F486856
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 961 | 313 | 961 | 63 |
Family's Representative Sequence
| Representative Sequence | 3300005365|Ga0070688_101543178|Ga0070688_1015431781 |
| Length | 65 |
| Sequence | MAQRCDVCGKGPSVGHKISHAHNVTKRRWLANLVSLRGKIGAAGVVQRLRVCTRCLKAGKVTKVV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 89 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 91 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 106 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 107 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 135 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 139 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 199 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 203 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 204 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 206 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 210 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 211 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 213 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 217 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 218 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 219 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 220 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 221 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 222 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 223 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 224 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 225 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 226 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 227 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 228 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 229 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 230 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 231 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 232 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 233 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 234 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 235 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 236 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 237 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 266 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 267 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 268 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 269 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 272 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 273 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 274 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 275 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.27 |
| Metatranscriptomes | 0.73 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.66 |
| Rhizosphere | 98.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1001299 | 3300000546 | Bacteria | 3690 |
| 2 | JGI24747J21853_1005708 | 3300001978 | Bacteria | 1157 |
| 3 | JGI24737J22298_10107498 | 3300001990 | Unclassified | 826 |
| 4 | JGI24743J22301_10007173 | 3300001991 | Bacteria | 1924 |
| 5 | JGI24751J29686_10001058 | 3300002459 | Bacteria | 5974 |
| 6 | Ga0058863_10163623 | 3300004799 | Bacteria | 725 |
| 7 | Ga0058861_10095151 | 3300004800 | Bacteria | 860 |
| 8 | Ga0058861_10169578 | 3300004800 | Unclassified | 722 |
| 9 | Ga0058861_10171377 | 3300004800 | Bacteria | 1260 |
| 10 | Ga0058862_10211581 | 3300004803 | Bacteria | 1177 |
| 11 | Ga0065712_10047790 | 3300005290 | Bacteria | 714 |
| 12 | Ga0065712_10312758 | 3300005290 | Bacteria | 841 |
| 13 | Ga0065715_10310948 | 3300005293 | Bacteria | 1021 |
| 14 | Ga0065707_10208242 | 3300005295 | Bacteria | 1278 |
| 15 | Ga0065707_10360330 | 3300005295 | Bacteria | 905 |
| 16 | Ga0065707_10993216 | 3300005295 | Bacteria | 541 |
| 17 | Ga0070658_10139618 | 3300005327 | Bacteria | 2023 |
| 18 | Ga0070658_10925189 | 3300005327 | Bacteria | 758 |
| 19 | Ga0070676_10006901 | 3300005328 | Bacteria | 6078 |
| 20 | Ga0070676_10104744 | 3300005328 | Bacteria | 1753 |
| 21 | Ga0070676_10125676 | 3300005328 | Bacteria | 1615 |
| 22 | Ga0070676_10266258 | 3300005328 | Bacteria | 1149 |
| 23 | Ga0070683_100012082 | 3300005329 | Bacteria | 7492 |
| 24 | Ga0070683_100021104 | 3300005329 | Bacteria | 5809 |
| 25 | Ga0070683_100045056 | 3300005329 | Bacteria | 4071 |
| 26 | Ga0070683_100074278 | 3300005329 | Bacteria | 3175 |
| 27 | Ga0070683_100562402 | 3300005329 | Unclassified | 1091 |
| 28 | Ga0070683_100903325 | 3300005329 | Unclassified | 847 |
| 29 | Ga0070690_100028368 | 3300005330 | Bacteria | 3466 |
| 30 | Ga0070690_100255065 | 3300005330 | Bacteria | 1242 |
| 31 | Ga0070690_100842191 | 3300005330 | Bacteria | 714 |
| 32 | Ga0070670_100017818 | 3300005331 | Bacteria | 6094 |
| 33 | Ga0070670_100026236 | 3300005331 | Bacteria | 5016 |
| 34 | Ga0070670_100092204 | 3300005331 | Bacteria | 2605 |
| 35 | Ga0070670_100130819 | 3300005331 | Bacteria | 2167 |
| 36 | Ga0070677_10011875 | 3300005333 | Bacteria | 3014 |
| 37 | Ga0070677_10155180 | 3300005333 | Unclassified | 1069 |
| 38 | Ga0070677_10356520 | 3300005333 | Bacteria | 759 |
| 39 | Ga0068869_100002767 | 3300005334 | Bacteria | 10622 |
| 40 | Ga0068869_100004989 | 3300005334 | Bacteria | 8308 |
| 41 | Ga0068869_100029661 | 3300005334 | Bacteria | 3835 |
| 42 | Ga0068869_100187938 | 3300005334 | Bacteria | 1623 |
| 43 | Ga0070680_100011932 | 3300005336 | Bacteria | 6740 |
| 44 | Ga0070680_100209933 | 3300005336 | Bacteria | 1643 |
| 45 | Ga0070680_100212672 | 3300005336 | Bacteria | 1631 |
| 46 | Ga0070680_100258169 | 3300005336 | Unclassified | 1474 |
| 47 | Ga0070680_100481586 | 3300005336 | Bacteria | 1061 |
| 48 | Ga0070680_100844665 | 3300005336 | Unclassified | 789 |
| 49 | Ga0070680_101743522 | 3300005336 | Bacteria | 540 |
| 50 | Ga0070682_100001205 | 3300005337 | Bacteria | 14746 |
| 51 | Ga0070682_100079880 | 3300005337 | Bacteria | 2113 |
| 52 | Ga0070682_100130021 | 3300005337 | Bacteria | 1703 |
| 53 | Ga0070682_100236723 | 3300005337 | Unclassified | 1309 |
| 54 | Ga0070682_101946233 | 3300005337 | Unclassified | 516 |
| 55 | Ga0068868_100009424 | 3300005338 | Bacteria | 7025 |
| 56 | Ga0068868_100020041 | 3300005338 | Bacteria | 5018 |
| 57 | Ga0068868_100026898 | 3300005338 | Bacteria | 4386 |
| 58 | Ga0068868_100116967 | 3300005338 | Bacteria | 2171 |
| 59 | Ga0068868_100134719 | 3300005338 | Bacteria | 2024 |
| 60 | Ga0068868_100749167 | 3300005338 | Bacteria | 877 |
| 61 | Ga0070660_100000332 | 3300005339 | Bacteria | 31219 |
| 62 | Ga0070660_100339242 | 3300005339 | Bacteria | 1236 |
| 63 | Ga0070660_101080180 | 3300005339 | Bacteria | 679 |
| 64 | Ga0070689_100031084 | 3300005340 | Bacteria | 4057 |
| 65 | Ga0070689_100045532 | 3300005340 | Bacteria | 3379 |
| 66 | Ga0070689_100055190 | 3300005340 | Bacteria | 3078 |
| 67 | Ga0070689_100065539 | 3300005340 | Unclassified | 2829 |
| 68 | Ga0070689_100174407 | 3300005340 | Bacteria | 1743 |
| 69 | Ga0070691_10007841 | 3300005341 | Bacteria | 4884 |
| 70 | Ga0070687_100058180 | 3300005343 | Bacteria | 2030 |
| 71 | Ga0070687_100070845 | 3300005343 | Bacteria | 1871 |
| 72 | Ga0070687_100112656 | 3300005343 | Bacteria | 1542 |
| 73 | Ga0070661_100008004 | 3300005344 | Bacteria | 7301 |
| 74 | Ga0070661_100010213 | 3300005344 | Bacteria | 6522 |
| 75 | Ga0070661_100366338 | 3300005344 | Unclassified | 1133 |
| 76 | Ga0070661_100563713 | 3300005344 | Bacteria | 918 |
| 77 | Ga0070692_10039660 | 3300005345 | Bacteria | 2405 |
| 78 | Ga0070692_10146528 | 3300005345 | Bacteria | 1341 |
| 79 | Ga0070692_10408458 | 3300005345 | Bacteria | 859 |
| 80 | Ga0070668_100024248 | 3300005347 | Bacteria | 4594 |
| 81 | Ga0070668_102154891 | 3300005347 | Unclassified | 515 |
| 82 | Ga0070669_100093849 | 3300005353 | Bacteria | 2254 |
| 83 | Ga0070669_100096286 | 3300005353 | Bacteria | 2227 |
| 84 | Ga0070669_100256695 | 3300005353 | Bacteria | 1393 |
| 85 | Ga0070669_100412395 | 3300005353 | Unclassified | 1107 |
| 86 | Ga0070669_100444189 | 3300005353 | Unclassified | 1068 |
| 87 | Ga0070669_100616655 | 3300005353 | Bacteria | 910 |
| 88 | Ga0070675_100008040 | 3300005354 | Bacteria | 8177 |
| 89 | Ga0070675_100092835 | 3300005354 | Bacteria | 2531 |
| 90 | Ga0070671_100288645 | 3300005355 | Bacteria | 1396 |
| 91 | Ga0070671_100369219 | 3300005355 | Bacteria | 1225 |
| 92 | Ga0070674_100195372 | 3300005356 | Bacteria | 1559 |
| 93 | Ga0070673_100013321 | 3300005364 | Bacteria | 5683 |
| 94 | Ga0070673_100190955 | 3300005364 | Bacteria | 1759 |
| 95 | Ga0070673_100305270 | 3300005364 | Bacteria | 1402 |
| 96 | Ga0070673_100808425 | 3300005364 | Unclassified | 866 |
| 97 | Ga0070688_100101502 | 3300005365 | Unclassified | 1898 |
| 98 | Ga0070688_100428583 | 3300005365 | Bacteria | 984 |
| 99 | Ga0070688_100525199 | 3300005365 | Unclassified | 896 |
| 100 | Ga0070688_101026319 | 3300005365 | Bacteria | 656 |
| 101 | Ga0070688_101543178 | 3300005365 | Bacteria | 541 |
| 102 | Ga0070688_101701286 | 3300005365 | Bacteria | 516 |
| 103 | Ga0070659_100007889 | 3300005366 | Bacteria | 7751 |
| 104 | Ga0070659_100054477 | 3300005366 | Unclassified | 3150 |
| 105 | Ga0070667_100075152 | 3300005367 | Bacteria | 2884 |
| 106 | Ga0070667_100163470 | 3300005367 | Bacteria | 1962 |
| 107 | Ga0070667_100248515 | 3300005367 | Unclassified | 1590 |
| 108 | Ga0070667_100860083 | 3300005367 | Unclassified | 843 |
| 109 | Ga0070667_101454837 | 3300005367 | Bacteria | 643 |
| 110 | Ga0070667_102063811 | 3300005367 | Unclassified | 537 |
| 111 | Ga0070703_10065721 | 3300005406 | Bacteria | 1198 |
| 112 | Ga0070703_10111366 | 3300005406 | Unclassified | 980 |
| 113 | Ga0070703_10178194 | 3300005406 | Bacteria | 819 |
| 114 | Ga0070709_10119517 | 3300005434 | Unclassified | 1784 |
| 115 | Ga0070709_10204332 | 3300005434 | Bacteria | 1401 |
| 116 | Ga0070709_10582266 | 3300005434 | Bacteria | 860 |
| 117 | Ga0070709_10827973 | 3300005434 | Bacteria | 728 |
| 118 | Ga0070714_101819508 | 3300005435 | Bacteria | 595 |
| 119 | Ga0070713_100293088 | 3300005436 | Bacteria | 1496 |
| 120 | Ga0070713_100391922 | 3300005436 | Bacteria | 1296 |
| 121 | Ga0070713_100603944 | 3300005436 | Bacteria | 1042 |
| 122 | Ga0070713_100854147 | 3300005436 | Unclassified | 874 |
| 123 | Ga0070713_101550899 | 3300005436 | Unclassified | 643 |
| 124 | Ga0070710_10061249 | 3300005437 | Bacteria | 2143 |
| 125 | Ga0070710_10199474 | 3300005437 | Bacteria | 1263 |
| 126 | Ga0070710_10336814 | 3300005437 | Bacteria | 995 |
| 127 | Ga0070710_11076953 | 3300005437 | Unclassified | 589 |
| 128 | Ga0070701_10041473 | 3300005438 | Bacteria | 2346 |
| 129 | Ga0070701_10095361 | 3300005438 | Bacteria | 1638 |
| 130 | Ga0070701_10309427 | 3300005438 | Bacteria | 974 |
| 131 | Ga0070711_100009216 | 3300005439 | Bacteria | 6068 |
| 132 | Ga0070711_100041508 | 3300005439 | Bacteria | 3108 |
| 133 | Ga0070711_101791610 | 3300005439 | Unclassified | 539 |
| 134 | Ga0070705_100010715 | 3300005440 | Bacteria | 4599 |
| 135 | Ga0070705_100018219 | 3300005440 | Bacteria | 3677 |
| 136 | Ga0070705_100049436 | 3300005440 | Bacteria | 2441 |
| 137 | Ga0070705_100051447 | 3300005440 | Unclassified | 2402 |
| 138 | Ga0070705_100054300 | 3300005440 | Bacteria | 2349 |
| 139 | Ga0070705_100524476 | 3300005440 | Bacteria | 903 |
| 140 | Ga0070705_100631361 | 3300005440 | Bacteria | 833 |
| 141 | Ga0070700_100834854 | 3300005441 | Bacteria | 745 |
| 142 | Ga0070700_101284512 | 3300005441 | Unclassified | 614 |
| 143 | Ga0070694_100000758 | 3300005444 | Bacteria | 18068 |
| 144 | Ga0070694_100004529 | 3300005444 | Bacteria | 8358 |
| 145 | Ga0070694_100012156 | 3300005444 | Bacteria | 5348 |
| 146 | Ga0070694_100133588 | 3300005444 | Bacteria | 1795 |
| 147 | Ga0070694_100405344 | 3300005444 | Bacteria | 1068 |
| 148 | Ga0070694_100621181 | 3300005444 | Bacteria | 872 |
| 149 | Ga0070694_100779407 | 3300005444 | Bacteria | 783 |
| 150 | Ga0070694_100785232 | 3300005444 | Bacteria | 780 |
| 151 | Ga0070708_100030979 | 3300005445 | Bacteria | 4627 |
| 152 | Ga0070708_100037363 | 3300005445 | Bacteria | 4236 |
| 153 | Ga0070708_100160636 | 3300005445 | Bacteria | 2094 |
| 154 | Ga0070708_100236987 | 3300005445 | Bacteria | 1713 |
| 155 | Ga0070708_100325665 | 3300005445 | Unclassified | 1447 |
| 156 | Ga0070708_100394414 | 3300005445 | Bacteria | 1305 |
| 157 | Ga0070708_100527572 | 3300005445 | Bacteria | 1114 |
| 158 | Ga0070708_100883351 | 3300005445 | Bacteria | 839 |
| 159 | Ga0070708_101754478 | 3300005445 | Unclassified | 577 |
| 160 | Ga0070708_102075156 | 3300005445 | Unclassified | 526 |
| 161 | Ga0070663_100013971 | 3300005455 | Bacteria | 5140 |
| 162 | Ga0070663_100076133 | 3300005455 | Bacteria | 2453 |
| 163 | Ga0070678_100045303 | 3300005456 | Bacteria | 3146 |
| 164 | Ga0070678_100762820 | 3300005456 | Bacteria | 876 |
| 165 | Ga0070662_100006301 | 3300005457 | Bacteria | 7644 |
| 166 | Ga0070662_100072724 | 3300005457 | Unclassified | 2539 |
| 167 | Ga0070662_100078017 | 3300005457 | Bacteria | 2459 |
| 168 | Ga0070662_100344527 | 3300005457 | Unclassified | 1220 |
| 169 | Ga0070662_101788583 | 3300005457 | Bacteria | 531 |
| 170 | Ga0070681_10000049 | 3300005458 | Bacteria | 82355 |
| 171 | Ga0070681_10031207 | 3300005458 | Bacteria | 5348 |
| 172 | Ga0070681_10093480 | 3300005458 | Bacteria | 2956 |
| 173 | Ga0070681_10300789 | 3300005458 | Unclassified | 1514 |
| 174 | Ga0070681_10306625 | 3300005458 | Bacteria | 1497 |
| 175 | Ga0070681_10345291 | 3300005458 | Bacteria | 1399 |
| 176 | Ga0070681_10384050 | 3300005458 | Bacteria | 1315 |
| 177 | Ga0070681_10557517 | 3300005458 | Bacteria | 1060 |
| 178 | Ga0070681_10753527 | 3300005458 | Bacteria | 890 |
| 179 | Ga0070681_11219084 | 3300005458 | Unclassified | 674 |
| 180 | Ga0068867_100006250 | 3300005459 | Bacteria | 8426 |
| 181 | Ga0068867_100045512 | 3300005459 | Bacteria | 3219 |
| 182 | Ga0068867_100067037 | 3300005459 | Bacteria | 2674 |
| 183 | Ga0068867_100092127 | 3300005459 | Bacteria | 2301 |
| 184 | Ga0068867_100138524 | 3300005459 | Bacteria | 1900 |
| 185 | Ga0070685_10037976 | 3300005466 | Bacteria | 2729 |
| 186 | Ga0070685_10546377 | 3300005466 | Bacteria | 826 |
| 187 | Ga0070706_100052747 | 3300005467 | Bacteria | 3753 |
| 188 | Ga0070706_100064589 | 3300005467 | Bacteria | 3383 |
| 189 | Ga0070706_100134914 | 3300005467 | Bacteria | 2304 |
| 190 | Ga0070706_100303431 | 3300005467 | Unclassified | 1489 |
| 191 | Ga0070706_100489498 | 3300005467 | Bacteria | 1144 |
| 192 | Ga0070706_100773818 | 3300005467 | Bacteria | 889 |
| 193 | Ga0070706_100891251 | 3300005467 | Bacteria | 822 |
| 194 | Ga0070706_101448583 | 3300005467 | Bacteria | 628 |
| 195 | Ga0070707_100020638 | 3300005468 | Bacteria | 6217 |
| 196 | Ga0070707_100041460 | 3300005468 | Bacteria | 4406 |
| 197 | Ga0070707_100046260 | 3300005468 | Bacteria | 4164 |
| 198 | Ga0070707_100142023 | 3300005468 | Unclassified | 2337 |
| 199 | Ga0070707_100147765 | 3300005468 | Bacteria | 2287 |
| 200 | Ga0070707_100156849 | 3300005468 | Bacteria | 2217 |
| 201 | Ga0070707_100228679 | 3300005468 | Unclassified | 1811 |
| 202 | Ga0070707_100273772 | 3300005468 | Bacteria | 1641 |
| 203 | Ga0070707_100351472 | 3300005468 | Bacteria | 1432 |
| 204 | Ga0070707_100534165 | 3300005468 | Unclassified | 1135 |
| 205 | Ga0070707_100773465 | 3300005468 | Bacteria | 924 |
| 206 | Ga0070707_102217388 | 3300005468 | Unclassified | 517 |
| 207 | Ga0070698_100073943 | 3300005471 | Bacteria | 3414 |
| 208 | Ga0070698_100081517 | 3300005471 | Bacteria | 3229 |
| 209 | Ga0070698_100156046 | 3300005471 | Bacteria | 2228 |
| 210 | Ga0070698_100180111 | 3300005471 | Bacteria | 2052 |
| 211 | Ga0070698_100488118 | 3300005471 | Bacteria | 1169 |
| 212 | Ga0070699_100015236 | 3300005518 | Bacteria | 6606 |
| 213 | Ga0070699_100024343 | 3300005518 | Bacteria | 5217 |
| 214 | Ga0070699_100031808 | 3300005518 | Bacteria | 4556 |
| 215 | Ga0070699_100087879 | 3300005518 | Bacteria | 2714 |
| 216 | Ga0070699_100180595 | 3300005518 | Bacteria | 1872 |
| 217 | Ga0070699_100280425 | 3300005518 | Bacteria | 1493 |
| 218 | Ga0070699_100414717 | 3300005518 | Bacteria | 1218 |
| 219 | Ga0070699_100484254 | 3300005518 | Unclassified | 1123 |
| 220 | Ga0070699_100543444 | 3300005518 | Unclassified | 1057 |
| 221 | Ga0070699_100901548 | 3300005518 | Unclassified | 810 |
| 222 | Ga0070699_100932255 | 3300005518 | Bacteria | 796 |
| 223 | Ga0070679_100010981 | 3300005530 | Bacteria | 8607 |
| 224 | Ga0070679_100016005 | 3300005530 | Bacteria | 7223 |
