F486799

General Info

Members Datasets Scaffolds Average Seq Length
958 438 1916 166

Family's Representative Sequence

Representative Sequence 3300035118|Ga0373954_0024673|Ga0373954_0024673_772_1365
Length 197
Sequence MSMRNRRGLRAWSFPPYIDGGRRCSGDAITRFRQEMMLDGLRQFIADVISPAAQEHRTFDDAGYRLAATALLVHVISLDGEPSEAERRKLHGLIESRFGLDPGTADQLIASATLIEGEAVDLYHFTSVIMRSVDEEGRLRIVEMMWELVYADGQVSEFEDNVVWRAADLLGVSSRDRIDLKHNVAARPPVPVVGTTG

Samples

Sample ID Description Type Environment
1 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
94 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
128 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
129 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
196 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
197 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
198 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
199 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
204 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
205 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
206 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
207 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
208 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
209 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
210 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
211 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
212 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
213 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
214 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
215 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
216 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
217 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
218 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
219 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
220 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
221 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
222 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
223 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
224 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
225 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
226 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
227 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
228 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
229 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
230 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
231 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
232 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
233 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
234 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
235 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
237 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
238 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
239 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
240 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
241 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
242 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
243 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
244 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
245 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
246 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
247 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
248 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
249 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
252 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
253 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
254 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
255 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
256 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
257 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
258 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
259 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
260 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
261 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
262 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
263 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
264 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
265 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
266 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
267 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
268 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
269 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
270 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
271 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
272 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
273 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
274 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
275 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
276 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
277 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
278 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
279 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
280 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
281 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
282 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
283 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
284 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
285 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
286 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
287 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
288 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
289 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
290 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
291 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
292 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
293 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
294 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
295 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
296 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
297 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
298 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
299 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
300 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
301 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
302 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
303 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
304 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
305 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
306 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
307 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
308 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
309 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
310 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
311 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
312 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
313 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
314 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
315 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
316 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
317 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
318 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
319 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
320 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
321 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
322 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
323 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
324 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
325 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
326 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
327 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
328 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
329 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
330 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
331 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
332 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
333 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
334 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
335 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
336 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
337 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
338 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
339 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
340 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
341 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
342 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
354 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
355 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
356 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
357 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
358 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
359 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
360 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
361 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
362 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
363 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
364 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
367 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
368 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
369 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
370 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
371 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
372 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
373 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
374 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
375 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
376 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
377 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
378 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
379 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
380 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
381 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
382 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
383 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
384 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
