678_100762820 Ga0070678_1007628202 62
174 3300005457 Ga0070662_100006301 Ga0070662_1000063016 62
175 3300005457 Ga0070662_100072724 Ga0070662_1000727242 62
176 3300005457 Ga0070662_100078017 Ga0070662_1000780174 62
177 3300005457 Ga0070662_100344527 Ga0070662_1003445272 62
178 3300005457 Ga0070662_101788583 Ga0070662_1017885831 62
179 3300005458 Ga0070681_10000049 Ga0070681_1000004968 62
180 3300005458 Ga0070681_10031207 Ga0070681_100312074 62
181 3300005458 Ga0070681_10093480 Ga0070681_100934802 62
182 3300005458 Ga0070681_10300789 Ga0070681_103007892 62
183 3300005458 Ga0070681_10306625 Ga0070681_103066251 62
184 3300005458 Ga0070681_10345291 Ga0070681_103452911 62
185 3300005458 Ga0070681_10384050 Ga0070681_103840502 62
186 3300005458 Ga0070681_10557517 Ga0070681_105575172 62
187 3300005458 Ga0070681_10753527 Ga0070681_107535272 62
188 3300005458 Ga0070681_11219084 Ga0070681_112190841 62
189 3300005459 Ga0068867_100006250 Ga0068867_1000062507 62
190 3300005459 Ga0068867_100045512 Ga0068867_1000455124 62
191 3300005459 Ga0068867_100067037 Ga0068867_1000670372 62
192 3300005459 Ga0068867_100092127 Ga0068867_1000921271 62
193 3300005459 Ga0068867_100138524 Ga0068867_1001385243 62
194 3300005466 Ga0070685_10037976 Ga0070685_100379764 62
195 3300005466 Ga0070685_10546377 Ga0070685_105463772 62
196 3300005467 Ga0070706_100052747 Ga0070706_1000527472 62
197 3300005467 Ga0070706_100064589 Ga0070706_1000645892 62
198 3300005467 Ga0070706_100134914 Ga0070706_1001349142 62
199 3300005467 Ga0070706_100303431 Ga0070706_1003034311 62
200 3300005467 Ga0070706_100489498 Ga0070706_1004894982 62
201 3300005467 Ga0070706_100773818 Ga0070706_1007738182 62
202 3300005467 Ga0070706_100891251 Ga0070706_1008912511 62
203 3300005467 Ga0070706_101448583 Ga0070706_1014485832 62
204 3300005468 Ga0070707_100041460 Ga0070707_1000414601 62
205 3300005468 Ga0070707_100046260 Ga0070707_1000462602 62
206 3300005468 Ga0070707_100142023 Ga0070707_1001420232 62
207 3300005468 Ga0070707_100147765 Ga0070707_1001477652 62
208 3300005468 Ga0070707_100156849 Ga0070707_1001568493 62
209 3300005468 Ga0070707_100228679 Ga0070707_1002286793 62
210 3300005468 Ga0070707_100273772 Ga0070707_1002737722 62
211 3300005468 Ga0070707_100351472 Ga0070707_1003514723 62
212 3300005468 Ga0070707_100534165 Ga0070707_1005341652 62
213 3300005468 Ga0070707_100773465 Ga0070707_1007734652 62
214 3300005471 Ga0070698_100073943 Ga0070698_1000739434 62
215 3300005471 Ga0070698_100081517 Ga0070698_1000815174 62
216 3300005471 Ga0070698_100156046 Ga0070698_1001560464 62
217 3300005471 Ga0070698_100488118 Ga0070698_1004881183 62
218 3300005518 Ga0070699_100015236 Ga0070699_1000152366 62
219 3300005518 Ga0070699_100024343 Ga0070699_1000243436 62
220 3300005518 Ga0070699_100031808 Ga0070699_1000318082 62
221 3300005518 Ga0070699_100087879 Ga0070699_1000878792 62
222 3300005518 Ga0070699_100180595 Ga0070699_1001805953 62
223 3300005518 Ga0070699_100280425 Ga0070699_1002804252 62
224 3300005518 Ga0070699_100414717 Ga0070699_1004147172 62
225 3300005518 Ga0070699_100484254 Ga0070699_1004842541 62
226 3300005518 Ga0070699_100543444 Ga0070699_1005434442 62
227 3300005518 Ga0070699_100901548 Ga0070699_1009015481 62
228 3300005518 Ga0070699_100932255 Ga0070699_1009322552 62
229 3300005530 Ga0070679_100010981 Ga0070679_1000109813 62
230 3300005530 Ga0070679_100016005 Ga0070679_1000160052 62
231 3300005530 Ga0070679_100032821 Ga0070679_1000328214 62
232 3300005530 Ga0070679_100121256 Ga0070679_1001212563 62
233 3300005530 Ga0070679_100317595 Ga0070679_1003175951 62
234 3300005530 Ga0070679_100545269 Ga0070679_1005452692 62
235 3300005530 Ga0070679_100823282 Ga0070679_1008232822 62
236 3300005530 Ga0070679_100898779 Ga0070679_1008987791 62
237 3300005530 Ga0070679_101225210 Ga0070679_1012252102 62
238 3300005535 Ga0070684_100003237 Ga0070684_1000032377 62
239 3300005535 Ga0070684_100017079 Ga0070684_1000170792 62
240 3300005535 Ga0070684_100019566 Ga0070684_1000195666 62
241 3300005535 Ga0070684_100038467 Ga0070684_1000384673 62
242 3300005536 Ga0070697_100002024 Ga0070697_10000202416 62
243 3300005536 Ga0070697_100008817 Ga0070697_1000088174 62
244 3300005536 Ga0070697_100059567 Ga0070697_1000595674 62
245 3300005536 Ga0070697_100086515 Ga0070697_1000865152 62
246 3300005536 Ga0070697_100167675 Ga0070697_1001676752 62
247 3300005536 Ga0070697_100178520 Ga0070697_1001785201 62
248 3300005536 Ga0070697_100306883 Ga0070697_1003068832 62
249 3300005536 Ga0070697_100431897 Ga0070697_1004318973 62
250 3300005536 Ga0070697_100478343 Ga0070697_1004783431 62
251 3300005536 Ga0070697_100617582 Ga0070697_1006175821 62
252 3300005536 Ga0070697_101167728 Ga0070697_1011677281 62
253 3300005536 Ga0070697_101507375 Ga0070697_1015073752 62
254 3300005536 Ga0070697_101758029 Ga0070697_1017580292 62
255 3300005539 Ga0068853_100001362 Ga0068853_10000136217 62
256 3300005539 Ga0068853_100009355 Ga0068853_1000093553 62
257 3300005539 Ga0068853_100045276 Ga0068853_1000452763 62
258 3300005539 Ga0068853_100209570 Ga0068853_1002095702 62
259 3300005539 Ga0068853_100238266 Ga0068853_1002382662 62
260 3300005539 Ga0068853_101503431 Ga0068853_1015034312 62
261 3300005539 Ga0068853_102277838 Ga0068853_1022778382 62
262 3300005543 Ga0070672_100273511 Ga0070672_1002735113 62
263 3300005543 Ga0070672_100654159 Ga0070672_1006541592 62
264 3300005544 Ga0070686_100199398 Ga0070686_1001993983 62
265 3300005544 Ga0070686_101285714 Ga0070686_1012857142 62
266 3300005545 Ga0070695_100001464 Ga0070695_1000014648 62
267 3300005545 Ga0070695_100002045 Ga0070695_1000020451 62
268 3300005545 Ga0070695_100003725 Ga0070695_1000037252 62
269 3300005545 Ga0070695_100057401 Ga0070695_1000574013 62
270 3300005545 Ga0070695_100880859 Ga0070695_1008808592 62
271 3300005545 Ga0070695_101421262 Ga0070695_1014212621 62
272 3300005546 Ga0070696_100004074 Ga0070696_10000407412 62
273 3300005546 Ga0070696_100043583 Ga0070696_1000435833 62
274 3300005546 Ga0070696_100125285 Ga0070696_1001252853 62
275 3300005546 Ga0070696_100277587 Ga0070696_1002775873 62
276 3300005546 Ga0070696_100310312 Ga0070696_1003103122 62
277 3300005546 Ga0070696_100674362 Ga0070696_1006743622 62