| 225 | Ga0070679_100032821 | 3300005530 | Bacteria | 5139 |
| 226 | Ga0070679_100121256 | 3300005530 | Bacteria | 2599 |
| 227 | Ga0070679_100317595 | 3300005530 | Bacteria | 1507 |
| 228 | Ga0070679_100545269 | 3300005530 | Bacteria | 1103 |
| 229 | Ga0070679_100823282 | 3300005530 | Unclassified | 871 |
| 230 | Ga0070679_100898779 | 3300005530 | Bacteria | 829 |
| 231 | Ga0070679_101225210 | 3300005530 | Bacteria | 696 |
| 232 | Ga0070684_100003237 | 3300005535 | Bacteria | 12180 |
| 233 | Ga0070684_100017079 | 3300005535 | Bacteria | 5948 |
| 234 | Ga0070684_100019566 | 3300005535 | Bacteria | 5603 |
| 235 | Ga0070684_100038467 | 3300005535 | Bacteria | 4110 |
| 236 | Ga0070697_100002024 | 3300005536 | Bacteria | 15517 |
| 237 | Ga0070697_100008817 | 3300005536 | Bacteria | 7872 |
| 238 | Ga0070697_100059567 | 3300005536 | Bacteria | 3109 |
| 239 | Ga0070697_100086515 | 3300005536 | Bacteria | 2587 |
| 240 | Ga0070697_100167675 | 3300005536 | Bacteria | 1857 |
| 241 | Ga0070697_100178520 | 3300005536 | Bacteria | 1799 |
| 242 | Ga0070697_100306883 | 3300005536 | Bacteria | 1365 |
| 243 | Ga0070697_100431897 | 3300005536 | Unclassified | 1145 |
| 244 | Ga0070697_100478343 | 3300005536 | Bacteria | 1087 |
| 245 | Ga0070697_100617582 | 3300005536 | Bacteria | 953 |
| 246 | Ga0070697_101167728 | 3300005536 | Bacteria | 686 |
| 247 | Ga0070697_101507375 | 3300005536 | Unclassified | 601 |
| 248 | Ga0070697_101758029 | 3300005536 | Bacteria | 555 |
| 249 | Ga0068853_100001362 | 3300005539 | Bacteria | 17619 |
| 250 | Ga0068853_100009355 | 3300005539 | Bacteria | 7900 |
| 251 | Ga0068853_100045276 | 3300005539 | Unclassified | 3768 |
| 252 | Ga0068853_100209570 | 3300005539 | Bacteria | 1776 |
| 253 | Ga0068853_100238266 | 3300005539 | Bacteria | 1667 |
| 254 | Ga0068853_101503431 | 3300005539 | Unclassified | 652 |
| 255 | Ga0068853_102277838 | 3300005539 | Bacteria | 525 |
| 256 | Ga0070672_100273511 | 3300005543 | Unclassified | 1427 |
| 257 | Ga0070672_100654159 | 3300005543 | Bacteria | 918 |
| 258 | Ga0070686_100199398 | 3300005544 | Bacteria | 1434 |
| 259 | Ga0070686_101285714 | 3300005544 | Unclassified | 610 |
| 260 | Ga0070695_100001464 | 3300005545 | Bacteria | 13072 |
| 261 | Ga0070695_100002045 | 3300005545 | Bacteria | 11528 |
| 262 | Ga0070695_100003725 | 3300005545 | Bacteria | 8892 |
| 263 | Ga0070695_100057401 | 3300005545 | Bacteria | 2515 |
| 264 | Ga0070695_100880859 | 3300005545 | Bacteria | 722 |
| 265 | Ga0070695_101421262 | 3300005545 | Bacteria | 576 |
| 266 | Ga0070696_100004074 | 3300005546 | Bacteria | 9751 |
| 267 | Ga0070696_100043583 | 3300005546 | Bacteria | 3105 |
| 268 | Ga0070696_100125285 | 3300005546 | Bacteria | 1863 |
| 269 | Ga0070696_100277587 | 3300005546 | Bacteria | 1276 |
| 270 | Ga0070696_100310312 | 3300005546 | Unclassified | 1211 |
| 271 | Ga0070696_100674362 | 3300005546 | Bacteria | 840 |
| 272 | Ga0070693_100000325 | 3300005547 | Bacteria | 21855 |
| 273 | Ga0070693_100022242 | 3300005547 | Bacteria | 3368 |
| 274 | Ga0070693_100114053 | 3300005547 | Bacteria | 1667 |
| 275 | Ga0070693_100318921 | 3300005547 | Bacteria | 1054 |
| 276 | Ga0070693_100330005 | 3300005547 | Unclassified | 1038 |
| 277 | Ga0070665_100095438 | 3300005548 | Bacteria | 2979 |
| 278 | Ga0070665_100138558 | 3300005548 | Bacteria | 2436 |
| 279 | Ga0070665_100251379 | 3300005548 | Bacteria | 1769 |
| 280 | Ga0070665_101658729 | 3300005548 | Unclassified | 647 |
| 281 | Ga0070704_100085995 | 3300005549 | Bacteria | 2329 |
| 282 | Ga0070704_100125505 | 3300005549 | Unclassified | 1980 |
| 283 | Ga0070704_100168418 | 3300005549 | Unclassified | 1739 |
| 284 | Ga0070704_100242137 | 3300005549 | Bacteria | 1477 |
| 285 | Ga0070704_101042207 | 3300005549 | Bacteria | 741 |
| 286 | Ga0070704_101807375 | 3300005549 | Bacteria | 566 |
| 287 | Ga0070704_102238146 | 3300005549 | Unclassified | 508 |
| 288 | Ga0068855_100000397 | 3300005563 | Bacteria | 53677 |
| 289 | Ga0068855_100033033 | 3300005563 | Bacteria | 6177 |
| 290 | Ga0068855_100042404 | 3300005563 | Bacteria | 5391 |
| 291 | Ga0068855_100120875 | 3300005563 | Bacteria | 2998 |
| 292 | Ga0068855_100464676 | 3300005563 | Bacteria | 1379 |
| 293 | Ga0068855_101807250 | 3300005563 | Unclassified | 621 |
| 294 | Ga0068855_102080773 | 3300005563 | Bacteria | 572 |
| 295 | Ga0068855_102114808 | 3300005563 | Bacteria | 567 |
| 296 | Ga0068855_102421408 | 3300005563 | Unclassified | 524 |
| 297 | Ga0070664_100000468 | 3300005564 | Bacteria | 30654 |
| 298 | Ga0070664_100043549 | 3300005564 | Bacteria | 3787 |
| 299 | Ga0070664_100082370 | 3300005564 | Unclassified | 2775 |
| 300 | Ga0070664_100127967 | 3300005564 | Unclassified | 2229 |
| 301 | Ga0068857_100000474 | 3300005577 | Bacteria | 28698 |
| 302 | Ga0068857_100011453 | 3300005577 | Bacteria | 7718 |
| 303 | Ga0068857_100014168 | 3300005577 | Bacteria | 6942 |
| 304 | Ga0068857_100061177 | 3300005577 | Bacteria | 3345 |
| 305 | Ga0068857_100486882 | 3300005577 | Bacteria | 1156 |
| 306 | Ga0068857_101017927 | 3300005577 | Unclassified | 798 |
| 307 | Ga0068854_100000353 | 3300005578 | Bacteria | 29520 |
| 308 | Ga0068854_100037036 | 3300005578 | Unclassified | 3422 |
| 309 | Ga0068854_100054791 | 3300005578 | Bacteria | 2869 |
| 310 | Ga0068854_100209085 | 3300005578 | Unclassified | 1538 |
| 311 | Ga0068854_100210627 | 3300005578 | Bacteria | 1533 |
| 312 | Ga0068854_100426306 | 3300005578 | Bacteria | 1103 |
| 313 | Ga0068856_100000475 | 3300005614 | Bacteria | 44356 |
| 314 | Ga0068856_100003466 | 3300005614 | Bacteria | 15940 |
| 315 | Ga0068856_100021766 | 3300005614 | Bacteria | 6231 |
| 316 | Ga0068856_100086827 | 3300005614 | Unclassified | 3109 |
| 317 | Ga0068856_101783989 | 3300005614 | Unclassified | 627 |
| 318 | Ga0068856_102372466 | 3300005614 | Unclassified | 538 |
| 319 | Ga0070702_100462419 | 3300005615 | Bacteria | 923 |
| 320 | Ga0070702_100635949 | 3300005615 | Unclassified | 805 |
| 321 | Ga0068852_100053578 | 3300005616 | Bacteria | 3473 |
| 322 | Ga0068852_100085266 | 3300005616 | Bacteria | 2814 |
| 323 | Ga0068852_100676904 | 3300005616 | Bacteria | 1041 |
| 324 | Ga0068852_101951648 | 3300005616 | Unclassified | 609 |
| 325 | Ga0068859_100000610 | 3300005617 | Bacteria | 35815 |
| 326 | Ga0068859_100002575 | 3300005617 | Bacteria | 18433 |
| 327 | Ga0068859_100028604 | 3300005617 | Bacteria | 5588 |
| 328 | Ga0068859_100184913 | 3300005617 | Bacteria | 2167 |
| 329 | Ga0068859_100208042 | 3300005617 | Bacteria | 2042 |
| 330 | Ga0068859_100214834 | 3300005617 | Bacteria | 2010 |
| 331 | Ga0068859_101388817 | 3300005617 | Bacteria | 774 |
| 332 | Ga0068859_102081566 | 3300005617 | Bacteria | 626 |
| 333 | Ga0068864_100000254 | 3300005618 | Bacteria | 47729 |
| 334 | Ga0068864_100157963 | 3300005618 | Bacteria | 2059 |
| 335 | Ga0068864_100794644 | 3300005618 | Bacteria | 929 |
| 336 | Ga0068866_10016681 | 3300005718 | Unclassified | 3289 |
| 337 | Ga0068866_10027467 | 3300005718 | Bacteria | 2699 |
| 338 | Ga0068866_10298050 | 3300005718 | Bacteria | 1006 |
| 339 | Ga0068861_100033261 | 3300005719 | Bacteria | 3802 |
| 340 | Ga0068861_100081024 | 3300005719 | Bacteria | 2540 |
| 341 | Ga0068861_100132403 | 3300005719 | Bacteria | 2025 |
| 342 | Ga0068861_100239767 | 3300005719 | Bacteria | 1542 |
| 343 | Ga0068851_10125339 | 3300005834 | Bacteria | 1384 |
| 344 | Ga0068851_10221315 | 3300005834 | Bacteria | 1064 |
| 345 | Ga0068870_10001907 | 3300005840 | Bacteria | 8603 |
| 346 | Ga0068870_10025433 | 3300005840 | Unclassified | 2938 |
| 347 | Ga0068870_10619510 | 3300005840 | Unclassified | 737 |
| 348 | Ga0068863_100007896 | 3300005841 | Bacteria | 10405 |
| 349 | Ga0068863_100025704 | 3300005841 | Bacteria | 5615 |
| 350 | Ga0068863_100135541 | 3300005841 | Bacteria | 2352 |
| 351 | Ga0068863_100286444 | 3300005841 | Bacteria | 1597 |
| 352 | Ga0068863_100292226 | 3300005841 | Bacteria | 1580 |
| 353 | Ga0068863_100313048 | 3300005841 | Bacteria | 1524 |
| 354 | Ga0068863_100700374 | 3300005841 | Bacteria | 1007 |
| 355 | Ga0068858_100002296 | 3300005842 | Bacteria | 19355 |
| 356 | Ga0068858_100059167 | 3300005842 | Unclassified | 3542 |
| 357 | Ga0068858_100139449 | 3300005842 | Bacteria | 2276 |
| 358 | Ga0068858_100158022 | 3300005842 | Bacteria | 2134 |
| 359 | Ga0068858_100416577 | 3300005842 | Unclassified | 1292 |
| 360 | Ga0068858_100705093 | 3300005842 | Bacteria | 982 |
| 361 | Ga0068858_100933324 | 3300005842 | Bacteria | 849 |
| 362 | Ga0068860_100004896 | 3300005843 | Bacteria | 13649 |
| 363 | Ga0068860_100047220 | 3300005843 | Bacteria | 4105 |
| 364 | Ga0068860_100074193 | 3300005843 | Unclassified | 3235 |
| 365 | Ga0068860_100192621 | 3300005843 | Bacteria | 1973 |
| 366 | Ga0068860_100193740 | 3300005843 | Bacteria | 1967 |
| 367 | Ga0068860_100318712 | 3300005843 | Bacteria | 1526 |
| 368 | Ga0068860_100433184 | 3300005843 | Bacteria | 1305 |
| 369 | Ga0068860_100687079 | 3300005843 | Bacteria | 1033 |
| 370 | Ga0068860_101333512 | 3300005843 | Bacteria | 738 |
| 371 | Ga0068860_101364035 | 3300005843 | Bacteria | 730 |
| 372 | Ga0068862_100036298 | 3300005844 | Bacteria | 4178 |
| 373 | Ga0068862_100047247 | 3300005844 | Bacteria | 3673 |
| 374 | Ga0068862_100050690 | 3300005844 | Bacteria | 3548 |
| 375 | Ga0068862_100051172 | 3300005844 | Bacteria | 3532 |
| 376 | Ga0068862_100231353 | 3300005844 | Bacteria | 1677 |
| 377 | Ga0068862_100417647 | 3300005844 | Bacteria | 1258 |
| 378 | Ga0068862_100762560 | 3300005844 | Bacteria | 942 |
| 379 | Ga0068862_101612735 | 3300005844 | Unclassified | 656 |
| 380 | Ga0081455_10067085 | 3300005937 | Bacteria | 2991 |
| 381 | Ga0081455_10080439 | 3300005937 | Bacteria | 2671 |
| 382 | Ga0081455_10498329 | 3300005937 | Unclassified | 819 |
| 383 | Ga0081538_10006559 | 3300005981 | Bacteria | 10220 |
| 384 | Ga0081540_1023348 | 3300005983 | Bacteria | 3620 |
| 385 | Ga0081540_1047673 | 3300005983 | Bacteria | 2152 |
| 386 | Ga0070717_10000962 | 3300006028 | Bacteria | 19214 |
| 387 | Ga0070717_10001900 | 3300006028 | Bacteria | 14613 |
| 388 | Ga0070717_10004828 | 3300006028 | Bacteria | 9810 |
| 389 | Ga0070717_10014769 | 3300006028 | Bacteria | 6007 |
| 390 | Ga0070717_10073416 | 3300006028 | Unclassified | 2859 |
| 391 | Ga0070717_10187116 | 3300006028 | Bacteria | 1808 |
| 392 | Ga0070717_10331915 | 3300006028 | Unclassified | 1357 |
| 393 | Ga0070717_11613848 | 3300006028 | Unclassified | 588 |
| 394 | Ga0070717_11883817 | 3300006028 | Bacteria | 540 |
| 395 | Ga0075432_10201831 | 3300006058 | Bacteria | 787 |
| 396 | Ga0070715_10035877 | 3300006163 | Unclassified | 2042 |
| 397 | Ga0070715_10126718 | 3300006163 | Bacteria | 1224 |
| 398 | Ga0070715_10385128 | 3300006163 | Bacteria | 775 |
| 399 | Ga0070716_100002702 | 3300006173 | Bacteria | 8212 |
| 400 | Ga0070716_100087343 | 3300006173 | Unclassified | 1878 |
| 401 | Ga0070716_100131091 | 3300006173 | Unclassified | 1585 |
| 402 | Ga0070716_100350917 | 3300006173 | Unclassified | 1044 |
| 403 | Ga0070716_100393190 | 3300006173 | Bacteria | 995 |
| 404 | Ga0070716_100929509 | 3300006173 | Bacteria | 683 |
| 405 | Ga0070716_101146886 | 3300006173 | Bacteria | 622 |
| 406 | Ga0070716_101673684 | 3300006173 | Bacteria | 524 |
| 407 | Ga0070712_100001521 | 3300006175 | Bacteria | 14157 |
| 408 | Ga0070712_100006037 | 3300006175 | Bacteria | 7499 |
| 409 | Ga0070712_100093001 | 3300006175 | Bacteria | 2213 |
| 410 | Ga0070712_100226384 | 3300006175 | Archaea | 1483 |
| 411 | Ga0070712_100561451 | 3300006175 | Bacteria | 963 |
| 412 | Ga0070712_100683559 | 3300006175 | Bacteria | 874 |
| 413 | Ga0097621_100016488 | 3300006237 | Bacteria | 5587 |
| 414 | Ga0097621_100021907 | 3300006237 | Unclassified | 4952 |
| 415 | Ga0097621_100037196 | 3300006237 | Bacteria | 3898 |
| 416 | Ga0097621_100200954 | 3300006237 | Bacteria | 1730 |
| 417 | Ga0097621_101600454 | 3300006237 | Unclassified | 619 |
| 418 | Ga0068871_100001677 | 3300006358 | Bacteria | 14885 |
| 419 | Ga0068871_100016064 | 3300006358 | Bacteria | 5625 |
| 420 | Ga0068871_100056014 | 3300006358 | Bacteria | 3203 |
| 421 | Ga0068871_100263617 | 3300006358 | Unclassified | 1504 |
| 422 | Ga0068871_100939352 | 3300006358 | Bacteria | 803 |
| 423 | Ga0075428_100018251 | 3300006844 | Bacteria | 7753 |
| 424 | Ga0075428_100189398 | 3300006844 | Bacteria | 2225 |
| 425 | Ga0075428_100351045 | 3300006844 | Bacteria | 1583 |
| 426 | Ga0075428_100789867 | 3300006844 | Bacteria | 1009 |
| 427 | Ga0075430_100292378 | 3300006846 | Unclassified | 1348 |
| 428 | Ga0075430_101623503 | 3300006846 | Unclassified | 531 |
| 429 | Ga0075431_100004465 | 3300006847 | Bacteria | 13728 |
| 430 | Ga0075431_100072796 | 3300006847 | Bacteria | 3546 |
| 431 | Ga0075431_100224811 | 3300006847 | Bacteria | 1914 |
| 432 | Ga0075431_102012259 | 3300006847 | Unclassified | 533 |
| 433 | Ga0075433_10002435 | 3300006852 | Bacteria | 14167 |
| 434 | Ga0075433_10019734 | 3300006852 | Bacteria | 5624 |
| 435 | Ga0075433_10031282 | 3300006852 | Bacteria | 4549 |
| 436 | Ga0075433_10052378 | 3300006852 | Bacteria | 3556 |
| 437 | Ga0075433_11951929 | 3300006852 | Unclassified | 503 |
| 438 | Ga0075434_100008438 | 3300006871 | Bacteria | 9581 |
| 439 | Ga0075434_100011622 | 3300006871 | Bacteria | 8313 |
| 440 | Ga0075434_100044987 | 3300006871 | Bacteria | 4379 |
| 441 | Ga0075434_100064385 | 3300006871 | Bacteria | 3650 |
| 442 | Ga0075434_100230258 | 3300006871 | Bacteria | 1872 |
| 443 | Ga0075434_100453317 | 3300006871 | Bacteria | 1304 |
| 444 | Ga0075434_101225506 | 3300006871 | Unclassified | 762 |
| 445 | Ga0075434_101234983 | 3300006871 | Bacteria | 759 |
| 446 | Ga0075434_101700812 | 3300006871 | Bacteria | 639 |
| 447 | Ga0075429_100004231 | 3300006880 | Bacteria | 12298 |
| 448 | Ga0075429_100069584 | 3300006880 | Bacteria | 3064 |
| 449 | Ga0075429_100610590 | 3300006880 | Archaea | 956 |
| 450 | Ga0068865_100005497 | 3300006881 | Bacteria | 7689 |
| 451 | Ga0068865_100072574 | 3300006881 | Bacteria | 2445 |
| 452 | Ga0068865_100237746 | 3300006881 | Bacteria | 1432 |
| 453 | Ga0068865_100555537 | 3300006881 | Bacteria | 965 |
| 454 | Ga0068865_101152444 | 3300006881 | Unclassified | 685 |
| 455 | Ga0068865_101844124 | 3300006881 | Unclassified | 547 |
| 456 | Ga0075436_100025990 | 3300006914 | Bacteria | 4031 |
| 457 | Ga0075436_100078023 | 3300006914 | Bacteria | 2294 |
| 458 | Ga0075436_100090721 | 3300006914 | Unclassified | 2124 |
| 459 | Ga0075436_100165673 | 3300006914 | Bacteria | 1559 |
| 460 | Ga0097620_100000610 | 3300006931 | Bacteria | 35815 |
| 461 | Ga0097620_100002575 | 3300006931 | Bacteria | 18433 |
| 462 | Ga0097620_100028602 | 3300006931 | Bacteria | 5588 |
| 463 | Ga0097620_100184910 | 3300006931 | Bacteria | 2167 |
| 464 | Ga0097620_100208042 | 3300006931 | Bacteria | 2042 |
| 465 | Ga0097620_100214821 | 3300006931 | Bacteria | 2010 |
| 466 | Ga0097620_101388779 | 3300006931 | Bacteria | 774 |
| 467 | Ga0097620_102081574 | 3300006931 | Bacteria | 626 |
| 468 | Ga0075435_100034942 | 3300007076 | Bacteria | 3987 |
| 469 | Ga0075435_100698580 | 3300007076 | Bacteria | 881 |
| 470 | Ga0075435_101704959 | 3300007076 | Unclassified | 553 |
| 471 | Ga0099794_10125645 | 3300007265 | Bacteria | 1293 |
| 472 | Ga0099794_10273023 | 3300007265 | Bacteria | 874 |
| 473 | Ga0099795_10607814 | 3300007788 | Bacteria | 521 |
| 474 | Ga0105240_10000631 | 3300009093 | Bacteria | 65015 |
| 475 | Ga0105240_10286085 | 3300009093 | Bacteria | 1892 |
| 476 | Ga0105240_10361418 | 3300009093 | Unclassified | 1644 |
| 477 | Ga0105240_10443611 | 3300009093 | Bacteria | 1454 |
| 478 | Ga0105240_10660850 | 3300009093 | Unclassified | 1144 |
| 479 | Ga0105240_11507845 | 3300009093 | Bacteria | 705 |
| 480 | Ga0111539_10000370 | 3300009094 | Bacteria | 55548 |
| 481 | Ga0111539_10282400 | 3300009094 | Bacteria | 1932 |
| 482 | Ga0111539_11549685 | 3300009094 | Bacteria | 768 |
| 483 | Ga0105245_10014746 | 3300009098 | Bacteria | 6806 |
| 484 | Ga0105245_10570905 | 3300009098 | Unclassified | 1155 |
| 485 | Ga0105247_10146799 | 3300009101 | Bacteria | 1551 |
| 486 | Ga0105247_10270397 | 3300009101 | Unclassified | 1169 |
| 487 | Ga0105247_10321849 | 3300009101 | Unclassified | 1079 |
| 488 | Ga0105247_10750871 | 3300009101 | Bacteria | 739 |
| 489 | Ga0114129_10042842 | 3300009147 | Bacteria | 6370 |
| 490 | Ga0114129_10098402 | 3300009147 | Bacteria | 4049 |
| 491 | Ga0114129_10158670 | 3300009147 | Bacteria | 3092 |
| 492 | Ga0114129_10209010 | 3300009147 | Bacteria | 2640 |
| 493 | Ga0114129_10514167 | 3300009147 | Unclassified | 1562 |