385 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
386 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
387 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
388 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
389 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
390 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
391 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
392 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
393 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
394 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
395 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
396 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
397 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
398 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
399 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
400 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
401 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
402 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
403 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
404 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
405 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
406 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
407 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
408 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
409 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
410 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
411 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
412 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
413 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
414 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
415 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
416 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
417 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
418 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
419 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
420 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
421 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
422 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
423 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
424 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
425 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
426 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
427 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
428 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
429 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
430 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
431 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
432 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
433 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
434 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
435 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
436 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
437 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
438 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.18
Metatranscriptomes 0.1
Isolates 2.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.44
Nodule 2.3
Rhizoplane 6.68
Rhizosphere 74.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373954_0024673 3300035118 Bacteria 2742
2 JGI25406J46586_10012434 3300003203 Bacteria 3693
3 JGI25165J46597_1014365 3300003214 Bacteria 1078
4 rootL2_10045963 3300003322 Bacteria 1730
5 rootL2_10096256 3300003322 Bacteria 1282
6 rootL2_10110173 3300003322 Bacteria 2825
7 JGI25404J52841_10003473 3300003659 Bacteria 3120
8 JGI25404J52841_10014495 3300003659 Bacteria 1712
9 JGI25404J52841_10017249 3300003659 Bacteria 1566
10 JGI25404J52841_10029009 3300003659 Bacteria 1187
11 JGI25405J52794_10029568 3300003911 Bacteria 1134
12 JGI25405J52794_10038265 3300003911 Bacteria 1010
13 Ga0070658_10014893 3300005327 Bacteria 6229
14 Ga0070658_10161129 3300005327 Bacteria 1882
15 Ga0070658_10207026 3300005327 Bacteria 1656
16 Ga0070676_10269668 3300005328 Bacteria 1143
17 Ga0070683_100023757 3300005329 Bacteria 5486
18 Ga0070683_100026678 3300005329 Bacteria 5205
19 Ga0068869_100153340 3300005334 Bacteria 1788
20 Ga0068869_100272752 3300005334 Bacteria 1358
21 Ga0068869_101690795 3300005334 Bacteria 565
22 Ga0070680_100081500 3300005336 Bacteria 2670
23 Ga0068868_100034114 3300005338 Bacteria 3927
24 Ga0070660_100002091 3300005339 Bacteria 13777
25 Ga0070660_100207546 3300005339 Bacteria 1590
26 Ga0070689_100446774 3300005340 Bacteria 1099
27 Ga0070689_101212350 3300005340 Bacteria 678
28 Ga0070687_100789260 3300005343 Bacteria 672
29 Ga0070687_101264114 3300005343 Bacteria 547
30 Ga0070661_100380440 3300005344 Bacteria 1113
31 Ga0070668_100038776 3300005347 Bacteria 3643
32 Ga0070668_100052404 3300005347 Bacteria 3145
33 Ga0070668_100052629 3300005347 Bacteria 3138
34 Ga0070668_100065717 3300005347 Bacteria 2813
35 Ga0070668_100081584 3300005347 Bacteria 2536
36 Ga0070668_100093078 3300005347 Bacteria 2378
37 Ga0070669_100112510 3300005353 Bacteria 2067
38 Ga0070675_100166479 3300005354 Bacteria 1899
39 Ga0070675_100214135 3300005354 Bacteria 1676
40 Ga0070675_100246901 3300005354 Bacteria 1561
41 Ga0070675_100524883 3300005354 Bacteria 1069
42 Ga0070671_100139781 3300005355 Bacteria 2043
43 Ga0070671_100615204 3300005355 Bacteria 939
44 Ga0070674_100427848 3300005356 Bacteria 1088
45 Ga0070674_100461309 3300005356 Bacteria 1051
46 Ga0070674_100548676 3300005356 Bacteria 969
47 Ga0070674_100781989 3300005356 Bacteria 823
48 Ga0070673_100197544 3300005364 Bacteria 1731
49 Ga0070673_100284219 3300005364 Bacteria 1452
50 Ga0070673_101336580 3300005364 Bacteria 674
51 Ga0070688_100183024 3300005365 Bacteria 1455
52 Ga0070688_100574830 3300005365 Bacteria 859
53 Ga0070659_100100796 3300005366 Bacteria 2324
54 Ga0070659_100379757 3300005366 Bacteria 1190
55 Ga0070667_100057192 3300005367 Bacteria 3296
56 Ga0070667_100599446 3300005367 Bacteria 1015
57 Ga0070709_10003366 3300005434 Bacteria 8596
58 Ga0070709_10992061 3300005434 Bacteria 668
59 Ga0070714_100003204 3300005435 Bacteria 12177
60 Ga0070714_100077968 3300005435 Bacteria 2879
61 Ga0070714_100105094 3300005435 Bacteria 2492
62 Ga0070713_100055042 3300005436 Bacteria 3304
63 Ga0070713_100289224 3300005436 Bacteria 1505
64 Ga0070710_10003286 3300005437 Bacteria 7665
65 Ga0070710_10030798 3300005437 Bacteria 2889
66 Ga0070710_10237258 3300005437 Bacteria 1167
67 Ga0070701_10087544 3300005438 Bacteria 1699
68 Ga0070711_100000745 3300005439 Bacteria 16987
69 Ga0070711_100014756 3300005439 Bacteria 4931
70 Ga0070711_100015345 3300005439 Bacteria 4848
71 Ga0070711_100342468 3300005439 Bacteria 1200
72 Ga0070700_100150599 3300005441 Bacteria 1591
73 Ga0070700_100711335 3300005441 Bacteria 800
74 Ga0070700_100822968 3300005441 Bacteria 750
75 Ga0070708_100263882 3300005445 Bacteria 1619
76 Ga0070663_100011469 3300005455 Bacteria 5566
77 Ga0070663_100022407 3300005455 Bacteria 4223
78 Ga0070663_100082416 3300005455 Bacteria 2366
79 Ga0070663_100204768 3300005455 Bacteria 1542
80 Ga0070663_100858687 3300005455 Bacteria 782
81 Ga0070678_100011085 3300005456 Bacteria 5542
82 Ga0070678_100048833 3300005456 Bacteria 3050
83 Ga0070678_100064850 3300005456 Bacteria 2709
84 Ga0070678_100152067 3300005456 Bacteria 1865
85 Ga0070678_100159924 3300005456 Bacteria 1823
86 Ga0070678_100185861 3300005456 Bacteria 1705
87 Ga0070662_100097724 3300005457 Bacteria 2216
88 Ga0070681_10041643 3300005458 Bacteria 4603
89 Ga0070681_10233050 3300005458 Bacteria 1755
90 Ga0068867_100049258 3300005459 Bacteria 3101
91 Ga0068867_100393149 3300005459 Bacteria 1168
92 Ga0068867_100407017 3300005459 Bacteria 1149
93 Ga0068867_100603275 3300005459 Bacteria 958
94 Ga0070685_10132615 3300005466 Bacteria 1560
95 Ga0070685_10296082 3300005466 Bacteria 1089
96 Ga0070706_100072375 3300005467 Bacteria 3190
97 Ga0070706_100493931 3300005467 Bacteria 1139
98 Ga0070706_100585893 3300005467 Bacteria 1037
99 Ga0070706_101528771 3300005467 Bacteria 610
100 Ga0070707_100560281 3300005468 Bacteria 1105
101 Ga0070698_100084471 3300005471 Bacteria 3163
102 Ga0070698_100904999 3300005471 Bacteria 828
103 Ga0070698_101814548 3300005471 Bacteria 563
104 Ga0070699_100506767 3300005518 Bacteria 1097
105 Ga0070679_100028386 3300005530 Bacteria 5516
106 Ga0070679_100038806 3300005530 Bacteria 4735
107 Ga0070679_100080723 3300005530 Bacteria 3242
108 Ga0070684_100004519 3300005535 Bacteria 10592
109 Ga0070684_100016992 3300005535 Bacteria 5962
110 Ga0070684_100159841 3300005535 Bacteria 2043
111 Ga0070684_100752393 3300005535 Bacteria 910
112 Ga0070697_100399205 3300005536 Bacteria 1193
113 Ga0070697_100399786 3300005536 Bacteria 1192
114 Ga0070697_100436918 3300005536 Bacteria 1139
115 Ga0068853_100203859 3300005539 Bacteria 1800
116 Ga0068853_100430451 3300005539 Bacteria 1239
117 Ga0068853_101055805 3300005539 Bacteria 783
118 Ga0070672_100047552 3300005543 Bacteria 3329
119 Ga0070672_100119640 3300005543 Bacteria 2155
120 Ga0070672_100382019 3300005543 Bacteria 1205
121 Ga0070686_100069204 3300005544 Bacteria 2304
122 Ga0070686_100181281 3300005544 Bacteria 1496
123 Ga0070695_100889492 3300005545 Bacteria 719
124 Ga0070696_100935292 3300005546 Bacteria 721
125 Ga0070665_100038779 3300005548 Bacteria 4789
126 Ga0070665_100084569 3300005548 Bacteria 3178
127 Ga0070665_100143395 3300005548 Bacteria 2392
128 Ga0070665_100159117 3300005548 Bacteria 2260
129 Ga0070665_100227433 3300005548 Bacteria 1865
130 Ga0070665_100487636 3300005548 Bacteria 1243
131 Ga0070665_100790605 3300005548 Bacteria 962
132 Ga0068855_100021984 3300005563 Bacteria 7648
133 Ga0068855_100039709 3300005563 Bacteria 5586
134 Ga0068855_100111720 3300005563 Bacteria 3137
135 Ga0068855_100494392 3300005563 Bacteria 1330
136 Ga0070664_100118017 3300005564 Bacteria 2321
137 Ga0068857_100021483 3300005577 Bacteria 5680
138 Ga0068857_100268057 3300005577 Bacteria 1569
139 Ga0068857_100272157 3300005577 Bacteria 1557
140 Ga0068857_100493160 3300005577 Bacteria 1149
141 Ga0068854_100010964 3300005578 Bacteria 5882
142 Ga0068854_100661758 3300005578 Bacteria 898
143 Ga0068856_100000540 3300005614 Bacteria 41724
144 Ga0068856_100014372 3300005614 Bacteria 7652
145 Ga0068856_100288133 3300005614 Bacteria 1659
146 Ga0068856_100447966 3300005614 Bacteria 1312
147 Ga0068856_100473876 3300005614 Bacteria 1273
148 Ga0070702_100617486 3300005615 Bacteria 815
149 Ga0070702_101000616 3300005615 Bacteria 662
150 Ga0068852_100004787 3300005616 Bacteria 9615