278 3300005547 Ga0070693_100000325 Ga0070693_1000003257 62
279 3300005547 Ga0070693_100022242 Ga0070693_1000222424 62
280 3300005547 Ga0070693_100114053 Ga0070693_1001140533 62
281 3300005547 Ga0070693_100318921 Ga0070693_1003189211 62
282 3300005547 Ga0070693_100330005 Ga0070693_1003300053 62
283 3300005548 Ga0070665_100095438 Ga0070665_1000954385 62
284 3300005548 Ga0070665_100138558 Ga0070665_1001385583 62
285 3300005548 Ga0070665_100251379 Ga0070665_1002513792 62
286 3300005548 Ga0070665_101658729 Ga0070665_1016587292 62
287 3300005549 Ga0070704_100085995 Ga0070704_1000859952 62
288 3300005549 Ga0070704_100125505 Ga0070704_1001255052 62
289 3300005549 Ga0070704_100168418 Ga0070704_1001684183 62
290 3300005549 Ga0070704_100242137 Ga0070704_1002421372 62
291 3300005549 Ga0070704_101042207 Ga0070704_1010422071 62
292 3300005549 Ga0070704_102238146 Ga0070704_1022381461 62
293 3300005563 Ga0068855_100000397 Ga0068855_10000039721 62
294 3300005563 Ga0068855_100033033 Ga0068855_1000330332 62
295 3300005563 Ga0068855_100042404 Ga0068855_1000424045 62
296 3300005563 Ga0068855_100120875 Ga0068855_1001208752 62
297 3300005563 Ga0068855_100464676 Ga0068855_1004646763 62
298 3300005563 Ga0068855_101807250 Ga0068855_1018072501 62
299 3300005563 Ga0068855_102080773 Ga0068855_1020807732 62
300 3300005563 Ga0068855_102114808 Ga0068855_1021148082 62
301 3300005563 Ga0068855_102421408 Ga0068855_1024214081 62
302 3300005564 Ga0070664_100000468 Ga0070664_10000046826 62
303 3300005564 Ga0070664_100043549 Ga0070664_1000435494 62
304 3300005564 Ga0070664_100082370 Ga0070664_1000823703 62
305 3300005564 Ga0070664_100127967 Ga0070664_1001279673 62
306 3300005577 Ga0068857_100000474 Ga0068857_10000047411 62
307 3300005577 Ga0068857_100011453 Ga0068857_1000114533 62
308 3300005577 Ga0068857_100014168 Ga0068857_1000141683 62
309 3300005577 Ga0068857_100061177 Ga0068857_1000611773 62
310 3300005577 Ga0068857_100486882 Ga0068857_1004868821 62
311 3300005577 Ga0068857_101017927 Ga0068857_1010179272 62
312 3300005578 Ga0068854_100000353 Ga0068854_10000035318 62
313 3300005578 Ga0068854_100037036 Ga0068854_1000370364 62
314 3300005578 Ga0068854_100054791 Ga0068854_1000547913 62
315 3300005578 Ga0068854_100209085 Ga0068854_1002090852 62
316 3300005578 Ga0068854_100210627 Ga0068854_1002106273 62
317 3300005578 Ga0068854_100426306 Ga0068854_1004263061 62
318 3300005614 Ga0068856_100000475 Ga0068856_10000047526 62
319 3300005614 Ga0068856_100003466 Ga0068856_1000034665 62
320 3300005614 Ga0068856_100021766 Ga0068856_1000217662 62
321 3300005614 Ga0068856_100086827 Ga0068856_1000868274 62
322 3300005614 Ga0068856_101783989 Ga0068856_1017839892 62
323 3300005614 Ga0068856_102372466 Ga0068856_1023724661 62
324 3300005615 Ga0070702_100462419 Ga0070702_1004624193 62
325 3300005615 Ga0070702_100635949 Ga0070702_1006359492 62
326 3300005616 Ga0068852_100053578 Ga0068852_1000535783 62
327 3300005616 Ga0068852_100085266 Ga0068852_1000852663 62
328 3300005616 Ga0068852_100676904 Ga0068852_1006769042 62
329 3300005616 Ga0068852_101951648 Ga0068852_1019516481 62
330 3300005617 Ga0068859_100000610 Ga0068859_10000061020 62
331 3300005617 Ga0068859_100002575 Ga0068859_10000257519 62
332 3300005617 Ga0068859_100028604 Ga0068859_1000286043 62
333 3300005617 Ga0068859_100184913 Ga0068859_1001849133 62
334 3300005617 Ga0068859_100208042 Ga0068859_1002080422 62
335 3300005617 Ga0068859_100214834 Ga0068859_1002148342 62
336 3300005617 Ga0068859_101388817 Ga0068859_1013888172 62
337 3300005617 Ga0068859_102081566 Ga0068859_1020815662 62
338 3300005618 Ga0068864_100000254 Ga0068864_10000025420 62
339 3300005618 Ga0068864_100157963 Ga0068864_1001579632 62
340 3300005618 Ga0068864_100794644 Ga0068864_1007946441 62
341 3300005718 Ga0068866_10016681 Ga0068866_100166814 62
342 3300005718 Ga0068866_10027467 Ga0068866_100274672 62
343 3300005718 Ga0068866_10298050 Ga0068866_102980502 62
344 3300005719 Ga0068861_100033261 Ga0068861_1000332616 62
345 3300005719 Ga0068861_100081024 Ga0068861_1000810243 62
346 3300005719 Ga0068861_100132403 Ga0068861_1001324032 62
347 3300005719 Ga0068861_100239767 Ga0068861_1002397672 62
348 3300005834 Ga0068851_10125339 Ga0068851_101253393 62
349 3300005834 Ga0068851_10221315 Ga0068851_102213152 62
350 3300005840 Ga0068870_10001907 Ga0068870_100019073 62
351 3300005840 Ga0068870_10025433 Ga0068870_100254332 62
352 3300005840 Ga0068870_10619510 Ga0068870_106195102 62
353 3300005841 Ga0068863_100007896 Ga0068863_1000078963 62
354 3300005841 Ga0068863_100025704 Ga0068863_1000257046 62
355 3300005841 Ga0068863_100135541 Ga0068863_1001355413 62
356 3300005841 Ga0068863_100286444 Ga0068863_1002864442 62
357 3300005841 Ga0068863_100292226 Ga0068863_1002922262 62
358 3300005841 Ga0068863_100313048 Ga0068863_1003130484 62
359 3300005841 Ga0068863_100700374 Ga0068863_1007003743 62
360 3300005842 Ga0068858_100002296 Ga0068858_10000229618 62
361 3300005842 Ga0068858_100059167 Ga0068858_1000591674 62
362 3300005842 Ga0068858_100139449 Ga0068858_1001394493 62
363 3300005842 Ga0068858_100158022 Ga0068858_1001580223 62
364 3300005842 Ga0068858_100416577 Ga0068858_1004165772 62
365 3300005842 Ga0068858_100705093 Ga0068858_1007050931 62
366 3300005842 Ga0068858_100933324 Ga0068858_1009333242 62
367 3300005843 Ga0068860_100004896 Ga0068860_1000048961 62
368 3300005843 Ga0068860_100047220 Ga0068860_1000472204 62
369 3300005843 Ga0068860_100074193 Ga0068860_1000741933 62
370 3300005843 Ga0068860_100192621 Ga0068860_1001926213 62
371 3300005843 Ga0068860_100193740 Ga0068860_1001937402 62
372 3300005843 Ga0068860_100318712 Ga0068860_1003187122 62
373 3300005843 Ga0068860_100433184 Ga0068860_1004331841 62
374 3300005843 Ga0068860_100687079 Ga0068860_1006870792 62
375 3300005843 Ga0068860_101333512 Ga0068860_1013335122 62
376 3300005843 Ga0068860_101364035 Ga0068860_1013640352 62
377 3300005844 Ga0068862_100036298 Ga0068862_1000362986 62
378 3300005844 Ga0068862_100047247 Ga0068862_1000472474 62
379 3300005844 Ga0068862_100050690 Ga0068862_1000506902 62
380 3300005844 Ga0068862_100051172 Ga0068862_1000511724 62
381 3300005844 Ga0068862_100231353 Ga0068862_1002313533 62