| 494 | Ga0114129_10998282 | 3300009147 | Unclassified | 1054 |
| 495 | Ga0105243_10128102 | 3300009148 | Bacteria | 2150 |
| 496 | Ga0105243_10788243 | 3300009148 | Bacteria | 935 |
| 497 | Ga0105243_11150977 | 3300009148 | Bacteria | 787 |
| 498 | Ga0105243_12332465 | 3300009148 | Bacteria | 573 |
| 499 | Ga0105241_10000218 | 3300009174 | Bacteria | 43050 |
| 500 | Ga0105241_10622006 | 3300009174 | Bacteria | 978 |
| 501 | Ga0105241_10981328 | 3300009174 | Unclassified | 789 |
| 502 | Ga0105241_11064906 | 3300009174 | Bacteria | 760 |
| 503 | Ga0105241_11107263 | 3300009174 | Bacteria | 746 |
| 504 | Ga0105241_11346610 | 3300009174 | Unclassified | 681 |
| 505 | Ga0105242_10301640 | 3300009176 | Bacteria | 1462 |
| 506 | Ga0105242_10531097 | 3300009176 | Unclassified | 1124 |
| 507 | Ga0105242_10625792 | 3300009176 | Bacteria | 1043 |
| 508 | Ga0105242_10716087 | 3300009176 | Bacteria | 981 |
| 509 | Ga0105242_11483690 | 3300009176 | Bacteria | 708 |
| 510 | Ga0105248_10000003 | 3300009177 | Bacteria | 1019601 |
| 511 | Ga0105248_10059326 | 3300009177 | Bacteria | 4298 |
| 512 | Ga0105248_10206787 | 3300009177 | Unclassified | 2212 |
| 513 | Ga0105248_10437759 | 3300009177 | Bacteria | 1473 |
| 514 | Ga0105248_10486124 | 3300009177 | Unclassified | 1391 |
| 515 | Ga0105248_10490679 | 3300009177 | Bacteria | 1385 |
| 516 | Ga0105248_10758461 | 3300009177 | Bacteria | 1095 |
| 517 | Ga0105248_11534571 | 3300009177 | Unclassified | 754 |
| 518 | Ga0105248_11980191 | 3300009177 | Bacteria | 662 |
| 519 | Ga0105237_10038178 | 3300009545 | Bacteria | 4851 |
| 520 | Ga0105237_10135744 | 3300009545 | Unclassified | 2455 |
| 521 | Ga0105237_10859458 | 3300009545 | Bacteria | 914 |
| 522 | Ga0105237_11037160 | 3300009545 | Bacteria | 827 |
| 523 | Ga0105237_12185466 | 3300009545 | Unclassified | 563 |
| 524 | Ga0105237_12364970 | 3300009545 | Unclassified | 541 |
| 525 | Ga0105238_10000330 | 3300009551 | Bacteria | 51705 |
| 526 | Ga0105238_10375897 | 3300009551 | Unclassified | 1412 |
| 527 | Ga0105238_11075153 | 3300009551 | Bacteria | 827 |
| 528 | Ga0105238_11728110 | 3300009551 | Unclassified | 657 |
| 529 | Ga0105238_12923362 | 3300009551 | Bacteria | 514 |
| 530 | Ga0105249_10045686 | 3300009553 | Bacteria | 3984 |
| 531 | Ga0105249_10081138 | 3300009553 | Bacteria | 3014 |
| 532 | Ga0105249_10808275 | 3300009553 | Bacteria | 1002 |
| 533 | Ga0105249_11319496 | 3300009553 | Bacteria | 793 |
| 534 | Ga0105249_12237989 | 3300009553 | Unclassified | 619 |
| 535 | Ga0105249_12515443 | 3300009553 | Unclassified | 587 |
| 536 | Ga0099796_10577339 | 3300010159 | Unclassified | 506 |
| 537 | Ga0105239_10017447 | 3300010375 | Bacteria | 7939 |
| 538 | Ga0105239_10136702 | 3300010375 | Bacteria | 2729 |
| 539 | Ga0105239_10490350 | 3300010375 | Bacteria | 1396 |
| 540 | Ga0105239_11237154 | 3300010375 | Bacteria | 861 |
| 541 | Ga0105239_11763757 | 3300010375 | Unclassified | 717 |
| 542 | Ga0105239_13635464 | 3300010375 | Unclassified | 501 |
| 543 | Ga0105246_10100913 | 3300011119 | Bacteria | 2101 |
| 544 | Ga0105246_10141582 | 3300011119 | Bacteria | 1809 |
| 545 | Ga0105246_10894702 | 3300011119 | Bacteria | 796 |
| 546 | Ga0105246_10944710 | 3300011119 | Bacteria | 777 |
| 547 | Ga0157373_10007747 | 3300013100 | Bacteria | 7984 |
| 548 | Ga0157373_10278390 | 3300013100 | Bacteria | 1185 |
| 549 | Ga0157373_10377827 | 3300013100 | Bacteria | 1013 |
| 550 | Ga0157373_10522220 | 3300013100 | Bacteria | 859 |
| 551 | Ga0157373_10977092 | 3300013100 | Bacteria | 631 |
| 552 | Ga0157371_10104300 | 3300013102 | Bacteria | 2012 |
| 553 | Ga0157371_10528594 | 3300013102 | Bacteria | 873 |
| 554 | Ga0157371_10715378 | 3300013102 | Bacteria | 750 |
| 555 | Ga0157371_11253077 | 3300013102 | Unclassified | 573 |
| 556 | Ga0157370_10297526 | 3300013104 | Unclassified | 1490 |
| 557 | Ga0157370_11124992 | 3300013104 | Bacteria | 709 |
| 558 | Ga0157370_11708890 | 3300013104 | Unclassified | 565 |
| 559 | Ga0157369_10000860 | 3300013105 | Bacteria | 38699 |
| 560 | Ga0157369_10036835 | 3300013105 | Bacteria | 5358 |
| 561 | Ga0157369_10038485 | 3300013105 | Bacteria | 5230 |
| 562 | Ga0157369_10039385 | 3300013105 | Bacteria | 5165 |
| 563 | Ga0157369_10042353 | 3300013105 | Bacteria | 4967 |
| 564 | Ga0157369_10057516 | 3300013105 | Bacteria | 4195 |
| 565 | Ga0157369_10091723 | 3300013105 | Bacteria | 3242 |
| 566 | Ga0157369_10475544 | 3300013105 | Bacteria | 1293 |
| 567 | Ga0157369_10648666 | 3300013105 | Bacteria | 1089 |
| 568 | Ga0157369_10718574 | 3300013105 | Unclassified | 1028 |
| 569 | Ga0157369_10744943 | 3300013105 | Bacteria | 1008 |
| 570 | Ga0157369_11275170 | 3300013105 | Bacteria | 749 |
| 571 | Ga0157369_11901950 | 3300013105 | Unclassified | 604 |
| 572 | Ga0157374_10000623 | 3300013296 | Bacteria | 31137 |
| 573 | Ga0157374_10001096 | 3300013296 | Bacteria | 23321 |
| 574 | Ga0157374_10068368 | 3300013296 | Bacteria | 3342 |
| 575 | Ga0157374_10207287 | 3300013296 | Bacteria | 1921 |
| 576 | Ga0157374_11343491 | 3300013296 | Unclassified | 737 |
| 577 | Ga0157378_10001737 | 3300013297 | Bacteria | 19543 |
| 578 | Ga0157378_10004369 | 3300013297 | Bacteria | 12440 |
| 579 | Ga0157378_10095679 | 3300013297 | Bacteria | 2705 |
| 580 | Ga0157378_10562822 | 3300013297 | Unclassified | 1147 |
| 581 | Ga0157378_11334226 | 3300013297 | Bacteria | 759 |
| 582 | Ga0157378_12571293 | 3300013297 | Unclassified | 561 |
| 583 | Ga0163162_10001630 | 3300013306 | Bacteria | 20998 |
| 584 | Ga0163162_10225317 | 3300013306 | Bacteria | 2004 |
| 585 | Ga0163162_10842400 | 3300013306 | Bacteria | 1032 |
| 586 | Ga0163162_11506763 | 3300013306 | Bacteria | 766 |
| 587 | Ga0163162_11714965 | 3300013306 | Bacteria | 717 |
| 588 | Ga0163162_12114399 | 3300013306 | Bacteria | 646 |
| 589 | Ga0163162_12383620 | 3300013306 | Unclassified | 608 |
| 590 | Ga0163162_13095874 | 3300013306 | Unclassified | 534 |
| 591 | Ga0157372_10002736 | 3300013307 | Bacteria | 19044 |
| 592 | Ga0157372_10006133 | 3300013307 | Bacteria | 12777 |
| 593 | Ga0157372_10015841 | 3300013307 | Bacteria | 8088 |
| 594 | Ga0157372_10034967 | 3300013307 | Bacteria | 5529 |
| 595 | Ga0157372_10071734 | 3300013307 | Bacteria | 3901 |
| 596 | Ga0157372_10139785 | 3300013307 | Bacteria | 2789 |
| 597 | Ga0157372_10206201 | 3300013307 | Unclassified | 2278 |
| 598 | Ga0157372_10470821 | 3300013307 | Bacteria | 1464 |
| 599 | Ga0157372_10540767 | 3300013307 | Unclassified | 1358 |
| 600 | Ga0157372_11024480 | 3300013307 | Unclassified | 956 |
| 601 | Ga0157372_11039895 | 3300013307 | Bacteria | 948 |
| 602 | Ga0157375_10258654 | 3300013308 | Unclassified | 1902 |
| 603 | Ga0157375_10440063 | 3300013308 | Bacteria | 1469 |
| 604 | Ga0157375_11030670 | 3300013308 | Bacteria | 961 |
| 605 | Ga0157375_11710345 | 3300013308 | Bacteria | 745 |
| 606 | Ga0163163_10203524 | 3300014325 | Bacteria | 2028 |
| 607 | Ga0163163_10482239 | 3300014325 | Bacteria | 1301 |
| 608 | Ga0163163_11221169 | 3300014325 | Bacteria | 814 |
| 609 | Ga0157380_10427492 | 3300014326 | Bacteria | 1265 |
| 610 | Ga0157380_10950765 | 3300014326 | Bacteria | 889 |
| 611 | Ga0182008_10056847 | 3300014497 | Unclassified | 1932 |
| 612 | Ga0157377_10039326 | 3300014745 | Unclassified | 2616 |
| 613 | Ga0157377_10124565 | 3300014745 | Unclassified | 1566 |
| 614 | Ga0157379_10025795 | 3300014968 | Bacteria | 5225 |
| 615 | Ga0157379_10059338 | 3300014968 | Bacteria | 3421 |
| 616 | Ga0157379_10103084 | 3300014968 | Bacteria | 2560 |
| 617 | Ga0157379_10596177 | 3300014968 | Unclassified | 1031 |
| 618 | Ga0157376_10133813 | 3300014969 | Unclassified | 2216 |
| 619 | Ga0157376_10182867 | 3300014969 | Bacteria | 1917 |
| 620 | Ga0157376_10261252 | 3300014969 | Bacteria | 1622 |
| 621 | Ga0157376_10346467 | 3300014969 | Bacteria | 1420 |
| 622 | Ga0157376_12108704 | 3300014969 | Bacteria | 602 |
| 623 | Ga0182007_10040446 | 3300015262 | Bacteria | 1557 |
| 624 | Ga0206354_10273109 | 3300020081 | Unclassified | 707 |
| 625 | Ga0206353_11476773 | 3300020082 | Unclassified | 2067 |
| 626 | Ga0207653_10039108 | 3300025885 | Bacteria | 1552 |
| 627 | Ga0207653_10045081 | 3300025885 | Bacteria | 1456 |
| 628 | Ga0207653_10087152 | 3300025885 | Bacteria | 1089 |
| 629 | Ga0207682_10209462 | 3300025893 | Unclassified | 899 |
| 630 | Ga0207692_10287538 | 3300025898 | Unclassified | 996 |
| 631 | Ga0207710_10021562 | 3300025900 | Bacteria | 2762 |
| 632 | Ga0207647_10215025 | 3300025904 | Unclassified | 1109 |
| 633 | Ga0207685_10277766 | 3300025905 | Bacteria | 821 |
| 634 | Ga0207699_10187793 | 3300025906 | Bacteria | 1393 |
| 635 | Ga0207645_10001324 | 3300025907 | Bacteria | 20346 |
| 636 | Ga0207645_10192689 | 3300025907 | Bacteria | 1340 |
| 637 | Ga0207643_10000157 | 3300025908 | Bacteria | 46902 |
| 638 | Ga0207684_10008133 | 3300025910 | Bacteria | 9350 |
| 639 | Ga0207684_10010283 | 3300025910 | Bacteria | 8236 |
| 640 | Ga0207684_10014651 | 3300025910 | Bacteria | 6754 |
| 641 | Ga0207684_10088487 | 3300025910 | Bacteria | 2638 |
| 642 | Ga0207684_10170081 | 3300025910 | Bacteria | 1878 |
| 643 | Ga0207684_10387218 | 3300025910 | Bacteria | 1202 |
| 644 | Ga0207684_10423134 | 3300025910 | Unclassified | 1144 |
| 645 | Ga0207654_10026891 | 3300025911 | Bacteria | 3122 |
| 646 | Ga0207654_11059643 | 3300025911 | Bacteria | 590 |
| 647 | Ga0207707_10000258 | 3300025912 | Bacteria | 57257 |
| 648 | Ga0207707_10174070 | 3300025912 | Bacteria | 1880 |
| 649 | Ga0207707_10582329 | 3300025912 | Unclassified | 948 |
| 650 | Ga0207707_11663668 | 3300025912 | Bacteria | 501 |
| 651 | Ga0207695_10006130 | 3300025913 | Bacteria | 15682 |
| 652 | Ga0207695_10472289 | 3300025913 | Unclassified | 1137 |
| 653 | Ga0207671_10241288 | 3300025914 | Bacteria | 1419 |
| 654 | Ga0207693_10001303 | 3300025915 | Bacteria | 22126 |
| 655 | Ga0207693_10142219 | 3300025915 | Bacteria | 1886 |
| 656 | Ga0207663_10052807 | 3300025916 | Bacteria | 2536 |
| 657 | Ga0207660_10224521 | 3300025917 | Unclassified | 1475 |
| 658 | Ga0207660_10414539 | 3300025917 | Unclassified | 1086 |
| 659 | Ga0207660_11131258 | 3300025917 | Bacteria | 638 |
| 660 | Ga0207662_10080195 | 3300025918 | Bacteria | 1990 |
| 661 | Ga0207657_10000373 | 3300025919 | Bacteria | 47375 |
| 662 | Ga0207649_10006286 | 3300025920 | Bacteria | 6452 |
| 663 | Ga0207652_10004142 | 3300025921 | Bacteria | 11838 |
| 664 | Ga0207652_10141140 | 3300025921 | Bacteria | 2154 |
| 665 | Ga0207646_10004675 | 3300025922 | Bacteria | 14754 |
| 666 | Ga0207646_10044552 | 3300025922 | Bacteria | 3982 |
| 667 | Ga0207646_10047209 | 3300025922 | Bacteria | 3863 |
| 668 | Ga0207646_10051594 | 3300025922 | Bacteria | 3680 |
| 669 | Ga0207646_10065789 | 3300025922 | Bacteria | 3236 |
| 670 | Ga0207646_10105489 | 3300025922 | Bacteria | 2527 |
| 671 | Ga0207646_10233756 | 3300025922 | Bacteria | 1661 |
| 672 | Ga0207646_10490945 | 3300025922 | Unclassified | 1107 |
| 673 | Ga0207681_10088200 | 3300025923 | Bacteria | 2209 |
| 674 | Ga0207694_11837595 | 3300025924 | Bacteria | 509 |
| 675 | Ga0207650_10076533 | 3300025925 | Unclassified | 2528 |
| 676 | Ga0207659_10176184 | 3300025926 | Unclassified | 1690 |
| 677 | Ga0207687_11484018 | 3300025927 | Unclassified | 582 |
| 678 | Ga0207690_10095350 | 3300025932 | Unclassified | 2113 |
| 679 | Ga0207706_10001857 | 3300025933 | Bacteria | 20682 |
| 680 | Ga0207706_10008929 | 3300025933 | Bacteria | 9225 |
| 681 | Ga0207706_10864532 | 3300025933 | Bacteria | 765 |
| 682 | Ga0207686_10339234 | 3300025934 | Bacteria | 1128 |
| 683 | Ga0207686_11157419 | 3300025934 | Bacteria | 632 |
| 684 | Ga0207709_10115773 | 3300025935 | Unclassified | 1801 |
| 685 | Ga0207709_11127613 | 3300025935 | Bacteria | 645 |
| 686 | Ga0207670_10028434 | 3300025936 | Bacteria | 3550 |
| 687 | Ga0207670_10036465 | 3300025936 | Bacteria | 3198 |
| 688 | Ga0207670_11267801 | 3300025936 | Bacteria | 625 |
| 689 | Ga0207704_10384794 | 3300025938 | Bacteria | 1102 |
| 690 | Ga0207704_10598929 | 3300025938 | Unclassified | 902 |
| 691 | Ga0207665_10005743 | 3300025939 | Bacteria | 8257 |
| 692 | Ga0207665_10657713 | 3300025939 | Bacteria | 822 |
| 693 | Ga0207691_11411252 | 3300025940 | Unclassified | 572 |
| 694 | Ga0207711_11300423 | 3300025941 | Unclassified | 669 |
| 695 | Ga0207689_10000975 | 3300025942 | Bacteria | 27466 |
| 696 | Ga0207689_10002812 | 3300025942 | Bacteria | 16083 |
| 697 | Ga0207661_10257351 | 3300025944 | Unclassified | 1554 |
| 698 | Ga0207679_10000779 | 3300025945 | Bacteria | 20862 |
| 699 | Ga0207667_10000857 | 3300025949 | Bacteria | 39178 |
| 700 | Ga0207667_10327367 | 3300025949 | Unclassified | 1564 |
| 701 | Ga0207667_10977281 | 3300025949 | Unclassified | 835 |
| 702 | Ga0207712_10058438 | 3300025961 | Bacteria | 2725 |
| 703 | Ga0207712_10274100 | 3300025961 | Unclassified | 1374 |
| 704 | Ga0207712_10552620 | 3300025961 | Bacteria | 990 |
| 705 | Ga0207640_10032375 | 3300025981 | Bacteria | 3241 |
| 706 | Ga0207658_11341873 | 3300025986 | Bacteria | 654 |
| 707 | Ga0207658_12040675 | 3300025986 | Unclassified | 522 |
| 708 | Ga0207677_10011276 | 3300026023 | Bacteria | 5088 |
| 709 | Ga0207703_10199610 | 3300026035 | Bacteria | 1777 |
| 710 | Ga0207703_10366062 | 3300026035 | Unclassified | 1331 |
| 711 | Ga0207703_11318259 | 3300026035 | Bacteria | 694 |
| 712 | Ga0207703_11951730 | 3300026035 | Bacteria | 563 |
| 713 | Ga0207639_10042698 | 3300026041 | Unclassified | 3399 |
| 714 | Ga0207678_10002143 | 3300026067 | Bacteria | 17878 |
| 715 | Ga0207708_10089290 | 3300026075 | Bacteria | 2375 |
| 716 | Ga0207708_10211569 | 3300026075 | Bacteria | 1550 |
| 717 | Ga0207708_10415349 | 3300026075 | Bacteria | 1115 |
| 718 | Ga0207708_10918024 | 3300026075 | Unclassified | 758 |
| 719 | Ga0207702_10001041 | 3300026078 | Bacteria | 28384 |
| 720 | Ga0207641_10110682 | 3300026088 | Bacteria | 2434 |
| 721 | Ga0207641_10134689 | 3300026088 | Unclassified | 2222 |
| 722 | Ga0207641_10470644 | 3300026088 | Unclassified | 1217 |
| 723 | Ga0207648_10027225 | 3300026089 | Bacteria | 5078 |
| 724 | Ga0207648_10513436 | 3300026089 | Bacteria | 1097 |
| 725 | Ga0207676_10005775 | 3300026095 | Bacteria | 8752 |
| 726 | Ga0207676_10835249 | 3300026095 | Bacteria | 900 |
| 727 | Ga0207674_10008510 | 3300026116 | Bacteria | 11845 |
| 728 | Ga0207674_10197920 | 3300026116 | Bacteria | 1959 |
| 729 | Ga0207675_100028715 | 3300026118 | Bacteria | 5182 |
| 730 | Ga0207675_100041467 | 3300026118 | Bacteria | 4299 |
| 731 | Ga0207675_100241559 | 3300026118 | Bacteria | 1745 |
| 732 | Ga0207698_11209964 | 3300026142 | Bacteria | 769 |
| 733 | Ga0209971_1086318 | 3300027682 | Unclassified | 765 |
| 734 | Ga0209974_10080257 | 3300027876 | Bacteria | 1122 |
| 735 | Ga0209974_10215543 | 3300027876 | Unclassified | 713 |
| 736 | Ga0207428_10000409 | 3300027907 | Bacteria | 53318 |
| 737 | Ga0207428_10055666 | 3300027907 | Bacteria | 3144 |
| 738 | Ga0268265_10012391 | 3300028380 | Bacteria | 5778 |
| 739 | Ga0268265_10039330 | 3300028380 | Bacteria | 3486 |
| 740 | Ga0268265_10183974 | 3300028380 | Bacteria | 1798 |
| 741 | Ga0268265_10613472 | 3300028380 | Bacteria | 1041 |
| 742 | Ga0268265_11470376 | 3300028380 | Unclassified | 684 |
| 743 | Ga0268264_10020556 | 3300028381 | Bacteria | 5394 |
| 744 | Ga0268264_10184885 | 3300028381 | Bacteria | 1895 |
| 745 | Ga0268264_10279165 | 3300028381 | Bacteria | 1564 |
| 746 | Ga0265338_10900391 | 3300028800 | Unclassified | 602 |
| 747 | Ga0373930_0037196 | 3300034816 | Bacteria | 1024 |
| 748 | Ga0373948_0031154 | 3300034817 | Unclassified | 1076 |
| 749 | Ga0373959_0010060 | 3300034820 | Bacteria | 1646 |
| 750 | Ga0373929_0012726 | 3300035085 | Unclassified | 1603 |
| 751 | Ga0373934_0152402 | 3300035086 | Unclassified | 947 |
| 752 | Ga0373949_0041100 | 3300035090 | Bacteria | 1137 |
| 753 | Ga0373949_0214466 | 3300035090 | Unclassified | 583 |
| 754 | Ga0373951_0181220 | 3300035091 | Unclassified | 605 |
| 755 | Ga0373952_0163889 | 3300035092 | Bacteria | 631 |
| 756 | Ga0373936_0563372 | 3300035113 | Unclassified | 533 |
| 757 | Ga0373941_0307983 | 3300035115 | Unclassified | 634 |
| 758 | Ga0373953_0022081 | 3300035117 | Bacteria | 2396 |
| 759 | Ga0373956_0167277 | 3300035119 | Bacteria | 1037 |
| 760 | Ga0373960_0125478 | 3300035121 | Bacteria | 856 |
| 761 | Ga0373961_0023387 | 3300035241 | Unclassified | 1662 |
| 762 | Ga0373962_0095026 | 3300035242 | Bacteria | 923 |
| 763 | Ga0316584_0721120 | 3300036712 | Bacteria | 682 |
| 764 | Ga0395905_0393256 | 3300037471 | Bacteria | 1281 |
| 765 | Ga0242420_137901 | 3300038996 | Unclassified | 541 |