151 Ga0068852_100123844 3300005616 Bacteria 2371
152 Ga0068859_100200649 3300005617 Bacteria 2079
153 Ga0068859_100201023 3300005617 Bacteria 2077
154 Ga0068864_100378585 3300005618 Bacteria 1341
155 Ga0068864_100396125 3300005618 Bacteria 1311
156 Ga0068866_10021203 3300005718 Bacteria 2991
157 Ga0068866_10353099 3300005718 Bacteria 935
158 Ga0068861_100052249 3300005719 Bacteria 3105
159 Ga0068861_100194902 3300005719 Bacteria 1696
160 Ga0068870_10063270 3300005840 Bacteria 1995
161 Ga0068858_100049531 3300005842 Bacteria 3890
162 Ga0068858_100063701 3300005842 Bacteria 3411
163 Ga0068858_100085133 3300005842 Bacteria 2941
164 Ga0068858_100249542 3300005842 Bacteria 1685
165 Ga0068860_100130560 3300005843 Bacteria 2410
166 Ga0068860_100233797 3300005843 Bacteria 1786
167 Ga0068860_100333779 3300005843 Bacteria 1490
168 Ga0068860_100528878 3300005843 Bacteria 1179
169 Ga0068862_100037181 3300005844 Bacteria 4126
170 Ga0068862_100259184 3300005844 Bacteria 1587
171 Ga0068862_100551300 3300005844 Bacteria 1101
172 Ga0081455_10003799 3300005937 Bacteria 17228
173 Ga0081455_10016122 3300005937 Bacteria 7224
174 Ga0081455_10023378 3300005937 Bacteria 5752
175 Ga0081455_10024424 3300005937 Bacteria 5598
176 Ga0081538_10022806 3300005981 Bacteria 4521
177 Ga0081540_1001162 3300005983 Bacteria 23140
178 Ga0081540_1005031 3300005983 Bacteria 9920
179 Ga0081540_1007496 3300005983 Bacteria 7769
180 Ga0081540_1009260 3300005983 Bacteria 6793
181 Ga0081540_1012233 3300005983 Bacteria 5673
182 Ga0081540_1018775 3300005983 Bacteria 4227
183 Ga0081540_1074124 3300005983 Bacteria 1561
184 Ga0081540_1117597 3300005983 Bacteria 1110
185 Ga0081540_1123230 3300005983 Bacteria 1071
186 Ga0081539_10000966 3300005985 Bacteria 53690
187 Ga0081539_10046027 3300005985 Bacteria 2503
188 Ga0070717_10000269 3300006028 Bacteria 35470
189 Ga0070717_10004197 3300006028 Bacteria 10389
190 Ga0070717_10124111 3300006028 Bacteria 2215
191 Ga0070717_10239814 3300006028 Bacteria 1598
192 Ga0075365_10007222 3300006038 Bacteria 6205
193 Ga0075365_10055244 3300006038 Bacteria 2635
194 Ga0075365_10104789 3300006038 Bacteria 1939
195 Ga0075365_10200035 3300006038 Bacteria 1399
196 Ga0075365_10254392 3300006038 Bacteria 1235
197 Ga0075365_10281124 3300006038 Bacteria 1171
198 Ga0075368_10212815 3300006042 Bacteria 820
199 Ga0075368_10279892 3300006042 Bacteria 717
200 Ga0075363_100016896 3300006048 Bacteria 3610
201 Ga0075363_100028560 3300006048 Bacteria 2871
202 Ga0075363_100053851 3300006048 Bacteria 2151
203 Ga0075363_100277746 3300006048 Bacteria 969
204 Ga0075364_10031529 3300006051 Bacteria 3405
205 Ga0075364_10305866 3300006051 Bacteria 1082
206 Ga0075364_10455731 3300006051 Bacteria 874
207 Ga0070715_10009248 3300006163 Bacteria 3467
208 Ga0070715_10043682 3300006163 Bacteria 1891
209 Ga0070715_10213412 3300006163 Bacteria 988
210 Ga0070716_100024130 3300006173 Bacteria 3234
211 Ga0070716_100054308 3300006173 Bacteria 2288
212 Ga0070716_100330371 3300006173 Bacteria 1072
213 Ga0070712_100006808 3300006175 Bacteria 7115
214 Ga0070712_100105562 3300006175 Bacteria 2092
215 Ga0070712_100161542 3300006175 Bacteria 1730
216 Ga0070712_100280156 3300006175 Bacteria 1343
217 Ga0075362_10017408 3300006177 Bacteria 2960
218 Ga0075362_10091355 3300006177 Bacteria 1414
219 Ga0075362_10124324 3300006177 Bacteria 1223
220 Ga0075362_10187535 3300006177 Bacteria 1004
221 Ga0075367_10204281 3300006178 Bacteria 1235
222 Ga0075367_10421047 3300006178 Bacteria 845
223 Ga0075369_10016235 3300006186 Bacteria 3001
224 Ga0075369_10034714 3300006186 Bacteria 2141
225 Ga0075369_10148024 3300006186 Bacteria 1073
226 Ga0075369_10157110 3300006186 Bacteria 1041
227 Ga0075366_10030691 3300006195 Bacteria 3161
228 Ga0075366_10137217 3300006195 Bacteria 1477
229 Ga0075366_10450007 3300006195 Bacteria 794
230 Ga0097621_100068907 3300006237 Bacteria 2919
231 Ga0097621_100094411 3300006237 Bacteria 2508
232 Ga0075370_10021423 3300006353 Bacteria 3541
233 Ga0075370_10131295 3300006353 Bacteria 1461
234 Ga0075370_10377985 3300006353 Bacteria 848
235 Ga0075370_10561316 3300006353 Bacteria 691
236 Ga0068871_100564787 3300006358 Bacteria 1032
237 Ga0068871_100945052 3300006358 Bacteria 801
238 Ga0075428_100125897 3300006844 Bacteria 2788
239 Ga0075434_100315212 3300006871 Bacteria 1585
240 Ga0075429_100459510 3300006880 Bacteria 1116
241 Ga0068865_100017842 3300006881 Bacteria 4570
242 Ga0068865_100129004 3300006881 Bacteria 1892
243 Ga0068865_100587428 3300006881 Bacteria 940
244 Ga0068865_100601009 3300006881 Bacteria 930
245 Ga0068865_100647124 3300006881 Bacteria 898
246 Ga0068865_100807603 3300006881 Bacteria 810
247 Ga0075436_100637026 3300006914 Bacteria 787
248 Ga0097620_100200641 3300006931 Bacteria 2079
249 Ga0097620_100201032 3300006931 Bacteria 2077
250 Ga0099824_1006119 3300006942 Bacteria 16669
251 Ga0099822_1014043 3300006943 Bacteria 9278
252 Ga0099794_10230174 3300007265 Bacteria 953
253 Ga0099795_10006732 3300007788 Bacteria 3155
254 Ga0099795_10012369 3300007788 Bacteria 2586
255 Ga0105240_10002943 3300009093 Bacteria 26851
256 Ga0105240_10113703 3300009093 Bacteria 3271
257 Ga0111539_10061321 3300009094 Bacteria 4456
258 Ga0105245_10074999 3300009098 Bacteria 3078
259 Ga0105245_10181113 3300009098 Bacteria 2013
260 Ga0105245_10337206 3300009098 Bacteria 1490
261 Ga0105247_10028777 3300009101 Bacteria 3362
262 Ga0105247_10078744 3300009101 Bacteria 2074
263 Ga0105247_10140941 3300009101 Bacteria 1580
264 Ga0105243_10045318 3300009148 Bacteria 3455
265 Ga0105243_10539593 3300009148 Bacteria 1112
266 Ga0105243_10619255 3300009148 Bacteria 1045
267 Ga0105241_10125496 3300009174 Bacteria 2072
268 Ga0105242_10039799 3300009176 Bacteria 3785
269 Ga0105242_10711023 3300009176 Bacteria 984
270 Ga0105248_10023017 3300009177 Bacteria 6919
271 Ga0105248_10314212 3300009177 Bacteria 1765
272 Ga0105248_11020580 3300009177 Bacteria 935
273 Ga0105237_10043269 3300009545 Bacteria 4537
274 Ga0105237_10083496 3300009545 Bacteria 3185
275 Ga0105237_10528926 3300009545 Bacteria 1186
276 Ga0105237_10865440 3300009545 Bacteria 911
277 Ga0105238_10006820 3300009551 Bacteria 11404
278 Ga0105238_10087183 3300009551 Bacteria 3108
279 Ga0105238_10213127 3300009551 Bacteria 1908
280 Ga0105249_10262698 3300009553 Bacteria 1716
281 Ga0105249_10340165 3300009553 Bacteria 1517
282 Ga0105249_10416025 3300009553 Bacteria 1377
283 Ga0105249_11715565 3300009553 Bacteria 701
284 Ga0099796_10011515 3300010159 Bacteria 2469
285 Ga0099796_10017101 3300010159 Bacteria 2153
286 Ga0099796_10219691 3300010159 Bacteria 778
287 Ga0105239_10013186 3300010375 Bacteria 9184
288 Ga0105239_10039840 3300010375 Bacteria 5147
289 Ga0105239_10060392 3300010375 Bacteria 4161
290 Ga0105239_10073624 3300010375 Bacteria 3755
291 Ga0105239_10146156 3300010375 Bacteria 2637
292 Ga0105239_10544550 3300010375 Bacteria 1321
293 Ga0105239_10592338 3300010375 Bacteria 1264
294 Ga0105246_10004242 3300011119 Bacteria 8716
295 Ga0105246_10061626 3300011119 Bacteria 2611
296 Ga0105246_10109633 3300011119 Bacteria 2025
297 Ga0105246_10425285 3300011119 Bacteria 1110
298 Ga0157337_1019336 3300012483 Bacteria 616
299 Ga0157370_10019039 3300013104 Bacteria 6901
300 Ga0157370_10055288 3300013104 Bacteria 3782
301 Ga0157369_10006724 3300013105 Bacteria 13270
302 Ga0157369_10749753 3300013105 Bacteria 1004
303 Ga0157369_11179679 3300013105 Bacteria 782
304 Ga0157374_10110606 3300013296 Bacteria 2642
305 Ga0157374_10708571 3300013296 Bacteria 1020
306 Ga0157378_10119537 3300013297 Bacteria 2427
307 Ga0157378_10177987 3300013297 Bacteria 1999
308 Ga0157378_10257569 3300013297 Bacteria 1673
309 Ga0157378_10344116 3300013297 Bacteria 1455
310 Ga0157378_11639592 3300013297 Bacteria 689
311 Ga0163162_10007574 3300013306 Bacteria 10573
312 Ga0163162_10315174 3300013306 Bacteria 1697
313 Ga0163162_10455550 3300013306 Bacteria 1411
314 Ga0163162_10528306 3300013306 Bacteria 1309
315 Ga0163162_11197798 3300013306 Bacteria 862
316 Ga0157372_12623184 3300013307 Bacteria 578
317 Ga0157375_10247981 3300013308 Bacteria 1941
318 Ga0157375_10272575 3300013308 Bacteria 1854
319 Ga0157375_10292148 3300013308 Bacteria 1793
320 Ga0157375_11010552 3300013308 Bacteria 971
321 Ga0163163_10068804 3300014325 Bacteria 3524
322 Ga0163163_10088341 3300014325 Bacteria 3111
323 Ga0163163_10237236 3300014325 Bacteria 1873
324 Ga0163163_10322212 3300014325 Bacteria 1599
325 Ga0163163_10882382 3300014325 Bacteria 958
326 Ga0163163_11046677 3300014325 Bacteria 879
327 Ga0157380_10027065 3300014326 Bacteria 4357
328 Ga0157380_10149254 3300014326 Bacteria 2019
329 Ga0157380_10332147 3300014326 Bacteria 1414
330 Ga0157380_11081999 3300014326 Bacteria 840
331 Ga0157380_11411552 3300014326 Bacteria 747
332 Ga0157377_10131013 3300014745 Bacteria 1531
333 Ga0157377_10735503 3300014745 Bacteria 720
334 Ga0157377_10750139 3300014745 Bacteria 714
335 Ga0157379_10192840 3300014968 Bacteria 1841
336 Ga0157379_11068753 3300014968 Bacteria 772
337 Ga0157376_10110109 3300014969 Bacteria 2422
338 Ga0157376_10147227 3300014969 Bacteria 2119
339 Ga0157376_10701271 3300014969 Bacteria 1017
340 Ga0157376_11136703 3300014969 Bacteria 808
341 Ga0182007_10167031 3300015262 Bacteria 755
342 Ga0163161_10080606 3300017792 Bacteria 2396
343 Ga0163161_10272828 3300017792 Bacteria 1324
344 Ga0163161_10573798 3300017792 Bacteria 927
345 Ga0213876_10032614 3300021384 Bacteria 2746
346 Ga0213871_10150037 3300021441 Bacteria 709
347 Ga0209233_1023807 3300025261 Bacteria 1543
348 Ga0209233_1028045 3300025261 Bacteria 1356
349 Ga0209455_1002223 3300025272 Bacteria 7649
350 Ga0209758_1006028 3300025297 Bacteria 8946
351 Ga0209758_1010347 3300025297 Bacteria 5598
352 Ga0209758_1070185 3300025297 Bacteria 1106
353 Ga0207426_1112741 3300025302 Bacteria 683
354 Ga0207697_10013036 3300025315 Bacteria 3474
355 Ga0207697_10023965 3300025315 Bacteria 2499
356 Ga0207656_10465633 3300025321 Bacteria 640
357 Ga0207692_10005362 3300025898 Bacteria 5134
358 Ga0207692_10015075 3300025898 Bacteria 3392
359 Ga0207692_10170389 3300025898 Bacteria 1261
360 Ga0207642_10035126 3300025899 Bacteria 2138
361 Ga0207642_10157253 3300025899 Bacteria 1216
362 Ga0207642_10409132 3300025899 Bacteria 814
363 Ga0207710_10028750 3300025900 Bacteria 2414
364 Ga0207710_10070899 3300025900 Bacteria 1598
365 Ga0207710_10108829 3300025900 Bacteria 1314
366 Ga0207710_10112693 3300025900 Bacteria 1292
367 Ga0207710_10136584 3300025900 Bacteria 1181
368 Ga0207688_10010585 3300025901 Bacteria 5016
369 Ga0207688_10026527 3300025901 Bacteria 3186
370 Ga0207688_10046897 3300025901 Bacteria 2413