382 3300005844 Ga0068862_100417647 Ga0068862_1004176471 62
383 3300005844 Ga0068862_100762560 Ga0068862_1007625602 62
384 3300005844 Ga0068862_101612735 Ga0068862_1016127351 62
385 3300005937 Ga0081455_10067085 Ga0081455_100670853 62
386 3300005937 Ga0081455_10080439 Ga0081455_100804392 62
387 3300005937 Ga0081455_10498329 Ga0081455_104983291 62
388 3300005981 Ga0081538_10006559 Ga0081538_100065593 62
389 3300005983 Ga0081540_1023348 Ga0081540_10233483 62
390 3300005983 Ga0081540_1047673 Ga0081540_10476732 62
391 3300006028 Ga0070717_10000962 Ga0070717_100009625 62
392 3300006028 Ga0070717_10001900 Ga0070717_100019005 62
393 3300006028 Ga0070717_10004828 Ga0070717_100048286 62
394 3300006028 Ga0070717_10014769 Ga0070717_100147692 62
395 3300006028 Ga0070717_10073416 Ga0070717_100734164 62
396 3300006028 Ga0070717_10187116 Ga0070717_101871164 62
397 3300006028 Ga0070717_10331915 Ga0070717_103319152 62
398 3300006028 Ga0070717_11613848 Ga0070717_116138482 62
399 3300006028 Ga0070717_11883817 Ga0070717_118838171 62
400 3300006058 Ga0075432_10201831 Ga0075432_102018312 62
401 3300006163 Ga0070715_10035877 Ga0070715_100358773 62
402 3300006163 Ga0070715_10126718 Ga0070715_101267183 62
403 3300006163 Ga0070715_10385128 Ga0070715_103851282 62
404 3300006173 Ga0070716_100002702 Ga0070716_1000027029 62
405 3300006173 Ga0070716_100087343 Ga0070716_1000873431 62
406 3300006173 Ga0070716_100131091 Ga0070716_1001310912 62
407 3300006173 Ga0070716_100350917 Ga0070716_1003509171 62
408 3300006173 Ga0070716_100393190 Ga0070716_1003931902 62
409 3300006173 Ga0070716_100929509 Ga0070716_1009295092 62
410 3300006173 Ga0070716_101146886 Ga0070716_1011468861 62
411 3300006173 Ga0070716_101673684 Ga0070716_1016736841 62
412 3300006175 Ga0070712_100001521 Ga0070712_1000015216 62
413 3300006175 Ga0070712_100006037 Ga0070712_1000060378 62
414 3300006175 Ga0070712_100093001 Ga0070712_1000930012 62
415 3300006175 Ga0070712_100226384 Ga0070712_1002263842 62
416 3300006175 Ga0070712_100561451 Ga0070712_1005614512 62
417 3300006175 Ga0070712_100683559 Ga0070712_1006835591 62
418 3300006237 Ga0097621_100016488 Ga0097621_1000164884 62
419 3300006237 Ga0097621_100021907 Ga0097621_1000219073 62
420 3300006237 Ga0097621_100037196 Ga0097621_1000371965 62
421 3300006237 Ga0097621_100200954 Ga0097621_1002009542 62
422 3300006237 Ga0097621_101600454 Ga0097621_1016004541 62
423 3300006358 Ga0068871_100001677 Ga0068871_1000016773 62
424 3300006358 Ga0068871_100016064 Ga0068871_1000160645 62
425 3300006358 Ga0068871_100056014 Ga0068871_1000560144 62
426 3300006358 Ga0068871_100263617 Ga0068871_1002636173 62
427 3300006358 Ga0068871_100939352 Ga0068871_1009393522 62
428 3300006844 Ga0075428_100018251 Ga0075428_1000182512 62
429 3300006844 Ga0075428_100189398 Ga0075428_1001893982 62
430 3300006844 Ga0075428_100351045 Ga0075428_1003510452 62
431 3300006844 Ga0075428_100789867 Ga0075428_1007898672 62
432 3300006846 Ga0075430_100292378 Ga0075430_1002923782 62
433 3300006846 Ga0075430_101623503 Ga0075430_1016235031 62
434 3300006847 Ga0075431_100004465 Ga0075431_1000044652 62
435 3300006847 Ga0075431_100072796 Ga0075431_1000727963 62
436 3300006847 Ga0075431_102012259 Ga0075431_1020122591 62
437 3300006852 Ga0075433_10002435 Ga0075433_1000243516 62
438 3300006852 Ga0075433_10019734 Ga0075433_100197342 62
439 3300006852 Ga0075433_10031282 Ga0075433_100312825 62
440 3300006852 Ga0075433_10052378 Ga0075433_100523783 62
441 3300006852 Ga0075433_11951929 Ga0075433_119519291 62
442 3300006871 Ga0075434_100008438 Ga0075434_1000084384 62
443 3300006871 Ga0075434_100011622 Ga0075434_1000116225 62
444 3300006871 Ga0075434_100044987 Ga0075434_1000449872 62
445 3300006871 Ga0075434_100064385 Ga0075434_1000643854 62
446 3300006871 Ga0075434_100230258 Ga0075434_1002302582 62
447 3300006871 Ga0075434_100453317 Ga0075434_1004533172 62
448 3300006871 Ga0075434_101225506 Ga0075434_1012255062 62
449 3300006871 Ga0075434_101234983 Ga0075434_1012349832 62
450 3300006871 Ga0075434_101700812 Ga0075434_1017008122 62
451 3300006880 Ga0075429_100004231 Ga0075429_1000042314 62
452 3300006880 Ga0075429_100069584 Ga0075429_1000695842 62
453 3300006880 Ga0075429_100610590 Ga0075429_1006105902 62
454 3300006881 Ga0068865_100005497 Ga0068865_1000054977 62
455 3300006881 Ga0068865_100072574 Ga0068865_1000725742 62
456 3300006881 Ga0068865_100237746 Ga0068865_1002377462 62
457 3300006881 Ga0068865_100555537 Ga0068865_1005555372 62
458 3300006881 Ga0068865_101152444 Ga0068865_1011524442 62
459 3300006881 Ga0068865_101844124 Ga0068865_1018441241 62
460 3300006914 Ga0075436_100025990 Ga0075436_1000259904 62
461 3300006914 Ga0075436_100078023 Ga0075436_1000780232 62
462 3300006914 Ga0075436_100090721 Ga0075436_1000907212 62
463 3300006914 Ga0075436_100165673 Ga0075436_1001656732 62
464 3300006931 Ga0097620_100000610 Ga0097620_10000061020 62
465 3300006931 Ga0097620_100002575 Ga0097620_10000257519 62
466 3300006931 Ga0097620_100028602 Ga0097620_1000286023 62
467 3300006931 Ga0097620_100184910 Ga0097620_1001849103 62
468 3300006931 Ga0097620_100208042 Ga0097620_1002080422 62
469 3300006931 Ga0097620_100214821 Ga0097620_1002148212 62
470 3300006931 Ga0097620_101388779 Ga0097620_1013887792 62
471 3300006931 Ga0097620_102081574 Ga0097620_1020815742 62
472 3300007076 Ga0075435_100034942 Ga0075435_1000349422 62
473 3300007076 Ga0075435_100698580 Ga0075435_1006985802 62
474 3300007076 Ga0075435_101704959 Ga0075435_1017049591 62
475 3300007265 Ga0099794_10125645 Ga0099794_101256452 62
476 3300007265 Ga0099794_10273023 Ga0099794_102730232 62
477 3300007788 Ga0099795_10607814 Ga0099795_106078142 62
478 3300009093 Ga0105240_10000631 Ga0105240_1000063137 62
479 3300009093 Ga0105240_10286085 Ga0105240_102860853 62
480 3300009093 Ga0105240_10361418 Ga0105240_103614181 62
481 3300009093 Ga0105240_10443611 Ga0105240_104436113 62
482 3300009093 Ga0105240_10660850 Ga0105240_106608502 62
483 3300009093 Ga0105240_11507845 Ga0105240_115078452 62
484 3300009094 Ga0111539_10000370 Ga0111539_1000037016 62
485 3300009094 Ga0111539_10282400 Ga0111539_102824002 62
486 3300009094 Ga0111539_11549685 Ga0111539_115496851 62
487 3300009098 Ga0105245_10014746 Ga0105245_100147462 62
488 3300009098 Ga0105245_10570905 Ga0105245_105709052 62
489 3300009101 Ga0105247_10146799 Ga0105247_101467992 62
490 3300009101 Ga0105247_10270397 Ga0105247_102703972 62
491 3300009101 Ga0105247_10321849 Ga0105247_103218491 62
492 3300009101 Ga0105247_10750871 Ga0105247_107508712 62
493 3300009147 Ga0114129_10042842 Ga0114129_100428424 62
494 3300009147 Ga0114129_10098402 Ga0114129_100984025 62
495 3300009147 Ga0114129_10158670 Ga0114129_101586702 62
496 3300009147 Ga0114129_10209010 Ga0114129_102090102 62
497 3300009147 Ga0114129_10514167 Ga0114129_105141672 62
498 3300009147 Ga0114129_10998282 Ga0114129_109982822 62
499 3300009148 Ga0105243_10128102 Ga0105243_101281022 62
500 3300009148 Ga0105243_10788243 Ga0105243_107882431 62
501 3300009148 Ga0105243_11150977 Ga0105243_111509772 62
502 3300009148 Ga0105243_12332465 Ga0105243_123324652 62
503 3300009174 Ga0105241_10000218 Ga0105241_1000021817 62
504 3300009174 Ga0105241_10622006 Ga0105241_106220062 62
505 3300009174 Ga0105241_10981328 Ga0105241_109813281 62
506 3300009174 Ga0105241_11064906 Ga0105241_110649061 62
507 3300009174 Ga0105241_11107263 Ga0105241_111072632 62
508 3300009174 Ga0105241_11346610 Ga0105241_113466102 62
509 3300009176 Ga0105242_10301640 Ga0105242_103016402 62
510 3300009176 Ga0105242_10531097 Ga0105242_105310971 62
511 3300009176 Ga0105242_10625792 Ga0105242_106257922 62
512 3300009176 Ga0105242_10716087 Ga0105242_107160872 62
513 3300009176 Ga0105242_11483690 Ga0105242_114836901 62
514 3300009177 Ga0105248_10000003 Ga0105248_10000003736 62
515 3300009177 Ga0105248_10059326 Ga0105248_100593265 62
516 3300009177 Ga0105248_10206787 Ga0105248_102067873 62
517 3300009177 Ga0105248_10437759 Ga0105248_104377591 62
518 3300009177 Ga0105248_10486124 Ga0105248_104861242 62
519 3300009177 Ga0105248_10490679 Ga0105248_104906792 62
520 3300009177 Ga0105248_10758461 Ga0105248_107584612 62
521 3300009177 Ga0105248_11534571 Ga0105248_115345713 62
522 3300009177 Ga0105248_11980191 Ga0105248_119801911 62
523 3300009545 Ga0105237_10038178 Ga0105237_100381783 62
524 3300009545 Ga0105237_10135744 Ga0105237_101357443 62
525 3300009545 Ga0105237_10859458 Ga0105237_108594582 62
526 3300009545 Ga0105237_11037160 Ga0105237_110371601 62
527 3300009545 Ga0105237_12185466 Ga0105237_121854661 62
528 3300009545 Ga0105237_12364970 Ga0105237_123649702 62
529 3300009551 Ga0105238_10000330 Ga0105238_100003304 62
530 3300009551 Ga0105238_10375897 Ga0105238_103758972 62
531 3300009551 Ga0105238_11075153 Ga0105238_110751532 62
532 3300009551 Ga0105238_11728110 Ga0105238_117281102 62
533 3300009551 Ga0105238_12923362 Ga0105238_129233621 62
534 3300009553 Ga0105249_10045686 Ga0105249_100456862 62
535 3300009553 Ga0105249_10081138 Ga0105249_100811382 62
536 3300009553 Ga0105249_10808275 Ga0105249_108082752 62
537 3300009553 Ga0105249_11319496 Ga0105249_113194962 62
538 3300009553 Ga0105249_12237989 Ga0105249_122379892 62
539 3300009553 Ga0105249_12515443 Ga0105249_125154432 62
540 3300010159 Ga0099796_10577339 Ga0099796_105773392 62
541 3300010375 Ga0105239_10017447 Ga0105239_100174473 62
542 3300010375 Ga0105239_10136702 Ga0105239_101367023 62
543 3300010375 Ga0105239_10490350 Ga0105239_104903502 62
544 3300010375 Ga0105239_11237154 Ga0105239_112371542 62
545 3300010375 Ga0105239_11763757 Ga0105239_117637572 62
546 3300010375 Ga0105239_13635464 Ga0105239_136354642 62
547 3300011119 Ga0105246_10100913 Ga0105246_101009132 62
548 3300011119 Ga0105246_10141582 Ga0105246_101415823 62
549 3300011119 Ga0105246_10894702 Ga0105246_108947021 62
550 3300011119 Ga0105246_10944710 Ga0105246_109447101 62
551 3300013100 Ga0157373_10007747 Ga0157373_100077478 62
552 3300013100 Ga0157373_10278390 Ga0157373_102783902 62
553 3300013100 Ga0157373_10377827 Ga0157373_103778272 62
554 3300013100 Ga0157373_10522220 Ga0157373_105222202 62
555 3300013100 Ga0157373_10977092 Ga0157373_109770921 62
556 3300013102 Ga0157371_10104300 Ga0157371_101043003 62
557 3300013102 Ga0157371_10528594 Ga0157371_105285942 62
558 3300013102 Ga0157371_10715378 Ga0157371_107153782 62
559 3300013102 Ga0157371_11253077 Ga0157371_112530771 62
560 3300013104 Ga0157370_10297526 Ga0157370_102975262 62
561 3300013104 Ga0157370_11124992 Ga0157370_111249922 62
562 3300013104 Ga0157370_11708890 Ga0157370_117088902 62
563 3300013105 Ga0157369_10000860 Ga0157369_1000086024 62
564 3300013105 Ga0157369_10036835 Ga0157369_100368355 62
565 3300013105 Ga0157369_10038485 Ga0157369_100384855 62
566 3300013105 Ga0157369_10039385 Ga0157369_100393851 62
567 3300013105 Ga0157369_10042353 Ga0157369_100423535 62
568 3300013105 Ga0157369_10057516 Ga0157369_100575165 62
569 3300013105 Ga0157369_10091723 Ga0157369_100917232 62
570 3300013105 Ga0157369_10475544 Ga0157369_104755442 62
571 3300013105 Ga0157369_10648666 Ga0157369_106486662 62
572 3300013105 Ga0157369_10718574 Ga0157369_107185742 62
573 3300013105 Ga0157369_10744943 Ga0157369_107449432 62
574 3300013105 Ga0157369_11275170 Ga0157369_112751702 62
575 3300013105 Ga0157369_11901950 Ga0157369_119019502 62
576 3300013296 Ga0157374_10000623 Ga0157374_1000062330 62
577 3300013296 Ga0157374_10001096 Ga0157374_100010968 62
578 3300013296 Ga0157374_10068368 Ga0157374_100683683 62
579 3300013296 Ga0157374_10207287 Ga0157374_102072874 62
580 3300013296 Ga0157374_11343491 Ga0157374_113434912 62
581 3300013297 Ga0157378_10001737 Ga0157378_1000173717 62
582 3300013297 Ga0157378_10004369 Ga0157378_100043693 62
583 3300013297 Ga0157378_10095679 Ga0157378_100956792 62
584 3300013297 Ga0157378_10562822 Ga0157378_105628222 62
585 3300013297 Ga0157378_11334226 Ga0157378_113342263 62
586 3300013297 Ga0157378_12571293 Ga0157378_125712931 62
587 3300013306 Ga0163162_10001630 Ga0163162_1000163022 62
588 3300013306 Ga0163162_10225317 Ga0163162_102253174 62
589 3300013306 Ga0163162_10842400 Ga0163162_108424003 62
590 3300013306 Ga0163162_11506763 Ga0163162_115067632 62
591 3300013306 Ga0163162_11714965 Ga0163162_117149651 62
592 3300013306 Ga0163162_12114399 Ga0163162_121143991 62
593 3300013306 Ga0163162_12383620 Ga0163162_123836202 62
594 3300013306 Ga0163162_13095874 Ga0163162_130958741 62