| 766 | Ga0436362_0536511 | 3300039453 | Unclassified | 520 |
| 767 | Ga0436362_0750444 | 3300039453 | Bacteria | 3396 |
| 768 | Ga0439443_103721 | 3300042003 | Unclassified | 546 |
| 769 | Ga0439448_0123190 | 3300042005 | Bacteria | 890 |
| 770 | Ga0439450_019674 | 3300042008 | Unclassified | 1433 |
| 771 | Ga0439455_0061480 | 3300042012 | Unclassified | 997 |
| 772 | Ga0450914_059757 | 3300042118 | Bacteria | 515 |
| 773 | Ga0439458_0084944 | 3300042157 | Unclassified | 810 |
| 774 | Ga0439459_0015470 | 3300042438 | Unclassified | 1398 |
| 775 | Ga0439464_0001377 | 3300042439 | Bacteria | 5694 |
| 776 | Ga0439464_0287693 | 3300042439 | Unclassified | 535 |
| 777 | Ga0439460_0004434 | 3300042461 | Bacteria | 3421 |
| 778 | Ga0439460_0098969 | 3300042461 | Unclassified | 935 |
| 779 | Ga0451577_0003197 | 3300042876 | Bacteria | 18404 |
| 780 | Ga0451577_0017287 | 3300042876 | Bacteria | 6665 |
| 781 | Ga0451577_0678249 | 3300042876 | Unclassified | 934 |
| 782 | Ga0451577_0888856 | 3300042876 | Unclassified | 802 |
| 783 | Ga0439440_0080245 | 3300042993 | Unclassified | 862 |
| 784 | Ga0439440_0111873 | 3300042993 | Bacteria | 752 |
| 785 | Ga0439440_0171081 | 3300042993 | Unclassified | 632 |
| 786 | Ga0453683_0032136 | 3300044673 | Bacteria | 3313 |
| 787 | Ga0453683_0048690 | 3300044673 | Bacteria | 2658 |
| 788 | Ga0466963_0255477 | 3300044694 | Bacteria | 1230 |
| 789 | Ga0466963_0397232 | 3300044694 | Unclassified | 972 |
| 790 | Ga0453684_0051544 | 3300044712 | Bacteria | 5392 |
| 791 | Ga0453684_0176401 | 3300044712 | Bacteria | 2513 |
| 792 | Ga0453684_1756387 | 3300044712 | Unclassified | 632 |
| 793 | Ga0451576_0016285 | 3300045051 | Bacteria | 8210 |
| 794 | Ga0451576_0021455 | 3300045051 | Bacteria | 7019 |
| 795 | Ga0451576_0109256 | 3300045051 | Bacteria | 2878 |
| 796 | Ga0451576_0374364 | 3300045051 | Bacteria | 1492 |
| 797 | Ga0451576_1819223 | 3300045051 | Unclassified | 629 |
| 798 | Ga0466958_0362224 | 3300045836 | Bacteria | 934 |
| 799 | Ga0466958_0387879 | 3300045836 | Bacteria | 901 |
| 800 | Ga0495603_0151546 | 3300046455 | Bacteria | 1347 |
| 801 | Ga0495651_0802509 | 3300046462 | Bacteria | 581 |
| 802 | Ga0495580_0142533 | 3300046472 | Bacteria | 1661 |
| 803 | Ga0495605_0386270 | 3300046474 | Bacteria | 584 |
| 804 | Ga0495662_0188767 | 3300046476 | Bacteria | 1016 |
| 805 | Ga0495664_0110358 | 3300046477 | Bacteria | 1660 |
| 806 | Ga0495584_0105366 | 3300046491 | Bacteria | 1426 |
| 807 | Ga0495594_0185997 | 3300046499 | Bacteria | 1183 |
| 808 | Ga0495628_0924417 | 3300046516 | Bacteria | 604 |
| 809 | Ga0495642_0040523 | 3300046528 | Bacteria | 1892 |
| 810 | Ga0495665_0150775 | 3300046531 | Bacteria | 1214 |
| 811 | Ga0495665_0280743 | 3300046531 | Bacteria | 854 |
| 812 | Ga0495586_0152297 | 3300046535 | Bacteria | 1301 |
| 813 | Ga0495587_0549160 | 3300046536 | Bacteria | 637 |
| 814 | Ga0495645_0084383 | 3300046543 | Bacteria | 2275 |
| 815 | Ga0495588_0153989 | 3300046674 | Unclassified | 1215 |
| 816 | Ga0495657_0702546 | 3300046675 | Bacteria | 581 |
| 817 | Ga0495599_0625873 | 3300046678 | Bacteria | 625 |
| 818 | Ga0495623_0145129 | 3300046679 | Bacteria | 1408 |
| 819 | Ga0495669_0172550 | 3300046684 | Unclassified | 1029 |
| 820 | Ga0495600_0235295 | 3300046809 | Unclassified | 1168 |
| 821 | Ga0495581_0348250 | 3300047315 | Bacteria | 865 |
| 822 | Ga0495581_0701533 | 3300047315 | Bacteria | 584 |
| 823 | Ga0495604_0097872 | 3300047317 | Bacteria | 2163 |
| 824 | Ga0495636_0700550 | 3300047318 | Bacteria | 500 |
| 825 | Ga0495683_0346110 | 3300047323 | Unclassified | 628 |
| 826 | Ga0495675_0236553 | 3300047444 | Bacteria | 1100 |
| 827 | Ga0495677_0125595 | 3300047445 | Unclassified | 980 |
| 828 | Ga0495602_0906776 | 3300048088 | Bacteria | 586 |
| 829 | Ga0495614_0214934 | 3300048089 | Bacteria | 873 |
| 830 | Ga0496102_1182226 | 3300048905 | Bacteria | 684 |
| 831 | Ga0496104_0684301 | 3300048907 | Unclassified | 934 |
| 832 | Ga0496104_0969422 | 3300048907 | Bacteria | 755 |
| 833 | Ga0496106_0518118 | 3300048909 | Bacteria | 958 |
| 834 | Ga0496107_0602822 | 3300048910 | Unclassified | 812 |
| 835 | Ga0496108_0529524 | 3300048911 | Bacteria | 1029 |
| 836 | Ga0496108_1750826 | 3300048911 | Unclassified | 510 |
| 837 | Ga0496109_0475554 | 3300048912 | Unclassified | 1180 |
| 838 | Ga0496109_0993790 | 3300048912 | Bacteria | 777 |
| 839 | Ga0496110_0876434 | 3300048913 | Unclassified | 803 |
| 840 | Ga0496112_0735378 | 3300048915 | Unclassified | 913 |
| 841 | Ga0496112_0993179 | 3300048915 | Unclassified | 759 |
| 842 | Ga0496113_0103521 | 3300048916 | Bacteria | 2208 |
| 843 | Ga0496113_1117253 | 3300048916 | Bacteria | 618 |
| 844 | Ga0496113_1350575 | 3300048916 | Unclassified | 553 |
| 845 | Ga0496115_0028275 | 3300048918 | Bacteria | 4394 |
| 846 | Ga0501032_0271872 | 3300049569 | Unclassified | 1098 |
| 847 | Ga0501033_0064984 | 3300049570 | Unclassified | 2684 |
| 848 | Ga0501033_0260019 | 3300049570 | Bacteria | 1229 |
| 849 | Ga0501036_0307362 | 3300049572 | Unclassified | 1326 |
| 850 | Ga0501036_0514743 | 3300049572 | Bacteria | 995 |
| 851 | Ga0501036_0629317 | 3300049572 | Bacteria | 889 |
| 852 | Ga0501036_1305803 | 3300049572 | Unclassified | 590 |
| 853 | Ga0501038_0150053 | 3300049574 | Unclassified | 1901 |
| 854 | Ga0501038_0191815 | 3300049574 | Unclassified | 1644 |
| 855 | Ga0501039_0079790 | 3300049575 | Unclassified | 2546 |
| 856 | Ga0501039_0305461 | 3300049575 | Bacteria | 1251 |
| 857 | Ga0501040_0003451 | 3300049576 | Bacteria | 10205 |
| 858 | Ga0501040_0041964 | 3300049576 | Bacteria | 3116 |
| 859 | Ga0501040_0136829 | 3300049576 | Bacteria | 1725 |
| 860 | Ga0501040_0192808 | 3300049576 | Bacteria | 1446 |
| 861 | Ga0501041_0003300 | 3300049577 | Bacteria | 9278 |
| 862 | Ga0501041_0233225 | 3300049577 | Bacteria | 1156 |
| 863 | Ga0501042_0009827 | 3300049578 | Bacteria | 6390 |
| 864 | Ga0501042_0105895 | 3300049578 | Bacteria | 2024 |
| 865 | Ga0501042_1321187 | 3300049578 | Bacteria | 526 |
| 866 | Ga0501043_0188199 | 3300049579 | Unclassified | 1606 |
| 867 | Ga0501043_0276229 | 3300049579 | Bacteria | 1289 |
| 868 | Ga0501046_0000607 | 3300049580 | Bacteria | 35214 |
| 869 | Ga0501046_0073675 | 3300049580 | Bacteria | 2650 |
| 870 | Ga0501046_0896204 | 3300049580 | Bacteria | 619 |
| 871 | Ga0501048_0189964 | 3300049582 | Bacteria | 1455 |
| 872 | Ga0501067_0576000 | 3300049583 | Bacteria | 631 |
| 873 | Ga0501068_0318313 | 3300049584 | Unclassified | 997 |
| 874 | Ga0501068_0562728 | 3300049584 | Bacteria | 742 |
| 875 | Ga0501069_0138456 | 3300049585 | Bacteria | 1396 |
| 876 | Ga0501069_0554619 | 3300049585 | Bacteria | 688 |
| 877 | Ga0501071_0247162 | 3300049587 | Bacteria | 1346 |
| 878 | Ga0501071_0626163 | 3300049587 | Unclassified | 828 |
| 879 | Ga0501072_0119308 | 3300049588 | Bacteria | 2102 |
| 880 | Ga0501072_0215305 | 3300049588 | Bacteria | 1531 |
| 881 | Ga0501073_0537600 | 3300049589 | Bacteria | 808 |
| 882 | Ga0501074_0171986 | 3300049590 | Bacteria | 1546 |
| 883 | Ga0501074_0286895 | 3300049590 | Unclassified | 1170 |
| 884 | Ga0501075_0315584 | 3300049591 | Unclassified | 1191 |
| 885 | Ga0501075_0668076 | 3300049591 | Unclassified | 792 |
| 886 | Ga0501076_0003696 | 3300049592 | Bacteria | 10761 |
| 887 | Ga0501076_0181203 | 3300049592 | Unclassified | 1717 |
| 888 | Ga0501076_0221552 | 3300049592 | Unclassified | 1546 |
| 889 | Ga0501076_0744962 | 3300049592 | Bacteria | 808 |
| 890 | Ga0501076_1525842 | 3300049592 | Unclassified | 548 |
| 891 | Ga0501077_0023484 | 3300049593 | Bacteria | 3911 |
| 892 | Ga0501077_0128880 | 3300049593 | Bacteria | 1604 |
| 893 | Ga0501077_0129556 | 3300049593 | Bacteria | 1599 |
| 894 | Ga0501077_0338062 | 3300049593 | Bacteria | 960 |
| 895 | Ga0501079_0009586 | 3300049741 | Bacteria | 7342 |
| 896 | Ga0501079_0022016 | 3300049741 | Bacteria | 4883 |
| 897 | Ga0501079_0722716 | 3300049741 | Bacteria | 784 |
| 898 | Ga0501079_1042496 | 3300049741 | Unclassified | 644 |
| 899 | Ga0501080_0028717 | 3300049742 | Bacteria | 5178 |
| 900 | Ga0501080_0390477 | 3300049742 | Bacteria | 1253 |
| 901 | Ga0501080_0568033 | 3300049742 | Bacteria | 1009 |
| 902 | Ga0501081_0018275 | 3300049743 | Bacteria | 4653 |
| 903 | Ga0501081_0060230 | 3300049743 | Bacteria | 2630 |
| 904 | Ga0501081_0183134 | 3300049743 | Unclassified | 1515 |
| 905 | Ga0501081_0443008 | 3300049743 | Unclassified | 964 |
| 906 | Ga0501083_0186803 | 3300049744 | Bacteria | 1353 |
| 907 | Ga0501083_0321280 | 3300049744 | Bacteria | 1007 |
| 908 | Ga0501035_0391223 | 3300049822 | Unclassified | 1158 |
| 909 | Ga0501045_0090523 | 3300049824 | Bacteria | 2261 |
| 910 | Ga0501045_0112285 | 3300049824 | Bacteria | 2021 |
| 911 | Ga0501045_0250114 | 3300049824 | Bacteria | 1319 |
| 912 | Ga0501045_0501717 | 3300049824 | Bacteria | 901 |
| 913 | nmdc:mga05p37_1068125_c1 | 3300050507 | Bacteria | 849 |
| 914 | nmdc:mga05p37_131447_c1 | 3300050507 | Bacteria | 3071 |
| 915 | nmdc:mga05p37_1343294_c1 | 3300050507 | Unclassified | 725 |
| 916 | nmdc:mga05p37_261175_c2 | 3300050507 | Bacteria | 1603 |
| 917 | nmdc:mga05p37_286830_c1 | 3300050507 | Unclassified | 1961 |
| 918 | nmdc:mga05p37_40058_c1 | 3300050507 | Bacteria | 5754 |
| 919 | nmdc:mga05p37_43249_c1 | 3300050507 | Bacteria | 5540 |
| 920 | nmdc:mga05p37_465902_c1 | 3300050507 | Bacteria | 1459 |
| 921 | nmdc:mga05p37_70128_c1 | 3300050507 | Bacteria | 4311 |
| 922 | nmdc:mga09592_11878_c1 | 3300050508 | Bacteria | 7084 |
| 923 | nmdc:mga09592_147685_c1 | 3300050508 | Unclassified | 2027 |
| 924 | nmdc:mga09592_84995_c1 | 3300050508 | Unclassified | 2699 |
| 925 | nmdc:mga0qj67_1363606_c1 | 3300050509 | Unclassified | 548 |
| 926 | nmdc:mga06r32_2118_c1 | 3300050510 | Bacteria | 17775 |
| 927 | nmdc:mga06r32_402829_c1 | 3300050510 | Bacteria | 1350 |
| 928 | nmdc:mga06r32_545350_c1 | 3300050510 | Bacteria | 1134 |
| 929 | nmdc:mga08y16_14948_c1 | 3300050511 | Bacteria | 8164 |
| 930 | nmdc:mga08y16_872768_c1 | 3300050511 | Bacteria | 888 |
| 931 | nmdc:mga0n895_1147262_c1 | 3300050512 | Unclassified | 753 |
| 932 | nmdc:mga0n895_12241_c1 | 3300050512 | Bacteria | 7688 |
| 933 | nmdc:mga0n895_1752318_c1 | 3300050512 | Bacteria | 583 |
| 934 | nmdc:mga0n895_22280_c1 | 3300050512 | Bacteria | 5939 |
| 935 | nmdc:mga0n895_236999_c1 | 3300050512 | Unclassified | 1852 |
| 936 | nmdc:mga0n895_659279_c1 | 3300050512 | Bacteria | 1045 |
| 937 | nmdc:mga0n895_774714_c1 | 3300050512 | Bacteria | 951 |
| 938 | nmdc:mga0n895_796590_c1 | 3300050512 | Unclassified | 936 |
| 939 | nmdc:mga0rr50_1393201_c1 | 3300050513 | Unclassified | 594 |
| 940 | nmdc:mga0rr50_39532_c1 | 3300050513 | Bacteria | 3423 |
| 941 | nmdc:mga0rr50_4563_c1 | 3300050513 | Bacteria | 8150 |
| 942 | nmdc:mga0rr50_884105_c1 | 3300050513 | Unclassified | 762 |
| 943 | nmdc:mga08x19_15303_c1 | 3300050514 | Bacteria | 4667 |
| 944 | nmdc:mga08x19_185061_c1 | 3300050514 | Unclassified | 1423 |
| 945 | nmdc:mga0a205_332583_c1 | 3300050515 | Unclassified | 1389 |
| 946 | nmdc:mga0a205_48721_c1 | 3300050515 | Bacteria | 4090 |
| 947 | nmdc:mga0a205_74174_c1 | 3300050515 | Bacteria | 3288 |
| 948 | nmdc:mga0a205_84734_c1 | 3300050515 | Bacteria | 3062 |
| 949 | nmdc:mga0a205_9635_c1 | 3300050515 | Bacteria | 8843 |
| 950 | nmdc:mga0a205_989509_c1 | 3300050515 | Bacteria | 688 |
| 951 | Ga0501084_0012880 | 3300054114 | Bacteria | 6927 |
| 952 | Ga0501084_0046613 | 3300054114 | Bacteria | 3632 |
| 953 | Ga0501084_0110288 | 3300054114 | Bacteria | 2312 |
| 954 | Ga0501084_0113395 | 3300054114 | Bacteria | 2279 |
| 955 | Ga0501082_0001321 | 3300060353 | Bacteria | 21707 |
| 956 | Ga0501082_0105974 | 3300060353 | Bacteria | 2432 |
| 957 | Ga0501082_0293158 | 3300060353 | Unclassified | 1416 |
| 958 | Ga0530510_0047065 | 3300061734 | Unclassified | 3116 |
| 959 | Ga0530510_0707923 | 3300061734 | Unclassified | 767 |
| 960 | Ga0530510_1420814 | 3300061734 | Unclassified | 532 |
| 961 | Ga0530510_1463227 | 3300061734 | Unclassified | 524 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005444 | Ga0070694_100133588 | Ga0070694_1001335882 | 61 |
| 2 | 3300005445 | Ga0070708_100394414 | Ga0070708_1003944142 | 61 |
| 3 | 3300005468 | Ga0070707_100020638 | Ga0070707_1000206382 | 61 |
| 4 | 3300005468 | Ga0070707_102217388 | Ga0070707_1022173881 | 61 |
| 5 | 3300005471 | Ga0070698_100180111 | Ga0070698_1001801112 | 61 |
| 6 | 3300005549 | Ga0070704_101807375 | Ga0070704_1018073751 | 61 |
| 7 | 3300006847 | Ga0075431_100224811 | Ga0075431_1002248112 | 61 |
| 8 | 3300025922 | Ga0207646_10233756 | Ga0207646_102337562 | 61 |
| 9 | 3300047318 | Ga0495636_0700550 | Ga0495636_0700550_248_439 | 61 |
| 10 | 3300050507 | nmdc:mga05p37_1068125_c1 | nmdc:mga05p37_1068125_c1_600_791 | 61 |
| 11 | 3300050510 | nmdc:mga06r32_402829_c1 | nmdc:mga06r32_402829_c1_835_1026 | 61 |
| 12 | 3300000546 | LJNas_1001299 | LJNas_10012992 | 62 |
| 13 | 3300001978 | JGI24747J21853_1005708 | JGI24747J21853_10057083 | 62 |
| 14 | 3300001990 | JGI24737J22298_10107498 | JGI24737J22298_101074982 | 62 |
| 15 | 3300001991 | JGI24743J22301_10007173 | JGI24743J22301_100071732 | 62 |
| 16 | 3300002459 | JGI24751J29686_10001058 | JGI24751J29686_100010583 | 62 |
| 17 | 3300004799 | Ga0058863_10163623 | Ga0058863_101636231 | 62 |
| 18 | 3300004800 | Ga0058861_10095151 | Ga0058861_100951511 | 62 |
| 19 | 3300004800 | Ga0058861_10169578 | Ga0058861_101695782 | 62 |
| 20 | 3300004800 | Ga0058861_10171377 | Ga0058861_101713773 | 62 |
| 21 | 3300004803 | Ga0058862_10211581 | Ga0058862_102115812 | 62 |
| 22 | 3300005290 | Ga0065712_10047790 | Ga0065712_100477902 | 62 |
| 23 | 3300005290 | Ga0065712_10312758 | Ga0065712_103127581 | 62 |
| 24 | 3300005293 | Ga0065715_10310948 | Ga0065715_103109481 | 62 |
| 25 | 3300005295 | Ga0065707_10208242 | Ga0065707_102082422 | 62 |
| 26 | 3300005295 | Ga0065707_10360330 | Ga0065707_103603303 | 62 |
| 27 | 3300005295 | Ga0065707_10993216 | Ga0065707_109932162 | 62 |
| 28 | 3300005327 | Ga0070658_10139618 | Ga0070658_101396181 | 62 |
| 29 | 3300005327 | Ga0070658_10925189 | Ga0070658_109251891 | 62 |
| 30 | 3300005328 | Ga0070676_10006901 | Ga0070676_100069012 | 62 |
| 31 | 3300005328 | Ga0070676_10104744 | Ga0070676_101047441 | 62 |
| 32 | 3300005328 | Ga0070676_10125676 | Ga0070676_101256762 | 62 |
| 33 | 3300005328 | Ga0070676_10266258 | Ga0070676_102662582 | 62 |
| 34 | 3300005329 | Ga0070683_100012082 | Ga0070683_1000120825 | 62 |
| 35 | 3300005329 | Ga0070683_100021104 | Ga0070683_1000211044 | 62 |
| 36 | 3300005329 | Ga0070683_100045056 | Ga0070683_1000450566 | 62 |
| 37 | 3300005329 | Ga0070683_100074278 | Ga0070683_1000742784 | 62 |
| 38 | 3300005329 | Ga0070683_100562402 | Ga0070683_1005624021 | 62 |
| 39 | 3300005329 | Ga0070683_100903325 | Ga0070683_1009033252 | 62 |
| 40 | 3300005330 | Ga0070690_100028368 | Ga0070690_1000283683 | 62 |
| 41 | 3300005330 | Ga0070690_100255065 | Ga0070690_1002550651 | 62 |
| 42 | 3300005330 | Ga0070690_100842191 | Ga0070690_1008421911 | 62 |
| 43 | 3300005331 | Ga0070670_100017818 | Ga0070670_1000178182 | 62 |
| 44 | 3300005331 | Ga0070670_100026236 | Ga0070670_1000262365 | 62 |
| 45 | 3300005331 | Ga0070670_100092204 | Ga0070670_1000922041 | 62 |
| 46 | 3300005331 | Ga0070670_100130819 | Ga0070670_1001308193 | 62 |
| 47 | 3300005333 | Ga0070677_10011875 | Ga0070677_100118754 | 62 |
| 48 | 3300005333 | Ga0070677_10155180 | Ga0070677_101551802 | 62 |
| 49 | 3300005333 | Ga0070677_10356520 | Ga0070677_103565202 | 62 |
| 50 | 3300005334 | Ga0068869_100002767 | Ga0068869_1000027672 | 62 |
| 51 | 3300005334 | Ga0068869_100004989 | Ga0068869_1000049895 | 62 |
| 52 | 3300005334 | Ga0068869_100029661 | Ga0068869_1000296613 | 62 |
| 53 | 3300005334 | Ga0068869_100187938 | Ga0068869_1001879383 | 62 |
| 54 | 3300005336 | Ga0070680_100011932 | Ga0070680_1000119328 | 62 |
| 55 | 3300005336 | Ga0070680_100209933 | Ga0070680_1002099332 | 62 |
| 56 | 3300005336 | Ga0070680_100212672 | Ga0070680_1002126723 | 62 |
| 57 | 3300005336 | Ga0070680_100258169 | Ga0070680_1002581692 | 62 |
| 58 | 3300005336 | Ga0070680_100481586 | Ga0070680_1004815862 | 62 |
| 59 | 3300005336 | Ga0070680_100844665 | Ga0070680_1008446651 | 62 |
| 60 | 3300005336 | Ga0070680_101743522 | Ga0070680_1017435221 | 62 |
| 61 | 3300005337 | Ga0070682_100001205 | Ga0070682_1000012057 | 62 |
| 62 | 3300005337 | Ga0070682_100079880 | Ga0070682_1000798803 | 62 |
| 63 | 3300005337 | Ga0070682_100130021 | Ga0070682_1001300213 | 62 |
| 64 | 3300005337 | Ga0070682_100236723 | Ga0070682_1002367232 | 62 |