371 Ga0207688_10061701 3300025901 Bacteria 2113
372 Ga0207688_10263506 3300025901 Bacteria 1047
373 Ga0207680_10393967 3300025903 Bacteria 978
374 Ga0207647_10100687 3300025904 Bacteria 1715
375 Ga0207685_10501513 3300025905 Bacteria 639
376 Ga0207699_10000309 3300025906 Bacteria 26099
377 Ga0207699_10090360 3300025906 Bacteria 1921
378 Ga0207699_10436859 3300025906 Bacteria 937
379 Ga0207645_10442535 3300025907 Bacteria 877
380 Ga0207643_10186796 3300025908 Bacteria 1256
381 Ga0207643_10631469 3300025908 Bacteria 690
382 Ga0207705_10357472 3300025909 Bacteria 1126
383 Ga0207684_10201526 3300025910 Bacteria 1717
384 Ga0207684_10235799 3300025910 Bacteria 1578
385 Ga0207684_10836656 3300025910 Bacteria 776
386 Ga0207654_10096908 3300025911 Bacteria 1810
387 Ga0207654_10129163 3300025911 Bacteria 1597
388 Ga0207707_10004049 3300025912 Bacteria 12993
389 Ga0207707_10084173 3300025912 Bacteria 2777
390 Ga0207695_10158317 3300025913 Bacteria 2198
391 Ga0207695_10308117 3300025913 Bacteria 1474
392 Ga0207671_10060067 3300025914 Bacteria 2820
393 Ga0207671_10163465 3300025914 Bacteria 1725
394 Ga0207671_11221270 3300025914 Bacteria 587
395 Ga0207693_10002279 3300025915 Bacteria 16682
396 Ga0207693_10036569 3300025915 Bacteria 3871
397 Ga0207693_10037840 3300025915 Bacteria 3802
398 Ga0207693_10092682 3300025915 Bacteria 2367
399 Ga0207693_10108972 3300025915 Bacteria 2172
400 Ga0207663_10001983 3300025916 Bacteria 9708
401 Ga0207663_10002139 3300025916 Bacteria 9428
402 Ga0207663_10053409 3300025916 Bacteria 2524
403 Ga0207660_10039770 3300025917 Bacteria 3289
404 Ga0207660_10258781 3300025917 Bacteria 1376
405 Ga0207657_10003634 3300025919 Bacteria 16422
406 Ga0207657_10092864 3300025919 Bacteria 2514
407 Ga0207657_10210687 3300025919 Bacteria 1560
408 Ga0207657_10322449 3300025919 Bacteria 1221
409 Ga0207649_10105847 3300025920 Bacteria 1870
410 Ga0207649_10379231 3300025920 Bacteria 1053
411 Ga0207652_10002638 3300025921 Bacteria 15043
412 Ga0207652_10097756 3300025921 Bacteria 2588
413 Ga0207681_10100674 3300025923 Bacteria 2083
414 Ga0207694_10112473 3300025924 Bacteria 2167
415 Ga0207694_11317947 3300025924 Bacteria 611
416 Ga0207650_10328321 3300025925 Bacteria 1254
417 Ga0207650_10473929 3300025925 Bacteria 1044
418 Ga0207650_10477105 3300025925 Bacteria 1040
419 Ga0207650_10777394 3300025925 Bacteria 811
420 Ga0207659_10159889 3300025926 Bacteria 1767
421 Ga0207659_10223616 3300025926 Bacteria 1515
422 Ga0207659_10324128 3300025926 Bacteria 1272
423 Ga0207659_10569531 3300025926 Bacteria 964
424 Ga0207687_10023004 3300025927 Bacteria 4150
425 Ga0207687_10024543 3300025927 Bacteria 4029
426 Ga0207687_10871268 3300025927 Bacteria 770
427 Ga0207700_10016746 3300025928 Bacteria 4880
428 Ga0207700_10049134 3300025928 Bacteria 3136
429 Ga0207664_10042185 3300025929 Bacteria 3560
430 Ga0207664_10055752 3300025929 Bacteria 3137
431 Ga0207664_10175665 3300025929 Bacteria 1836
432 Ga0207664_10280396 3300025929 Bacteria 1462
433 Ga0207644_10385830 3300025931 Bacteria 1143
434 Ga0207644_10438468 3300025931 Bacteria 1072
435 Ga0207644_11229092 3300025931 Bacteria 630
436 Ga0207690_10891055 3300025932 Bacteria 738
437 Ga0207706_10025700 3300025933 Bacteria 5275
438 Ga0207706_10088312 3300025933 Bacteria 2725
439 Ga0207706_10323700 3300025933 Bacteria 1342
440 Ga0207686_10366762 3300025934 Bacteria 1088
441 Ga0207709_10413595 3300025935 Bacteria 1034
442 Ga0207709_10418209 3300025935 Bacteria 1029
443 Ga0207709_10954767 3300025935 Bacteria 699
444 Ga0207709_10957997 3300025935 Bacteria 698
445 Ga0207669_10055249 3300025937 Bacteria 2403
446 Ga0207669_10300119 3300025937 Bacteria 1220
447 Ga0207704_10031422 3300025938 Bacteria 2991
448 Ga0207704_10178562 3300025938 Bacteria 1532
449 Ga0207704_10601907 3300025938 Bacteria 900
450 Ga0207704_10646143 3300025938 Bacteria 871
451 Ga0207665_10002452 3300025939 Bacteria 12524
452 Ga0207665_10035091 3300025939 Bacteria 3327
453 Ga0207665_10053824 3300025939 Bacteria 2713
454 Ga0207665_10066823 3300025939 Bacteria 2447
455 Ga0207665_10188122 3300025939 Bacteria 1499
456 Ga0207665_10203579 3300025939 Bacteria 1443
457 Ga0207691_10058603 3300025940 Bacteria 3502
458 Ga0207691_10060550 3300025940 Bacteria 3439
459 Ga0207691_10313472 3300025940 Bacteria 1346
460 Ga0207711_10155096 3300025941 Bacteria 2069
461 Ga0207711_10217312 3300025941 Bacteria 1747
462 Ga0207711_10583776 3300025941 Bacteria 1043
463 Ga0207689_10196723 3300025942 Bacteria 1664
464 Ga0207661_10001804 3300025944 Bacteria 14632
465 Ga0207661_10007278 3300025944 Bacteria 7874
466 Ga0207679_10103763 3300025945 Bacteria 2229
467 Ga0207679_10171579 3300025945 Bacteria 1786
468 Ga0207667_10008204 3300025949 Bacteria 12430
469 Ga0207667_10046583 3300025949 Bacteria 4591
470 Ga0207667_10391628 3300025949 Bacteria 1415
471 Ga0207667_10539508 3300025949 Bacteria 1180
472 Ga0207651_10292405 3300025960 Bacteria 1351
473 Ga0207651_10514015 3300025960 Bacteria 1037
474 Ga0207712_10239357 3300025961 Bacteria 1461
475 Ga0207668_10073979 3300025972 Bacteria 2444
476 Ga0207668_10186108 3300025972 Bacteria 1642
477 Ga0207668_10406272 3300025972 Bacteria 1152
478 Ga0207668_10557764 3300025972 Bacteria 993
479 Ga0207640_10011851 3300025981 Bacteria 4949
480 Ga0207640_10714416 3300025981 Bacteria 860
481 Ga0207640_11044766 3300025981 Bacteria 720
482 Ga0207640_11616702 3300025981 Bacteria 584
483 Ga0207658_11224375 3300025986 Bacteria 686
484 Ga0207677_10028438 3300026023 Bacteria 3535
485 Ga0207677_10117463 3300026023 Bacteria 1994
486 Ga0207703_10034719 3300026035 Bacteria 4003
487 Ga0207703_10186095 3300026035 Bacteria 1836
488 Ga0207703_10409057 3300026035 Bacteria 1260
489 Ga0207703_10475113 3300026035 Bacteria 1171
490 Ga0207639_10078976 3300026041 Bacteria 2599
491 Ga0207639_10238815 3300026041 Bacteria 1579
492 Ga0207639_10572555 3300026041 Bacteria 1039
493 Ga0207639_10599694 3300026041 Bacteria 1015
494 Ga0207639_11129528 3300026041 Bacteria 735
495 Ga0207678_10024550 3300026067 Bacteria 5265
496 Ga0207678_10048527 3300026067 Bacteria 3669
497 Ga0207678_10093941 3300026067 Bacteria 2562
498 Ga0207678_10094956 3300026067 Bacteria 2548
499 Ga0207678_10199547 3300026067 Bacteria 1710
500 Ga0207678_10289318 3300026067 Bacteria 1407
501 Ga0207708_10725563 3300026075 Bacteria 851
502 Ga0207702_10003075 3300026078 Bacteria 15498
503 Ga0207702_10363622 3300026078 Bacteria 1387
504 Ga0207641_10380706 3300026088 Bacteria 1351
505 Ga0207641_10656443 3300026088 Bacteria 1030
506 Ga0207648_10111099 3300026089 Bacteria 2406
507 Ga0207648_10117176 3300026089 Bacteria 2341
508 Ga0207648_10529890 3300026089 Bacteria 1080
509 Ga0207676_10338008 3300026095 Bacteria 1388
510 Ga0207674_10003708 3300026116 Bacteria 18660
511 Ga0207674_10033510 3300026116 Bacteria 5377
512 Ga0207674_10400024 3300026116 Bacteria 1327
513 Ga0207675_100043240 3300026118 Bacteria 4207
514 Ga0207675_100048585 3300026118 Bacteria 3961
515 Ga0207683_10019513 3300026121 Bacteria 5789
516 Ga0207683_10043506 3300026121 Bacteria 3925
517 Ga0207683_10051303 3300026121 Bacteria 3614
518 Ga0207683_10075599 3300026121 Bacteria 2981
519 Ga0207683_10102080 3300026121 Bacteria 2561
520 Ga0207683_10198600 3300026121 Bacteria 1823
521 Ga0207683_10387816 3300026121 Bacteria 1284
522 Ga0207683_10692265 3300026121 Bacteria 945
523 Ga0207683_10911092 3300026121 Bacteria 816
524 Ga0207698_10117280 3300026142 Bacteria 2245
525 Ga0207698_10174301 3300026142 Bacteria 1897
526 Ga0209589_1000021 3300027357 Bacteria 186431
527 Ga0209489_100028 3300027361 Bacteria 186431
528 Ga0209700_100037 3300027363 Bacteria 186431
529 Ga0209813_10090542 3300027866 Bacteria 1026
530 Ga0207428_10302262 3300027907 Bacteria 1184
531 Ga0268266_10000680 3300028379 Bacteria 45937
532 Ga0268266_10002169 3300028379 Bacteria 21507
533 Ga0268266_10024779 3300028379 Bacteria 5105
534 Ga0268266_10096578 3300028379 Bacteria 2597
535 Ga0268266_10098886 3300028379 Bacteria 2568
536 Ga0268266_10133948 3300028379 Bacteria 2218
537 Ga0268266_10392226 3300028379 Bacteria 1311
538 Ga0268266_10508727 3300028379 Bacteria 1150
539 Ga0268265_10028819 3300028380 Bacteria 3979
540 Ga0268265_10120452 3300028380 Bacteria 2161
541 Ga0268265_10498026 3300028380 Bacteria 1147
542 Ga0268265_10727038 3300028380 Bacteria 961
543 Ga0268264_10211583 3300028381 Bacteria 1780
544 Ga0268264_10360833 3300028381 Bacteria 1386
545 Ga0268264_11005879 3300028381 Bacteria 840
546 Ga0265323_10016069 3300028653 Bacteria 2929
547 Ga0265336_10013367 3300028666 Bacteria 2738
548 Ga0307517_10000175 3300028786 Bacteria 105567
549 Ga0307515_10093325 3300028794 Bacteria 3733
550 Ga0307515_10280782 3300028794 Bacteria 1373
551 Ga0265338_10000835 3300028800 Bacteria 51961
552 Ga0265324_10019533 3300029957 Bacteria 2441
553 Ga0307512_10302631 3300030522 Bacteria 743
554 Ga0265330_10021122 3300031235 Bacteria 2974
555 Ga0265330_10023914 3300031235 Bacteria 2772
556 Ga0265330_10070163 3300031235 Bacteria 1516
557 Ga0265332_10118417 3300031238 Bacteria 1113
558 Ga0265332_10207671 3300031238 Bacteria 813
559 Ga0265325_10035551 3300031241 Bacteria 2645
560 Ga0265340_10000884 3300031247 Bacteria 16974
561 Ga0265340_10035059 3300031247 Bacteria 2493
562 Ga0265339_10004328 3300031249 Bacteria 9706
563 Ga0265339_10016094 3300031249 Bacteria 4467
564 Ga0265339_10083650 3300031249 Bacteria 1683
565 Ga0265316_10359186 3300031344 Bacteria 1053
566 Ga0307513_10057077 3300031456 Bacteria 4163
567 Ga0307513_10182197 3300031456 Bacteria 1962
568 Ga0307513_10371673 3300031456 Bacteria 1172
569 Ga0307509_10084646 3300031507 Bacteria 3266
570 Ga0307408_100505017 3300031548 Bacteria 1059
571 Ga0265313_10041621 3300031595 Bacteria 2262
572 Ga0307508_10000108 3300031616 Bacteria 97443
573 Ga0265314_10003949 3300031711 Bacteria 14062
574 Ga0265314_10124640 3300031711 Bacteria 1616
575 Ga0265342_10147385 3300031712 Bacteria 1309
576 Ga0307516_10151857 3300031730 Bacteria 2075
577 Ga0307516_10192455 3300031730 Bacteria 1765
578 Ga0307516_10610540 3300031730 Bacteria 745
579 Ga0307405_10241741 3300031731 Bacteria 1338
580 Ga0307406_10127422 3300031901 Bacteria 1781
581 Ga0307406_10150823 3300031901 Bacteria 1658
582 Ga0307412_10431601 3300031911 Bacteria 1080
583 Ga0307412_10998363 3300031911 Bacteria 739
584 Ga0307416_100267044 3300032002 Bacteria 1677
585 Ga0307416_100415049 3300032002 Bacteria 1388
586 Ga0307416_102306814 3300032002 Bacteria 638
587 Ga0307414_10434577 3300032004 Bacteria 1148
588 Ga0307411_10065225 3300032005 Bacteria 2442
589 Ga0307415_100054255 3300032126 Bacteria 2735