595 3300013307 Ga0157372_10002736 Ga0157372_100027364 62
596 3300013307 Ga0157372_10006133 Ga0157372_100061333 62
597 3300013307 Ga0157372_10015841 Ga0157372_100158414 62
598 3300013307 Ga0157372_10034967 Ga0157372_100349671 62
599 3300013307 Ga0157372_10071734 Ga0157372_100717343 62
600 3300013307 Ga0157372_10139785 Ga0157372_101397851 62
601 3300013307 Ga0157372_10206201 Ga0157372_102062013 62
602 3300013307 Ga0157372_10470821 Ga0157372_104708212 62
603 3300013307 Ga0157372_10540767 Ga0157372_105407673 62
604 3300013307 Ga0157372_11024480 Ga0157372_110244802 62
605 3300013307 Ga0157372_11039895 Ga0157372_110398951 62
606 3300013308 Ga0157375_10258654 Ga0157375_102586542 62
607 3300013308 Ga0157375_10440063 Ga0157375_104400632 62
608 3300013308 Ga0157375_11030670 Ga0157375_110306702 62
609 3300013308 Ga0157375_11710345 Ga0157375_117103453 62
610 3300014325 Ga0163163_10203524 Ga0163163_102035242 62
611 3300014325 Ga0163163_10482239 Ga0163163_104822393 62
612 3300014325 Ga0163163_11221169 Ga0163163_112211692 62
613 3300014326 Ga0157380_10427492 Ga0157380_104274921 62
614 3300014326 Ga0157380_10950765 Ga0157380_109507651 62
615 3300014497 Ga0182008_10056847 Ga0182008_100568472 62
616 3300014745 Ga0157377_10039326 Ga0157377_100393262 62
617 3300014745 Ga0157377_10124565 Ga0157377_101245652 62
618 3300014968 Ga0157379_10025795 Ga0157379_100257954 62
619 3300014968 Ga0157379_10059338 Ga0157379_100593383 62
620 3300014968 Ga0157379_10103084 Ga0157379_101030842 62
621 3300014968 Ga0157379_10596177 Ga0157379_105961773 62
622 3300014969 Ga0157376_10133813 Ga0157376_101338131 62
623 3300014969 Ga0157376_10182867 Ga0157376_101828674 62
624 3300014969 Ga0157376_10261252 Ga0157376_102612522 62
625 3300014969 Ga0157376_10346467 Ga0157376_103464672 62
626 3300014969 Ga0157376_12108704 Ga0157376_121087042 62
627 3300015262 Ga0182007_10040446 Ga0182007_100404462 62
628 3300020081 Ga0206354_10273109 Ga0206354_102731092 62
629 3300020082 Ga0206353_11476773 Ga0206353_114767732 62
630 3300025885 Ga0207653_10039108 Ga0207653_100391082 62
631 3300025885 Ga0207653_10045081 Ga0207653_100450812 62
632 3300025885 Ga0207653_10087152 Ga0207653_100871521 62
633 3300025893 Ga0207682_10209462 Ga0207682_102094622 62
634 3300025898 Ga0207692_10287538 Ga0207692_102875381 62
635 3300025900 Ga0207710_10021562 Ga0207710_100215622 62
636 3300025904 Ga0207647_10215025 Ga0207647_102150252 62
637 3300025905 Ga0207685_10277766 Ga0207685_102777662 62
638 3300025906 Ga0207699_10187793 Ga0207699_101877931 62
639 3300025907 Ga0207645_10001324 Ga0207645_100013248 62
640 3300025907 Ga0207645_10192689 Ga0207645_101926891 62
641 3300025908 Ga0207643_10000157 Ga0207643_1000015723 62
642 3300025910 Ga0207684_10008133 Ga0207684_1000813310 62
643 3300025910 Ga0207684_10010283 Ga0207684_100102834 62
644 3300025910 Ga0207684_10014651 Ga0207684_100146516 62
645 3300025910 Ga0207684_10088487 Ga0207684_100884872 62
646 3300025910 Ga0207684_10170081 Ga0207684_101700813 62
647 3300025910 Ga0207684_10387218 Ga0207684_103872181 62
648 3300025910 Ga0207684_10423134 Ga0207684_104231342 62
649 3300025911 Ga0207654_10026891 Ga0207654_100268914 62
650 3300025911 Ga0207654_11059643 Ga0207654_110596432 62
651 3300025912 Ga0207707_10000258 Ga0207707_1000025832 62
652 3300025912 Ga0207707_10174070 Ga0207707_101740702 62
653 3300025912 Ga0207707_10582329 Ga0207707_105823292 62
654 3300025912 Ga0207707_11663668 Ga0207707_116636681 62
655 3300025913 Ga0207695_10006130 Ga0207695_100061303 62
656 3300025913 Ga0207695_10472289 Ga0207695_104722892 62
657 3300025914 Ga0207671_10241288 Ga0207671_102412883 62
658 3300025915 Ga0207693_10001303 Ga0207693_1000130319 62
659 3300025915 Ga0207693_10142219 Ga0207693_101422192 62
660 3300025916 Ga0207663_10052807 Ga0207663_100528072 62
661 3300025917 Ga0207660_10224521 Ga0207660_102245212 62
662 3300025917 Ga0207660_10414539 Ga0207660_104145392 62
663 3300025917 Ga0207660_11131258 Ga0207660_111312581 62
664 3300025918 Ga0207662_10080195 Ga0207662_100801951 62
665 3300025919 Ga0207657_10000373 Ga0207657_1000037318 62
666 3300025920 Ga0207649_10006286 Ga0207649_100062866 62
667 3300025921 Ga0207652_10004142 Ga0207652_100041422 62
668 3300025921 Ga0207652_10141140 Ga0207652_101411401 62
669 3300025922 Ga0207646_10004675 Ga0207646_1000467510 62
670 3300025922 Ga0207646_10044552 Ga0207646_100445525 62
671 3300025922 Ga0207646_10047209 Ga0207646_100472092 62
672 3300025922 Ga0207646_10051594 Ga0207646_100515944 62
673 3300025922 Ga0207646_10065789 Ga0207646_100657892 62
674 3300025922 Ga0207646_10105489 Ga0207646_101054893 62
675 3300025922 Ga0207646_10490945 Ga0207646_104909451 62
676 3300025923 Ga0207681_10088200 Ga0207681_100882003 62
677 3300025924 Ga0207694_11837595 Ga0207694_118375952 62
678 3300025925 Ga0207650_10076533 Ga0207650_100765333 62
679 3300025926 Ga0207659_10176184 Ga0207659_101761842 62
680 3300025927 Ga0207687_11484018 Ga0207687_114840181 62
681 3300025932 Ga0207690_10095350 Ga0207690_100953502 62
682 3300025933 Ga0207706_10001857 Ga0207706_100018572 62
683 3300025933 Ga0207706_10008929 Ga0207706_100089296 62
684 3300025933 Ga0207706_10864532 Ga0207706_108645321 62
685 3300025934 Ga0207686_10339234 Ga0207686_103392342 62
686 3300025934 Ga0207686_11157419 Ga0207686_111574192 62
687 3300025935 Ga0207709_10115773 Ga0207709_101157732 62
688 3300025935 Ga0207709_11127613 Ga0207709_111276132 62
689 3300025936 Ga0207670_10028434 Ga0207670_100284343 62
690 3300025936 Ga0207670_10036465 Ga0207670_100364654 62
691 3300025936 Ga0207670_11267801 Ga0207670_112678011 62
692 3300025938 Ga0207704_10384794 Ga0207704_103847942 62
693 3300025938 Ga0207704_10598929 Ga0207704_105989293 62
694 3300025939 Ga0207665_10005743 Ga0207665_100057433 62
695 3300025939 Ga0207665_10657713 Ga0207665_106577131 62
696 3300025940 Ga0207691_11411252 Ga0207691_114112522 62
697 3300025941 Ga0207711_11300423 Ga0207711_113004231 62
698 3300025942 Ga0207689_10000975 Ga0207689_100009754 62
699 3300025942 Ga0207689_10002812 Ga0207689_100028122 62
700 3300025944 Ga0207661_10257351 Ga0207661_102573512 62
701 3300025945 Ga0207679_10000779 Ga0207679_1000077917 62
702 3300025949 Ga0207667_10000857 Ga0207667_1000085728 62
703 3300025949 Ga0207667_10327367 Ga0207667_103273674 62
704 3300025949 Ga0207667_10977281 Ga0207667_109772812 62
705 3300025961 Ga0207712_10058438 Ga0207712_100584382 62
706 3300025961 Ga0207712_10274100 Ga0207712_102741002 62
707 3300025961 Ga0207712_10552620 Ga0207712_105526202 62
708 3300025981 Ga0207640_10032375 Ga0207640_100323752 62
709 3300025986 Ga0207658_11341873 Ga0207658_113418732 62
710 3300025986 Ga0207658_12040675 Ga0207658_120406752 62
711 3300026023 Ga0207677_10011276 Ga0207677_100112764 62
712 3300026035 Ga0207703_10199610 Ga0207703_101996102 62
713 3300026035 Ga0207703_10366062 Ga0207703_103660622 62
714 3300026035 Ga0207703_11318259 Ga0207703_113182591 62
715 3300026035 Ga0207703_11951730 Ga0207703_119517303 62
716 3300026041 Ga0207639_10042698 Ga0207639_100426982 62
717 3300026067 Ga0207678_10002143 Ga0207678_100021434 62
718 3300026075 Ga0207708_10089290 Ga0207708_100892902 62
719 3300026075 Ga0207708_10211569 Ga0207708_102115692 62
720 3300026075 Ga0207708_10415349 Ga0207708_104153491 62
721 3300026075 Ga0207708_10918024 Ga0207708_109180241 62
722 3300026078 Ga0207702_10001041 Ga0207702_1000104111 62
723 3300026088 Ga0207641_10110682 Ga0207641_101106822 62
724 3300026088 Ga0207641_10134689 Ga0207641_101346891 62
725 3300026088 Ga0207641_10470644 Ga0207641_104706441 62
726 3300026089 Ga0207648_10027225 Ga0207648_100272252 62
727 3300026089 Ga0207648_10513436 Ga0207648_105134361 62
728 3300026095 Ga0207676_10005775 Ga0207676_1000577511 62
729 3300026095 Ga0207676_10835249 Ga0207676_108352491 62
730 3300026116 Ga0207674_10008510 Ga0207674_100085102 62
731 3300026116 Ga0207674_10197920 Ga0207674_101979202 62
732 3300026118 Ga0207675_100028715 Ga0207675_1000287154 62
733 3300026118 Ga0207675_100041467 Ga0207675_1000414673 62
734 3300026118 Ga0207675_100241559 Ga0207675_1002415592 62
735 3300026142 Ga0207698_11209964 Ga0207698_112099641 62
736 3300027682 Ga0209971_1086318 Ga0209971_10863182 62
737 3300027876 Ga0209974_10080257 Ga0209974_100802572 62
738 3300027876 Ga0209974_10215543 Ga0209974_102155431 62
739 3300027907 Ga0207428_10000409 Ga0207428_1000040933 62
740 3300027907 Ga0207428_10055666 Ga0207428_100556663 62
741 3300028380 Ga0268265_10012391 Ga0268265_100123912 62
742 3300028380 Ga0268265_10039330 Ga0268265_100393302 62
743 3300028380 Ga0268265_10183974 Ga0268265_101839743 62
744 3300028380 Ga0268265_10613472 Ga0268265_106134722 62
745 3300028380 Ga0268265_11470376 Ga0268265_114703761 62
746 3300028381 Ga0268264_10020556 Ga0268264_100205561 62
747 3300028381 Ga0268264_10184885 Ga0268264_101848852 62
748 3300028381 Ga0268264_10279165 Ga0268264_102791652 62
749 3300028800 Ga0265338_10900391 Ga0265338_109003911 62
750 3300034816 Ga0373930_0037196 Ga0373930_0037196_196_387 62
751 3300034817 Ga0373948_0031154 Ga0373948_0031154_796_987 62
752 3300034820 Ga0373959_0010060 Ga0373959_0010060_390_581 62
753 3300035085 Ga0373929_0012726 Ga0373929_0012726_164_355 62
754 3300035086 Ga0373934_0152402 Ga0373934_0152402_369_560 62
755 3300035090 Ga0373949_0041100 Ga0373949_0041100_226_417 62
756 3300035090 Ga0373949_0214466 Ga0373949_0214466_340_531 62
757 3300035091 Ga0373951_0181220 Ga0373951_0181220_311_502 62
758 3300035092 Ga0373952_0163889 Ga0373952_0163889_309_500 62
759 3300035113 Ga0373936_0563372 Ga0373936_0563372_174_365 62
760 3300035115 Ga0373941_0307983 Ga0373941_0307983_280_471 62
761 3300035117 Ga0373953_0022081 Ga0373953_0022081_1293_1484 62
762 3300035119 Ga0373956_0167277 Ga0373956_0167277_605_796 62
763 3300035121 Ga0373960_0125478 Ga0373960_0125478_565_756 62
764 3300035241 Ga0373961_0023387 Ga0373961_0023387_1139_1330 62
765 3300035242 Ga0373962_0095026 Ga0373962_0095026_479_670 62
766 3300036712 Ga0316584_0721120 Ga0316584_0721120_70_261 62
767 3300037471 Ga0395905_0393256 Ga0395905_0393256_156_347 62
768 3300038996 Ga0242420_137901 Ga0242420_137901_30_221 62
769 3300039453 Ga0436362_0536511 Ga0436362_0536511_183_374 62
770 3300039453 Ga0436362_0750444 Ga0436362_0750444_2541_2768 62
771 3300042003 Ga0439443_103721 Ga0439443_103721_316_510 62
772 3300042005 Ga0439448_0123190 Ga0439448_0123190_216_407 62
773 3300042008 Ga0439450_019674 Ga0439450_019674_974_1165 62
774 3300042012 Ga0439455_0061480 Ga0439455_0061480_634_825 62
775 3300042118 Ga0450914_059757 Ga0450914_059757_270_461 62
776 3300042157 Ga0439458_0084944 Ga0439458_0084944_190_381 62
777 3300042438 Ga0439459_0015470 Ga0439459_0015470_768_959 62
778 3300042439 Ga0439464_0001377 Ga0439464_0001377_2879_3070 62
779 3300042439 Ga0439464_0287693 Ga0439464_0287693_289_480 62
780 3300042461 Ga0439460_0004434 Ga0439460_0004434_740_931 62
781 3300042461 Ga0439460_0098969 Ga0439460_0098969_357_551 62
782 3300042876 Ga0451577_0003197 Ga0451577_0003197_1602_1796 62
783 3300042876 Ga0451577_0017287 Ga0451577_0017287_6378_6569 62
784 3300042876 Ga0451577_0678249 Ga0451577_0678249_471_662 62
785 3300042876 Ga0451577_0888856 Ga0451577_0888856_142_333 62
786 3300042993 Ga0439440_0080245 Ga0439440_0080245_484_675 62
787 3300042993 Ga0439440_0111873 Ga0439440_0111873_512_703 62
788 3300042993 Ga0439440_0171081 Ga0439440_0171081_245_439 62
789 3300044673 Ga0453683_0032136 Ga0453683_0032136_1902_2096 62
790 3300044673 Ga0453683_0048690 Ga0453683_0048690_1997_2188 62
791 3300044694 Ga0466963_0255477 Ga0466963_0255477_695_886 62
792 3300044694 Ga0466963_0397232 Ga0466963_0397232_29_220 62
793 3300044712 Ga0453684_0051544 Ga0453684_0051544_1347_1541 62
794 3300044712 Ga0453684_0176401 Ga0453684_0176401_210_401 62
795 3300044712 Ga0453684_1756387 Ga0453684_1756387_164_355 62
796 3300045051 Ga0451576_0016285 Ga0451576_0016285_3586_3780 62
797 3300045051 Ga0451576_0021455 Ga0451576_0021455_441_632 62
798 3300045051 Ga0451576_0109256 Ga0451576_0109256_579_770 62
799 3300045051 Ga0451576_0374364 Ga0451576_0374364_1087_1278 62
800 3300045051 Ga0451576_1819223 Ga0451576_1819223_407_601 62
801 3300045836 Ga0466958_0362224 Ga0466958_0362224_14_205 62
802 3300045836 Ga0466958_0387879 Ga0466958_0387879_681_872 62
803 3300046455 Ga0495603_0151546 Ga0495603_0151546_15_206 62
804 3300046462 Ga0495651_0802509 Ga0495651_0802509_215_448 62
805 3300046472 Ga0495580_0142533 Ga0495580_0142533_324_548 62
806 3300046474 Ga0495605_0386270 Ga0495605_0386270_223_456 62
807 3300046476 Ga0495662_0188767 Ga0495662_0188767_93_326 62
808 3300046477 Ga0495664_0110358 Ga0495664_0110358_709_942 62
809 3300046491 Ga0495584_0105366 Ga0495584_0105366_895_1086 62
810 3300046499 Ga0495594_0185997 Ga0495594_0185997_243_467 62
811 3300046516 Ga0495628_0924417 Ga0495628_0924417_270_503 62
812 3300046528 Ga0495642_0040523 Ga0495642_0040523_25_249 62
813 3300046531 Ga0495665_0150775 Ga0495665_0150775_667_900 62
814 3300046531 Ga0495665_0280743 Ga0495665_0280743_30_254 62
815 3300046535 Ga0495586_0152297 Ga0495586_0152297_603_836 62
816 3300046536 Ga0495587_0549160 Ga0495587_0549160_208_441 62
817 3300046543 Ga0495645_0084383 Ga0495645_0084383_1881_2114 62
818 3300046674 Ga0495588_0153989 Ga0495588_0153989_485_709 62
819 3300046675 Ga0495657_0702546 Ga0495657_0702546_130_363 62
820 3300046678 Ga0495599_0625873 Ga0495599_0625873_182_415 62
821 3300046679 Ga0495623_0145129 Ga0495623_0145129_181_414 62
822 3300046684 Ga0495669_0172550 Ga0495669_0172550_97_330 62
823 3300046809 Ga0495600_0235295 Ga0495600_0235295_860_1093 62
824 3300047315 Ga0495581_0348250 Ga0495581_0348250_197_421 62
825 3300047315 Ga0495581_0701533 Ga0495581_0701533_188_421 62
826 3300047317 Ga0495604_0097872 Ga0495604_0097872_936_1169 62
827 3300047323 Ga0495683_0346110 Ga0495683_0346110_269_493 62
828 3300047444 Ga0495675_0236553 Ga0495675_0236553_84_317 62
829 3300047445 Ga0495677_0125595 Ga0495677_0125595_136_360 62
830 3300048088 Ga0495602_0906776 Ga0495602_0906776_190_423 62
831 3300048089 Ga0495614_0214934 Ga0495614_0214934_533_757 62
832 3300048905 Ga0496102_1182226 Ga0496102_1182226_158_349 62
833 3300048907 Ga0496104_0684301 Ga0496104_0684301_500_724 62
834 3300048907 Ga0496104_0969422 Ga0496104_0969422_430_621 62
835 3300048909 Ga0496106_0518118 Ga0496106_0518118_640_831 62
836 3300048910 Ga0496107_0602822 Ga0496107_0602822_411_602 62
837 3300048911 Ga0496108_0529524 Ga0496108_0529524_154_345 62
838 3300048911 Ga0496108_1750826 Ga0496108_1750826_108_332 62
839 3300048912 Ga0496109_0475554 Ga0496109_0475554_841_1032 62
840 3300048912 Ga0496109_0993790 Ga0496109_0993790_236_427 62
841 3300048913 Ga0496110_0876434 Ga0496110_0876434_348_539 62
842 3300048915 Ga0496112_0735378 Ga0496112_0735378_571_762 62
843 3300048915 Ga0496112_0993179 Ga0496112_0993179_130_354 62
844 3300048916 Ga0496113_0103521 Ga0496113_0103521_834_1025 62
845 3300048916 Ga0496113_1117253 Ga0496113_1117253_164_394 62
846 3300048916 Ga0496113_1350575 Ga0496113_1350575_61_252 62
847 3300048918 Ga0496115_0028275 Ga0496115_0028275_169_360 62
848 3300049569 Ga0501032_0271872 Ga0501032_0271872_377_568 62
849 3300049570 Ga0501033_0064984 Ga0501033_0064984_1995_2186 62
850 3300049570 Ga0501033_0260019 Ga0501033_0260019_171_362 62
851 3300049572 Ga0501036_0307362 Ga0501036_0307362_905_1096 62
852 3300049572 Ga0501036_0514743 Ga0501036_0514743_766_957 62
853 3300049572 Ga0501036_0629317 Ga0501036_0629317_281_472 62
854 3300049572 Ga0501036_1305803 Ga0501036_1305803_384_578 62
855 3300049574 Ga0501038_0150053 Ga0501038_0150053_297_488 62
856 3300049574 Ga0501038_0191815 Ga0501038_0191815_17_208 62
857 3300049575 Ga0501039_0079790 Ga0501039_0079790_1513_1704 62
858 3300049575 Ga0501039_0305461 Ga0501039_0305461_798_989 62
859 3300049576 Ga0501040_0003451 Ga0501040_0003451_89_280 62
860 3300049576 Ga0501040_0041964 Ga0501040_0041964_674_865 62
861 3300049576 Ga0501040_0136829 Ga0501040_0136829_581_772 62
862 3300049576 Ga0501040_0192808 Ga0501040_0192808_914_1105 62
863 3300049577 Ga0501041_0003300 Ga0501041_0003300_7487_7678 62
864 3300049577 Ga0501041_0233225 Ga0501041_0233225_945_1136 62
865 3300049578 Ga0501042_0009827 Ga0501042_0009827_5767_5958 62
866 3300049578 Ga0501042_0105895 Ga0501042_0105895_975_1166 62
867 3300049578 Ga0501042_1321187 Ga0501042_1321187_272_463 62
868 3300049579 Ga0501043_0188199 Ga0501043_0188199_961_1152 62
869 3300049579 Ga0501043_0276229 Ga0501043_0276229_473_664 62
870 3300049580 Ga0501046_0000607 Ga0501046_0000607_17756_17947 62
871 3300049580 Ga0501046_0073675 Ga0501046_0073675_382_573 62
872 3300049580 Ga0501046_0896204 Ga0501046_0896204_211_402 62
873 3300049582 Ga0501048_0189964 Ga0501048_0189964_176_367 62
874 3300049583 Ga0501067_0576000 Ga0501067_0576000_253_444 62
875 3300049584 Ga0501068_0318313 Ga0501068_0318313_237_428 62
876 3300049584 Ga0501068_0562728 Ga0501068_0562728_135_326 62
877 3300049585 Ga0501069_0138456 Ga0501069_0138456_1018_1209 62
878 3300049585 Ga0501069_0554619 Ga0501069_0554619_159_350 62
879 3300049587 Ga0501071_0247162 Ga0501071_0247162_978_1169 62
880 3300049587 Ga0501071_0626163 Ga0501071_0626163_621_812 62
881 3300049588 Ga0501072_0119308 Ga0501072_0119308_251_445 62
882 3300049588 Ga0501072_0215305 Ga0501072_0215305_467_658 62
883 3300049589 Ga0501073_0537600 Ga0501073_0537600_181_372 62
884 3300049590 Ga0501074_0171986 Ga0501074_0171986_118_309 62
885 3300049590 Ga0501074_0286895 Ga0501074_0286895_693_884 62
886 3300049591 Ga0501075_0315584 Ga0501075_0315584_802_993 62
887 3300049591 Ga0501075_0668076 Ga0501075_0668076_147_338 62
888 3300049592 Ga0501076_0003696 Ga0501076_0003696_725_916 62
889 3300049592 Ga0501076_0181203 Ga0501076_0181203_11_202 62
890 3300049592 Ga0501076_0221552 Ga0501076_0221552_986_1177 62
891 3300049592 Ga0501076_0744962 Ga0501076_0744962_437_628 62
892 3300049592 Ga0501076_1525842 Ga0501076_1525842_106_297 62
893 3300049593 Ga0501077_0023484 Ga0501077_0023484_2926_3117 62
894 3300049593 Ga0501077_0128880 Ga0501077_0128880_870_1061 62
895 3300049593 Ga0501077_0129556 Ga0501077_0129556_431_622 62
896 3300049593 Ga0501077_0338062 Ga0501077_0338062_414_605 62
897 3300049741 Ga0501079_0009586 Ga0501079_0009586_5821_6012 62
898 3300049741 Ga0501079_0022016 Ga0501079_0022016_510_701 62
899 3300049741 Ga0501079_0722716 Ga0501079_0722716_294_485 62
900 3300049741 Ga0501079_1042496 Ga0501079_1042496_79_270 62
901 3300049742 Ga0501080_0028717 Ga0501080_0028717_4108_4299 62
902 3300049742 Ga0501080_0390477 Ga0501080_0390477_133_324 62
903 3300049742 Ga0501080_0568033 Ga0501080_0568033_24_215 62
904 3300049743 Ga0501081_0018275 Ga0501081_0018275_4288_4479 62
905 3300049743 Ga0501081_0060230 Ga0501081_0060230_830_1021 62
906 3300049743 Ga0501081_0183134 Ga0501081_0183134_301_492 62
907 3300049743 Ga0501081_0443008 Ga0501081_0443008_17_208 62
908 3300049744 Ga0501083_0186803 Ga0501083_0186803_403_594 62
909 3300049744 Ga0501083_0321280 Ga0501083_0321280_299_490 62
910 3300049822 Ga0501035_0391223 Ga0501035_0391223_838_1029 62
911 3300049824 Ga0501045_0090523 Ga0501045_0090523_715_906 62
912 3300049824 Ga0501045_0112285 Ga0501045_0112285_1246_1437 62
913 3300049824 Ga0501045_0250114 Ga0501045_0250114_79_270 62
914 3300049824 Ga0501045_0501717 Ga0501045_0501717_551_742 62
915 3300050507 nmdc:mga05p37_131447_c1 nmdc:mga05p37_131447_c1_1880_2071 62
916 3300050507 nmdc:mga05p37_1343294_c1 nmdc:mga05p37_1343294_c1_322_516 62
917 3300050507 nmdc:mga05p37_261175_c2 nmdc:mga05p37_261175_c2_1183_1374 62
918 3300050507 nmdc:mga05p37_286830_c1 nmdc:mga05p37_286830_c1_836_1027 62
919 3300050507 nmdc:mga05p37_40058_c1 nmdc:mga05p37_40058_c1_55_246 62
920 3300050507 nmdc:mga05p37_43249_c1 nmdc:mga05p37_43249_c1_1939_2130 62
921 3300050507 nmdc:mga05p37_465902_c1 nmdc:mga05p37_465902_c1_56_250 62
922 3300050507 nmdc:mga05p37_70128_c1 nmdc:mga05p37_70128_c1_646_879 62
923 3300050508 nmdc:mga09592_11878_c1 nmdc:mga09592_11878_c1_2638_2871 62
924 3300050508 nmdc:mga09592_147685_c1 nmdc:mga09592_147685_c1_988_1182 62
925 3300050508 nmdc:mga09592_84995_c1 nmdc:mga09592_84995_c1_1971_2162 62
926 3300050509 nmdc:mga0qj67_1363606_c1 nmdc:mga0qj67_1363606_c1_105_305 62
927 3300050510 nmdc:mga06r32_2118_c1 nmdc:mga06r32_2118_c1_5507_5701 62
928 3300050510 nmdc:mga06r32_545350_c1 nmdc:mga06r32_545350_c1_553_786 62
929 3300050511 nmdc:mga08y16_14948_c1 nmdc:mga08y16_14948_c1_5009_5203 62
930 3300050511 nmdc:mga08y16_872768_c1 nmdc:mga08y16_872768_c1_289_480 62
931 3300050512 nmdc:mga0n895_1147262_c1 nmdc:mga0n895_1147262_c1_50_241 62
932 3300050512 nmdc:mga0n895_12241_c1 nmdc:mga0n895_12241_c1_1805_1996 62
933 3300050512 nmdc:mga0n895_1752318_c1 nmdc:mga0n895_1752318_c1_275_472 62
934 3300050512 nmdc:mga0n895_22280_c1 nmdc:mga0n895_22280_c1_2835_3029 62
935 3300050512 nmdc:mga0n895_236999_c1 nmdc:mga0n895_236999_c1_1387_1578 62
936 3300050512 nmdc:mga0n895_659279_c1 nmdc:mga0n895_659279_c1_92_289 62
937 3300050512 nmdc:mga0n895_774714_c1 nmdc:mga0n895_774714_c1_407_604 62
938 3300050512 nmdc:mga0n895_796590_c1 nmdc:mga0n895_796590_c1_362_556 62
939 3300050513 nmdc:mga0rr50_1393201_c1 nmdc:mga0rr50_1393201_c1_62_253 62
940 3300050513 nmdc:mga0rr50_39532_c1 nmdc:mga0rr50_39532_c1_1833_2024 62
941 3300050513 nmdc:mga0rr50_4563_c1 nmdc:mga0rr50_4563_c1_886_1083 62
942 3300050513 nmdc:mga0rr50_884105_c1 nmdc:mga0rr50_884105_c1_84_278 62
943 3300050514 nmdc:mga08x19_15303_c1 nmdc:mga08x19_15303_c1_4199_4390 62
944 3300050514 nmdc:mga08x19_185061_c1 nmdc:mga08x19_185061_c1_1014_1205 62
945 3300050515 nmdc:mga0a205_332583_c1 nmdc:mga0a205_332583_c1_950_1141 62
946 3300050515 nmdc:mga0a205_48721_c1 nmdc:mga0a205_48721_c1_588_779 62
947 3300050515 nmdc:mga0a205_74174_c1 nmdc:mga0a205_74174_c1_264_458 62
948 3300050515 nmdc:mga0a205_84734_c1 nmdc:mga0a205_84734_c1_1067_1258 62
949 3300050515 nmdc:mga0a205_9635_c1 nmdc:mga0a205_9635_c1_7756_7950 62
950 3300050515 nmdc:mga0a205_989509_c1 nmdc:mga0a205_989509_c1_62_259 62
951 3300054114 Ga0501084_0012880 Ga0501084_0012880_3127_3318 62
952 3300054114 Ga0501084_0046613 Ga0501084_0046613_25_216 62
953 3300054114 Ga0501084_0110288 Ga0501084_0110288_272_463 62
954 3300054114 Ga0501084_0113395 Ga0501084_0113395_1622_1813 62
955 3300060353 Ga0501082_0001321 Ga0501082_0001321_17480_17671 62
956 3300060353 Ga0501082_0105974 Ga0501082_0105974_83_274 62
957 3300060353 Ga0501082_0293158 Ga0501082_0293158_576_767 62
958 3300061734 Ga0530510_0047065 Ga0530510_0047065_1953_2144 62
959 3300061734 Ga0530510_0707923 Ga0530510_0707923_454_645 62
960 3300061734 Ga0530510_1420814 Ga0530510_1420814_232_423 62
961 3300061734 Ga0530510_1463227 Ga0530510_1463227_214_405 62

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00830

Ribosomal_L28

Ribosomal L28 family

3

62

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8buu-assembly1.cif.gz_X are-abcf vmlr2 bound to a 70s ribosome 0.8455 4 62
8qpp-assembly1.cif.gz_v bacillus subtilis muts2-collided disome complex (stalled 70s) 0.8266 3 59
7nhk-assembly1.cif.gz_Z lsaa, an antibiotic resistance abcf, in complex with 70s ribosome from enterococcus faecalis 0.8263 4 61
8a57-assembly1.cif.gz_1 cryo-em structure of hflxr bound to the listeria monocytogenes 50s ribosomal subunit. 0.8262 3 62
8a63-assembly1.cif.gz_1 cryo-em structure of listeria monocytogenes 50s ribosomal subunit. 0.8227 3 59
ID Description Score Start End Superfamily
af_C0H4C3_127_204_2.30.170.40 Mainly Beta;Roll;Ribosomal Protein L24e; Chain: T;;Ribosomal protein L28/L24 0.8024 3 58 2.30.170.40
4tovX00 Mainly Beta;Roll;Ribosomal Protein L24e; Chain: T;;Ribosomal protein L28/L24 0.7649 4 58 2.30.170.40
af_P9WHA9_2_78_2.30.170.40 Mainly Beta;Roll;Ribosomal Protein L24e; Chain: T;;Ribosomal protein L28/L24 0.7453 4 58 2.30.170.40
2awbZ00 Few Secondary Structures;Irregular;30s Ribosomal Protein S14; Chain N;Ribosomal protein L31 0.7276 3 58 4.10.830.30
af_C0H4C3_127_204_2.30.170.40 Mainly Beta;Roll;Ribosomal Protein L24e; Chain: T;;Ribosomal protein L28/L24 0.7249 3 58 2.30.170.40
ID Description Score Start End GO Terms
AF-A0A367ZTT3-F1-model_v4 Large ribosomal subunit protein bL28 0.9227 1 60 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7V4A907-F1-model_v4 Large ribosomal subunit protein bL28 0.9076 3 58 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7C6X2Q8-F1-model_v4 Large ribosomal subunit protein bL28 0.9059 1 62 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7C3L345-F1-model_v4 Large ribosomal subunit protein bL28 0.9001 1 55 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7C2DKY0-F1-model_v4 Large ribosomal subunit protein bL28 0.8986 1 62 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Feature Viewer

pLDDT pTM Quality
86.24 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map