| 65 | 3300005337 | Ga0070682_101946233 | Ga0070682_1019462331 | 62 |
| 66 | 3300005338 | Ga0068868_100009424 | Ga0068868_1000094241 | 62 |
| 67 | 3300005338 | Ga0068868_100020041 | Ga0068868_1000200412 | 62 |
| 68 | 3300005338 | Ga0068868_100026898 | Ga0068868_1000268983 | 62 |
| 69 | 3300005338 | Ga0068868_100116967 | Ga0068868_1001169671 | 62 |
| 70 | 3300005338 | Ga0068868_100134719 | Ga0068868_1001347193 | 62 |
| 71 | 3300005338 | Ga0068868_100749167 | Ga0068868_1007491672 | 62 |
| 72 | 3300005339 | Ga0070660_100000332 | Ga0070660_10000033217 | 62 |
| 73 | 3300005339 | Ga0070660_100339242 | Ga0070660_1003392423 | 62 |
| 74 | 3300005339 | Ga0070660_101080180 | Ga0070660_1010801802 | 62 |
| 75 | 3300005340 | Ga0070689_100031084 | Ga0070689_1000310844 | 62 |
| 76 | 3300005340 | Ga0070689_100045532 | Ga0070689_1000455323 | 62 |
| 77 | 3300005340 | Ga0070689_100055190 | Ga0070689_1000551902 | 62 |
| 78 | 3300005340 | Ga0070689_100065539 | Ga0070689_1000655393 | 62 |
| 79 | 3300005340 | Ga0070689_100174407 | Ga0070689_1001744072 | 62 |
| 80 | 3300005341 | Ga0070691_10007841 | Ga0070691_100078415 | 62 |
| 81 | 3300005343 | Ga0070687_100058180 | Ga0070687_1000581801 | 62 |
| 82 | 3300005343 | Ga0070687_100070845 | Ga0070687_1000708454 | 62 |
| 83 | 3300005343 | Ga0070687_100112656 | Ga0070687_1001126562 | 62 |
| 84 | 3300005344 | Ga0070661_100008004 | Ga0070661_1000080047 | 62 |
| 85 | 3300005344 | Ga0070661_100010213 | Ga0070661_1000102138 | 62 |
| 86 | 3300005344 | Ga0070661_100366338 | Ga0070661_1003663382 | 62 |
| 87 | 3300005344 | Ga0070661_100563713 | Ga0070661_1005637132 | 62 |
| 88 | 3300005345 | Ga0070692_10039660 | Ga0070692_100396601 | 62 |
| 89 | 3300005345 | Ga0070692_10146528 | Ga0070692_101465282 | 62 |
| 90 | 3300005345 | Ga0070692_10408458 | Ga0070692_104084582 | 62 |
| 91 | 3300005347 | Ga0070668_100024248 | Ga0070668_1000242483 | 62 |
| 92 | 3300005347 | Ga0070668_102154891 | Ga0070668_1021548911 | 62 |
| 93 | 3300005353 | Ga0070669_100093849 | Ga0070669_1000938492 | 62 |
| 94 | 3300005353 | Ga0070669_100096286 | Ga0070669_1000962862 | 62 |
| 95 | 3300005353 | Ga0070669_100256695 | Ga0070669_1002566953 | 62 |
| 96 | 3300005353 | Ga0070669_100412395 | Ga0070669_1004123952 | 62 |
| 97 | 3300005353 | Ga0070669_100444189 | Ga0070669_1004441891 | 62 |
| 98 | 3300005353 | Ga0070669_100616655 | Ga0070669_1006166553 | 62 |
| 99 | 3300005354 | Ga0070675_100008040 | Ga0070675_1000080404 | 62 |
| 100 | 3300005354 | Ga0070675_100092835 | Ga0070675_1000928354 | 62 |
| 101 | 3300005355 | Ga0070671_100288645 | Ga0070671_1002886451 | 62 |
| 102 | 3300005355 | Ga0070671_100369219 | Ga0070671_1003692192 | 62 |
| 103 | 3300005356 | Ga0070674_100195372 | Ga0070674_1001953722 | 62 |
| 104 | 3300005364 | Ga0070673_100013321 | Ga0070673_1000133215 | 62 |
| 105 | 3300005364 | Ga0070673_100190955 | Ga0070673_1001909553 | 62 |
| 106 | 3300005364 | Ga0070673_100305270 | Ga0070673_1003052701 | 62 |
| 107 | 3300005364 | Ga0070673_100808425 | Ga0070673_1008084251 | 62 |
| 108 | 3300005365 | Ga0070688_100101502 | Ga0070688_1001015023 | 62 |
| 109 | 3300005365 | Ga0070688_100428583 | Ga0070688_1004285832 | 62 |
| 110 | 3300005365 | Ga0070688_100525199 | Ga0070688_1005251992 | 62 |
| 111 | 3300005365 | Ga0070688_101026319 | Ga0070688_1010263191 | 62 |
| 112 | 3300005365 | Ga0070688_101543178 | Ga0070688_1015431781 | 62 |
| 113 | 3300005365 | Ga0070688_101701286 | Ga0070688_1017012862 | 62 |
| 114 | 3300005366 | Ga0070659_100007889 | Ga0070659_1000078898 | 62 |
| 115 | 3300005366 | Ga0070659_100054477 | Ga0070659_1000544772 | 62 |
| 116 | 3300005367 | Ga0070667_100075152 | Ga0070667_1000751523 | 62 |
| 117 | 3300005367 | Ga0070667_100163470 | Ga0070667_1001634704 | 62 |
| 118 | 3300005367 | Ga0070667_100248515 | Ga0070667_1002485153 | 62 |
| 119 | 3300005367 | Ga0070667_100860083 | Ga0070667_1008600832 | 62 |
| 120 | 3300005367 | Ga0070667_101454837 | Ga0070667_1014548372 | 62 |
| 121 | 3300005367 | Ga0070667_102063811 | Ga0070667_1020638111 | 62 |
| 122 | 3300005406 | Ga0070703_10065721 | Ga0070703_100657211 | 62 |
| 123 | 3300005406 | Ga0070703_10111366 | Ga0070703_101113661 | 62 |
| 124 | 3300005406 | Ga0070703_10178194 | Ga0070703_101781942 | 62 |
| 125 | 3300005434 | Ga0070709_10119517 | Ga0070709_101195172 | 62 |
| 126 | 3300005434 | Ga0070709_10204332 | Ga0070709_102043323 | 62 |
| 127 | 3300005434 | Ga0070709_10582266 | Ga0070709_105822661 | 62 |
| 128 | 3300005434 | Ga0070709_10827973 | Ga0070709_108279732 | 62 |
| 129 | 3300005435 | Ga0070714_101819508 | Ga0070714_1018195082 | 62 |
| 130 | 3300005436 | Ga0070713_100293088 | Ga0070713_1002930883 | 62 |
| 131 | 3300005436 | Ga0070713_100391922 | Ga0070713_1003919222 | 62 |
| 132 | 3300005436 | Ga0070713_100603944 | Ga0070713_1006039442 | 62 |
| 133 | 3300005436 | Ga0070713_100854147 | Ga0070713_1008541472 | 62 |
| 134 | 3300005436 | Ga0070713_101550899 | Ga0070713_1015508991 | 62 |
| 135 | 3300005437 | Ga0070710_10061249 | Ga0070710_100612492 | 62 |
| 136 | 3300005437 | Ga0070710_10199474 | Ga0070710_101994742 | 62 |
| 137 | 3300005437 | Ga0070710_10336814 | Ga0070710_103368141 | 62 |
| 138 | 3300005437 | Ga0070710_11076953 | Ga0070710_110769532 | 62 |
| 139 | 3300005438 | Ga0070701_10041473 | Ga0070701_100414732 | 62 |
| 140 | 3300005438 | Ga0070701_10095361 | Ga0070701_100953611 | 62 |
| 141 | 3300005438 | Ga0070701_10309427 | Ga0070701_103094272 | 62 |
| 142 | 3300005439 | Ga0070711_100009216 | Ga0070711_1000092164 | 62 |
| 143 | 3300005439 | Ga0070711_100041508 | Ga0070711_1000415082 | 62 |
| 144 | 3300005439 | Ga0070711_101791610 | Ga0070711_1017916101 | 62 |
| 145 | 3300005440 | Ga0070705_100010715 | Ga0070705_1000107154 | 62 |
| 146 | 3300005440 | Ga0070705_100018219 | Ga0070705_1000182193 | 62 |
| 147 | 3300005440 | Ga0070705_100049436 | Ga0070705_1000494363 | 62 |
| 148 | 3300005440 | Ga0070705_100051447 | Ga0070705_1000514471 | 62 |
| 149 | 3300005440 | Ga0070705_100054300 | Ga0070705_1000543002 | 62 |
| 150 | 3300005440 | Ga0070705_100524476 | Ga0070705_1005244762 | 62 |
| 151 | 3300005440 | Ga0070705_100631361 | Ga0070705_1006313611 | 62 |
| 152 | 3300005441 | Ga0070700_100834854 | Ga0070700_1008348541 | 62 |
| 153 | 3300005441 | Ga0070700_101284512 | Ga0070700_1012845121 | 62 |
| 154 | 3300005444 | Ga0070694_100000758 | Ga0070694_1000007583 | 62 |
| 155 | 3300005444 | Ga0070694_100004529 | Ga0070694_1000045298 | 62 |
| 156 | 3300005444 | Ga0070694_100012156 | Ga0070694_1000121564 | 62 |
| 157 | 3300005444 | Ga0070694_100405344 | Ga0070694_1004053442 | 62 |
| 158 | 3300005444 | Ga0070694_100621181 | Ga0070694_1006211812 | 62 |
| 159 | 3300005444 | Ga0070694_100779407 | Ga0070694_1007794071 | 62 |
| 160 | 3300005444 | Ga0070694_100785232 | Ga0070694_1007852321 | 62 |
| 161 | 3300005445 | Ga0070708_100030979 | Ga0070708_1000309795 | 62 |
| 162 | 3300005445 | Ga0070708_100037363 | Ga0070708_1000373634 | 62 |
| 163 | 3300005445 | Ga0070708_100160636 | Ga0070708_1001606362 | 62 |
| 164 | 3300005445 | Ga0070708_100236987 | Ga0070708_1002369871 | 62 |
| 165 | 3300005445 | Ga0070708_100325665 | Ga0070708_1003256652 | 62 |
| 166 | 3300005445 | Ga0070708_100527572 | Ga0070708_1005275722 | 62 |
| 167 | 3300005445 | Ga0070708_100883351 | Ga0070708_1008833511 | 62 |
| 168 | 3300005445 | Ga0070708_101754478 | Ga0070708_1017544782 | 62 |
| 169 | 3300005445 | Ga0070708_102075156 | Ga0070708_1020751561 | 62 |
| 170 | 3300005455 | Ga0070663_100013971 | Ga0070663_1000139714 | 62 |
| 171 | 3300005455 | Ga0070663_100076133 | Ga0070663_1000761332 | 62 |
| 172 | 3300005456 | Ga0070678_100045303 | Ga0070678_1000453033 | 62 |
| 173 | 3300005456 | Ga0070678_100762820 | Ga0070678_1007628202 | 62 |
| 174 | 3300005457 | Ga0070662_100006301 | Ga0070662_1000063016 | 62 |
| 175 | 3300005457 | Ga0070662_100072724 | Ga0070662_1000727242 | 62 |
| 176 | 3300005457 | Ga0070662_100078017 | Ga0070662_1000780174 | 62 |
| 177 | 3300005457 | Ga0070662_100344527 | Ga0070662_1003445272 | 62 |
| 178 | 3300005457 | Ga0070662_101788583 | Ga0070662_1017885831 | 62 |
| 179 | 3300005458 | Ga0070681_10000049 | Ga0070681_1000004968 | 62 |
| 180 | 3300005458 | Ga0070681_10031207 | Ga0070681_100312074 | 62 |
| 181 | 3300005458 | Ga0070681_10093480 | Ga0070681_100934802 | 62 |
| 182 | 3300005458 | Ga0070681_10300789 | Ga0070681_103007892 | 62 |
| 183 | 3300005458 | Ga0070681_10306625 | Ga0070681_103066251 | 62 |
| 184 | 3300005458 | Ga0070681_10345291 | Ga0070681_103452911 | 62 |
| 185 | 3300005458 | Ga0070681_10384050 | Ga0070681_103840502 | 62 |
| 186 | 3300005458 | Ga0070681_10557517 | Ga0070681_105575172 | 62 |
| 187 | 3300005458 | Ga0070681_10753527 | Ga0070681_107535272 | 62 |
| 188 | 3300005458 | Ga0070681_11219084 | Ga0070681_112190841 | 62 |
| 189 | 3300005459 | Ga0068867_100006250 | Ga0068867_1000062507 | 62 |
| 190 | 3300005459 | Ga0068867_100045512 | Ga0068867_1000455124 | 62 |
| 191 | 3300005459 | Ga0068867_100067037 | Ga0068867_1000670372 | 62 |
| 192 | 3300005459 | Ga0068867_100092127 | Ga0068867_1000921271 | 62 |
| 193 | 3300005459 | Ga0068867_100138524 | Ga0068867_1001385243 | 62 |
| 194 | 3300005466 | Ga0070685_10037976 | Ga0070685_100379764 | 62 |
| 195 | 3300005466 | Ga0070685_10546377 | Ga0070685_105463772 | 62 |
| 196 | 3300005467 | Ga0070706_100052747 | Ga0070706_1000527472 | 62 |
| 197 | 3300005467 | Ga0070706_100064589 | Ga0070706_1000645892 | 62 |
| 198 | 3300005467 | Ga0070706_100134914 | Ga0070706_1001349142 | 62 |
| 199 | 3300005467 | Ga0070706_100303431 | Ga0070706_1003034311 | 62 |
| 200 | 3300005467 | Ga0070706_100489498 | Ga0070706_1004894982 | 62 |
| 201 | 3300005467 | Ga0070706_100773818 | Ga0070706_1007738182 | 62 |
| 202 | 3300005467 | Ga0070706_100891251 | Ga0070706_1008912511 | 62 |
| 203 | 3300005467 | Ga0070706_101448583 | Ga0070706_1014485832 | 62 |
| 204 | 3300005468 | Ga0070707_100041460 | Ga0070707_1000414601 | 62 |
| 205 | 3300005468 | Ga0070707_100046260 | Ga0070707_1000462602 | 62 |
| 206 | 3300005468 | Ga0070707_100142023 | Ga0070707_1001420232 | 62 |
| 207 | 3300005468 | Ga0070707_100147765 | Ga0070707_1001477652 | 62 |
| 208 | 3300005468 | Ga0070707_100156849 | Ga0070707_1001568493 | 62 |
| 209 | 3300005468 | Ga0070707_100228679 | Ga0070707_1002286793 | 62 |
| 210 | 3300005468 | Ga0070707_100273772 | Ga0070707_1002737722 | 62 |
| 211 | 3300005468 | Ga0070707_100351472 | Ga0070707_1003514723 | 62 |
| 212 | 3300005468 | Ga0070707_100534165 | Ga0070707_1005341652 | 62 |
| 213 | 3300005468 | Ga0070707_100773465 | Ga0070707_1007734652 | 62 |
| 214 | 3300005471 | Ga0070698_100073943 | Ga0070698_1000739434 | 62 |
| 215 | 3300005471 | Ga0070698_100081517 | Ga0070698_1000815174 | 62 |
| 216 | 3300005471 | Ga0070698_100156046 | Ga0070698_1001560464 | 62 |
| 217 | 3300005471 | Ga0070698_100488118 | Ga0070698_1004881183 | 62 |
| 218 | 3300005518 | Ga0070699_100015236 | Ga0070699_1000152366 | 62 |
| 219 | 3300005518 | Ga0070699_100024343 | Ga0070699_1000243436 | 62 |
| 220 | 3300005518 | Ga0070699_100031808 | Ga0070699_1000318082 | 62 |
| 221 | 3300005518 | Ga0070699_100087879 | Ga0070699_1000878792 | 62 |
| 222 | 3300005518 | Ga0070699_100180595 | Ga0070699_1001805953 | 62 |
| 223 | 3300005518 | Ga0070699_100280425 | Ga0070699_1002804252 | 62 |
| 224 | 3300005518 | Ga0070699_100414717 | Ga0070699_1004147172 | 62 |
| 225 | 3300005518 | Ga0070699_100484254 | Ga0070699_1004842541 | 62 |
| 226 | 3300005518 | Ga0070699_100543444 | Ga0070699_1005434442 | 62 |
| 227 | 3300005518 | Ga0070699_100901548 | Ga0070699_1009015481 | 62 |
| 228 | 3300005518 | Ga0070699_100932255 | Ga0070699_1009322552 | 62 |
| 229 | 3300005530 | Ga0070679_100010981 | Ga0070679_1000109813 | 62 |
| 230 | 3300005530 | Ga0070679_100016005 | Ga0070679_1000160052 | 62 |
| 231 | 3300005530 | Ga0070679_100032821 | Ga0070679_1000328214 | 62 |
| 232 | 3300005530 | Ga0070679_100121256 | Ga0070679_1001212563 | 62 |
| 233 | 3300005530 | Ga0070679_100317595 | Ga0070679_1003175951 | 62 |
| 234 | 3300005530 | Ga0070679_100545269 | Ga0070679_1005452692 | 62 |
| 235 | 3300005530 | Ga0070679_100823282 | Ga0070679_1008232822 | 62 |
| 236 | 3300005530 | Ga0070679_100898779 | Ga0070679_1008987791 | 62 |
| 237 | 3300005530 | Ga0070679_101225210 | Ga0070679_1012252102 | 62 |
| 238 | 3300005535 | Ga0070684_100003237 | Ga0070684_1000032377 | 62 |
| 239 | 3300005535 | Ga0070684_100017079 | Ga0070684_1000170792 | 62 |
| 240 | 3300005535 | Ga0070684_100019566 | Ga0070684_1000195666 | 62 |
| 241 | 3300005535 | Ga0070684_100038467 | Ga0070684_1000384673 | 62 |
| 242 | 3300005536 | Ga0070697_100002024 | Ga0070697_10000202416 | 62 |
| 243 | 3300005536 | Ga0070697_100008817 | Ga0070697_1000088174 | 62 |
| 244 | 3300005536 | Ga0070697_100059567 | Ga0070697_1000595674 | 62 |
| 245 | 3300005536 | Ga0070697_100086515 | Ga0070697_1000865152 | 62 |
| 246 | 3300005536 | Ga0070697_100167675 | Ga0070697_1001676752 | 62 |
| 247 | 3300005536 | Ga0070697_100178520 | Ga0070697_1001785201 | 62 |
| 248 | 3300005536 | Ga0070697_100306883 | Ga0070697_1003068832 | 62 |
| 249 | 3300005536 | Ga0070697_100431897 | Ga0070697_1004318973 | 62 |
| 250 | 3300005536 | Ga0070697_100478343 | Ga0070697_1004783431 | 62 |
| 251 | 3300005536 | Ga0070697_100617582 | Ga0070697_1006175821 | 62 |
| 252 | 3300005536 | Ga0070697_101167728 | Ga0070697_1011677281 | 62 |
| 253 | 3300005536 | Ga0070697_101507375 | Ga0070697_1015073752 | 62 |
| 254 | 3300005536 | Ga0070697_101758029 | Ga0070697_1017580292 | 62 |
| 255 | 3300005539 | Ga0068853_100001362 | Ga0068853_10000136217 | 62 |
| 256 | 3300005539 | Ga0068853_100009355 | Ga0068853_1000093553 | 62 |
| 257 | 3300005539 | Ga0068853_100045276 | Ga0068853_1000452763 | 62 |
| 258 | 3300005539 | Ga0068853_100209570 | Ga0068853_1002095702 | 62 |
| 259 | 3300005539 | Ga0068853_100238266 | Ga0068853_1002382662 | 62 |
| 260 | 3300005539 | Ga0068853_101503431 | Ga0068853_1015034312 | 62 |
| 261 | 3300005539 | Ga0068853_102277838 | Ga0068853_1022778382 | 62 |
| 262 | 3300005543 | Ga0070672_100273511 | Ga0070672_1002735113 | 62 |
| 263 | 3300005543 | Ga0070672_100654159 | Ga0070672_1006541592 | 62 |
| 264 | 3300005544 | Ga0070686_100199398 | Ga0070686_1001993983 | 62 |
| 265 | 3300005544 | Ga0070686_101285714 | Ga0070686_1012857142 | 62 |
| 266 | 3300005545 | Ga0070695_100001464 | Ga0070695_1000014648 | 62 |
| 267 | 3300005545 | Ga0070695_100002045 | Ga0070695_1000020451 | 62 |
| 268 | 3300005545 | Ga0070695_100003725 | Ga0070695_1000037252 | 62 |
| 269 | 3300005545 | Ga0070695_100057401 | Ga0070695_1000574013 | 62 |
| 270 | 3300005545 | Ga0070695_100880859 | Ga0070695_1008808592 | 62 |
| 271 | 3300005545 | Ga0070695_101421262 | Ga0070695_1014212621 | 62 |
| 272 | 3300005546 | Ga0070696_100004074 | Ga0070696_10000407412 | 62 |
| 273 | 3300005546 | Ga0070696_100043583 | Ga0070696_1000435833 | 62 |
| 274 | 3300005546 | Ga0070696_100125285 | Ga0070696_1001252853 | 62 |
| 275 | 3300005546 | Ga0070696_100277587 | Ga0070696_1002775873 | 62 |
| 276 | 3300005546 | Ga0070696_100310312 | Ga0070696_1003103122 | 62 |
| 277 | 3300005546 | Ga0070696_100674362 | Ga0070696_1006743622 | 62 |
| 278 | 3300005547 | Ga0070693_100000325 | Ga0070693_1000003257 | 62 |
| 279 | 3300005547 | Ga0070693_100022242 | Ga0070693_1000222424 | 62 |
| 280 | 3300005547 | Ga0070693_100114053 | Ga0070693_1001140533 | 62 |
| 281 | 3300005547 | Ga0070693_100318921 | Ga0070693_1003189211 | 62 |
| 282 | 3300005547 | Ga0070693_100330005 | Ga0070693_1003300053 | 62 |
| 283 | 3300005548 | Ga0070665_100095438 | Ga0070665_1000954385 | 62 |
| 284 | 3300005548 | Ga0070665_100138558 | Ga0070665_1001385583 | 62 |
| 285 | 3300005548 | Ga0070665_100251379 | Ga0070665_1002513792 | 62 |
| 286 | 3300005548 | Ga0070665_101658729 | Ga0070665_1016587292 | 62 |
| 287 | 3300005549 | Ga0070704_100085995 | Ga0070704_1000859952 | 62 |
| 288 | 3300005549 | Ga0070704_100125505 | Ga0070704_1001255052 | 62 |
| 289 | 3300005549 | Ga0070704_100168418 | Ga0070704_1001684183 | 62 |
| 290 | 3300005549 | Ga0070704_100242137 | Ga0070704_1002421372 | 62 |
| 291 | 3300005549 | Ga0070704_101042207 | Ga0070704_1010422071 | 62 |
| 292 | 3300005549 | Ga0070704_102238146 | Ga0070704_1022381461 | 62 |
| 293 | 3300005563 | Ga0068855_100000397 | Ga0068855_10000039721 | 62 |
| 294 | 3300005563 | Ga0068855_100033033 | Ga0068855_1000330332 | 62 |
| 295 | 3300005563 | Ga0068855_100042404 | Ga0068855_1000424045 | 62 |
| 296 | 3300005563 | Ga0068855_100120875 | Ga0068855_1001208752 | 62 |
| 297 | 3300005563 | Ga0068855_100464676 | Ga0068855_1004646763 | 62 |
| 298 | 3300005563 | Ga0068855_101807250 | Ga0068855_1018072501 | 62 |
| 299 | 3300005563 | Ga0068855_102080773 | Ga0068855_1020807732 | 62 |