590 Ga0307415_100085248 3300032126 Bacteria 2269
591 Ga0307415_100321899 3300032126 Bacteria 1290
592 Ga0307510_10010287 3300033180 Bacteria 11113
593 Ga0307510_10200456 3300033180 Bacteria 1531
594 Ga0316215_1005545 3300033544 Bacteria 1219
595 Ga0373926_0132099 3300035083 Bacteria 946
596 Ga0373944_0275669 3300035089 Bacteria 626
597 Ga0373923_0060610 3300035111 Bacteria 1607
598 Ga0373932_0026257 3300035112 Bacteria 1583
599 Ga0373932_0116569 3300035112 Bacteria 886
600 Ga0373941_0142888 3300035115 Bacteria 872
601 Ga0373945_0204677 3300035116 Bacteria 821
602 Ga0373955_0225677 3300035172 Bacteria 1120
603 Ga0373962_0212440 3300035242 Bacteria 659
604 Ga0373931_0003001 3300035691 Bacteria 7533
605 Ga0373931_0091713 3300035691 Bacteria 1694
606 Ga0373927_0003306 3300035695 Bacteria 11600
607 Ga0373927_0153238 3300035695 Bacteria 1509
608 Ga0373927_0235163 3300035695 Bacteria 1204
609 Ga0373947_0023036 3300035725 Bacteria 3619
610 Ga0373947_0213774 3300035725 Bacteria 1266
611 Ga0373937_0078308 3300036401 Bacteria 3055
612 Ga0373937_0428902 3300036401 Bacteria 1255
613 Ga0372808_020771 3300036459 Bacteria 944
614 Ga0373925_0077409 3300037068 Bacteria 2524
615 Ga0373925_0174161 3300037068 Bacteria 1700
616 Ga0373925_0328147 3300037068 Bacteria 1239
617 Ga0373925_0636194 3300037068 Bacteria 879
618 Ga0395900_0109182 3300037418 Bacteria 2842
619 Ga0395905_0499162 3300037471 Bacteria 1117
620 Ga0436364_1450038 3300037853 Bacteria 2404
621 Ga0395901_0380417 3300038443 Bacteria 1453
622 Ga0395901_1068423 3300038443 Bacteria 779
623 Ga0436365_0168484 3300039437 Bacteria 6646
624 Ga0436365_1582279 3300039437 Bacteria 2245
625 Ga0436360_0023737 3300039438 Bacteria 1902
626 Ga0436360_1245929 3300039438 Bacteria 673
627 Ga0436363_0159943 3300039450 Bacteria 1083
628 Ga0436363_1166950 3300039450 Bacteria 674
629 Ga0436363_1403617 3300039450 Bacteria 3318
630 Ga0436362_0181511 3300039453 Bacteria 1872
631 Ga0451802_0623261 3300041460 Bacteria 952
632 Ga0451807_1001866 3300041486 Bacteria 728
633 Ga0451807_1667569 3300041486 Bacteria 779
634 Ga0451807_1946340 3300041486 Bacteria 1094
635 Ga0451833_0048398 3300041491 Bacteria 561
636 Ga0451835_1012982 3300041492 Bacteria 696
637 Ga0451839_0736368 3300041496 Bacteria 740
638 Ga0466964_0565191 3300044706 Bacteria 619
639 Ga0466957_0564762 3300044842 Bacteria 794
640 Ga0466960_0247273 3300044901 Bacteria 990
641 Ga0466967_0682013 3300045976 Bacteria 1017
642 Ga0466967_0702043 3300045976 Bacteria 1002
643 Ga0466967_1024621 3300045976 Bacteria 822
644 Ga0495617_051254 3300046452 Bacteria 1372
645 Ga0495603_0010419 3300046455 Bacteria 5630
646 Ga0495603_0016067 3300046455 Bacteria 4525
647 Ga0495603_0056389 3300046455 Bacteria 2326
648 Ga0495603_0173014 3300046455 Bacteria 1250
649 Ga0495603_0364080 3300046455 Bacteria 829
650 Ga0495590_0336458 3300046457 Bacteria 572
651 Ga0495629_0077987 3300046459 Bacteria 2313
652 Ga0495638_0094374 3300046460 Bacteria 1798
653 Ga0495638_0134796 3300046460 Bacteria 1447
654 Ga0495638_0156987 3300046460 Bacteria 1315
655 Ga0495651_0780390 3300046462 Bacteria 591
656 Ga0495650_0099227 3300046471 Bacteria 1096
657 Ga0495582_0028352 3300046473 Bacteria 3073
658 Ga0495639_0062306 3300046475 Bacteria 1711
659 Ga0495585_0131359 3300046492 Bacteria 1317
660 Ga0495594_0129264 3300046499 Bacteria 1430
661 Ga0495596_0063536 3300046500 Bacteria 1436
662 Ga0495583_0210154 3300046506 Bacteria 789
663 Ga0495606_0132216 3300046507 Bacteria 1482
664 Ga0495606_0204613 3300046507 Bacteria 1122
665 Ga0495610_0028391 3300046512 Bacteria 2960
666 Ga0495610_0159647 3300046512 Bacteria 954
667 Ga0495616_0328317 3300046513 Bacteria 641
668 Ga0495620_0186358 3300046515 Bacteria 801
669 Ga0495630_0196993 3300046517 Bacteria 1537
670 Ga0495631_0090236 3300046518 Bacteria 1319
671 Ga0495644_0069318 3300046523 Bacteria 1325
672 Ga0495644_0147410 3300046523 Bacteria 900
673 Ga0495648_0001251 3300046524 Bacteria 25398
674 Ga0495648_0320809 3300046524 Bacteria 718
675 Ga0495654_0165764 3300046530 Bacteria 967
676 Ga0495665_0246776 3300046531 Bacteria 920
677 Ga0495640_0577440 3300046533 Bacteria 680
678 Ga0495587_0283480 3300046536 Bacteria 928
679 Ga0495609_0043250 3300046538 Bacteria 2022
680 Ga0495609_0050883 3300046538 Bacteria 1846
681 Ga0495609_0161223 3300046538 Bacteria 950
682 Ga0495621_0010649 3300046539 Bacteria 2821
683 Ga0495645_0110908 3300046543 Bacteria 1941
684 Ga0495645_0123252 3300046543 Bacteria 1823
685 Ga0495622_0044765 3300046557 Bacteria 2057
686 Ga0495622_0297899 3300046557 Bacteria 703
687 Ga0495656_0003421 3300046615 Bacteria 5364
688 Ga0495656_0009022 3300046615 Bacteria 3579
689 Ga0495656_0028898 3300046615 Bacteria 2228
690 Ga0495656_0030100 3300046615 Bacteria 2192
691 Ga0495668_0125789 3300046616 Bacteria 1403
692 Ga0495668_0166092 3300046616 Bacteria 1209
693 Ga0495668_0208085 3300046616 Bacteria 1071
694 Ga0495668_0630773 3300046616 Bacteria 592
695 Ga0495625_0067931 3300046660 Bacteria 2507
696 Ga0495625_0273687 3300046660 Bacteria 1089
697 Ga0495625_0295610 3300046660 Bacteria 1038
698 Ga0495625_0373557 3300046660 Bacteria 896
699 Ga0495625_0465578 3300046660 Bacteria 778
700 Ga0495659_0033870 3300046664 Bacteria 1794
701 Ga0495659_0058120 3300046664 Bacteria 1422
702 Ga0495588_0281158 3300046674 Bacteria 877
703 Ga0495599_0008234 3300046678 Bacteria 6340
704 Ga0495623_0218694 3300046679 Bacteria 1087
705 Ga0495647_0402293 3300046681 Bacteria 629
706 Ga0495669_0015183 3300046684 Bacteria 3296
707 Ga0495669_0064842 3300046684 Bacteria 1657
708 Ga0495669_0083825 3300046684 Bacteria 1465
709 Ga0495669_0170181 3300046684 Bacteria 1036
710 Ga0495669_0316731 3300046684 Bacteria 753
711 Ga0495613_0782777 3300046689 Bacteria 623
712 Ga0495624_0123097 3300046690 Bacteria 1593
713 Ga0495670_0096732 3300046691 Bacteria 1516
714 Ga0495671_0115441 3300046692 Bacteria 1311
715 Ga0495671_0170410 3300046692 Bacteria 1058
716 Ga0495649_0186263 3300046694 Bacteria 1081
717 Ga0495649_0394862 3300046694 Bacteria 695
718 Ga0495589_0095626 3300046794 Bacteria 1441
719 Ga0495589_0142352 3300046794 Bacteria 1148
720 Ga0495589_0169547 3300046794 Bacteria 1038
721 Ga0495600_0143564 3300046809 Bacteria 1548
722 Ga0495581_0131300 3300047315 Bacteria 1459
723 Ga0495581_0202275 3300047315 Bacteria 1162
724 Ga0495581_0602697 3300047315 Bacteria 636
725 Ga0495604_0214928 3300047317 Bacteria 1327
726 Ga0495604_0265593 3300047317 Bacteria 1165
727 Ga0495636_0030621 3300047318 Bacteria 2201
728 Ga0495674_0198480 3300047319 Bacteria 1665
729 Ga0495672_0339280 3300047320 Bacteria 701
730 Ga0495676_0062458 3300047321 Bacteria 2908
731 Ga0495683_0047765 3300047323 Bacteria 2147
732 Ga0495683_0128105 3300047323 Bacteria 1199
733 Ga0495685_086272 3300047447 Bacteria 1043
734 Ga0495685_114679 3300047447 Bacteria 886
735 Ga0495686_0127380 3300047472 Bacteria 1513
736 Ga0495686_0490492 3300047472 Bacteria 648
737 Ga0495602_0671054 3300048088 Bacteria 706
738 Ga0495626_0176548 3300048091 Bacteria 888
739 Ga0496100_0048756 3300048903 Bacteria 2735
740 Ga0496100_0081491 3300048903 Bacteria 2186
741 Ga0496101_0008281 3300048904 Bacteria 6792
742 Ga0496101_0044430 3300048904 Bacteria 3179
743 Ga0496101_0319134 3300048904 Bacteria 1219
744 Ga0496102_0001453 3300048905 Bacteria 20988
745 Ga0496102_0043946 3300048905 Bacteria 4052
746 Ga0496102_0327127 3300048905 Bacteria 1444
747 Ga0496102_0339395 3300048905 Bacteria 1415
748 Ga0496102_1324930 3300048905 Bacteria 639
749 Ga0496103_0010530 3300048906 Bacteria 5475
750 Ga0496103_0056754 3300048906 Bacteria 2431
751 Ga0496103_0674250 3300048906 Bacteria 656
752 Ga0496104_0027853 3300048907 Bacteria 5231
753 Ga0496104_0135896 3300048907 Bacteria 2362
754 Ga0496104_0271160 3300048907 Bacteria 1609
755 Ga0496104_0373628 3300048907 Bacteria 1338
756 Ga0496104_0618479 3300048907 Bacteria 993
757 Ga0496105_0005368 3300048908 Bacteria 9717
758 Ga0496105_0197778 3300048908 Bacteria 1641
759 Ga0496105_0864316 3300048908 Bacteria 684
760 Ga0496106_0003462 3300048909 Bacteria 11759
761 Ga0496106_0007634 3300048909 Bacteria 7998
762 Ga0496106_0076324 3300048909 Bacteria 2568
763 Ga0496106_0199556 3300048909 Bacteria 1592
764 Ga0496106_0257845 3300048909 Bacteria 1395
765 Ga0496106_0478127 3300048909 Bacteria 1001
766 Ga0496107_0008406 3300048910 Bacteria 7144
767 Ga0496107_0019887 3300048910 Bacteria 4741
768 Ga0496107_0029236 3300048910 Bacteria 3920
769 Ga0496107_0092416 3300048910 Bacteria 2212
770 Ga0496107_0171756 3300048910 Bacteria 1609
771 Ga0496107_0352387 3300048910 Bacteria 1095
772 Ga0496108_0034768 3300048911 Bacteria 4187
773 Ga0496108_0039651 3300048911 Bacteria 3925
774 Ga0496108_0104749 3300048911 Bacteria 2414
775 Ga0496109_0090477 3300048912 Bacteria 2830
776 Ga0496109_0652160 3300048912 Bacteria 989
777 Ga0496110_0009850 3300048913 Bacteria 7745
778 Ga0496110_0015996 3300048913 Bacteria 6256
779 Ga0496111_0024623 3300048914 Bacteria 4241
780 Ga0496111_0039977 3300048914 Bacteria 3364
781 Ga0496111_0231979 3300048914 Bacteria 1371
782 Ga0496112_0042992 3300048915 Bacteria 4422
783 Ga0496112_0051842 3300048915 Bacteria 4025
784 Ga0496112_0078349 3300048915 Bacteria 3268
785 Ga0496113_0023859 3300048916 Bacteria 4342
786 Ga0496113_0032245 3300048916 Bacteria 3807
787 Ga0496113_0047640 3300048916 Bacteria 3186
788 Ga0496113_0114650 3300048916 Bacteria 2101
789 Ga0496113_0174611 3300048916 Bacteria 1702
790 Ga0496113_0548004 3300048916 Bacteria 928
791 Ga0496114_0022794 3300048917 Bacteria 5103
792 Ga0496114_0037886 3300048917 Bacteria 3989
793 Ga0496114_0063296 3300048917 Bacteria 3097
794 Ga0496115_0004695 3300048918 Bacteria 9904
795 Ga0496115_0027446 3300048918 Bacteria 4453
796 Ga0496115_0109423 3300048918 Bacteria 2269
797 Ga0496115_0444017 3300048918 Bacteria 1049
798 Ga0496115_0910449 3300048918 Bacteria 678
799 Ga0496117_0228952 3300048920 Bacteria 1029
800 Ga0496118_0096208 3300048921 Bacteria 2019
801 Ga0496118_0216458 3300048921 Bacteria 1119
802 Ga0496121_0063692 3300048924 Bacteria 3010
803 Ga0496121_0070730 3300048924 Bacteria 2809
804 Ga0496121_0216414 3300048924 Bacteria 1353
805 Ga0496121_0282937 3300048924 Bacteria 1133
806 Ga0496121_0311718 3300048924 Bacteria 1063
807 Ga0496124_0046885 3300048927 Bacteria 3699
808 Ga0496124_0180542 3300048927 Bacteria 1625
809 Ga0496124_0305447 3300048927 Bacteria 1147
810 Ga0496125_0047124 3300048928 Bacteria 3608
811 Ga0496125_0208382 3300048928 Bacteria 1272
812 Ga0496125_0354947 3300048928 Bacteria 874
813 Ga0496126_0011555 3300048929 Bacteria 9118
814 Ga0496126_0014534 3300048929 Bacteria 7952