| 300 | 3300005563 | Ga0068855_102114808 | Ga0068855_1021148082 | 62 |
| 301 | 3300005563 | Ga0068855_102421408 | Ga0068855_1024214081 | 62 |
| 302 | 3300005564 | Ga0070664_100000468 | Ga0070664_10000046826 | 62 |
| 303 | 3300005564 | Ga0070664_100043549 | Ga0070664_1000435494 | 62 |
| 304 | 3300005564 | Ga0070664_100082370 | Ga0070664_1000823703 | 62 |
| 305 | 3300005564 | Ga0070664_100127967 | Ga0070664_1001279673 | 62 |
| 306 | 3300005577 | Ga0068857_100000474 | Ga0068857_10000047411 | 62 |
| 307 | 3300005577 | Ga0068857_100011453 | Ga0068857_1000114533 | 62 |
| 308 | 3300005577 | Ga0068857_100014168 | Ga0068857_1000141683 | 62 |
| 309 | 3300005577 | Ga0068857_100061177 | Ga0068857_1000611773 | 62 |
| 310 | 3300005577 | Ga0068857_100486882 | Ga0068857_1004868821 | 62 |
| 311 | 3300005577 | Ga0068857_101017927 | Ga0068857_1010179272 | 62 |
| 312 | 3300005578 | Ga0068854_100000353 | Ga0068854_10000035318 | 62 |
| 313 | 3300005578 | Ga0068854_100037036 | Ga0068854_1000370364 | 62 |
| 314 | 3300005578 | Ga0068854_100054791 | Ga0068854_1000547913 | 62 |
| 315 | 3300005578 | Ga0068854_100209085 | Ga0068854_1002090852 | 62 |
| 316 | 3300005578 | Ga0068854_100210627 | Ga0068854_1002106273 | 62 |
| 317 | 3300005578 | Ga0068854_100426306 | Ga0068854_1004263061 | 62 |
| 318 | 3300005614 | Ga0068856_100000475 | Ga0068856_10000047526 | 62 |
| 319 | 3300005614 | Ga0068856_100003466 | Ga0068856_1000034665 | 62 |
| 320 | 3300005614 | Ga0068856_100021766 | Ga0068856_1000217662 | 62 |
| 321 | 3300005614 | Ga0068856_100086827 | Ga0068856_1000868274 | 62 |
| 322 | 3300005614 | Ga0068856_101783989 | Ga0068856_1017839892 | 62 |
| 323 | 3300005614 | Ga0068856_102372466 | Ga0068856_1023724661 | 62 |
| 324 | 3300005615 | Ga0070702_100462419 | Ga0070702_1004624193 | 62 |
| 325 | 3300005615 | Ga0070702_100635949 | Ga0070702_1006359492 | 62 |
| 326 | 3300005616 | Ga0068852_100053578 | Ga0068852_1000535783 | 62 |
| 327 | 3300005616 | Ga0068852_100085266 | Ga0068852_1000852663 | 62 |
| 328 | 3300005616 | Ga0068852_100676904 | Ga0068852_1006769042 | 62 |
| 329 | 3300005616 | Ga0068852_101951648 | Ga0068852_1019516481 | 62 |
| 330 | 3300005617 | Ga0068859_100000610 | Ga0068859_10000061020 | 62 |
| 331 | 3300005617 | Ga0068859_100002575 | Ga0068859_10000257519 | 62 |
| 332 | 3300005617 | Ga0068859_100028604 | Ga0068859_1000286043 | 62 |
| 333 | 3300005617 | Ga0068859_100184913 | Ga0068859_1001849133 | 62 |
| 334 | 3300005617 | Ga0068859_100208042 | Ga0068859_1002080422 | 62 |
| 335 | 3300005617 | Ga0068859_100214834 | Ga0068859_1002148342 | 62 |
| 336 | 3300005617 | Ga0068859_101388817 | Ga0068859_1013888172 | 62 |
| 337 | 3300005617 | Ga0068859_102081566 | Ga0068859_1020815662 | 62 |
| 338 | 3300005618 | Ga0068864_100000254 | Ga0068864_10000025420 | 62 |
| 339 | 3300005618 | Ga0068864_100157963 | Ga0068864_1001579632 | 62 |
| 340 | 3300005618 | Ga0068864_100794644 | Ga0068864_1007946441 | 62 |
| 341 | 3300005718 | Ga0068866_10016681 | Ga0068866_100166814 | 62 |
| 342 | 3300005718 | Ga0068866_10027467 | Ga0068866_100274672 | 62 |
| 343 | 3300005718 | Ga0068866_10298050 | Ga0068866_102980502 | 62 |
| 344 | 3300005719 | Ga0068861_100033261 | Ga0068861_1000332616 | 62 |
| 345 | 3300005719 | Ga0068861_100081024 | Ga0068861_1000810243 | 62 |
| 346 | 3300005719 | Ga0068861_100132403 | Ga0068861_1001324032 | 62 |
| 347 | 3300005719 | Ga0068861_100239767 | Ga0068861_1002397672 | 62 |
| 348 | 3300005834 | Ga0068851_10125339 | Ga0068851_101253393 | 62 |
| 349 | 3300005834 | Ga0068851_10221315 | Ga0068851_102213152 | 62 |
| 350 | 3300005840 | Ga0068870_10001907 | Ga0068870_100019073 | 62 |
| 351 | 3300005840 | Ga0068870_10025433 | Ga0068870_100254332 | 62 |
| 352 | 3300005840 | Ga0068870_10619510 | Ga0068870_106195102 | 62 |
| 353 | 3300005841 | Ga0068863_100007896 | Ga0068863_1000078963 | 62 |
| 354 | 3300005841 | Ga0068863_100025704 | Ga0068863_1000257046 | 62 |
| 355 | 3300005841 | Ga0068863_100135541 | Ga0068863_1001355413 | 62 |
| 356 | 3300005841 | Ga0068863_100286444 | Ga0068863_1002864442 | 62 |
| 357 | 3300005841 | Ga0068863_100292226 | Ga0068863_1002922262 | 62 |
| 358 | 3300005841 | Ga0068863_100313048 | Ga0068863_1003130484 | 62 |
| 359 | 3300005841 | Ga0068863_100700374 | Ga0068863_1007003743 | 62 |
| 360 | 3300005842 | Ga0068858_100002296 | Ga0068858_10000229618 | 62 |
| 361 | 3300005842 | Ga0068858_100059167 | Ga0068858_1000591674 | 62 |
| 362 | 3300005842 | Ga0068858_100139449 | Ga0068858_1001394493 | 62 |
| 363 | 3300005842 | Ga0068858_100158022 | Ga0068858_1001580223 | 62 |
| 364 | 3300005842 | Ga0068858_100416577 | Ga0068858_1004165772 | 62 |
| 365 | 3300005842 | Ga0068858_100705093 | Ga0068858_1007050931 | 62 |
| 366 | 3300005842 | Ga0068858_100933324 | Ga0068858_1009333242 | 62 |
| 367 | 3300005843 | Ga0068860_100004896 | Ga0068860_1000048961 | 62 |
| 368 | 3300005843 | Ga0068860_100047220 | Ga0068860_1000472204 | 62 |
| 369 | 3300005843 | Ga0068860_100074193 | Ga0068860_1000741933 | 62 |
| 370 | 3300005843 | Ga0068860_100192621 | Ga0068860_1001926213 | 62 |
| 371 | 3300005843 | Ga0068860_100193740 | Ga0068860_1001937402 | 62 |
| 372 | 3300005843 | Ga0068860_100318712 | Ga0068860_1003187122 | 62 |
| 373 | 3300005843 | Ga0068860_100433184 | Ga0068860_1004331841 | 62 |
| 374 | 3300005843 | Ga0068860_100687079 | Ga0068860_1006870792 | 62 |
| 375 | 3300005843 | Ga0068860_101333512 | Ga0068860_1013335122 | 62 |
| 376 | 3300005843 | Ga0068860_101364035 | Ga0068860_1013640352 | 62 |
| 377 | 3300005844 | Ga0068862_100036298 | Ga0068862_1000362986 | 62 |
| 378 | 3300005844 | Ga0068862_100047247 | Ga0068862_1000472474 | 62 |
| 379 | 3300005844 | Ga0068862_100050690 | Ga0068862_1000506902 | 62 |
| 380 | 3300005844 | Ga0068862_100051172 | Ga0068862_1000511724 | 62 |
| 381 | 3300005844 | Ga0068862_100231353 | Ga0068862_1002313533 | 62 |
| 382 | 3300005844 | Ga0068862_100417647 | Ga0068862_1004176471 | 62 |
| 383 | 3300005844 | Ga0068862_100762560 | Ga0068862_1007625602 | 62 |
| 384 | 3300005844 | Ga0068862_101612735 | Ga0068862_1016127351 | 62 |
| 385 | 3300005937 | Ga0081455_10067085 | Ga0081455_100670853 | 62 |
| 386 | 3300005937 | Ga0081455_10080439 | Ga0081455_100804392 | 62 |
| 387 | 3300005937 | Ga0081455_10498329 | Ga0081455_104983291 | 62 |
| 388 | 3300005981 | Ga0081538_10006559 | Ga0081538_100065593 | 62 |
| 389 | 3300005983 | Ga0081540_1023348 | Ga0081540_10233483 | 62 |
| 390 | 3300005983 | Ga0081540_1047673 | Ga0081540_10476732 | 62 |
| 391 | 3300006028 | Ga0070717_10000962 | Ga0070717_100009625 | 62 |
| 392 | 3300006028 | Ga0070717_10001900 | Ga0070717_100019005 | 62 |
| 393 | 3300006028 | Ga0070717_10004828 | Ga0070717_100048286 | 62 |
| 394 | 3300006028 | Ga0070717_10014769 | Ga0070717_100147692 | 62 |
| 395 | 3300006028 | Ga0070717_10073416 | Ga0070717_100734164 | 62 |
| 396 | 3300006028 | Ga0070717_10187116 | Ga0070717_101871164 | 62 |
| 397 | 3300006028 | Ga0070717_10331915 | Ga0070717_103319152 | 62 |
| 398 | 3300006028 | Ga0070717_11613848 | Ga0070717_116138482 | 62 |
| 399 | 3300006028 | Ga0070717_11883817 | Ga0070717_118838171 | 62 |
| 400 | 3300006058 | Ga0075432_10201831 | Ga0075432_102018312 | 62 |
| 401 | 3300006163 | Ga0070715_10035877 | Ga0070715_100358773 | 62 |
| 402 | 3300006163 | Ga0070715_10126718 | Ga0070715_101267183 | 62 |
| 403 | 3300006163 | Ga0070715_10385128 | Ga0070715_103851282 | 62 |
| 404 | 3300006173 | Ga0070716_100002702 | Ga0070716_1000027029 | 62 |
| 405 | 3300006173 | Ga0070716_100087343 | Ga0070716_1000873431 | 62 |
| 406 | 3300006173 | Ga0070716_100131091 | Ga0070716_1001310912 | 62 |
| 407 | 3300006173 | Ga0070716_100350917 | Ga0070716_1003509171 | 62 |
| 408 | 3300006173 | Ga0070716_100393190 | Ga0070716_1003931902 | 62 |
| 409 | 3300006173 | Ga0070716_100929509 | Ga0070716_1009295092 | 62 |
| 410 | 3300006173 | Ga0070716_101146886 | Ga0070716_1011468861 | 62 |
| 411 | 3300006173 | Ga0070716_101673684 | Ga0070716_1016736841 | 62 |
| 412 | 3300006175 | Ga0070712_100001521 | Ga0070712_1000015216 | 62 |
| 413 | 3300006175 | Ga0070712_100006037 | Ga0070712_1000060378 | 62 |
| 414 | 3300006175 | Ga0070712_100093001 | Ga0070712_1000930012 | 62 |
| 415 | 3300006175 | Ga0070712_100226384 | Ga0070712_1002263842 | 62 |
| 416 | 3300006175 | Ga0070712_100561451 | Ga0070712_1005614512 | 62 |
| 417 | 3300006175 | Ga0070712_100683559 | Ga0070712_1006835591 | 62 |
| 418 | 3300006237 | Ga0097621_100016488 | Ga0097621_1000164884 | 62 |
| 419 | 3300006237 | Ga0097621_100021907 | Ga0097621_1000219073 | 62 |
| 420 | 3300006237 | Ga0097621_100037196 | Ga0097621_1000371965 | 62 |
| 421 | 3300006237 | Ga0097621_100200954 | Ga0097621_1002009542 | 62 |
| 422 | 3300006237 | Ga0097621_101600454 | Ga0097621_1016004541 | 62 |
| 423 | 3300006358 | Ga0068871_100001677 | Ga0068871_1000016773 | 62 |
| 424 | 3300006358 | Ga0068871_100016064 | Ga0068871_1000160645 | 62 |
| 425 | 3300006358 | Ga0068871_100056014 | Ga0068871_1000560144 | 62 |
| 426 | 3300006358 | Ga0068871_100263617 | Ga0068871_1002636173 | 62 |
| 427 | 3300006358 | Ga0068871_100939352 | Ga0068871_1009393522 | 62 |
| 428 | 3300006844 | Ga0075428_100018251 | Ga0075428_1000182512 | 62 |
| 429 | 3300006844 | Ga0075428_100189398 | Ga0075428_1001893982 | 62 |
| 430 | 3300006844 | Ga0075428_100351045 | Ga0075428_1003510452 | 62 |
| 431 | 3300006844 | Ga0075428_100789867 | Ga0075428_1007898672 | 62 |
| 432 | 3300006846 | Ga0075430_100292378 | Ga0075430_1002923782 | 62 |
| 433 | 3300006846 | Ga0075430_101623503 | Ga0075430_1016235031 | 62 |
| 434 | 3300006847 | Ga0075431_100004465 | Ga0075431_1000044652 | 62 |
| 435 | 3300006847 | Ga0075431_100072796 | Ga0075431_1000727963 | 62 |
| 436 | 3300006847 | Ga0075431_102012259 | Ga0075431_1020122591 | 62 |
| 437 | 3300006852 | Ga0075433_10002435 | Ga0075433_1000243516 | 62 |
| 438 | 3300006852 | Ga0075433_10019734 | Ga0075433_100197342 | 62 |
| 439 | 3300006852 | Ga0075433_10031282 | Ga0075433_100312825 | 62 |
| 440 | 3300006852 | Ga0075433_10052378 | Ga0075433_100523783 | 62 |
| 441 | 3300006852 | Ga0075433_11951929 | Ga0075433_119519291 | 62 |
| 442 | 3300006871 | Ga0075434_100008438 | Ga0075434_1000084384 | 62 |
| 443 | 3300006871 | Ga0075434_100011622 | Ga0075434_1000116225 | 62 |
| 444 | 3300006871 | Ga0075434_100044987 | Ga0075434_1000449872 | 62 |
| 445 | 3300006871 | Ga0075434_100064385 | Ga0075434_1000643854 | 62 |
| 446 | 3300006871 | Ga0075434_100230258 | Ga0075434_1002302582 | 62 |
| 447 | 3300006871 | Ga0075434_100453317 | Ga0075434_1004533172 | 62 |
| 448 | 3300006871 | Ga0075434_101225506 | Ga0075434_1012255062 | 62 |
| 449 | 3300006871 | Ga0075434_101234983 | Ga0075434_1012349832 | 62 |
| 450 | 3300006871 | Ga0075434_101700812 | Ga0075434_1017008122 | 62 |
| 451 | 3300006880 | Ga0075429_100004231 | Ga0075429_1000042314 | 62 |
| 452 | 3300006880 | Ga0075429_100069584 | Ga0075429_1000695842 | 62 |
| 453 | 3300006880 | Ga0075429_100610590 | Ga0075429_1006105902 | 62 |
| 454 | 3300006881 | Ga0068865_100005497 | Ga0068865_1000054977 | 62 |
| 455 | 3300006881 | Ga0068865_100072574 | Ga0068865_1000725742 | 62 |
| 456 | 3300006881 | Ga0068865_100237746 | Ga0068865_1002377462 | 62 |
| 457 | 3300006881 | Ga0068865_100555537 | Ga0068865_1005555372 | 62 |
| 458 | 3300006881 | Ga0068865_101152444 | Ga0068865_1011524442 | 62 |
| 459 | 3300006881 | Ga0068865_101844124 | Ga0068865_1018441241 | 62 |
| 460 | 3300006914 | Ga0075436_100025990 | Ga0075436_1000259904 | 62 |
| 461 | 3300006914 | Ga0075436_100078023 | Ga0075436_1000780232 | 62 |
| 462 | 3300006914 | Ga0075436_100090721 | Ga0075436_1000907212 | 62 |
| 463 | 3300006914 | Ga0075436_100165673 | Ga0075436_1001656732 | 62 |
| 464 | 3300006931 | Ga0097620_100000610 | Ga0097620_10000061020 | 62 |
| 465 | 3300006931 | Ga0097620_100002575 | Ga0097620_10000257519 | 62 |
| 466 | 3300006931 | Ga0097620_100028602 | Ga0097620_1000286023 | 62 |
| 467 | 3300006931 | Ga0097620_100184910 | Ga0097620_1001849103 | 62 |
| 468 | 3300006931 | Ga0097620_100208042 | Ga0097620_1002080422 | 62 |
| 469 | 3300006931 | Ga0097620_100214821 | Ga0097620_1002148212 | 62 |
| 470 | 3300006931 | Ga0097620_101388779 | Ga0097620_1013887792 | 62 |
| 471 | 3300006931 | Ga0097620_102081574 | Ga0097620_1020815742 | 62 |
| 472 | 3300007076 | Ga0075435_100034942 | Ga0075435_1000349422 | 62 |
| 473 | 3300007076 | Ga0075435_100698580 | Ga0075435_1006985802 | 62 |
| 474 | 3300007076 | Ga0075435_101704959 | Ga0075435_1017049591 | 62 |
| 475 | 3300007265 | Ga0099794_10125645 | Ga0099794_101256452 | 62 |
| 476 | 3300007265 | Ga0099794_10273023 | Ga0099794_102730232 | 62 |
| 477 | 3300007788 | Ga0099795_10607814 | Ga0099795_106078142 | 62 |
| 478 | 3300009093 | Ga0105240_10000631 | Ga0105240_1000063137 | 62 |
| 479 | 3300009093 | Ga0105240_10286085 | Ga0105240_102860853 | 62 |
| 480 | 3300009093 | Ga0105240_10361418 | Ga0105240_103614181 | 62 |
| 481 | 3300009093 | Ga0105240_10443611 | Ga0105240_104436113 | 62 |
| 482 | 3300009093 | Ga0105240_10660850 | Ga0105240_106608502 | 62 |
| 483 | 3300009093 | Ga0105240_11507845 | Ga0105240_115078452 | 62 |
| 484 | 3300009094 | Ga0111539_10000370 | Ga0111539_1000037016 | 62 |
| 485 | 3300009094 | Ga0111539_10282400 | Ga0111539_102824002 | 62 |
| 486 | 3300009094 | Ga0111539_11549685 | Ga0111539_115496851 | 62 |
| 487 | 3300009098 | Ga0105245_10014746 | Ga0105245_100147462 | 62 |
| 488 | 3300009098 | Ga0105245_10570905 | Ga0105245_105709052 | 62 |
| 489 | 3300009101 | Ga0105247_10146799 | Ga0105247_101467992 | 62 |
| 490 | 3300009101 | Ga0105247_10270397 | Ga0105247_102703972 | 62 |
| 491 | 3300009101 | Ga0105247_10321849 | Ga0105247_103218491 | 62 |
| 492 | 3300009101 | Ga0105247_10750871 | Ga0105247_107508712 | 62 |
| 493 | 3300009147 | Ga0114129_10042842 | Ga0114129_100428424 | 62 |
| 494 | 3300009147 | Ga0114129_10098402 | Ga0114129_100984025 | 62 |
| 495 | 3300009147 | Ga0114129_10158670 | Ga0114129_101586702 | 62 |
| 496 | 3300009147 | Ga0114129_10209010 | Ga0114129_102090102 | 62 |
| 497 | 3300009147 | Ga0114129_10514167 | Ga0114129_105141672 | 62 |
| 498 | 3300009147 | Ga0114129_10998282 | Ga0114129_109982822 | 62 |
| 499 | 3300009148 | Ga0105243_10128102 | Ga0105243_101281022 | 62 |
| 500 | 3300009148 | Ga0105243_10788243 | Ga0105243_107882431 | 62 |
| 501 | 3300009148 | Ga0105243_11150977 | Ga0105243_111509772 | 62 |
| 502 | 3300009148 | Ga0105243_12332465 | Ga0105243_123324652 | 62 |
| 503 | 3300009174 | Ga0105241_10000218 | Ga0105241_1000021817 | 62 |
| 504 | 3300009174 | Ga0105241_10622006 | Ga0105241_106220062 | 62 |
| 505 | 3300009174 | Ga0105241_10981328 | Ga0105241_109813281 | 62 |
| 506 | 3300009174 | Ga0105241_11064906 | Ga0105241_110649061 | 62 |
| 507 | 3300009174 | Ga0105241_11107263 | Ga0105241_111072632 | 62 |
| 508 | 3300009174 | Ga0105241_11346610 | Ga0105241_113466102 | 62 |
| 509 | 3300009176 | Ga0105242_10301640 | Ga0105242_103016402 | 62 |
| 510 | 3300009176 | Ga0105242_10531097 | Ga0105242_105310971 | 62 |
| 511 | 3300009176 | Ga0105242_10625792 | Ga0105242_106257922 | 62 |
| 512 | 3300009176 | Ga0105242_10716087 | Ga0105242_107160872 | 62 |
| 513 | 3300009176 | Ga0105242_11483690 | Ga0105242_114836901 | 62 |
| 514 | 3300009177 | Ga0105248_10000003 | Ga0105248_10000003736 | 62 |
| 515 | 3300009177 | Ga0105248_10059326 | Ga0105248_100593265 | 62 |
| 516 | 3300009177 | Ga0105248_10206787 | Ga0105248_102067873 | 62 |
| 517 | 3300009177 | Ga0105248_10437759 | Ga0105248_104377591 | 62 |
| 518 | 3300009177 | Ga0105248_10486124 | Ga0105248_104861242 | 62 |
| 519 | 3300009177 | Ga0105248_10490679 | Ga0105248_104906792 | 62 |
| 520 | 3300009177 | Ga0105248_10758461 | Ga0105248_107584612 | 62 |
| 521 | 3300009177 | Ga0105248_11534571 | Ga0105248_115345713 | 62 |
| 522 | 3300009177 | Ga0105248_11980191 | Ga0105248_119801911 | 62 |
| 523 | 3300009545 | Ga0105237_10038178 | Ga0105237_100381783 | 62 |
| 524 | 3300009545 | Ga0105237_10135744 | Ga0105237_101357443 | 62 |
| 525 | 3300009545 | Ga0105237_10859458 | Ga0105237_108594582 | 62 |
| 526 | 3300009545 | Ga0105237_11037160 | Ga0105237_110371601 | 62 |
| 527 | 3300009545 | Ga0105237_12185466 | Ga0105237_121854661 | 62 |
| 528 | 3300009545 | Ga0105237_12364970 | Ga0105237_123649702 | 62 |
| 529 | 3300009551 | Ga0105238_10000330 | Ga0105238_100003304 | 62 |
| 530 | 3300009551 | Ga0105238_10375897 | Ga0105238_103758972 | 62 |
| 531 | 3300009551 | Ga0105238_11075153 | Ga0105238_110751532 | 62 |
| 532 | 3300009551 | Ga0105238_11728110 | Ga0105238_117281102 | 62 |
| 533 | 3300009551 | Ga0105238_12923362 | Ga0105238_129233621 | 62 |
| 534 | 3300009553 | Ga0105249_10045686 | Ga0105249_100456862 | 62 |
| 535 | 3300009553 | Ga0105249_10081138 | Ga0105249_100811382 | 62 |
| 536 | 3300009553 | Ga0105249_10808275 | Ga0105249_108082752 | 62 |
| 537 | 3300009553 | Ga0105249_11319496 | Ga0105249_113194962 | 62 |
| 538 | 3300009553 | Ga0105249_12237989 | Ga0105249_122379892 | 62 |
| 539 | 3300009553 | Ga0105249_12515443 | Ga0105249_125154432 | 62 |
| 540 | 3300010159 | Ga0099796_10577339 | Ga0099796_105773392 | 62 |
| 541 | 3300010375 | Ga0105239_10017447 | Ga0105239_100174473 | 62 |
| 542 | 3300010375 | Ga0105239_10136702 | Ga0105239_101367023 | 62 |
| 543 | 3300010375 | Ga0105239_10490350 | Ga0105239_104903502 | 62 |
| 544 | 3300010375 | Ga0105239_11237154 | Ga0105239_112371542 | 62 |
| 545 | 3300010375 | Ga0105239_11763757 | Ga0105239_117637572 | 62 |
| 546 | 3300010375 | Ga0105239_13635464 | Ga0105239_136354642 | 62 |
| 547 | 3300011119 | Ga0105246_10100913 | Ga0105246_101009132 | 62 |
| 548 | 3300011119 | Ga0105246_10141582 | Ga0105246_101415823 | 62 |
| 549 | 3300011119 | Ga0105246_10894702 | Ga0105246_108947021 | 62 |
| 550 | 3300011119 | Ga0105246_10944710 | Ga0105246_109447101 | 62 |
| 551 | 3300013100 | Ga0157373_10007747 | Ga0157373_100077478 | 62 |
| 552 | 3300013100 | Ga0157373_10278390 | Ga0157373_102783902 | 62 |
| 553 | 3300013100 | Ga0157373_10377827 | Ga0157373_103778272 | 62 |
| 554 | 3300013100 | Ga0157373_10522220 | Ga0157373_105222202 | 62 |
| 555 | 3300013100 | Ga0157373_10977092 | Ga0157373_109770921 | 62 |
| 556 | 3300013102 | Ga0157371_10104300 | Ga0157371_101043003 | 62 |
| 557 | 3300013102 | Ga0157371_10528594 | Ga0157371_105285942 | 62 |
| 558 | 3300013102 | Ga0157371_10715378 | Ga0157371_107153782 | 62 |
| 559 | 3300013102 | Ga0157371_11253077 | Ga0157371_112530771 | 62 |
| 560 | 3300013104 | Ga0157370_10297526 | Ga0157370_102975262 | 62 |
| 561 | 3300013104 | Ga0157370_11124992 | Ga0157370_111249922 | 62 |
| 562 | 3300013104 | Ga0157370_11708890 | Ga0157370_117088902 | 62 |
| 563 | 3300013105 | Ga0157369_10000860 | Ga0157369_1000086024 | 62 |
| 564 | 3300013105 | Ga0157369_10036835 | Ga0157369_100368355 | 62 |
| 565 | 3300013105 | Ga0157369_10038485 | Ga0157369_100384855 | 62 |
| 566 | 3300013105 | Ga0157369_10039385 | Ga0157369_100393851 | 62 |
| 567 | 3300013105 | Ga0157369_10042353 | Ga0157369_100423535 | 62 |
| 568 | 3300013105 | Ga0157369_10057516 | Ga0157369_100575165 | 62 |
| 569 | 3300013105 | Ga0157369_10091723 | Ga0157369_100917232 | 62 |
| 570 | 3300013105 | Ga0157369_10475544 | Ga0157369_104755442 | 62 |
| 571 | 3300013105 | Ga0157369_10648666 | Ga0157369_106486662 | 62 |
| 572 | 3300013105 | Ga0157369_10718574 | Ga0157369_107185742 | 62 |
| 573 | 3300013105 | Ga0157369_10744943 | Ga0157369_107449432 | 62 |
| 574 | 3300013105 | Ga0157369_11275170 | Ga0157369_112751702 | 62 |
| 575 | 3300013105 | Ga0157369_11901950 | Ga0157369_119019502 | 62 |
| 576 | 3300013296 | Ga0157374_10000623 | Ga0157374_1000062330 | 62 |
| 577 | 3300013296 | Ga0157374_10001096 | Ga0157374_100010968 | 62 |
| 578 | 3300013296 | Ga0157374_10068368 | Ga0157374_100683683 | 62 |
| 579 | 3300013296 | Ga0157374_10207287 | Ga0157374_102072874 | 62 |
| 580 | 3300013296 | Ga0157374_11343491 | Ga0157374_113434912 | 62 |
| 581 | 3300013297 | Ga0157378_10001737 | Ga0157378_1000173717 | 62 |
| 582 | 3300013297 | Ga0157378_10004369 | Ga0157378_100043693 | 62 |
| 583 | 3300013297 | Ga0157378_10095679 | Ga0157378_100956792 | 62 |
| 584 | 3300013297 | Ga0157378_10562822 | Ga0157378_105628222 | 62 |
| 585 | 3300013297 | Ga0157378_11334226 | Ga0157378_113342263 | 62 |
| 586 | 3300013297 | Ga0157378_12571293 | Ga0157378_125712931 | 62 |
| 587 | 3300013306 | Ga0163162_10001630 | Ga0163162_1000163022 | 62 |
| 588 | 3300013306 | Ga0163162_10225317 | Ga0163162_102253174 | 62 |
| 589 | 3300013306 | Ga0163162_10842400 | Ga0163162_108424003 | 62 |
| 590 | 3300013306 | Ga0163162_11506763 | Ga0163162_115067632 | 62 |
| 591 | 3300013306 | Ga0163162_11714965 | Ga0163162_117149651 | 62 |
| 592 | 3300013306 | Ga0163162_12114399 | Ga0163162_121143991 | 62 |
| 593 | 3300013306 | Ga0163162_12383620 | Ga0163162_123836202 | 62 |
| 594 | 3300013306 | Ga0163162_13095874 | Ga0163162_130958741 | 62 |
| 595 | 3300013307 | Ga0157372_10002736 | Ga0157372_100027364 | 62 |
| 596 | 3300013307 | Ga0157372_10006133 | Ga0157372_100061333 | 62 |
| 597 | 3300013307 | Ga0157372_10015841 | Ga0157372_100158414 | 62 |
| 598 | 3300013307 | Ga0157372_10034967 | Ga0157372_100349671 | 62 |
| 599 | 3300013307 | Ga0157372_10071734 | Ga0157372_100717343 | 62 |
| 600 | 3300013307 | Ga0157372_10139785 | Ga0157372_101397851 | 62 |
| 601 | 3300013307 | Ga0157372_10206201 | Ga0157372_102062013 | 62 |
| 602 | 3300013307 | Ga0157372_10470821 | Ga0157372_104708212 | 62 |
| 603 | 3300013307 | Ga0157372_10540767 | Ga0157372_105407673 | 62 |
| 604 | 3300013307 | Ga0157372_11024480 | Ga0157372_110244802 | 62 |
| 605 | 3300013307 | Ga0157372_11039895 | Ga0157372_110398951 | 62 |
| 606 | 3300013308 | Ga0157375_10258654 | Ga0157375_102586542 | 62 |
| 607 | 3300013308 | Ga0157375_10440063 | Ga0157375_104400632 | 62 |
| 608 | 3300013308 | Ga0157375_11030670 | Ga0157375_110306702 | 62 |
| 609 | 3300013308 | Ga0157375_11710345 | Ga0157375_117103453 | 62 |
| 610 | 3300014325 | Ga0163163_10203524 | Ga0163163_102035242 | 62 |
| 611 | 3300014325 | Ga0163163_10482239 | Ga0163163_104822393 | 62 |
| 612 | 3300014325 | Ga0163163_11221169 | Ga0163163_112211692 | 62 |
| 613 | 3300014326 | Ga0157380_10427492 | Ga0157380_104274921 | 62 |
| 614 | 3300014326 | Ga0157380_10950765 | Ga0157380_109507651 | 62 |
| 615 | 3300014497 | Ga0182008_10056847 | Ga0182008_100568472 | 62 |
| 616 | 3300014745 | Ga0157377_10039326 | Ga0157377_100393262 | 62 |
| 617 | 3300014745 | Ga0157377_10124565 | Ga0157377_101245652 | 62 |
| 618 | 3300014968 | Ga0157379_10025795 | Ga0157379_100257954 | 62 |
| 619 | 3300014968 | Ga0157379_10059338 | Ga0157379_100593383 | 62 |
| 620 | 3300014968 | Ga0157379_10103084 | Ga0157379_101030842 | 62 |
| 621 | 3300014968 | Ga0157379_10596177 | Ga0157379_105961773 | 62 |
| 622 | 3300014969 | Ga0157376_10133813 | Ga0157376_101338131 | 62 |
| 623 | 3300014969 | Ga0157376_10182867 | Ga0157376_101828674 | 62 |
| 624 | 3300014969 | Ga0157376_10261252 | Ga0157376_102612522 | 62 |
| 625 | 3300014969 | Ga0157376_10346467 | Ga0157376_103464672 | 62 |
| 626 | 3300014969 | Ga0157376_12108704 | Ga0157376_121087042 | 62 |
| 627 | 3300015262 | Ga0182007_10040446 | Ga0182007_100404462 | 62 |
| 628 | 3300020081 | Ga0206354_10273109 | Ga0206354_102731092 | 62 |
| 629 | 3300020082 | Ga0206353_11476773 | Ga0206353_114767732 | 62 |
| 630 | 3300025885 | Ga0207653_10039108 | Ga0207653_100391082 | 62 |
| 631 | 3300025885 | Ga0207653_10045081 | Ga0207653_100450812 | 62 |
| 632 | 3300025885 | Ga0207653_10087152 | Ga0207653_100871521 | 62 |
| 633 | 3300025893 | Ga0207682_10209462 | Ga0207682_102094622 | 62 |
| 634 | 3300025898 | Ga0207692_10287538 | Ga0207692_102875381 | 62 |
| 635 | 3300025900 | Ga0207710_10021562 | Ga0207710_100215622 | 62 |
| 636 | 3300025904 | Ga0207647_10215025 | Ga0207647_102150252 | 62 |
| 637 | 3300025905 | Ga0207685_10277766 | Ga0207685_102777662 | 62 |
| 638 | 3300025906 | Ga0207699_10187793 | Ga0207699_101877931 | 62 |
| 639 | 3300025907 | Ga0207645_10001324 | Ga0207645_100013248 | 62 |
| 640 | 3300025907 | Ga0207645_10192689 | Ga0207645_101926891 | 62 |
| 641 | 3300025908 | Ga0207643_10000157 | Ga0207643_1000015723 | 62 |
| 642 | 3300025910 | Ga0207684_10008133 | Ga0207684_1000813310 | 62 |
| 643 | 3300025910 | Ga0207684_10010283 | Ga0207684_100102834 | 62 |
| 644 | 3300025910 | Ga0207684_10014651 | Ga0207684_100146516 | 62 |
| 645 | 3300025910 | Ga0207684_10088487 | Ga0207684_100884872 | 62 |
| 646 | 3300025910 | Ga0207684_10170081 | Ga0207684_101700813 | 62 |
| 647 | 3300025910 | Ga0207684_10387218 | Ga0207684_103872181 | 62 |
| 648 | 3300025910 | Ga0207684_10423134 | Ga0207684_104231342 | 62 |
| 649 | 3300025911 | Ga0207654_10026891 | Ga0207654_100268914 | 62 |
| 650 | 3300025911 | Ga0207654_11059643 | Ga0207654_110596432 | 62 |
| 651 | 3300025912 | Ga0207707_10000258 | Ga0207707_1000025832 | 62 |
| 652 | 3300025912 | Ga0207707_10174070 | Ga0207707_101740702 | 62 |
| 653 | 3300025912 | Ga0207707_10582329 | Ga0207707_105823292 | 62 |
| 654 | 3300025912 | Ga0207707_11663668 | Ga0207707_116636681 | 62 |
| 655 | 3300025913 | Ga0207695_10006130 | Ga0207695_100061303 | 62 |
| 656 | 3300025913 | Ga0207695_10472289 | Ga0207695_104722892 | 62 |
| 657 | 3300025914 | Ga0207671_10241288 | Ga0207671_102412883 | 62 |
| 658 | 3300025915 | Ga0207693_10001303 | Ga0207693_1000130319 | 62 |
| 659 | 3300025915 | Ga0207693_10142219 | Ga0207693_101422192 | 62 |
| 660 | 3300025916 | Ga0207663_10052807 | Ga0207663_100528072 | 62 |
| 661 | 3300025917 | Ga0207660_10224521 | Ga0207660_102245212 | 62 |
| 662 | 3300025917 | Ga0207660_10414539 | Ga0207660_104145392 | 62 |
| 663 | 3300025917 | Ga0207660_11131258 | Ga0207660_111312581 | 62 |
| 664 | 3300025918 | Ga0207662_10080195 | Ga0207662_100801951 | 62 |
| 665 | 3300025919 | Ga0207657_10000373 | Ga0207657_1000037318 | 62 |
| 666 | 3300025920 | Ga0207649_10006286 | Ga0207649_100062866 | 62 |
| 667 | 3300025921 | Ga0207652_10004142 | Ga0207652_100041422 | 62 |
| 668 | 3300025921 | Ga0207652_10141140 | Ga0207652_101411401 | 62 |
| 669 | 3300025922 | Ga0207646_10004675 | Ga0207646_1000467510 | 62 |
| 670 | 3300025922 | Ga0207646_10044552 | Ga0207646_100445525 | 62 |
| 671 | 3300025922 | Ga0207646_10047209 | Ga0207646_100472092 | 62 |
| 672 | 3300025922 | Ga0207646_10051594 | Ga0207646_100515944 | 62 |
| 673 | 3300025922 | Ga0207646_10065789 | Ga0207646_100657892 | 62 |
| 674 | 3300025922 | Ga0207646_10105489 | Ga0207646_101054893 | 62 |
| 675 | 3300025922 | Ga0207646_10490945 | Ga0207646_104909451 | 62 |
| 676 | 3300025923 | Ga0207681_10088200 | Ga0207681_100882003 | 62 |
| 677 | 3300025924 | Ga0207694_11837595 | Ga0207694_118375952 | 62 |
| 678 | 3300025925 | Ga0207650_10076533 | Ga0207650_100765333 | 62 |
| 679 | 3300025926 | Ga0207659_10176184 | Ga0207659_101761842 | 62 |
| 680 | 3300025927 | Ga0207687_11484018 | Ga0207687_114840181 | 62 |
| 681 | 3300025932 | Ga0207690_10095350 | Ga0207690_100953502 | 62 |
| 682 | 3300025933 | Ga0207706_10001857 | Ga0207706_100018572 | 62 |
| 683 | 3300025933 | Ga0207706_10008929 | Ga0207706_100089296 | 62 |
| 684 | 3300025933 | Ga0207706_10864532 | Ga0207706_108645321 | 62 |
| 685 | 3300025934 | Ga0207686_10339234 | Ga0207686_103392342 | 62 |
| 686 | 3300025934 | Ga0207686_11157419 | Ga0207686_111574192 | 62 |
| 687 | 3300025935 | Ga0207709_10115773 | Ga0207709_101157732 | 62 |
| 688 | 3300025935 | Ga0207709_11127613 | Ga0207709_111276132 | 62 |
| 689 | 3300025936 | Ga0207670_10028434 | Ga0207670_100284343 | 62 |
| 690 | 3300025936 | Ga0207670_10036465 | Ga0207670_100364654 | 62 |
| 691 | 3300025936 | Ga0207670_11267801 | Ga0207670_112678011 | 62 |
| 692 | 3300025938 | Ga0207704_10384794 | Ga0207704_103847942 | 62 |
| 693 | 3300025938 | Ga0207704_10598929 | Ga0207704_105989293 | 62 |
| 694 | 3300025939 | Ga0207665_10005743 | Ga0207665_100057433 | 62 |
| 695 | 3300025939 | Ga0207665_10657713 | Ga0207665_106577131 | 62 |
| 696 | 3300025940 | Ga0207691_11411252 | Ga0207691_114112522 | 62 |
| 697 | 3300025941 | Ga0207711_11300423 | Ga0207711_113004231 | 62 |
| 698 | 3300025942 | Ga0207689_10000975 | Ga0207689_100009754 | 62 |
| 699 | 3300025942 | Ga0207689_10002812 | Ga0207689_100028122 | 62 |
| 700 | 3300025944 | Ga0207661_10257351 | Ga0207661_102573512 | 62 |
| 701 | 3300025945 | Ga0207679_10000779 | Ga0207679_1000077917 | 62 |
| 702 | 3300025949 | Ga0207667_10000857 | Ga0207667_1000085728 | 62 |
| 703 | 3300025949 | Ga0207667_10327367 | Ga0207667_103273674 | 62 |
| 704 | 3300025949 | Ga0207667_10977281 | Ga0207667_109772812 | 62 |
| 705 | 3300025961 | Ga0207712_10058438 | Ga0207712_100584382 | 62 |
| 706 | 3300025961 | Ga0207712_10274100 | Ga0207712_102741002 | 62 |
| 707 | 3300025961 | Ga0207712_10552620 | Ga0207712_105526202 | 62 |
| 708 | 3300025981 | Ga0207640_10032375 | Ga0207640_100323752 | 62 |
| 709 | 3300025986 | Ga0207658_11341873 | Ga0207658_113418732 | 62 |
| 710 | 3300025986 | Ga0207658_12040675 | Ga0207658_120406752 | 62 |
| 711 | 3300026023 | Ga0207677_10011276 | Ga0207677_100112764 | 62 |
| 712 | 3300026035 | Ga0207703_10199610 | Ga0207703_101996102 | 62 |
| 713 | 3300026035 | Ga0207703_10366062 | Ga0207703_103660622 | 62 |
| 714 | 3300026035 | Ga0207703_11318259 | Ga0207703_113182591 | 62 |
| 715 | 3300026035 | Ga0207703_11951730 | Ga0207703_119517303 | 62 |
| 716 | 3300026041 | Ga0207639_10042698 | Ga0207639_100426982 | 62 |
| 717 | 3300026067 | Ga0207678_10002143 | Ga0207678_100021434 | 62 |
| 718 | 3300026075 | Ga0207708_10089290 | Ga0207708_100892902 | 62 |
| 719 | 3300026075 | Ga0207708_10211569 | Ga0207708_102115692 | 62 |
| 720 | 3300026075 | Ga0207708_10415349 | Ga0207708_104153491 | 62 |
| 721 | 3300026075 | Ga0207708_10918024 | Ga0207708_109180241 | 62 |
| 722 | 3300026078 | Ga0207702_10001041 | Ga0207702_1000104111 | 62 |
| 723 | 3300026088 | Ga0207641_10110682 | Ga0207641_101106822 | 62 |
| 724 | 3300026088 | Ga0207641_10134689 | Ga0207641_101346891 | 62 |
| 725 | 3300026088 | Ga0207641_10470644 | Ga0207641_104706441 | 62 |
| 726 | 3300026089 | Ga0207648_10027225 | Ga0207648_100272252 | 62 |
| 727 | 3300026089 | Ga0207648_10513436 | Ga0207648_105134361 | 62 |
| 728 | 3300026095 | Ga0207676_10005775 | Ga0207676_1000577511 | 62 |
| 729 | 3300026095 | Ga0207676_10835249 | Ga0207676_108352491 | 62 |
| 730 | 3300026116 | Ga0207674_10008510 | Ga0207674_100085102 | 62 |
| 731 | 3300026116 | Ga0207674_10197920 | Ga0207674_101979202 | 62 |
| 732 | 3300026118 | Ga0207675_100028715 | Ga0207675_1000287154 | 62 |
| 733 | 3300026118 | Ga0207675_100041467 | Ga0207675_1000414673 | 62 |
| 734 | 3300026118 | Ga0207675_100241559 | Ga0207675_1002415592 | 62 |
| 735 | 3300026142 | Ga0207698_11209964 | Ga0207698_112099641 | 62 |
| 736 | 3300027682 | Ga0209971_1086318 | Ga0209971_10863182 | 62 |
| 737 | 3300027876 | Ga0209974_10080257 | Ga0209974_100802572 | 62 |
| 738 | 3300027876 | Ga0209974_10215543 | Ga0209974_102155431 | 62 |
| 739 | 3300027907 | Ga0207428_10000409 | Ga0207428_1000040933 | 62 |
| 740 | 3300027907 | Ga0207428_10055666 | Ga0207428_100556663 | 62 |
| 741 | 3300028380 | Ga0268265_10012391 | Ga0268265_100123912 | 62 |
| 742 | 3300028380 | Ga0268265_10039330 | Ga0268265_100393302 | 62 |
| 743 | 3300028380 | Ga0268265_10183974 | Ga0268265_101839743 | 62 |
| 744 | 3300028380 | Ga0268265_10613472 | Ga0268265_106134722 | 62 |
| 745 | 3300028380 | Ga0268265_11470376 | Ga0268265_114703761 | 62 |
| 746 | 3300028381 | Ga0268264_10020556 | Ga0268264_100205561 | 62 |
| 747 | 3300028381 | Ga0268264_10184885 | Ga0268264_101848852 | 62 |
| 748 | 3300028381 | Ga0268264_10279165 | Ga0268264_102791652 | 62 |
| 749 | 3300028800 | Ga0265338_10900391 | Ga0265338_109003911 | 62 |
| 750 | 3300034816 | Ga0373930_0037196 | Ga0373930_0037196_196_387 | 62 |
| 751 | 3300034817 | Ga0373948_0031154 | Ga0373948_0031154_796_987 | 62 |
| 752 | 3300034820 | Ga0373959_0010060 | Ga0373959_0010060_390_581 | 62 |
| 753 | 3300035085 | Ga0373929_0012726 | Ga0373929_0012726_164_355 | 62 |
| 754 | 3300035086 | Ga0373934_0152402 | Ga0373934_0152402_369_560 | 62 |
| 755 | 3300035090 | Ga0373949_0041100 | Ga0373949_0041100_226_417 | 62 |
| 756 | 3300035090 | Ga0373949_0214466 | Ga0373949_0214466_340_531 | 62 |
| 757 | 3300035091 | Ga0373951_0181220 | Ga0373951_0181220_311_502 | 62 |
| 758 | 3300035092 | Ga0373952_0163889 | Ga0373952_0163889_309_500 | 62 |
| 759 | 3300035113 | Ga0373936_0563372 | Ga0373936_0563372_174_365 | 62 |
| 760 | 3300035115 | Ga0373941_0307983 | Ga0373941_0307983_280_471 | 62 |
| 761 | 3300035117 | Ga0373953_0022081 | Ga0373953_0022081_1293_1484 | 62 |
| 762 | 3300035119 | Ga0373956_0167277 | Ga0373956_0167277_605_796 | 62 |
| 763 | 3300035121 | Ga0373960_0125478 | Ga0373960_0125478_565_756 | 62 |
| 764 | 3300035241 | Ga0373961_0023387 | Ga0373961_0023387_1139_1330 | 62 |
| 765 | 3300035242 | Ga0373962_0095026 | Ga0373962_0095026_479_670 | 62 |
| 766 | 3300036712 | Ga0316584_0721120 | Ga0316584_0721120_70_261 | 62 |
| 767 | 3300037471 | Ga0395905_0393256 | Ga0395905_0393256_156_347 | 62 |
| 768 | 3300038996 | Ga0242420_137901 | Ga0242420_137901_30_221 | 62 |
| 769 | 3300039453 | Ga0436362_0536511 | Ga0436362_0536511_183_374 | 62 |
| 770 | 3300039453 | Ga0436362_0750444 | Ga0436362_0750444_2541_2768 | 62 |
| 771 | 3300042003 | Ga0439443_103721 | Ga0439443_103721_316_510 | 62 |
| 772 | 3300042005 | Ga0439448_0123190 | Ga0439448_0123190_216_407 | 62 |