815 Ga0496126_0062393 3300048929 Bacteria 3344
816 Ga0496126_0073518 3300048929 Bacteria 3039
817 Ga0496126_0117515 3300048929 Bacteria 2310
818 Ga0496126_0145240 3300048929 Bacteria 2038
819 Ga0496126_0242181 3300048929 Bacteria 1506
820 Ga0496126_0267846 3300048929 Bacteria 1418
821 Ga0496126_0283596 3300048929 Bacteria 1371
822 Ga0496126_0371971 3300048929 Bacteria 1165
823 Ga0496126_0480060 3300048929 Bacteria 996
824 Ga0501031_0160646 3300049568 Bacteria 1469
825 Ga0501033_0150909 3300049570 Bacteria 1676
826 Ga0501033_0308273 3300049570 Bacteria 1113
827 Ga0501034_0048287 3300049571 Bacteria 4296
828 Ga0501036_1306400 3300049572 Bacteria 589
829 Ga0501037_0249504 3300049573 Bacteria 1242
830 Ga0501038_0124216 3300049574 Bacteria 2125
831 Ga0501038_0561556 3300049574 Bacteria 867
832 Ga0501039_0164864 3300049575 Bacteria 1742
833 Ga0501042_0346240 3300049578 Bacteria 1075
834 Ga0501043_0330162 3300049579 Bacteria 1161
835 Ga0501046_0019136 3300049580 Bacteria 5681
836 Ga0501046_0134887 3300049580 Bacteria 1870
837 Ga0501047_0020926 3300049581 Bacteria 6283
838 Ga0501067_0035210 3300049583 Bacteria 2780
839 Ga0501067_0044688 3300049583 Bacteria 2461
840 Ga0501068_0027765 3300049584 Bacteria 3344
841 Ga0501068_0273486 3300049584 Bacteria 1079
842 Ga0501069_0057654 3300049585 Bacteria 2166
843 Ga0501069_0203031 3300049585 Bacteria 1149
844 Ga0501070_0008271 3300049586 Bacteria 8797
845 Ga0501071_0187713 3300049587 Bacteria 1550
846 Ga0501071_0370302 3300049587 Bacteria 1092
847 Ga0501071_0392019 3300049587 Bacteria 1060
848 Ga0501073_0008815 3300049589 Bacteria 7460
849 Ga0501074_0015460 3300049590 Bacteria 5548
850 Ga0501075_0611963 3300049591 Bacteria 831
851 Ga0501076_0098020 3300049592 Bacteria 2362
852 Ga0501076_0146208 3300049592 Bacteria 1922
853 Ga0501079_0385992 3300049741 Bacteria 1098
854 Ga0501080_0016296 3300049742 Bacteria 6861
855 Ga0501080_0249895 3300049742 Bacteria 1617
856 Ga0501035_0082361 3300049822 Bacteria 2839
857 Ga0501044_0017082 3300049823 Bacteria 7787
858 Ga0501045_0379058 3300049824 Bacteria 1053
859 Ga0501045_0471835 3300049824 Bacteria 932
860 nmdc:mga03683_19812_c1 3300050489 Bacteria 2573
861 nmdc:mga03683_279409_c1 3300050489 Bacteria 780
862 nmdc:mga03683_402934_c1 3300050489 Bacteria 653
863 nmdc:mga03n38_164796_c1 3300050490 Bacteria 1125
864 nmdc:mga03n38_287851_c1 3300050490 Bacteria 879
865 nmdc:mga03n38_298337_c1 3300050490 Bacteria 865
866 nmdc:mga00v17_211293_c1 3300050491 Bacteria 1256
867 nmdc:mga00v17_87918_c1 3300050491 Bacteria 1948
868 nmdc:mga0yw44_103713_c1 3300050492 Bacteria 1814
869 nmdc:mga0yw44_189590_c1 3300050492 Bacteria 1356
870 nmdc:mga0yw44_265923_c1 3300050492 Bacteria 1144
871 nmdc:mga0yw44_30731_c1 3300050492 Bacteria 3117
872 nmdc:mga0yw44_3728_c1 3300050492 Bacteria 6824
873 nmdc:mga0yw44_971088_c1 3300050492 Bacteria 575
874 nmdc:mga0k408_11114_c1 3300050493 Bacteria 2513
875 nmdc:mga0k408_332175_c1 3300050493 Bacteria 907
876 nmdc:mga0k408_46281_c1 3300050493 Bacteria 2512
877 nmdc:mga06z11_31889_c1 3300050494 Bacteria 2565
878 nmdc:mga06z11_386642_c1 3300050494 Bacteria 841
879 nmdc:mga06z11_494596_c1 3300050494 Bacteria 741
880 nmdc:mga04h51_414475_c1 3300050495 Bacteria 566
881 nmdc:mga04h51_97303_c1 3300050495 Bacteria 1068
882 nmdc:mga07m45_148798_c1 3300050496 Bacteria 1357
883 nmdc:mga07m45_43287_c1 3300050496 Bacteria 2524
884 nmdc:mga07m45_9877_c1 3300050496 Bacteria 4965
885 nmdc:mga05p37_573050_c1 3300050507 Bacteria 1280
886 nmdc:mga09592_688562_c1 3300050508 Bacteria 871
887 nmdc:mga08y16_170224_c1 3300050511 Bacteria 2262
888 nmdc:mga08y16_66686_c1 3300050511 Bacteria 3756
889 nmdc:mga0n895_187543_c1 3300050512 Bacteria 2099
890 nmdc:mga0rr50_512824_c1 3300050513 Bacteria 1020
891 nmdc:mga0rr50_669647_c1 3300050513 Bacteria 885
892 nmdc:mga0a205_229797_c1 3300050515 Bacteria 1738
893 nmdc:mga0sz30_37500_c1 3300050516 Bacteria 2029
894 Ga0495612_0038738 3300053078 Bacteria 1937
895 Ga0495612_0179654 3300053078 Bacteria 929
896 Ga0495655_0074640 3300053083 Bacteria 956
897 Ga0495595_0067844 3300053084 Bacteria 1681
898 Ga0500578_0453093 3300053086 Bacteria 730
899 Ga0500646_0024926 3300053090 Bacteria 1613
900 Ga0500646_0110726 3300053090 Bacteria 873
901 Ga0500583_0011614 3300053092 Bacteria 3327
902 Ga0500651_0084520 3300053093 Bacteria 1962
903 Ga0500641_0006112 3300053096 Bacteria 4267
904 Ga0500641_0013194 3300053096 Bacteria 3033
905 Ga0500562_083418 3300053108 Bacteria 865
906 Ga0500572_000099 3300053111 Bacteria 28590
907 Ga0500582_160514 3300053114 Bacteria 773
908 Ga0500594_0025287 3300053118 Bacteria 1520
909 Ga0500595_000506 3300053119 Bacteria 23559
910 Ga0500595_000631 3300053119 Bacteria 21077
911 Ga0500655_090724 3300053133 Bacteria 634
912 Ga0500658_0072400 3300053134 Bacteria 1457
913 Ga0500559_0000238 3300053136 Bacteria 43775
914 Ga0500561_0044808 3300053137 Bacteria 1184
915 Ga0500568_0206216 3300053139 Bacteria 719
916 Ga0500577_0077432 3300053142 Bacteria 1318
917 Ga0500577_0189174 3300053142 Bacteria 885
918 Ga0500589_055504 3300053147 Bacteria 1828
919 Ga0500627_0155115 3300053158 Bacteria 1034
920 Ga0500634_0082379 3300053161 Bacteria 1654
921 Ga0500638_002747 3300053162 Bacteria 6264
922 Ga0500638_070154 3300053162 Bacteria 1676
923 Ga0500636_0056756 3300053177 Bacteria 2292
924 Ga0500637_0000350 3300053178 Bacteria 17499
925 Ga0500637_0076292 3300053178 Bacteria 1933
926 Ga0500637_0128472 3300053178 Bacteria 1470
927 Ga0500576_045994 3300053725 Bacteria 1952
928 Ga0500611_108289 3300053727 Bacteria 728
929 Ga0500645_022804 3300053730 Bacteria 1921
930 Ga0500596_002870 3300053735 Bacteria 3357
931 Ga0501084_1047699 3300054114 Bacteria 685
932 Ga0501082_0355885 3300060353 Bacteria 1277
933 2514014783 2513237161 Bacteria 8871253
934 2515627541 2515154112 Bacteria 8294334
935 2617352166 2617270735 Bacteria 9163226
936 2805915537 2802429603 Bacteria 8777136
937 2824675729 2824671348 Bacteria 8369588
938 2824691426 2824687955 Bacteria 8360029
939 2824699708 2824696289 Bacteria 8335049
940 2824779817 2824773399 Bacteria 8360218
941 2838124591 2838122688 Bacteria 8803140
942 2841945278 2841941048 Bacteria 8688029
943 2841952067 2841949485 Bacteria 8680857
944 2841970547 2841966195 Bacteria 8673214
945 2841981796 2841974524 Bacteria 8931498
946 2841985074 2841983080 Bacteria 8395090
947 2844315440 2844315083 Bacteria 8138177
948 2847942231 2847939898 Bacteria 8606328
949 2903732284 2903727486 Bacteria 8281579
950 2904691119 2904690495 Bacteria 9412302
951 2906604351 2906602504 Bacteria 8295279
952 2908756513 2908756301 Bacteria 8864324
953 2932794241 2932794094 Bacteria 7915132
954 2932808165 2932801729 Bacteria 7987968
955 2935890018 2935883170 Bacteria 7964738
956 3005595131 3005594810 Bacteria 8716512
957 3005718377 3005718088 Bacteria 8283608
958 8006933277 8006926726 Bacteria 6749210
959 Ga0373954_0024673
960 JGI25406J46586_10012434
961 JGI25165J46597_1014365
962 rootL2_10045963
963 rootL2_10096256
964 rootL2_10110173
965 JGI25404J52841_10003473
966 JGI25404J52841_10014495
967 JGI25404J52841_10017249
968 JGI25404J52841_10029009
969 JGI25405J52794_10029568
970 JGI25405J52794_10038265
971 Ga0070658_10014893
972 Ga0070658_10161129
973 Ga0070658_10207026
974 Ga0070676_10269668
975 Ga0070683_100023757
976 Ga0070683_100026678
977 Ga0068869_100153340
978 Ga0068869_100272752
979 Ga0068869_101690795
980 Ga0070680_100081500
981 Ga0068868_100034114
982 Ga0070660_100002091
983 Ga0070660_100207546
984 Ga0070689_100446774
985 Ga0070689_101212350
986 Ga0070687_100789260
987 Ga0070687_101264114
988 Ga0070661_100380440
989 Ga0070668_100038776
990 Ga0070668_100052404
991 Ga0070668_100052629
992 Ga0070668_100065717
993 Ga0070668_100081584
994 Ga0070668_100093078
995 Ga0070669_100112510
996 Ga0070675_100166479
997 Ga0070675_100214135
998 Ga0070675_100246901
999 Ga0070675_100524883
1000 Ga0070671_100139781
1001 Ga0070671_100615204
1002 Ga0070674_100427848
1003 Ga0070674_100461309
1004 Ga0070674_100548676
1005 Ga0070674_100781989
1006 Ga0070673_100197544
1007 Ga0070673_100284219
1008 Ga0070673_101336580
1009 Ga0070688_100183024
1010 Ga0070688_100574830
1011 Ga0070659_100100796
1012 Ga0070659_100379757
1013 Ga0070667_100057192
1014 Ga0070667_100599446
1015 Ga0070709_10003366
1016 Ga0070709_10992061
1017 Ga0070714_100003204
1018 Ga0070714_100077968
1019 Ga0070714_100105094
1020 Ga0070713_100055042
1021 Ga0070713_100289224
1022 Ga0070710_10003286
1023 Ga0070710_10030798
1024 Ga0070710_10237258
1025 Ga0070701_10087544
1026 Ga0070711_100000745
1027 Ga0070711_100014756
1028 Ga0070711_100015345
1029 Ga0070711_100342468
1030 Ga0070700_100150599
1031 Ga0070700_100711335
1032 Ga0070700_100822968
1033 Ga0070708_100263882
1034 Ga0070663_100011469
1035 Ga0070663_100022407
1036 Ga0070663_100082416
1037 Ga0070663_100204768
1038 Ga0070663_100858687
1039 Ga0070678_100011085
1040 Ga0070678_100048833
1041 Ga0070678_100064850
1042 Ga0070678_100152067
1043 Ga0070678_100159924
1044 Ga0070678_100185861
1045 Ga0070662_100097724
1046 Ga0070681_10041643
1047 Ga0070681_10233050
1048 Ga0068867_100049258
1049 Ga0068867_100393149
1050 Ga0068867_100407017
1051 Ga0068867_100603275
1052 Ga0070685_10132615
1053 Ga0070685_10296082
1054 Ga0070706_100072375
1055 Ga0070706_100493931
1056 Ga0070706_100585893
1057 Ga0070706_101528771
1058 Ga0070707_100560281
1059 Ga0070698_100084471
1060 Ga0070698_100904999
1061 Ga0070698_101814548
1062 Ga0070699_100506767
1063 Ga0070679_100028386
1064 Ga0070679_100038806
1065 Ga0070679_100080723
1066 Ga0070684_100004519
1067 Ga0070684_100016992
1068 Ga0070684_100159841
1069 Ga0070684_100752393
1070 Ga0070697_100399205
1071 Ga0070697_100399786
1072 Ga0070697_100436918
1073 Ga0068853_100203859
1074 Ga0068853_100430451
1075 Ga0068853_101055805
1076 Ga0070672_100047552
1077 Ga0070672_100119640
1078 Ga0070672_100382019
1079 Ga0070686_100069204
1080 Ga0070686_100181281
1081 Ga0070695_100889492
1082 Ga0070696_100935292
1083 Ga0070665_100038779
1084 Ga0070665_100084569
1085 Ga0070665_100143395
1086 Ga0070665_100159117
1087 Ga0070665_100227433
1088 Ga0070665_100487636
1089 Ga0070665_100790605
1090 Ga0068855_100021984
1091 Ga0068855_100039709
1092 Ga0068855_100111720
1093 Ga0068855_100494392
1094 Ga0070664_100118017
1095 Ga0068857_100021483
1096 Ga0068857_100268057
1097 Ga0068857_100272157
1098 Ga0068857_100493160
1099 Ga0068854_100010964
1100 Ga0068854_100661758
1101 Ga0068856_100000540
1102 Ga0068856_100014372
1103 Ga0068856_100288133
1104 Ga0068856_100447966
1105 Ga0068856_100473876
1106 Ga0070702_100617486
1107 Ga0070702_101000616
1108 Ga0068852_100004787
1109 Ga0068852_100123844
1110 Ga0068859_100200649
1111 Ga0068859_100201023
1112 Ga0068864_100378585
1113 Ga0068864_100396125
1114 Ga0068866_10021203
1115 Ga0068866_10353099
1116 Ga0068861_100052249
1117 Ga0068861_100194902
1118 Ga0068870_10063270
1119 Ga0068858_100049531
1120 Ga0068858_100063701
1121 Ga0068858_100085133
1122 Ga0068858_100249542
1123 Ga0068860_100130560
1124 Ga0068860_100233797
1125 Ga0068860_100333779
1126 Ga0068860_100528878
1127 Ga0068862_100037181
1128 Ga0068862_100259184
1129 Ga0068862_100551300
1130 Ga0081455_10003799
1131 Ga0081455_10016122
1132 Ga0081455_10023378
1133 Ga0081455_10024424
1134 Ga0081538_10022806
1135 Ga0081540_1001162
1136 Ga0081540_1005031
1137 Ga0081540_1007496
1138 Ga0081540_1009260
1139 Ga0081540_1012233
1140 Ga0081540_1018775
1141 Ga0081540_1074124
1142 Ga0081540_1117597
1143 Ga0081540_1123230
1144 Ga0081539_10000966
1145 Ga0081539_10046027
1146 Ga0070717_10000269
1147 Ga0070717_10004197
1148 Ga0070717_10124111
1149 Ga0070717_10239814
1150 Ga0075365_10007222
1151 Ga0075365_10055244
1152 Ga0075365_10104789
1153 Ga0075365_10200035
1154 Ga0075365_10254392
1155 Ga0075365_10281124
1156 Ga0075368_10212815
1157 Ga0075368_10279892
1158 Ga0075363_100016896
1159 Ga0075363_100028560
1160 Ga0075363_100053851
1161 Ga0075363_100277746
1162 Ga0075364_10031529
1163 Ga0075364_10305866
1164 Ga0075364_10455731
1165 Ga0070715_10009248
1166 Ga0070715_10043682
1167 Ga0070715_10213412
1168 Ga0070716_100024130
1169 Ga0070716_100054308
1170 Ga0070716_100330371
1171 Ga0070712_100006808
1172 Ga0070712_100105562
1173 Ga0070712_100161542
1174 Ga0070712_100280156
1175 Ga0075362_10017408
1176 Ga0075362_10091355
1177 Ga0075362_10124324
1178 Ga0075362_10187535
1179 Ga0075367_10204281
1180 Ga0075367_10421047
1181 Ga0075369_10016235
1182 Ga0075369_10034714
1183 Ga0075369_10148024
1184 Ga0075369_10157110
1185 Ga0075366_10030691
1186 Ga0075366_10137217
1187 Ga0075366_10450007
1188 Ga0097621_100068907
1189 Ga0097621_100094411
1190 Ga0075370_10021423
1191 Ga0075370_10131295
1192 Ga0075370_10377985
1193 Ga0075370_10561316
1194 Ga0068871_100564787
1195 Ga0068871_100945052
1196 Ga0075428_100125897
1197 Ga0075434_100315212
1198 Ga0075429_100459510
1199 Ga0068865_100017842
1200 Ga0068865_100129004
1201 Ga0068865_100587428
1202 Ga0068865_100601009
1203 Ga0068865_100647124
1204 Ga0068865_100807603
1205 Ga0075436_100637026
1206 Ga0097620_100200641
1207 Ga0097620_100201032
1208 Ga0099824_1006119
1209 Ga0099822_1014043
1210 Ga0099794_10230174
1211 Ga0099795_10006732
1212 Ga0099795_10012369
1213 Ga0105240_10002943
1214 Ga0105240_10113703
1215 Ga0111539_10061321
1216 Ga0105245_10074999
1217 Ga0105245_10181113
1218 Ga0105245_10337206
1219 Ga0105247_10028777
1220 Ga0105247_10078744
1221 Ga0105247_10140941
1222 Ga0105243_10045318
1223 Ga0105243_10539593
1224 Ga0105243_10619255
1225 Ga0105241_10125496
1226 Ga0105242_10039799
1227 Ga0105242_10711023
1228 Ga0105248_10023017
1229 Ga0105248_10314212
1230 Ga0105248_11020580
1231 Ga0105237_10043269
1232 Ga0105237_10083496
1233 Ga0105237_10528926
1234 Ga0105237_10865440
1235 Ga0105238_10006820
1236 Ga0105238_10087183
1237 Ga0105238_10213127
1238 Ga0105249_10262698
1239 Ga0105249_10340165
1240 Ga0105249_10416025
1241 Ga0105249_11715565
1242 Ga0099796_10011515
1243 Ga0099796_10017101
1244 Ga0099796_10219691
1245 Ga0105239_10013186
1246 Ga0105239_10039840
1247 Ga0105239_10060392
1248 Ga0105239_10073624
1249 Ga0105239_10146156
1250 Ga0105239_10544550
1251 Ga0105239_10592338
1252 Ga0105246_10004242
1253 Ga0105246_10061626
1254 Ga0105246_10109633
1255 Ga0105246_10425285
1256 Ga0157337_1019336
1257 Ga0157370_10019039
1258 Ga0157370_10055288
1259 Ga0157369_10006724
1260 Ga0157369_10749753
1261 Ga0157369_11179679
1262 Ga0157374_10110606
1263 Ga0157374_10708571
1264 Ga0157378_10119537
1265 Ga0157378_10177987
1266 Ga0157378_10257569
1267 Ga0157378_10344116
1268 Ga0157378_11639592
1269 Ga0163162_10007574
1270 Ga0163162_10315174
1271 Ga0163162_10455550
1272 Ga0163162_10528306
1273 Ga0163162_11197798
1274 Ga0157372_12623184
1275 Ga0157375_10247981
1276 Ga0157375_10272575
1277 Ga0157375_10292148
1278 Ga0157375_11010552
1279 Ga0163163_10068804
1280 Ga0163163_10088341
1281 Ga0163163_10237236
1282 Ga0163163_10322212
1283 Ga0163163_10882382
1284 Ga0163163_11046677
1285 Ga0157380_10027065
1286 Ga0157380_10149254
1287 Ga0157380_10332147
1288 Ga0157380_11081999
1289 Ga0157380_11411552
1290 Ga0157377_10131013
1291 Ga0157377_10735503
1292 Ga0157377_10750139
1293 Ga0157379_10192840
1294 Ga0157379_11068753
1295 Ga0157376_10110109
1296 Ga0157376_10147227
1297 Ga0157376_10701271
1298 Ga0157376_11136703
1299 Ga0182007_10167031
1300 Ga0163161_10080606
1301 Ga0163161_10272828
1302 Ga0163161_10573798
1303 Ga0213876_10032614
1304 Ga0213871_10150037
1305 Ga0209233_1023807
1306 Ga0209233_1028045
1307 Ga0209455_1002223
1308 Ga0209758_1006028
1309 Ga0209758_1010347
1310 Ga0209758_1070185
1311 Ga0207426_1112741
1312 Ga0207697_10013036
1313 Ga0207697_10023965
1314 Ga0207656_10465633
1315 Ga0207692_10005362
1316 Ga0207692_10015075
1317 Ga0207692_10170389
1318 Ga0207642_10035126
1319 Ga0207642_10157253
1320 Ga0207642_10409132
1321 Ga0207710_10028750
1322 Ga0207710_10070899
1323 Ga0207710_10108829
1324 Ga0207710_10112693
1325 Ga0207710_10136584
1326 Ga0207688_10010585
1327 Ga0207688_10026527
1328 Ga0207688_10046897
1329 Ga0207688_10061701
1330 Ga0207688_10263506
1331 Ga0207680_10393967
1332 Ga0207647_10100687
1333 Ga0207685_10501513
1334 Ga0207699_10000309
1335 Ga0207699_10090360
1336 Ga0207699_10436859
1337 Ga0207645_10442535
1338 Ga0207643_10186796
1339 Ga0207643_10631469
1340 Ga0207705_10357472
1341 Ga0207684_10201526
1342 Ga0207684_10235799
1343 Ga0207684_10836656
1344 Ga0207654_10096908
1345 Ga0207654_10129163
1346 Ga0207707_10004049
1347 Ga0207707_10084173
1348 Ga0207695_10158317
1349 Ga0207695_10308117
1350 Ga0207671_10060067
1351 Ga0207671_10163465
1352 Ga0207671_11221270
1353 Ga0207693_10002279
1354 Ga0207693_10036569
1355 Ga0207693_10037840
1356 Ga0207693_10092682
1357 Ga0207693_10108972
1358 Ga0207663_10001983
1359 Ga0207663_10002139
1360 Ga0207663_10053409
1361 Ga0207660_10039770
1362 Ga0207660_10258781
1363 Ga0207657_10003634
1364 Ga0207657_10092864
1365 Ga0207657_10210687
1366 Ga0207657_10322449
1367 Ga0207649_10105847
1368 Ga0207649_10379231
1369 Ga0207652_10002638
1370 Ga0207652_10097756
1371 Ga0207681_10100674
1372 Ga0207694_10112473
1373 Ga0207694_11317947
1374 Ga0207650_10328321
1375 Ga0207650_10473929
1376 Ga0207650_10477105
1377 Ga0207650_10777394
1378 Ga0207659_10159889
1379 Ga0207659_10223616
1380 Ga0207659_10324128
1381 Ga0207659_10569531
1382 Ga0207687_10023004
1383 Ga0207687_10024543
1384 Ga0207687_10871268
1385 Ga0207700_10016746
1386 Ga0207700_10049134
1387 Ga0207664_10042185
1388 Ga0207664_10055752
1389 Ga0207664_10175665
1390 Ga0207664_10280396
1391 Ga0207644_10385830
1392 Ga0207644_10438468
1393 Ga0207644_11229092
1394 Ga0207690_10891055
1395 Ga0207706_10025700
1396 Ga0207706_10088312
1397 Ga0207706_10323700
1398 Ga0207686_10366762
1399 Ga0207709_10413595
1400 Ga0207709_10418209
1401 Ga0207709_10954767
1402 Ga0207709_10957997
1403 Ga0207669_10055249
1404 Ga0207669_10300119
1405 Ga0207704_10031422
1406 Ga0207704_10178562
1407 Ga0207704_10601907
1408 Ga0207704_10646143
1409 Ga0207665_10002452
1410 Ga0207665_10035091
1411 Ga0207665_10053824
1412 Ga0207665_10066823
1413 Ga0207665_10188122
1414 Ga0207665_10203579
1415 Ga0207691_10058603
1416 Ga0207691_10060550
1417 Ga0207691_10313472
1418 Ga0207711_10155096
1419 Ga0207711_10217312
1420 Ga0207711_10583776
1421 Ga0207689_10196723
1422 Ga0207661_10001804
1423 Ga0207661_10007278
1424 Ga0207679_10103763
1425 Ga0207679_10171579
1426 Ga0207667_10008204
1427 Ga0207667_10046583
1428 Ga0207667_10391628
1429 Ga0207667_10539508
1430 Ga0207651_10292405
1431 Ga0207651_10514015
1432 Ga0207712_10239357
1433 Ga0207668_10073979
1434 Ga0207668_10186108
1435 Ga0207668_10406272
1436 Ga0207668_10557764
1437 Ga0207640_10011851
1438 Ga0207640_10714416
1439 Ga0207640_11044766
1440 Ga0207640_11616702
1441 Ga0207658_11224375
1442 Ga0207677_10028438
1443 Ga0207677_10117463
1444 Ga0207703_10034719
1445 Ga0207703_10186095
1446 Ga0207703_10409057
1447 Ga0207703_10475113
1448 Ga0207639_10078976
1449 Ga0207639_10238815
1450 Ga0207639_10572555
1451 Ga0207639_10599694
1452 Ga0207639_11129528
1453 Ga0207678_10024550
1454 Ga0207678_10048527
1455 Ga0207678_10093941
1456 Ga0207678_10094956
1457 Ga0207678_10199547
1458 Ga0207678_10289318
1459 Ga0207708_10725563
1460 Ga0207702_10003075
1461 Ga0207702_10363622
1462 Ga0207641_10380706
1463 Ga0207641_10656443
1464 Ga0207648_10111099
1465 Ga0207648_10117176
1466 Ga0207648_10529890
1467 Ga0207676_10338008
1468 Ga0207674_10003708
1469 Ga0207674_10033510
1470 Ga0207674_10400024
1471 Ga0207675_100043240
1472 Ga0207675_100048585
1473 Ga0207683_10019513
1474 Ga0207683_10043506
1475 Ga0207683_10051303
1476 Ga0207683_10075599
1477 Ga0207683_10102080
1478 Ga0207683_10198600
1479 Ga0207683_10387816
1480 Ga0207683_10692265
1481 Ga0207683_10911092
1482 Ga0207698_10117280
1483 Ga0207698_10174301
1484 Ga0209589_1000021
1485 Ga0209489_100028
1486 Ga0209700_100037
1487 Ga0209813_10090542
1488 Ga0207428_10302262
1489 Ga0268266_10000680
1490 Ga0268266_10002169
1491 Ga0268266_10024779
1492 Ga0268266_10096578
1493 Ga0268266_10098886
1494 Ga0268266_10133948
1495 Ga0268266_10392226
1496 Ga0268266_10508727
1497 Ga0268265_10028819
1498 Ga0268265_10120452
1499 Ga0268265_10498026
1500 Ga0268265_10727038
1501 Ga0268264_10211583
1502 Ga0268264_10360833
1503 Ga0268264_11005879
1504 Ga0265323_10016069
1505 Ga0265336_10013367
1506 Ga0307517_10000175
1507 Ga0307515_10093325
1508 Ga0307515_10280782
1509 Ga0265338_10000835
1510 Ga0265324_10019533
1511 Ga0307512_10302631
1512 Ga0265330_10021122
1513 Ga0265330_10023914
1514 Ga0265330_10070163
1515 Ga0265332_10118417
1516 Ga0265332_10207671
1517 Ga0265325_10035551
1518 Ga0265340_10000884
1519 Ga0265340_10035059
1520 Ga0265339_10004328
1521 Ga0265339_10016094
1522 Ga0265339_10083650
1523 Ga0265316_10359186
1524 Ga0307513_10057077
1525 Ga0307513_10182197
1526 Ga0307513_10371673
1527 Ga0307509_10084646
1528 Ga0307408_100505017
1529 Ga0265313_10041621
1530 Ga0307508_10000108
1531 Ga0265314_10003949
1532 Ga0265314_10124640
1533 Ga0265342_10147385
1534 Ga0307516_10151857
1535 Ga0307516_10192455
1536 Ga0307516_10610540
1537 Ga0307405_10241741
1538 Ga0307406_10127422
1539 Ga0307406_10150823
1540 Ga0307412_10431601
1541 Ga0307412_10998363
1542 Ga0307416_100267044
1543 Ga0307416_100415049
1544 Ga0307416_102306814
1545 Ga0307414_10434577
1546 Ga0307411_10065225
1547 Ga0307415_100054255
1548 Ga0307415_100085248
1549 Ga0307415_100321899
1550 Ga0307510_10010287
1551 Ga0307510_10200456
1552 Ga0316215_1005545
1553 Ga0373926_0132099
1554 Ga0373944_0275669
1555 Ga0373923_0060610
1556 Ga0373932_0026257
1557 Ga0373932_0116569
1558 Ga0373941_0142888
1559 Ga0373945_0204677
1560 Ga0373955_0225677
1561 Ga0373962_0212440
1562 Ga0373931_0003001
1563 Ga0373931_0091713
1564 Ga0373927_0003306
1565 Ga0373927_0153238
1566 Ga0373927_0235163
1567 Ga0373947_0023036
1568 Ga0373947_0213774
1569 Ga0373937_0078308
1570 Ga0373937_0428902
1571 Ga0372808_020771
1572 Ga0373925_0077409
1573 Ga0373925_0174161
1574 Ga0373925_0328147
1575 Ga0373925_0636194
1576 Ga0395900_0109182
1577 Ga0395905_0499162
1578 Ga0436364_1450038
1579 Ga0395901_0380417
1580 Ga0395901_1068423
1581 Ga0436365_0168484
1582 Ga0436365_1582279
1583 Ga0436360_0023737
1584 Ga0436360_1245929
1585 Ga0436363_0159943
1586 Ga0436363_1166950
1587 Ga0436363_1403617
1588 Ga0436362_0181511
1589 Ga0451802_0623261
1590 Ga0451807_1001866
1591 Ga0451807_1667569
1592 Ga0451807_1946340
1593 Ga0451833_0048398
1594 Ga0451835_1012982
1595 Ga0451839_0736368
1596 Ga0466964_0565191
1597 Ga0466957_0564762
1598 Ga0466960_0247273
1599 Ga0466967_0682013
1600 Ga0466967_0702043
1601 Ga0466967_1024621
1602 Ga0495617_051254
1603 Ga0495603_0010419
1604 Ga0495603_0016067
1605 Ga0495603_0056389
1606 Ga0495603_0173014
1607 Ga0495603_0364080
1608 Ga0495590_0336458
1609 Ga0495629_0077987
1610 Ga0495638_0094374
1611 Ga0495638_0134796
1612 Ga0495638_0156987
1613 Ga0495651_0780390
1614 Ga0495650_0099227
1615 Ga0495582_0028352
1616 Ga0495639_0062306
1617 Ga0495585_0131359
1618 Ga0495594_0129264
1619 Ga0495596_0063536
1620 Ga0495583_0210154
1621 Ga0495606_0132216
1622 Ga0495606_0204613
1623 Ga0495610_0028391
1624 Ga0495610_0159647
1625 Ga0495616_0328317
1626 Ga0495620_0186358
1627 Ga0495630_0196993
1628 Ga0495631_0090236
1629 Ga0495644_0069318
1630 Ga0495644_0147410
1631 Ga0495648_0001251
1632 Ga0495648_0320809
1633 Ga0495654_0165764
1634 Ga0495665_0246776
1635 Ga0495640_0577440
1636 Ga0495587_0283480
1637 Ga0495609_0043250
1638 Ga0495609_0050883
1639 Ga0495609_0161223
1640 Ga0495621_0010649
1641 Ga0495645_0110908
1642 Ga0495645_0123252
1643 Ga0495622_0044765
1644 Ga0495622_0297899
1645 Ga0495656_0003421
1646 Ga0495656_0009022
1647 Ga0495656_0028898
1648 Ga0495656_0030100
1649 Ga0495668_0125789
1650 Ga0495668_0166092
1651 Ga0495668_0208085
1652 Ga0495668_0630773
1653 Ga0495625_0067931
1654 Ga0495625_0273687
1655 Ga0495625_0295610
1656 Ga0495625_0373557
1657 Ga0495625_0465578
1658 Ga0495659_0033870
1659 Ga0495659_0058120
1660 Ga0495588_0281158
1661 Ga0495599_0008234
1662 Ga0495623_0218694
1663 Ga0495647_0402293
1664 Ga0495669_0015183
1665 Ga0495669_0064842
1666 Ga0495669_0083825
1667 Ga0495669_0170181
1668 Ga0495669_0316731
1669 Ga0495613_0782777
1670 Ga0495624_0123097
1671 Ga0495670_0096732
1672 Ga0495671_0115441
1673 Ga0495671_0170410
1674 Ga0495649_0186263
1675 Ga0495649_0394862
1676 Ga0495589_0095626
1677 Ga0495589_0142352
1678 Ga0495589_0169547
1679 Ga0495600_0143564
1680 Ga0495581_0131300
1681 Ga0495581_0202275
1682 Ga0495581_0602697
1683 Ga0495604_0214928
1684 Ga0495604_0265593
1685 Ga0495636_0030621
1686 Ga0495674_0198480
1687 Ga0495672_0339280
1688 Ga0495676_0062458
1689 Ga0495683_0047765
1690 Ga0495683_0128105
1691 Ga0495685_086272
1692 Ga0495685_114679
1693 Ga0495686_0127380
1694 Ga0495686_0490492
1695 Ga0495602_0671054
1696 Ga0495626_0176548
1697 Ga0496100_0048756
1698 Ga0496100_0081491
1699 Ga0496101_0008281
1700 Ga0496101_0044430
1701 Ga0496101_0319134
1702 Ga0496102_0001453
1703 Ga0496102_0043946
1704 Ga0496102_0327127
1705 Ga0496102_0339395
1706 Ga0496102_1324930
1707 Ga0496103_0010530
1708 Ga0496103_0056754
1709 Ga0496103_0674250
1710 Ga0496104_0027853
1711 Ga0496104_0135896
1712 Ga0496104_0271160
1713 Ga0496104_0373628
1714 Ga0496104_0618479
1715 Ga0496105_0005368
1716 Ga0496105_0197778
1717 Ga0496105_0864316
1718 Ga0496106_0003462
1719 Ga0496106_0007634
1720 Ga0496106_0076324
1721 Ga0496106_0199556
1722 Ga0496106_0257845
1723 Ga0496106_0478127
1724 Ga0496107_0008406
1725 Ga0496107_0019887
1726 Ga0496107_0029236
1727 Ga0496107_0092416
1728 Ga0496107_0171756
1729 Ga0496107_0352387
1730 Ga0496108_0034768
1731 Ga0496108_0039651
1732 Ga0496108_0104749
1733 Ga0496109_0090477
1734 Ga0496109_0652160
1735 Ga0496110_0009850
1736 Ga0496110_0015996
1737 Ga0496111_0024623
1738 Ga0496111_0039977
1739 Ga0496111_0231979
1740 Ga0496112_0042992
1741 Ga0496112_0051842
1742 Ga0496112_0078349
1743 Ga0496113_0023859
1744 Ga0496113_0032245
1745 Ga0496113_0047640
1746 Ga0496113_0114650
1747 Ga0496113_0174611
1748 Ga0496113_0548004
1749 Ga0496114_0022794
1750 Ga0496114_0037886
1751 Ga0496114_0063296
1752 Ga0496115_0004695
1753 Ga0496115_0027446
1754 Ga0496115_0109423
1755 Ga0496115_0444017
1756 Ga0496115_0910449
1757 Ga0496117_0228952
1758 Ga0496118_0096208
1759 Ga0496118_0216458
1760 Ga0496121_0063692
1761 Ga0496121_0070730
1762 Ga0496121_0216414
1763 Ga0496121_0282937
1764 Ga0496121_0311718
1765 Ga0496124_0046885
1766 Ga0496124_0180542
1767 Ga0496124_0305447
1768 Ga0496125_0047124
1769 Ga0496125_0208382
1770 Ga0496125_0354947
1771 Ga0496126_0011555
1772 Ga0496126_0014534
1773 Ga0496126_0062393
1774 Ga0496126_0073518
1775 Ga0496126_0117515
1776 Ga0496126_0145240
1777 Ga0496126_0242181
1778 Ga0496126_0267846
1779 Ga0496126_0283596
1780 Ga0496126_0371971
1781 Ga0496126_0480060
1782 Ga0501031_0160646
1783 Ga0501033_0150909
1784 Ga0501033_0308273
1785 Ga0501034_0048287
1786 Ga0501036_1306400
1787 Ga0501037_0249504
1788 Ga0501038_0124216
1789 Ga0501038_0561556
1790 Ga0501039_0164864
1791 Ga0501042_0346240
1792 Ga0501043_0330162
1793 Ga0501046_0019136
1794 Ga0501046_0134887
1795 Ga0501047_0020926
1796 Ga0501067_0035210
1797 Ga0501067_0044688
1798 Ga0501068_0027765
1799 Ga0501068_0273486
1800 Ga0501069_0057654
1801 Ga0501069_0203031
1802 Ga0501070_0008271
1803 Ga0501071_0187713
1804 Ga0501071_0370302
1805 Ga0501071_0392019
1806 Ga0501073_0008815
1807 Ga0501074_0015460
1808 Ga0501075_0611963
1809 Ga0501076_0098020
1810 Ga0501076_0146208
1811 Ga0501079_0385992
1812 Ga0501080_0016296
1813 Ga0501080_0249895
1814 Ga0501035_0082361
1815 Ga0501044_0017082
1816 Ga0501045_0379058
1817 Ga0501045_0471835
1818 nmdc:mga03683_19812_c1
1819 nmdc:mga03683_279409_c1
1820 nmdc:mga03683_402934_c1
1821 nmdc:mga03n38_164796_c1
1822 nmdc:mga03n38_287851_c1
1823 nmdc:mga03n38_298337_c1
1824 nmdc:mga00v17_211293_c1
1825 nmdc:mga00v17_87918_c1
1826 nmdc:mga0yw44_103713_c1
1827 nmdc:mga0yw44_189590_c1
1828 nmdc:mga0yw44_265923_c1
1829 nmdc:mga0yw44_30731_c1
1830 nmdc:mga0yw44_3728_c1
1831 nmdc:mga0yw44_971088_c1
1832 nmdc:mga0k408_11114_c1
1833 nmdc:mga0k408_332175_c1
1834 nmdc:mga0k408_46281_c1
1835 nmdc:mga06z11_31889_c1
1836 nmdc:mga06z11_386642_c1
1837 nmdc:mga06z11_494596_c1
1838 nmdc:mga04h51_414475_c1
1839 nmdc:mga04h51_97303_c1
1840 nmdc:mga07m45_148798_c1
1841 nmdc:mga07m45_43287_c1
1842 nmdc:mga07m45_9877_c1
1843 nmdc:mga05p37_573050_c1
1844 nmdc:mga09592_688562_c1
1845 nmdc:mga08y16_170224_c1
1846 nmdc:mga08y16_66686_c1
1847 nmdc:mga0n895_187543_c1
1848 nmdc:mga0rr50_512824_c1
1849 nmdc:mga0rr50_669647_c1
1850 nmdc:mga0a205_229797_c1
1851 nmdc:mga0sz30_37500_c1
1852 Ga0495612_0038738
1853 Ga0495612_0179654
1854 Ga0495655_0074640
1855 Ga0495595_0067844
1856 Ga0500578_0453093
1857 Ga0500646_0024926
1858 Ga0500646_0110726
1859 Ga0500583_0011614
1860 Ga0500651_0084520
1861 Ga0500641_0006112
1862 Ga0500641_0013194
1863 Ga0500562_083418
1864 Ga0500572_000099
1865 Ga0500582_160514
1866 Ga0500594_0025287
1867 Ga0500595_000506
1868 Ga0500595_000631
1869 Ga0500655_090724
1870 Ga0500658_0072400
1871 Ga0500559_0000238
1872 Ga0500561_0044808
1873 Ga0500568_0206216
1874 Ga0500577_0077432
1875 Ga0500577_0189174
1876 Ga0500589_055504
1877 Ga0500627_0155115
1878 Ga0500634_0082379
1879 Ga0500638_002747
1880 Ga0500638_070154
1881 Ga0500636_0056756
1882 Ga0500637_0000350
1883 Ga0500637_0076292
1884 Ga0500637_0128472
1885 Ga0500576_045994
1886 Ga0500611_108289
1887 Ga0500645_022804
1888 Ga0500596_002870
1889 Ga0501084_1047699
1890 Ga0501082_0355885
1891 2514014783
1892 2515627541
1893 2617352166
1894 2805915537
1895 2824675729
1896 2824691426
1897 2824699708
1898 2824779817
1899 2838124591
1900 2841945278
1901 2841952067
1902 2841970547
1903 2841981796
1904 2841985074
1905 2844315440
1906 2847942231
1907 2903732284
1908 2904691119
1909 2906604351
1910 2908756513
1911 2932794241
1912 2932808165
1913 2935890018
1914 3005595131
1915 3005718377
1916 8006933277

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05099

TerB

Tellurite resistance protein TerB

65

182

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zx1-assembly1.cif.gz_A crystal structure of ent domain from t. brucei 0.6784 98 160
2h5n-assembly1.cif.gz_B crystal structure of protein of unknown function pg1108 from porphyromonas gingivalis w83 0.5596 22 147
2h5n-assembly1.cif.gz_B crystal structure of protein of unknown function pg1108 from porphyromonas gingivalis w83 0.5434 22 147
5zx1-assembly1.cif.gz_A crystal structure of ent domain from t. brucei 0.519 98 160
2ou3-assembly1.cif.gz_B crystal structure of a tellurite resistance protein of cog3793 (npun_f6341) from nostoc punctiforme pcc 73102 at 1.85 a resolution 0.5122 4 156
ID Description Score Start End Superfamily
af_Q9M2M2_56_121_1.10.1240.40 Mainly Alpha;Orthogonal Bundle;Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1;ENT domain 0.84 98 147 1.10.1240.40
af_I1JUF7_325_389_1.10.1240.40 Mainly Alpha;Orthogonal Bundle;Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1;ENT domain 0.7981 90 151 1.10.1240.40
af_Q9M2Q2_35_103_1.10.3680.10 Mainly Alpha;Orthogonal Bundle;TerB-like;TerB-like 0.7674 101 160 1.10.3680.10
af_I1JUF7_325_389_1.10.1240.40 Mainly Alpha;Orthogonal Bundle;Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1;ENT domain 0.7017 90 151 1.10.1240.40
af_A0A0P0W487_245_310_1.10.1240.40 Mainly Alpha;Orthogonal Bundle;Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1;ENT domain 0.7008 80 150 1.10.1240.40
ID Description Score Start End GO Terms
AF-Q2S7K9-F1-model_v4 Uncharacterized protein conserved in bacteria 0.8194 1 150
AF-X5MEQ8-F1-model_v4 Co-chaperone DjlA N-terminal domain-containing protein 0.811 1 152
AF-Q2S7K9-F1-model_v4 Uncharacterized protein conserved in bacteria 0.8095 1 150
AF-X5MEQ8-F1-model_v4 Co-chaperone DjlA N-terminal domain-containing protein 0.8016 1 152
AF-A0A6B1GQA6-F1-model_v4 TerB family tellurite resistance protein 0.7878 2 154

Map