| 773 | 3300042008 | Ga0439450_019674 | Ga0439450_019674_974_1165 | 62 |
| 774 | 3300042012 | Ga0439455_0061480 | Ga0439455_0061480_634_825 | 62 |
| 775 | 3300042118 | Ga0450914_059757 | Ga0450914_059757_270_461 | 62 |
| 776 | 3300042157 | Ga0439458_0084944 | Ga0439458_0084944_190_381 | 62 |
| 777 | 3300042438 | Ga0439459_0015470 | Ga0439459_0015470_768_959 | 62 |
| 778 | 3300042439 | Ga0439464_0001377 | Ga0439464_0001377_2879_3070 | 62 |
| 779 | 3300042439 | Ga0439464_0287693 | Ga0439464_0287693_289_480 | 62 |
| 780 | 3300042461 | Ga0439460_0004434 | Ga0439460_0004434_740_931 | 62 |
| 781 | 3300042461 | Ga0439460_0098969 | Ga0439460_0098969_357_551 | 62 |
| 782 | 3300042876 | Ga0451577_0003197 | Ga0451577_0003197_1602_1796 | 62 |
| 783 | 3300042876 | Ga0451577_0017287 | Ga0451577_0017287_6378_6569 | 62 |
| 784 | 3300042876 | Ga0451577_0678249 | Ga0451577_0678249_471_662 | 62 |
| 785 | 3300042876 | Ga0451577_0888856 | Ga0451577_0888856_142_333 | 62 |
| 786 | 3300042993 | Ga0439440_0080245 | Ga0439440_0080245_484_675 | 62 |
| 787 | 3300042993 | Ga0439440_0111873 | Ga0439440_0111873_512_703 | 62 |
| 788 | 3300042993 | Ga0439440_0171081 | Ga0439440_0171081_245_439 | 62 |
| 789 | 3300044673 | Ga0453683_0032136 | Ga0453683_0032136_1902_2096 | 62 |
| 790 | 3300044673 | Ga0453683_0048690 | Ga0453683_0048690_1997_2188 | 62 |
| 791 | 3300044694 | Ga0466963_0255477 | Ga0466963_0255477_695_886 | 62 |
| 792 | 3300044694 | Ga0466963_0397232 | Ga0466963_0397232_29_220 | 62 |
| 793 | 3300044712 | Ga0453684_0051544 | Ga0453684_0051544_1347_1541 | 62 |
| 794 | 3300044712 | Ga0453684_0176401 | Ga0453684_0176401_210_401 | 62 |
| 795 | 3300044712 | Ga0453684_1756387 | Ga0453684_1756387_164_355 | 62 |
| 796 | 3300045051 | Ga0451576_0016285 | Ga0451576_0016285_3586_3780 | 62 |
| 797 | 3300045051 | Ga0451576_0021455 | Ga0451576_0021455_441_632 | 62 |
| 798 | 3300045051 | Ga0451576_0109256 | Ga0451576_0109256_579_770 | 62 |
| 799 | 3300045051 | Ga0451576_0374364 | Ga0451576_0374364_1087_1278 | 62 |
| 800 | 3300045051 | Ga0451576_1819223 | Ga0451576_1819223_407_601 | 62 |
| 801 | 3300045836 | Ga0466958_0362224 | Ga0466958_0362224_14_205 | 62 |
| 802 | 3300045836 | Ga0466958_0387879 | Ga0466958_0387879_681_872 | 62 |
| 803 | 3300046455 | Ga0495603_0151546 | Ga0495603_0151546_15_206 | 62 |
| 804 | 3300046462 | Ga0495651_0802509 | Ga0495651_0802509_215_448 | 62 |
| 805 | 3300046472 | Ga0495580_0142533 | Ga0495580_0142533_324_548 | 62 |
| 806 | 3300046474 | Ga0495605_0386270 | Ga0495605_0386270_223_456 | 62 |
| 807 | 3300046476 | Ga0495662_0188767 | Ga0495662_0188767_93_326 | 62 |
| 808 | 3300046477 | Ga0495664_0110358 | Ga0495664_0110358_709_942 | 62 |
| 809 | 3300046491 | Ga0495584_0105366 | Ga0495584_0105366_895_1086 | 62 |
| 810 | 3300046499 | Ga0495594_0185997 | Ga0495594_0185997_243_467 | 62 |
| 811 | 3300046516 | Ga0495628_0924417 | Ga0495628_0924417_270_503 | 62 |
| 812 | 3300046528 | Ga0495642_0040523 | Ga0495642_0040523_25_249 | 62 |
| 813 | 3300046531 | Ga0495665_0150775 | Ga0495665_0150775_667_900 | 62 |
| 814 | 3300046531 | Ga0495665_0280743 | Ga0495665_0280743_30_254 | 62 |
| 815 | 3300046535 | Ga0495586_0152297 | Ga0495586_0152297_603_836 | 62 |
| 816 | 3300046536 | Ga0495587_0549160 | Ga0495587_0549160_208_441 | 62 |
| 817 | 3300046543 | Ga0495645_0084383 | Ga0495645_0084383_1881_2114 | 62 |
| 818 | 3300046674 | Ga0495588_0153989 | Ga0495588_0153989_485_709 | 62 |
| 819 | 3300046675 | Ga0495657_0702546 | Ga0495657_0702546_130_363 | 62 |
| 820 | 3300046678 | Ga0495599_0625873 | Ga0495599_0625873_182_415 | 62 |
| 821 | 3300046679 | Ga0495623_0145129 | Ga0495623_0145129_181_414 | 62 |
| 822 | 3300046684 | Ga0495669_0172550 | Ga0495669_0172550_97_330 | 62 |
| 823 | 3300046809 | Ga0495600_0235295 | Ga0495600_0235295_860_1093 | 62 |
| 824 | 3300047315 | Ga0495581_0348250 | Ga0495581_0348250_197_421 | 62 |
| 825 | 3300047315 | Ga0495581_0701533 | Ga0495581_0701533_188_421 | 62 |
| 826 | 3300047317 | Ga0495604_0097872 | Ga0495604_0097872_936_1169 | 62 |
| 827 | 3300047323 | Ga0495683_0346110 | Ga0495683_0346110_269_493 | 62 |
| 828 | 3300047444 | Ga0495675_0236553 | Ga0495675_0236553_84_317 | 62 |
| 829 | 3300047445 | Ga0495677_0125595 | Ga0495677_0125595_136_360 | 62 |
| 830 | 3300048088 | Ga0495602_0906776 | Ga0495602_0906776_190_423 | 62 |
| 831 | 3300048089 | Ga0495614_0214934 | Ga0495614_0214934_533_757 | 62 |
| 832 | 3300048905 | Ga0496102_1182226 | Ga0496102_1182226_158_349 | 62 |
| 833 | 3300048907 | Ga0496104_0684301 | Ga0496104_0684301_500_724 | 62 |
| 834 | 3300048907 | Ga0496104_0969422 | Ga0496104_0969422_430_621 | 62 |
| 835 | 3300048909 | Ga0496106_0518118 | Ga0496106_0518118_640_831 | 62 |
| 836 | 3300048910 | Ga0496107_0602822 | Ga0496107_0602822_411_602 | 62 |
| 837 | 3300048911 | Ga0496108_0529524 | Ga0496108_0529524_154_345 | 62 |
| 838 | 3300048911 | Ga0496108_1750826 | Ga0496108_1750826_108_332 | 62 |
| 839 | 3300048912 | Ga0496109_0475554 | Ga0496109_0475554_841_1032 | 62 |
| 840 | 3300048912 | Ga0496109_0993790 | Ga0496109_0993790_236_427 | 62 |
| 841 | 3300048913 | Ga0496110_0876434 | Ga0496110_0876434_348_539 | 62 |
| 842 | 3300048915 | Ga0496112_0735378 | Ga0496112_0735378_571_762 | 62 |
| 843 | 3300048915 | Ga0496112_0993179 | Ga0496112_0993179_130_354 | 62 |
| 844 | 3300048916 | Ga0496113_0103521 | Ga0496113_0103521_834_1025 | 62 |
| 845 | 3300048916 | Ga0496113_1117253 | Ga0496113_1117253_164_394 | 62 |
| 846 | 3300048916 | Ga0496113_1350575 | Ga0496113_1350575_61_252 | 62 |
| 847 | 3300048918 | Ga0496115_0028275 | Ga0496115_0028275_169_360 | 62 |
| 848 | 3300049569 | Ga0501032_0271872 | Ga0501032_0271872_377_568 | 62 |
| 849 | 3300049570 | Ga0501033_0064984 | Ga0501033_0064984_1995_2186 | 62 |
| 850 | 3300049570 | Ga0501033_0260019 | Ga0501033_0260019_171_362 | 62 |
| 851 | 3300049572 | Ga0501036_0307362 | Ga0501036_0307362_905_1096 | 62 |
| 852 | 3300049572 | Ga0501036_0514743 | Ga0501036_0514743_766_957 | 62 |
| 853 | 3300049572 | Ga0501036_0629317 | Ga0501036_0629317_281_472 | 62 |
| 854 | 3300049572 | Ga0501036_1305803 | Ga0501036_1305803_384_578 | 62 |
| 855 | 3300049574 | Ga0501038_0150053 | Ga0501038_0150053_297_488 | 62 |
| 856 | 3300049574 | Ga0501038_0191815 | Ga0501038_0191815_17_208 | 62 |
| 857 | 3300049575 | Ga0501039_0079790 | Ga0501039_0079790_1513_1704 | 62 |
| 858 | 3300049575 | Ga0501039_0305461 | Ga0501039_0305461_798_989 | 62 |
| 859 | 3300049576 | Ga0501040_0003451 | Ga0501040_0003451_89_280 | 62 |
| 860 | 3300049576 | Ga0501040_0041964 | Ga0501040_0041964_674_865 | 62 |
| 861 | 3300049576 | Ga0501040_0136829 | Ga0501040_0136829_581_772 | 62 |
| 862 | 3300049576 | Ga0501040_0192808 | Ga0501040_0192808_914_1105 | 62 |
| 863 | 3300049577 | Ga0501041_0003300 | Ga0501041_0003300_7487_7678 | 62 |
| 864 | 3300049577 | Ga0501041_0233225 | Ga0501041_0233225_945_1136 | 62 |
| 865 | 3300049578 | Ga0501042_0009827 | Ga0501042_0009827_5767_5958 | 62 |
| 866 | 3300049578 | Ga0501042_0105895 | Ga0501042_0105895_975_1166 | 62 |
| 867 | 3300049578 | Ga0501042_1321187 | Ga0501042_1321187_272_463 | 62 |
| 868 | 3300049579 | Ga0501043_0188199 | Ga0501043_0188199_961_1152 | 62 |
| 869 | 3300049579 | Ga0501043_0276229 | Ga0501043_0276229_473_664 | 62 |
| 870 | 3300049580 | Ga0501046_0000607 | Ga0501046_0000607_17756_17947 | 62 |
| 871 | 3300049580 | Ga0501046_0073675 | Ga0501046_0073675_382_573 | 62 |
| 872 | 3300049580 | Ga0501046_0896204 | Ga0501046_0896204_211_402 | 62 |
| 873 | 3300049582 | Ga0501048_0189964 | Ga0501048_0189964_176_367 | 62 |
| 874 | 3300049583 | Ga0501067_0576000 | Ga0501067_0576000_253_444 | 62 |
| 875 | 3300049584 | Ga0501068_0318313 | Ga0501068_0318313_237_428 | 62 |
| 876 | 3300049584 | Ga0501068_0562728 | Ga0501068_0562728_135_326 | 62 |
| 877 | 3300049585 | Ga0501069_0138456 | Ga0501069_0138456_1018_1209 | 62 |
| 878 | 3300049585 | Ga0501069_0554619 | Ga0501069_0554619_159_350 | 62 |
| 879 | 3300049587 | Ga0501071_0247162 | Ga0501071_0247162_978_1169 | 62 |
| 880 | 3300049587 | Ga0501071_0626163 | Ga0501071_0626163_621_812 | 62 |
| 881 | 3300049588 | Ga0501072_0119308 | Ga0501072_0119308_251_445 | 62 |
| 882 | 3300049588 | Ga0501072_0215305 | Ga0501072_0215305_467_658 | 62 |
| 883 | 3300049589 | Ga0501073_0537600 | Ga0501073_0537600_181_372 | 62 |
| 884 | 3300049590 | Ga0501074_0171986 | Ga0501074_0171986_118_309 | 62 |
| 885 | 3300049590 | Ga0501074_0286895 | Ga0501074_0286895_693_884 | 62 |
| 886 | 3300049591 | Ga0501075_0315584 | Ga0501075_0315584_802_993 | 62 |
| 887 | 3300049591 | Ga0501075_0668076 | Ga0501075_0668076_147_338 | 62 |
| 888 | 3300049592 | Ga0501076_0003696 | Ga0501076_0003696_725_916 | 62 |
| 889 | 3300049592 | Ga0501076_0181203 | Ga0501076_0181203_11_202 | 62 |
| 890 | 3300049592 | Ga0501076_0221552 | Ga0501076_0221552_986_1177 | 62 |
| 891 | 3300049592 | Ga0501076_0744962 | Ga0501076_0744962_437_628 | 62 |
| 892 | 3300049592 | Ga0501076_1525842 | Ga0501076_1525842_106_297 | 62 |
| 893 | 3300049593 | Ga0501077_0023484 | Ga0501077_0023484_2926_3117 | 62 |
| 894 | 3300049593 | Ga0501077_0128880 | Ga0501077_0128880_870_1061 | 62 |
| 895 | 3300049593 | Ga0501077_0129556 | Ga0501077_0129556_431_622 | 62 |
| 896 | 3300049593 | Ga0501077_0338062 | Ga0501077_0338062_414_605 | 62 |
| 897 | 3300049741 | Ga0501079_0009586 | Ga0501079_0009586_5821_6012 | 62 |
| 898 | 3300049741 | Ga0501079_0022016 | Ga0501079_0022016_510_701 | 62 |
| 899 | 3300049741 | Ga0501079_0722716 | Ga0501079_0722716_294_485 | 62 |
| 900 | 3300049741 | Ga0501079_1042496 | Ga0501079_1042496_79_270 | 62 |
| 901 | 3300049742 | Ga0501080_0028717 | Ga0501080_0028717_4108_4299 | 62 |
| 902 | 3300049742 | Ga0501080_0390477 | Ga0501080_0390477_133_324 | 62 |
| 903 | 3300049742 | Ga0501080_0568033 | Ga0501080_0568033_24_215 | 62 |
| 904 | 3300049743 | Ga0501081_0018275 | Ga0501081_0018275_4288_4479 | 62 |
| 905 | 3300049743 | Ga0501081_0060230 | Ga0501081_0060230_830_1021 | 62 |
| 906 | 3300049743 | Ga0501081_0183134 | Ga0501081_0183134_301_492 | 62 |
| 907 | 3300049743 | Ga0501081_0443008 | Ga0501081_0443008_17_208 | 62 |
| 908 | 3300049744 | Ga0501083_0186803 | Ga0501083_0186803_403_594 | 62 |
| 909 | 3300049744 | Ga0501083_0321280 | Ga0501083_0321280_299_490 | 62 |
| 910 | 3300049822 | Ga0501035_0391223 | Ga0501035_0391223_838_1029 | 62 |
| 911 | 3300049824 | Ga0501045_0090523 | Ga0501045_0090523_715_906 | 62 |
| 912 | 3300049824 | Ga0501045_0112285 | Ga0501045_0112285_1246_1437 | 62 |
| 913 | 3300049824 | Ga0501045_0250114 | Ga0501045_0250114_79_270 | 62 |
| 914 | 3300049824 | Ga0501045_0501717 | Ga0501045_0501717_551_742 | 62 |
| 915 | 3300050507 | nmdc:mga05p37_131447_c1 | nmdc:mga05p37_131447_c1_1880_2071 | 62 |
| 916 | 3300050507 | nmdc:mga05p37_1343294_c1 | nmdc:mga05p37_1343294_c1_322_516 | 62 |
| 917 | 3300050507 | nmdc:mga05p37_261175_c2 | nmdc:mga05p37_261175_c2_1183_1374 | 62 |
| 918 | 3300050507 | nmdc:mga05p37_286830_c1 | nmdc:mga05p37_286830_c1_836_1027 | 62 |
| 919 | 3300050507 | nmdc:mga05p37_40058_c1 | nmdc:mga05p37_40058_c1_55_246 | 62 |
| 920 | 3300050507 | nmdc:mga05p37_43249_c1 | nmdc:mga05p37_43249_c1_1939_2130 | 62 |
| 921 | 3300050507 | nmdc:mga05p37_465902_c1 | nmdc:mga05p37_465902_c1_56_250 | 62 |
| 922 | 3300050507 | nmdc:mga05p37_70128_c1 | nmdc:mga05p37_70128_c1_646_879 | 62 |
| 923 | 3300050508 | nmdc:mga09592_11878_c1 | nmdc:mga09592_11878_c1_2638_2871 | 62 |
| 924 | 3300050508 | nmdc:mga09592_147685_c1 | nmdc:mga09592_147685_c1_988_1182 | 62 |
| 925 | 3300050508 | nmdc:mga09592_84995_c1 | nmdc:mga09592_84995_c1_1971_2162 | 62 |
| 926 | 3300050509 | nmdc:mga0qj67_1363606_c1 | nmdc:mga0qj67_1363606_c1_105_305 | 62 |
| 927 | 3300050510 | nmdc:mga06r32_2118_c1 | nmdc:mga06r32_2118_c1_5507_5701 | 62 |
| 928 | 3300050510 | nmdc:mga06r32_545350_c1 | nmdc:mga06r32_545350_c1_553_786 | 62 |
| 929 | 3300050511 | nmdc:mga08y16_14948_c1 | nmdc:mga08y16_14948_c1_5009_5203 | 62 |
| 930 | 3300050511 | nmdc:mga08y16_872768_c1 | nmdc:mga08y16_872768_c1_289_480 | 62 |
| 931 | 3300050512 | nmdc:mga0n895_1147262_c1 | nmdc:mga0n895_1147262_c1_50_241 | 62 |
| 932 | 3300050512 | nmdc:mga0n895_12241_c1 | nmdc:mga0n895_12241_c1_1805_1996 | 62 |
| 933 | 3300050512 | nmdc:mga0n895_1752318_c1 | nmdc:mga0n895_1752318_c1_275_472 | 62 |
| 934 | 3300050512 | nmdc:mga0n895_22280_c1 | nmdc:mga0n895_22280_c1_2835_3029 | 62 |
| 935 | 3300050512 | nmdc:mga0n895_236999_c1 | nmdc:mga0n895_236999_c1_1387_1578 | 62 |
| 936 | 3300050512 | nmdc:mga0n895_659279_c1 | nmdc:mga0n895_659279_c1_92_289 | 62 |
| 937 | 3300050512 | nmdc:mga0n895_774714_c1 | nmdc:mga0n895_774714_c1_407_604 | 62 |
| 938 | 3300050512 | nmdc:mga0n895_796590_c1 | nmdc:mga0n895_796590_c1_362_556 | 62 |
| 939 | 3300050513 | nmdc:mga0rr50_1393201_c1 | nmdc:mga0rr50_1393201_c1_62_253 | 62 |
| 940 | 3300050513 | nmdc:mga0rr50_39532_c1 | nmdc:mga0rr50_39532_c1_1833_2024 | 62 |
| 941 | 3300050513 | nmdc:mga0rr50_4563_c1 | nmdc:mga0rr50_4563_c1_886_1083 | 62 |
| 942 | 3300050513 | nmdc:mga0rr50_884105_c1 | nmdc:mga0rr50_884105_c1_84_278 | 62 |
| 943 | 3300050514 | nmdc:mga08x19_15303_c1 | nmdc:mga08x19_15303_c1_4199_4390 | 62 |
| 944 | 3300050514 | nmdc:mga08x19_185061_c1 | nmdc:mga08x19_185061_c1_1014_1205 | 62 |
| 945 | 3300050515 | nmdc:mga0a205_332583_c1 | nmdc:mga0a205_332583_c1_950_1141 | 62 |
| 946 | 3300050515 | nmdc:mga0a205_48721_c1 | nmdc:mga0a205_48721_c1_588_779 | 62 |
| 947 | 3300050515 | nmdc:mga0a205_74174_c1 | nmdc:mga0a205_74174_c1_264_458 | 62 |
| 948 | 3300050515 | nmdc:mga0a205_84734_c1 | nmdc:mga0a205_84734_c1_1067_1258 | 62 |
| 949 | 3300050515 | nmdc:mga0a205_9635_c1 | nmdc:mga0a205_9635_c1_7756_7950 | 62 |
| 950 | 3300050515 | nmdc:mga0a205_989509_c1 | nmdc:mga0a205_989509_c1_62_259 | 62 |
| 951 | 3300054114 | Ga0501084_0012880 | Ga0501084_0012880_3127_3318 | 62 |
| 952 | 3300054114 | Ga0501084_0046613 | Ga0501084_0046613_25_216 | 62 |
| 953 | 3300054114 | Ga0501084_0110288 | Ga0501084_0110288_272_463 | 62 |
| 954 | 3300054114 | Ga0501084_0113395 | Ga0501084_0113395_1622_1813 | 62 |
| 955 | 3300060353 | Ga0501082_0001321 | Ga0501082_0001321_17480_17671 | 62 |
| 956 | 3300060353 | Ga0501082_0105974 | Ga0501082_0105974_83_274 | 62 |
| 957 | 3300060353 | Ga0501082_0293158 | Ga0501082_0293158_576_767 | 62 |
| 958 | 3300061734 | Ga0530510_0047065 | Ga0530510_0047065_1953_2144 | 62 |
| 959 | 3300061734 | Ga0530510_0707923 | Ga0530510_0707923_454_645 | 62 |
| 960 | 3300061734 | Ga0530510_1420814 | Ga0530510_1420814_232_423 | 62 |
| 961 | 3300061734 | Ga0530510_1463227 | Ga0530510_1463227_214_405 | 62 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8buu-assembly1.cif.gz_X | are-abcf vmlr2 bound to a 70s ribosome | 0.8455 | 4 | 62 |
| 8qpp-assembly1.cif.gz_v | bacillus subtilis muts2-collided disome complex (stalled 70s) | 0.8266 | 3 | 59 |
| 7nhk-assembly1.cif.gz_Z | lsaa, an antibiotic resistance abcf, in complex with 70s ribosome from enterococcus faecalis | 0.8263 | 4 | 61 |
| 8a57-assembly1.cif.gz_1 | cryo-em structure of hflxr bound to the listeria monocytogenes 50s ribosomal subunit. | 0.8262 | 3 | 62 |
| 8a63-assembly1.cif.gz_1 | cryo-em structure of listeria monocytogenes 50s ribosomal subunit. | 0.8227 | 3 | 59 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C0H4C3_127_204_2.30.170.40 | Mainly Beta;Roll;Ribosomal Protein L24e; Chain: T;;Ribosomal protein L28/L24 | 0.8024 | 3 | 58 | 2.30.170.40 |
| 4tovX00 | Mainly Beta;Roll;Ribosomal Protein L24e; Chain: T;;Ribosomal protein L28/L24 | 0.7649 | 4 | 58 | 2.30.170.40 |
| af_P9WHA9_2_78_2.30.170.40 | Mainly Beta;Roll;Ribosomal Protein L24e; Chain: T;;Ribosomal protein L28/L24 | 0.7453 | 4 | 58 | 2.30.170.40 |
| 2awbZ00 | Few Secondary Structures;Irregular;30s Ribosomal Protein S14; Chain N;Ribosomal protein L31 | 0.7276 | 3 | 58 | 4.10.830.30 |
| af_C0H4C3_127_204_2.30.170.40 | Mainly Beta;Roll;Ribosomal Protein L24e; Chain: T;;Ribosomal protein L28/L24 | 0.7249 | 3 | 58 | 2.30.170.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A367ZTT3-F1-model_v4 | Large ribosomal subunit protein bL28 | 0.9227 | 1 | 60 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7V4A907-F1-model_v4 | Large ribosomal subunit protein bL28 | 0.9076 | 3 | 58 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7C6X2Q8-F1-model_v4 | Large ribosomal subunit protein bL28 | 0.9059 | 1 | 62 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7C3L345-F1-model_v4 | Large ribosomal subunit protein bL28 | 0.9001 | 1 | 55 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7C2DKY0-F1-model_v4 | Large ribosomal subunit protein bL28 | 0.8986 | 1 | 62 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar