F486755

General Info

Members Datasets Scaffolds Average Seq Length
956 443 881 277

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2791355253|2793280811
Length 295
Sequence MTAPAAPTPASDVGRGAPSGMVGRTTGDRIILGLTIALAIVMMAPLLWVVALSLKDNKELMVSMNAVFHAPYTVQNYINILATSSVFRWILNSLVVAGGLTVGTLVLSSLAGYGFARLNFPFRNVLFVIVLMGLAVPEQAVLIARHQLFSWLKLHNTYPGLILPGLSAPFGVFLMTQYFRAIPKELDEAALLDNASRFKIFWKVLLPLTLPAQATLGIFTFLGAWNDYLWPLISGTKKEMYTLTVGIASTQTNFAQSEGLGFLMSQAVFAGAPILILYLFFQKYIVTAVSGAAVR

Samples

Sample ID Description Type Environment
1 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
2 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
3 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
4 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
5 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
6 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
7 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
8 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
9 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
10 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
11 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
12 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
13 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
14 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
15 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
16 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
17 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
18 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
19 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
20 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
21 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
22 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
23 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
24 2643221568 Rhizobium sp. Root564 Isolate Unclassified
25 2643221584 Caulobacter sp. Root656 Isolate Unclassified
26 2643221599 Rhizobium sp. Root708 Isolate Unclassified
27 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
28 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
29 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
30 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
31 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
32 2738541293 Rhizobium sp. GV031 Isolate Unclassified
33 2738541297 Duganella sp. GV083 Isolate Unclassified
34 2738541357 Duganella sp. GV053 Isolate Unclassified
35 2738543003 Duganella sp. GV066 Isolate Unclassified
36 2738543026 Duganella sp. GV089 Isolate Unclassified
37 2738543029 Duganella sp. GV039 Isolate Unclassified
38 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
39 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
40 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
41 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
42 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
43 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
44 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
45 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
46 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
47 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
48 2818991435 Caulobacter henricii 536 Isolate Unclassified
49 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
50 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
51 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
52 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
53 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
54 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
55 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
56 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
57 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
58 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
59 2909042592 Labrys sp. LIt4 Isolate Nodule
60 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
61 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
62 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
63 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
64 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
65 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
66 2996887358 Rhizobium sp. R711 Isolate Nodule
67 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
68 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
69 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
70 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
71 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
72 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
73 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
74 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
75 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
76 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
77 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
78 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
80 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
81 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
82 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
83 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
84 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
85 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
86 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
87 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
88 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
89 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
90 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
91 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
92 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
93 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
94 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
95 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
96 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
97 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
98 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
99 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
100 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
101 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
102 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
103 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
104 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
105 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
106 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
107 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
108 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
109 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
110 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
111 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
112 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
113 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
114 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
115 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
116 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
117 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
118 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
119 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
120 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
121 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
122 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
123 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
124 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
125 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
126 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
127 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
128 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
129 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
130 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
131 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
132 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
133 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
134 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
135 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
136 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
137 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
138 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
139 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
140 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
141 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
142 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
143 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
144 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
145 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
146 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
147 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
148 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
149 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
150 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
151 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
152 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
153 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
154 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
155 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
156 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
157 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
158 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
159 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
160 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
161 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
162 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
163 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
164 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
165 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
166 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
167 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
168 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
169 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
170 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
171 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
172 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
173 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
174 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
175 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
176 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
177 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
178 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
180 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
181 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
182 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
183 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
184 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
187 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
189 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
191 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
194 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
251 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
252 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
253 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
254 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
255 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
256 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
257 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
258 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
259 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
260 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
261 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
262 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
263 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
264 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
265 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
266 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
267 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
268 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
269 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
270 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
271 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
272 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
273 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
274 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
275 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
276 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
277 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
278 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
279 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
280 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
281 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
282 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
283 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
284 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
285 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
286 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
287 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
288 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
289 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
290 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
291 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
292 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
293 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
294 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
295 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
296 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
297 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
298 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
299 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
300 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
301 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
302 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
303 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
304 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
305 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
306 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
307 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
308 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
309 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
310 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
311 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
312 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
313 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
314 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
315 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
316 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
317 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
318 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
319 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
320 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
321 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
322 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
323 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
324 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
325 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
326 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
327 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
328 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
329 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
330 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
331 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
332 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
333 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
334 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
335 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
336 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
337 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
338 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
339 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
340 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
341 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
342 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
343 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
344 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
345 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
346 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
347 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
348 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
349 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
350 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
351 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
352 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
353 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
354 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
355 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
356 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
357 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
358 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
359 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
360 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
361 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
362 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
363 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
364 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
365 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
366 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
367 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
368 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
369 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
370 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
371 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
372 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
373 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
374 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
375 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
376 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
377 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
378 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
379 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
380 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
381 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
382 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
383 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
384 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
385 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
386 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
387 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
388 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
389 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
390 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
391 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
392 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
393 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
394 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
395 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
396 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
397 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
398 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
399 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
400 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
401 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
402 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
403 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
404 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
408 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
409 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
410 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
412 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
413 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
414 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
415 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
416 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
417 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
418 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
419 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
420 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
421 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
422 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
423 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
424 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
425 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
426 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
427 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
428 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
429 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
430 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
431 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
432 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
433 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
434 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
435 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
436 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
437 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
438 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
439 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
440 8005258706 Rhizobium sp. R693 Isolate Nodule
441 8005321885 Rhizobium sp. R72 Isolate Nodule
442 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
443 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.15
Metatranscriptomes 0
Isolates 7.85

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 10.25
Nodule 2.3
Rhizoplane 4.39
Rhizosphere 74.48
Stem 0
Stem Tuber 0
Unclassified 8.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001232 3300001979 Bacteria 11577
2 JGI24740J21852_10002276 3300001979 Bacteria 8731
3 JGI24739J22299_10011198 3300001989 Bacteria 3313
4 JGI24739J22299_10012889 3300001989 Bacteria 3062
5 JGI24735J21928_10004904 3300002067 Bacteria 4460
6 JGI24735J21928_10009146 3300002067 Bacteria 3188
7 JGI24735J21928_10009735 3300002067 Bacteria 3078
8 JGI24735J21928_10033867 3300002067 Bacteria 1508
9 JGI24744J21845_10000200 3300002077 Bacteria 9234
10 JGI25162J39368_1000322 3300002737 Bacteria 42100
11 JGI25152J39213_1000557 3300002773 Bacteria 20439
12 JGI25152J39213_1000784 3300002773 Bacteria 15967
13 JGI25152J39213_1007244 3300002773 Bacteria 2898
14 JGI25150J39212_1000119 3300002774 Bacteria 44099
15 JGI25159J45721_1005825 3300002987 Bacteria 3804
16 JGI25151J46595_10000007 3300003187 Bacteria 411751
17 JGI25151J46595_10000834 3300003187 Bacteria 24587
18 JGI25406J46586_10010542 3300003203 Bacteria 4096
19 JGI25165J46597_1000248 3300003214 Bacteria 73257
20 JGI25153J46596_10001312 3300003215 Bacteria 14885
21 JGI25153J46596_10023166 3300003215 Bacteria 2269
22 rootL2_10065467 3300003322 Bacteria 2313
23 rootH1_10100938 3300003323 Bacteria 10599
24 rootH1_10247060 3300003323 Bacteria 2449
25 rootH1_10287660 3300003323 Bacteria 1514
26 Ga0055526_1010747 3300003771 Bacteria 4220
27 Ga0055526_1011964 3300003771 Bacteria 3842
28 Ga0055537_1000646 3300003773 Bacteria 18512
29 Ga0055524_1009262 3300003775 Bacteria 4026
30 Ga0055524_1012966 3300003775 Bacteria 3170
31 Ga0055528_1001758 3300003790 Bacteria 12475
32 Ga0055528_1002895 3300003790 Bacteria 8922
33 Ga0055528_1012540 3300003790 Bacteria 3280
34 Ga0055530_10000082 3300003791 Bacteria 81812
35 Ga0055530_10001087 3300003791 Bacteria 21357
36 Ga0055531_10000012 3300003794 Bacteria 191187
37 Ga0065165_1001607 3300005262 Bacteria 23108
38 Ga0070658_10016871 3300005327 Bacteria 5845
39 Ga0070658_10021683 3300005327 Bacteria 5149
40 Ga0070658_10076002 3300005327 Bacteria 2755
41 Ga0070658_10107708 3300005327 Bacteria 2306
42 Ga0070658_10159433 3300005327 Bacteria 1892
43 Ga0070676_10076204 3300005328 Bacteria 2024
44 Ga0070683_100005325 3300005329 Bacteria 10726
45 Ga0070683_100075480 3300005329 Bacteria 3149
46 Ga0070690_100004330 3300005330 Bacteria 7872
47 Ga0070670_100052588 3300005331 Bacteria 3497
48 Ga0070670_100056212 3300005331 Bacteria 3377
49 Ga0070670_100126192 3300005331 Unclassified 2209
50 Ga0070677_10011562 3300005333 Bacteria 3048
51 Ga0070677_10062094 3300005333 Bacteria 1544
52 Ga0068869_100548347 3300005334 Bacteria 971
53 Ga0070666_10007359 3300005335 Bacteria 6784
54 Ga0070666_10014250 3300005335 Bacteria 5060
55 Ga0070666_10034931 3300005335 Bacteria 3332
56 Ga0070666_10149040 3300005335 Bacteria 1632
57 Ga0070680_100000896 3300005336 Bacteria 21045
58 Ga0070680_100027734 3300005336 Bacteria 4537
59 Ga0068868_100153899 3300005338 Bacteria 1895
60 Ga0070660_100012465 3300005339 Bacteria 6072
61 Ga0070660_100032761 3300005339 Bacteria 3913
62 Ga0070660_100161342 3300005339 Bacteria 1806
63 Ga0070660_100266824 3300005339 Bacteria 1399
64 Ga0070691_10000243 3300005341 Bacteria 18635
65 Ga0070661_100000114 3300005344 Bacteria 67216
66 Ga0070661_100007497 3300005344 Bacteria 7528
67 Ga0070661_100017301 3300005344 Bacteria 5112
68 Ga0070661_100046420 3300005344 Bacteria 3177
69 Ga0070661_100096305 3300005344 Bacteria 2196
70 Ga0070661_100274019 3300005344 Bacteria 1307
71 Ga0070661_100278344 3300005344 Bacteria 1297
72 Ga0070668_100072978 3300005347 Bacteria 2675
73 Ga0070668_100117672 3300005347 Bacteria 2121
74 Ga0070668_100207109 3300005347 Bacteria 1612
75 Ga0070669_100104748 3300005353 Bacteria 2139
76 Ga0070669_100322345 3300005353 Bacteria 1248
77 Ga0070675_100004750 3300005354 Bacteria 10371
78 Ga0070675_100101476 3300005354 Bacteria 2424
79 Ga0070671_100013084 3300005355 Bacteria 6686
80 Ga0070671_100021902 3300005355 Bacteria 5220
81 Ga0070671_100051862 3300005355 Bacteria 3411
82 Ga0070671_100165356 3300005355 Bacteria 1871
83 Ga0070674_100009553 3300005356 Bacteria 5809
84 Ga0070674_100116810 3300005356 Bacteria 1969
85 Ga0070674_100231453 3300005356 Bacteria 1442
86 Ga0070673_100011648 3300005364 Bacteria 6008
87 Ga0070673_100076810 3300005364 Bacteria 2698
88 Ga0070673_100303197 3300005364 Bacteria 1407
89 Ga0070659_100006154 3300005366 Bacteria 8662
90 Ga0070659_100027988 3300005366 Bacteria 4348
91 Ga0070659_100029874 3300005366 Bacteria 4214
92 Ga0070659_100036187 3300005366 Bacteria 3847
93 Ga0070667_100051710 3300005367 Bacteria 3464
94 Ga0070667_100060515 3300005367 Bacteria 3204
95 Ga0070667_100097175 3300005367 Bacteria 2540
96 Ga0070714_100051080 3300005435 Bacteria 3524
97 Ga0070714_100106170 3300005435 Bacteria 2481
98 Ga0070714_100204275 3300005435 Bacteria 1808
99 Ga0070663_100056616 3300005455 Bacteria 2810
100 Ga0070663_100141264 3300005455 Bacteria 1839
101 Ga0070663_100275765 3300005455 Bacteria 1338
102 Ga0070678_100011116 3300005456 Bacteria 5538
103 Ga0070678_100026944 3300005456 Bacteria 3894
104 Ga0070678_100142327 3300005456 Bacteria 1921
105 Ga0070662_100005842 3300005457 Bacteria 7898
106 Ga0070662_100016221 3300005457 Bacteria 4999
107 Ga0070662_100016262 3300005457 Bacteria 4993
108 Ga0070662_100076892 3300005457 Bacteria 2476
109 Ga0070662_100154096 3300005457 Bacteria 1792
110 Ga0070662_100191359 3300005457 Bacteria 1618
111 Ga0070662_100261332 3300005457 Bacteria 1395
112 Ga0070681_10001905 3300005458 Bacteria 18821
113 Ga0068867_100022953 3300005459 Bacteria 4464
114 Ga0068867_100044237 3300005459 Bacteria 3261
115 Ga0068867_100097356 3300005459 Bacteria 2242
116 Ga0070679_100000084 3300005530 Bacteria 70823
117 Ga0070679_100065796 3300005530 Bacteria 3613
118 Ga0070679_100197098 3300005530 Bacteria 1981
119 Ga0070679_100400011 3300005530 Bacteria 1319
120 Ga0070684_100099624 3300005535 Bacteria 2594
121 Ga0068853_100007461 3300005539 Bacteria 8754
122 Ga0068853_100303291 3300005539 Bacteria 1477
123 Ga0068853_100518696 3300005539 Bacteria 1126
124 Ga0070672_100001479 3300005543 Bacteria 14586
125 Ga0070672_100027362 3300005543 Bacteria 4252
126 Ga0070672_100056292 3300005543 Bacteria 3083
127 Ga0070665_100004829 3300005548 Bacteria 14002
128 Ga0070665_100025110 3300005548 Bacteria 6005
129 Ga0070665_100133769 3300005548 Bacteria 2481
130 Ga0070665_100203399 3300005548 Bacteria 1980
131 Ga0070665_100225279 3300005548 Bacteria 1875
132 Ga0070665_100236395 3300005548 Bacteria 1828
133 Ga0068855_100510988 3300005563 Unclassified 1305
134 Ga0070664_100005462 3300005564 Bacteria 10202
135 Ga0070664_100014140 3300005564 Bacteria 6511
136 Ga0070664_100030890 3300005564 Bacteria 4471
137 Ga0070664_100194836 3300005564 Bacteria 1806
138 Ga0070664_100372620 3300005564 Bacteria 1302
139 Ga0070664_100472244 3300005564 Bacteria 1153
140 Ga0070664_100543573 3300005564 Bacteria 1074
141 Ga0068857_100012566 3300005577 Bacteria 7375
142 Ga0068857_100061853 3300005577 Bacteria 3327
143 Ga0068857_100270538 3300005577 Bacteria 1561
144 Ga0068854_100003724 3300005578 Bacteria 9537
145 Ga0068856_100024453 3300005614 Bacteria 5881
146 Ga0068856_100077106 3300005614 Bacteria 3302
147 Ga0068856_100268147 3300005614 Bacteria 1723
148 Ga0068856_100653785 3300005614 Bacteria 1072
149 Ga0068852_100005727 3300005616 Bacteria 8912
150 Ga0068852_100007056 3300005616 Bacteria 8182
151 Ga0068852_100122427 3300005616 Unclassified 2384
152 Ga0068852_100308098 3300005616 Bacteria 1535
153 Ga0068852_100397856 3300005616 Bacteria 1354
154 Ga0068859_100040456 3300005617 Bacteria 4679
155 Ga0068864_100000487 3300005618 Bacteria 34323
156 Ga0068864_100043457 3300005618 Bacteria 3848
157 Ga0068864_100078492 3300005618 Bacteria 2889
158 Ga0068866_10007066 3300005718 Bacteria 4693
159 Ga0068851_10009633 3300005834 Bacteria 4497
160 Ga0068851_10022060 3300005834 Bacteria 3098
161 Ga0068851_10164207 3300005834 Bacteria 1222
162 Ga0068863_100060266 3300005841 Bacteria 3589
163 Ga0068858_100030052 3300005842 Bacteria 5045
164 Ga0068860_100134317 3300005843 Bacteria 2376
165 Ga0068862_100541626 3300005844 Bacteria 1110
166 Ga0081540_1028100 3300005983 Bacteria 3168
167 Ga0081539_10000038 3300005985 Bacteria 296079
168 Ga0075365_10015038 3300006038 Bacteria 4671
169 Ga0075365_10107863 3300006038 Bacteria 1912
170 Ga0075368_10014911 3300006042 Bacteria 2877
171 Ga0075367_10001368 3300006178 Bacteria 10395
172 Ga0075367_10021130 3300006178 Bacteria 3634
173 Ga0075367_10070893 3300006178 Bacteria 2096
174 Ga0075369_10003078 3300006186 Bacteria 6039
175 Ga0075369_10039051 3300006186 Bacteria 2026
176 Ga0075369_10039943 3300006186 Bacteria 2004
177 Ga0075370_10176661 3300006353 Bacteria 1256
178 Ga0068871_100239414 3300006358 Bacteria 1577
179 Ga0068865_100285155 3300006881 Bacteria 1316
180 Ga0097620_100040456 3300006931 Bacteria 4679
181 Ga0105251_10029906 3300009011 Bacteria 2740
182 Ga0105251_10034833 3300009011 Bacteria 2488
183 Ga0105244_10147377 3300009036 Bacteria 1129
184 Ga0105240_10021229 3300009093 Bacteria 8644
185 Ga0105240_10124835 3300009093 Bacteria 3095
186 Ga0105240_10219562 3300009093 Bacteria 2216
187 Ga0111539_10119724 3300009094 Bacteria 3085
188 Ga0111539_10721864 3300009094 Bacteria 1160
189 Ga0105245_10031632 3300009098 Bacteria 4684
190 Ga0105245_10183385 3300009098 Bacteria 2001
191 Ga0105245_10202837 3300009098 Bacteria 1905
192 Ga0105245_10322338 3300009098 Bacteria 1522
193 Ga0105247_10125008 3300009101 Bacteria 1671
194 Ga0105243_10022964 3300009148 Bacteria 4744
195 Ga0105243_10183355 3300009148 Bacteria 1822
196 Ga0105241_10101119 3300009174 Bacteria 2292
197 Ga0105241_10106735 3300009174 Bacteria 2235
198 Ga0105242_10112065 3300009176 Bacteria 2327
199 Ga0105242_10382834 3300009176 Bacteria 1308
200 Ga0105242_10765998 3300009176 Bacteria 952
201 Ga0105248_10001528 3300009177 Bacteria 25762
202 Ga0105248_10019256 3300009177 Bacteria 7552
203 Ga0105248_10023155 3300009177 Bacteria 6898
204 Ga0105248_10027431 3300009177 Bacteria 6341
205 Ga0105248_10286789 3300009177 Bacteria 1854
206 Ga0105248_10291577 3300009177 Bacteria 1837
207 Ga0105248_10613417 3300009177 Unclassified 1227
208 Ga0105237_10053612 3300009545 Bacteria 4044
209 Ga0105237_10392298 3300009545 Bacteria 1393
210 Ga0105238_10006858 3300009551 Bacteria 11373
211 Ga0105238_10079714 3300009551 Bacteria 3264
212 Ga0105249_10152102 3300009553 Bacteria 2229
213 Ga0105249_10160730 3300009553 Bacteria 2171
214 Ga0105249_10460336 3300009553 Unclassified 1312
215 Ga0105239_10039797 3300010375 Bacteria 5151
216 Ga0105239_10075638 3300010375 Bacteria 3703
217 Ga0105239_10275202 3300010375 Bacteria 1894
218 Ga0105239_10379452 3300010375 Bacteria 1598
219 Ga0157373_10024150 3300013100 Bacteria 4406
220 Ga0157373_10034558 3300013100 Bacteria 3630
221 Ga0157373_10194325 3300013100 Bacteria 1430
222 Ga0157371_10005134 3300013102 Bacteria 11163
223 Ga0157371_10024538 3300013102 Bacteria 4401
224 Ga0157371_10059690 3300013102 Bacteria 2704
225 Ga0157371_10124599 3300013102 Bacteria 1832
226 Ga0157371_10180469 3300013102 Bacteria 1510
227 Ga0157371_10307491 3300013102 Bacteria 1148
228 Ga0157371_10405516 3300013102 Bacteria 998
229 Ga0157370_10005211 3300013104 Bacteria 14650
230 Ga0157370_10102902 3300013104 Bacteria 2673
231 Ga0157369_10010073 3300013105 Bacteria 10792
232 Ga0157369_10058693 3300013105 Bacteria 4151
233 Ga0157369_10120004 3300013105 Bacteria 2790
234 Ga0157369_10126147 3300013105 Unclassified 2713
235 Ga0157369_10175271 3300013105 Bacteria 2258
236 Ga0157369_10187962 3300013105 Bacteria 2171
237 Ga0157369_10308625 3300013105 Bacteria 1645
238 Ga0157369_10324562 3300013105 Bacteria 1600
239 Ga0157374_10316770 3300013296 Bacteria 1545
240 Ga0157378_10058402 3300013297 Bacteria 3441
241 Ga0157378_10182842 3300013297 Bacteria 1973
242 Ga0157378_10483429 3300013297 Unclassified 1234
243 Ga0163162_10387233 3300013306 Unclassified 1531
244 Ga0157372_10026759 3300013307 Bacteria 6278
245 Ga0163163_10047514 3300014325 Bacteria 4220
246 Ga0163163_10212719 3300014325 Bacteria 1982
247 Ga0157380_10505272 3300014326 Bacteria 1175
248 Ga0157379_10422937 3300014968 Unclassified 1227
249 Ga0157376_10048842 3300014969 Bacteria 3503
250 Ga0163161_10026938 3300017792 Bacteria 4075
251 Ga0214544_1000017 3300021320 Bacteria 193638
252 Ga0214542_1000006 3300021321 Bacteria 345164
253 Ga0214543_1000014 3300021327 Bacteria 324986
254 Ga0213873_10000013 3300021358 Bacteria 206227
255 Ga0213876_10000072 3300021384 Bacteria 123469
256 Ga0213876_10006514 3300021384 Bacteria 6364
257 Ga0213876_10010220 3300021384 Bacteria 5041
258 Ga0209563_101879 3300025230 Bacteria 5091
259 Ga0209437_100040 3300025233 Bacteria 448096
260 Ga0207425_1000018 3300025245 Bacteria 411841
261 Ga0209759_1003548 3300025256 Bacteria 6177
262 Ga0209129_1000026 3300025258 Bacteria 411839
263 Ga0209129_1001054 3300025258 Bacteria 16280
264 Ga0209129_1005221 3300025258 Bacteria 4705
265 Ga0209233_1000051 3300025261 Bacteria 447617
266 Ga0209565_1000118 3300025263 Bacteria 113196
267 Ga0209673_1001150 3300025273 Bacteria 28906
268 Ga0209673_1015890 3300025273 Bacteria 2837
269 Ga0209673_1021733 3300025273 Bacteria 2235
270 Ga0209130_1001632 3300025284 Bacteria 13770
271 Ga0209675_1011805 3300025291 Bacteria 2869
272 Ga0209025_1000035 3300025294 Bacteria 411841
273 Ga0209025_1001871 3300025294 Bacteria 24663
274 Ga0209025_1009341 3300025294 Bacteria 6857
275 Ga0209564_1005948 3300025295 Bacteria 6757
276 Ga0209564_1007331 3300025295 Bacteria 5721
277 Ga0209758_1000040 3300025297 Bacteria 411841
278 Ga0209758_1000835 3300025297 Bacteria 42973
279 Ga0209758_1011719 3300025297 Bacteria 5034
280 Ga0209758_1018810 3300025297 Bacteria 3366
281 Ga0209758_1033961 3300025297 Bacteria 2038
282 Ga0209758_1035188 3300025297 Bacteria 1977
283 Ga0209050_1000039 3300025298 Bacteria 410069
284 Ga0209256_1011665 3300025299 Bacteria 3480
285 Ga0209256_1025930 3300025299 Bacteria 1699
286 Ga0207426_1000182 3300025302 Bacteria 155724
287 Ga0207426_1001984 3300025302 Bacteria 14503
288 Ga0207426_1002244 3300025302 Bacteria 12860
289 Ga0209257_1000051 3300025304 Bacteria 434166
290 Ga0209257_1000506 3300025304 Bacteria 68402
291 Ga0207697_10027588 3300025315 Bacteria 2322
292 Ga0207656_10006046 3300025321 Bacteria 4329
293 Ga0207656_10007905 3300025321 Bacteria 3896
294 Ga0207682_10006032 3300025893 Bacteria 4900
295 Ga0207682_10032212 3300025893 Bacteria 2107
296 Ga0207688_10002384 3300025901 Bacteria 10114
297 Ga0207680_10005418 3300025903 Bacteria 6097
298 Ga0207680_10044350 3300025903 Bacteria 2614
299 Ga0207647_10000769 3300025904 Bacteria 25007
300 Ga0207647_10001347 3300025904 Bacteria 18861
301 Ga0207647_10002711 3300025904 Bacteria 13377
302 Ga0207647_10021746 3300025904 Bacteria 4275
303 Ga0207647_10145577 3300025904 Unclassified 1387
304 Ga0207705_10009397 3300025909 Bacteria 7110
305 Ga0207705_10016966 3300025909 Bacteria 5215
306 Ga0207705_10086738 3300025909 Bacteria 2288
307 Ga0207705_10092501 3300025909 Bacteria 2216
308 Ga0207705_10103663 3300025909 Bacteria 2095
309 Ga0207705_10118753 3300025909 Bacteria 1960
310 Ga0207705_10121531 3300025909 Bacteria 1938
311 Ga0207705_10158675 3300025909 Bacteria 1698
312 Ga0207707_10005427 3300025912 Bacteria 11146
313 Ga0207695_10009389 3300025913 Bacteria 12098
314 Ga0207695_10088474 3300025913 Bacteria 3117
315 Ga0207695_10098981 3300025913 Bacteria 2914
316 Ga0207671_10267299 3300025914 Bacteria 1347
317 Ga0207660_10000951 3300025917 Bacteria 19171
318 Ga0207660_10011228 3300025917 Bacteria 5826
319 Ga0207660_10065921 3300025917 Bacteria 2618
320 Ga0207662_10060289 3300025918 Bacteria 2275
321 Ga0207657_10003509 3300025919 Bacteria 16744
322 Ga0207657_10007321 3300025919 Bacteria 11322
323 Ga0207657_10034689 3300025919 Bacteria 4534
324 Ga0207657_10048872 3300025919 Bacteria 3691
325 Ga0207657_10081899 3300025919 Bacteria 2710
326 Ga0207657_10083170 3300025919 Bacteria 2686
327 Ga0207657_10096625 3300025919 Bacteria 2457
328 Ga0207657_10281457 3300025919 Bacteria 1320
329 Ga0207649_10000011 3300025920 Bacteria 266219
330 Ga0207649_10005260 3300025920 Bacteria 6996
331 Ga0207649_10010641 3300025920 Bacteria 5058
332 Ga0207649_10018955 3300025920 Bacteria 3926
333 Ga0207649_10200544 3300025920 Bacteria 1409
334 Ga0207649_10235117 3300025920 Bacteria 1312
335 Ga0207652_10000001 3300025921 Bacteria 1006643
336 Ga0207652_10000002 3300025921 Bacteria 878035
337 Ga0207652_10141214 3300025921 Bacteria 2153
338 Ga0207652_10167226 3300025921 Bacteria 1972
339 Ga0207681_10162389 3300025923 Bacteria 1685
340 Ga0207681_10182879 3300025923 Bacteria 1598
341 Ga0207694_10012853 3300025924 Bacteria 6305
342 Ga0207694_10026522 3300025924 Bacteria 4408
343 Ga0207650_10068784 3300025925 Bacteria 2660
344 Ga0207650_10169574 3300025925 Bacteria 1734
345 Ga0207650_10374292 3300025925 Bacteria 1175
346 Ga0207659_10018045 3300025926 Bacteria 4619
347 Ga0207659_10019430 3300025926 Bacteria 4473
348 Ga0207687_10055397 3300025927 Bacteria 2779
349 Ga0207700_10122472 3300025928 Bacteria 2111
350 Ga0207664_10644988 3300025929 Bacteria 952
351 Ga0207644_10001523 3300025931 Bacteria 14942
352 Ga0207644_10013384 3300025931 Bacteria 5467
353 Ga0207644_10030632 3300025931 Bacteria 3743
354 Ga0207644_10095824 3300025931 Bacteria 2220
355 Ga0207644_10139090 3300025931 Bacteria 1868
356 Ga0207690_10001973 3300025932 Bacteria 12564
357 Ga0207690_10005548 3300025932 Bacteria 7449
358 Ga0207690_10014564 3300025932 Bacteria 4750
359 Ga0207690_10028343 3300025932 Bacteria 3549
360 Ga0207690_10038777 3300025932 Bacteria 3103
361 Ga0207690_10074543 3300025932 Bacteria 2351
362 Ga0207690_10104614 3300025932 Bacteria 2028
363 Ga0207690_10242763 3300025932 Bacteria 1388
364 Ga0207690_10243789 3300025932 Bacteria 1385
365 Ga0207706_10002853 3300025933 Bacteria 16775
366 Ga0207706_10005711 3300025933 Bacteria 11589
367 Ga0207706_10016430 3300025933 Bacteria 6681
368 Ga0207706_10024238 3300025933 Bacteria 5440
369 Ga0207706_10025153 3300025933 Bacteria 5337
370 Ga0207706_10078497 3300025933 Bacteria 2903
371 Ga0207706_10148231 3300025933 Bacteria 2064
372 Ga0207706_10464812 3300025933 Bacteria 1094
373 Ga0207686_10010042 3300025934 Bacteria 5150
374 Ga0207669_10016893 3300025937 Bacteria 3726
375 Ga0207669_10053759 3300025937 Bacteria 2428
376 Ga0207669_10158452 3300025937 Unclassified 1595
377 Ga0207669_10213230 3300025937 Bacteria 1411
378 Ga0207691_10004286 3300025940 Bacteria 13860
379 Ga0207691_10012677 3300025940 Bacteria 8074
380 Ga0207691_10013663 3300025940 Bacteria 7758
381 Ga0207691_10045971 3300025940 Bacteria 4013
382 Ga0207691_10158714 3300025940 Bacteria 1985
383 Ga0207711_10000345 3300025941 Bacteria 49338
384 Ga0207711_10004198 3300025941 Bacteria 12335
385 Ga0207711_10045263 3300025941 Bacteria 3761
386 Ga0207711_10051289 3300025941 Bacteria 3533
387 Ga0207711_10059324 3300025941 Bacteria 3294
388 Ga0207711_10161344 3300025941 Bacteria 2029
389 Ga0207711_10223058 3300025941 Bacteria 1725
390 Ga0207711_10242777 3300025941 Bacteria 1652
391 Ga0207689_10090834 3300025942 Bacteria 2509
392 Ga0207661_10014283 3300025944 Bacteria 5816
393 Ga0207661_10027319 3300025944 Bacteria 4358
394 Ga0207661_10352254 3300025944 Bacteria 1328
395 Ga0207661_10657162 3300025944 Bacteria 964
396 Ga0207679_10013785 3300025945 Bacteria 5301
397 Ga0207679_10032616 3300025945 Bacteria 3659
398 Ga0207679_10056492 3300025945 Bacteria 2898
399 Ga0207679_10085503 3300025945 Bacteria 2423
400 Ga0207667_10016893 3300025949 Bacteria 8233
401 Ga0207667_10257889 3300025949 Bacteria 1783
402 Ga0207651_10013678 3300025960 Bacteria 4653
403 Ga0207651_10014971 3300025960 Bacteria 4493
404 Ga0207651_10017450 3300025960 Bacteria 4243
405 Ga0207651_10289845 3300025960 Bacteria 1357
406 Ga0207712_10089157 3300025961 Bacteria 2267
407 Ga0207668_10180833 3300025972 Bacteria 1663
408 Ga0207640_10002725 3300025981 Bacteria 9449
409 Ga0207640_10046671 3300025981 Bacteria 2789
410 Ga0207640_10193830 3300025981 Bacteria 1534
411 Ga0207658_10109899 3300025986 Bacteria 2177
412 Ga0207658_10309064 3300025986 Bacteria 1365
413 Ga0207677_10036297 3300026023 Bacteria 3211
414 Ga0207703_10038455 3300026035 Bacteria 3818
415 Ga0207639_10009043 3300026041 Bacteria 6863
416 Ga0207639_10188416 3300026041 Bacteria 1760
417 Ga0207639_10281952 3300026041 Unclassified 1462
418 Ga0207678_10002237 3300026067 Bacteria 17496
419 Ga0207678_10020591 3300026067 Bacteria 5783
420 Ga0207678_10037661 3300026067 Bacteria 4206
421 Ga0207678_10083862 3300026067 Bacteria 2726
422 Ga0207702_10017005 3300026078 Bacteria 6019
423 Ga0207702_10063343 3300026078 Bacteria 3161
424 Ga0207702_10122322 3300026078 Bacteria 2331
425 Ga0207702_10170427 3300026078 Bacteria 1996
426 Ga0207702_10247017 3300026078 Bacteria 1674
427 Ga0207641_10102045 3300026088 Bacteria 2529
428 Ga0207641_10281469 3300026088 Bacteria 1564
429 Ga0207648_10005937 3300026089 Bacteria 12213
430 Ga0207648_10016189 3300026089 Bacteria 6824
431 Ga0207648_10121101 3300026089 Bacteria 2301
432 Ga0207676_10014056 3300026095 Bacteria 5750
433 Ga0207676_10017609 3300026095 Bacteria 5180
434 Ga0207674_10005682 3300026116 Bacteria 14788
435 Ga0207674_10009767 3300026116 Bacteria 10931
436 Ga0207674_10068073 3300026116 Bacteria 3583
437 Ga0207674_10264394 3300026116 Bacteria 1668
438 Ga0207675_100120056 3300026118 Bacteria 2487
439 Ga0207683_10024569 3300026121 Bacteria 5190
440 Ga0207683_10040908 3300026121 Bacteria 4047
441 Ga0207683_10094928 3300026121 Bacteria 2658
442 Ga0207698_10005661 3300026142 Bacteria 7738
443 Ga0207698_10066124 3300026142 Bacteria 2844
444 Ga0207698_10070482 3300026142 Bacteria 2770
445 Ga0207698_10078488 3300026142 Bacteria 2651
446 Ga0207698_10329012 3300026142 Bacteria 1434
447 Ga0209371_1030682 3300027312 Bacteria 1175
448 Ga0209974_10069589 3300027876 Bacteria 1199
449 Ga0268266_10060804 3300028379 Bacteria 3257
450 Ga0268265_10604031 3300028380 Bacteria 1049
451 Ga0268264_10105978 3300028381 Bacteria 2453
452 Ga0307515_10017859 3300028794 Bacteria 12890
453 Ga0307515_10018412 3300028794 Bacteria 12641
454 Ga0307515_10324848 3300028794 Bacteria 1202
455 Ga0268256_1034886 3300030500 Bacteria 1175
456 Ga0307511_10066775 3300030521 Bacteria 2677
457 Ga0307513_10185070 3300031456 Bacteria 1941
458 Ga0307408_100215159 3300031548 Bacteria 1564
459 Ga0307408_100231749 3300031548 Bacteria 1513
460 Ga0307508_10103537 3300031616 Bacteria 2443
461 Ga0307405_10014708 3300031731 Bacteria 4217
462 Ga0307405_10015120 3300031731 Bacteria 4170
463 Ga0307405_10034239 3300031731 Bacteria 3020
464 Ga0307413_10011924 3300031824 Bacteria 4300
465 Ga0307413_10033469 3300031824 Bacteria 2927
466 Ga0307413_10211771 3300031824 Bacteria 1408
467 Ga0307410_10000658 3300031852 Bacteria 14276
468 Ga0307410_10003486 3300031852 Bacteria 7899
469 Ga0307410_10059009 3300031852 Bacteria 2618
470 Ga0307410_10062340 3300031852 Bacteria 2554
471 Ga0307410_10104777 3300031852 Bacteria 2034
472 Ga0307410_10134767 3300031852 Bacteria 1819
473 Ga0307410_10141484 3300031852 Bacteria 1780
474 Ga0307410_10558877 3300031852 Bacteria 949
475 Ga0307406_10007490 3300031901 Bacteria 6055
476 Ga0307406_10036793 3300031901 Bacteria 3018
477 Ga0307407_10038425 3300031903 Bacteria 2653
478 Ga0307407_10088067 3300031903 Bacteria 1896
479 Ga0307407_10170308 3300031903 Bacteria 1433
480 Ga0307407_10270566 3300031903 Bacteria 1172
481 Ga0307412_10017634 3300031911 Bacteria 4276
482 Ga0307412_10040067 3300031911 Bacteria 3030
483 Ga0307412_10046028 3300031911 Bacteria 2856
484 Ga0307412_10226097 3300031911 Bacteria 1438
485 Ga0307409_100016764 3300031995 Bacteria 4860
486 Ga0307409_100115037 3300031995 Bacteria 2264
487 Ga0307409_100146291 3300031995 Bacteria 2044
488 Ga0307409_100299651 3300031995 Bacteria 1495
489 Ga0307409_100616950 3300031995 Bacteria 1074
490 Ga0307416_100052040 3300032002 Bacteria 3276
491 Ga0307416_100129195 3300032002 Bacteria 2270
492 Ga0307414_10020719 3300032004 Bacteria 4105
493 Ga0307414_10026608 3300032004 Bacteria 3726
494 Ga0307414_10039495 3300032004 Bacteria 3179
495 Ga0307414_10042888 3300032004 Bacteria 3077
496 Ga0307414_10078994 3300032004 Bacteria 2400
497 Ga0307414_10101051 3300032004 Bacteria 2170
498 Ga0307414_10461471 3300032004 Bacteria 1116
499 Ga0307411_10003235 3300032005 Bacteria 7505
500 Ga0307411_10006548 3300032005 Bacteria 5839
501 Ga0307411_10007485 3300032005 Bacteria 5569
502 Ga0307411_10020260 3300032005 Bacteria 3863
503 Ga0307411_10034980 3300032005 Bacteria 3132
504 Ga0307411_10060021 3300032005 Bacteria 2523
505 Ga0307411_10224071 3300032005 Bacteria 1461
506 Ga0307415_100003615 3300032126 Bacteria 7900
507 Ga0307415_100184902 3300032126 Bacteria 1639
508 Ga0307510_10000007 3300033180 Bacteria 558582
509 Ga0373936_0012860 3300035113 Bacteria 3190
510 Ga0373946_0070630 3300035171 Bacteria 1507
511 Ga0373946_0090533 3300035171 Bacteria 1355
512 Ga0395899_0000007 3300037312 Bacteria 629129
513 Ga0395899_0006239 3300037312 Bacteria 9235
514 Ga0395899_0067713 3300037312 Bacteria 2619
515 Ga0395899_0092635 3300037312 Bacteria 2188
516 Ga0395899_0122140 3300037312 Bacteria 1864
517 Ga0395900_0000026 3300037418 Bacteria 313470
518 Ga0395900_0000849 3300037418 Bacteria 40245
519 Ga0395900_0020627 3300037418 Bacteria 6733
520 Ga0395900_0029935 3300037418 Bacteria 5587
521 Ga0395900_0057163 3300037418 Bacteria 4016
522 Ga0395900_0068757 3300037418 Bacteria 3640
523 Ga0395900_0100913 3300037418 Bacteria 2964
524 Ga0395900_0105335 3300037418 Bacteria 2897
525 Ga0395900_0116182 3300037418 Bacteria 2745
526 Ga0395900_0123764 3300037418 Bacteria 2652
527 Ga0395900_0128884 3300037418 Bacteria 2593
528 Ga0395900_0130943 3300037418 Bacteria 2571
529 Ga0395900_0235325 3300037418 Bacteria 1840
530 Ga0395900_0281293 3300037418 Bacteria 1655
531 Ga0395900_0339800 3300037418 Bacteria 1477
532 Ga0395900_0503779 3300037418 Bacteria 1161
533 Ga0395898_0000085 3300037466 Bacteria 240992
534 Ga0395898_0035607 3300037466 Bacteria 4948
535 Ga0395898_0047421 3300037466 Bacteria 4216
536 Ga0395898_0072874 3300037466 Bacteria 3317
537 Ga0395898_0216568 3300037466 Bacteria 1826
538 Ga0395905_0000519 3300037471 Bacteria 52760
539 Ga0395905_0002257 3300037471 Bacteria 21639
540 Ga0395905_0005730 3300037471 Bacteria 12630
541 Ga0395905_0009882 3300037471 Bacteria 9299
542 Ga0395905_0013679 3300037471 Bacteria 7772
543 Ga0395905_0030896 3300037471 Bacteria 5044
544 Ga0395905_0047940 3300037471 Bacteria 4003
545 Ga0395905_0055365 3300037471 Bacteria 3712
546 Ga0395905_0102121 3300037471 Bacteria 2692
547 Ga0395905_0111374 3300037471 Bacteria 2570
548 Ga0395905_0152432 3300037471 Bacteria 2174
549 Ga0395905_0159507 3300037471 Bacteria 2120
550 Ga0395905_0161390 3300037471 Bacteria 2106
551 Ga0395905_0201968 3300037471 Bacteria 1863
552 Ga0395905_0225800 3300037471 Bacteria 1752
553 Ga0395905_0277318 3300037471 Bacteria 1562
554 Ga0395905_0308493 3300037471 Bacteria 1471
555 Ga0395905_0342111 3300037471 Bacteria 1387
556 Ga0395905_0365567 3300037471 Bacteria 1336
557 Ga0395905_0372548 3300037471 Bacteria 1321
558 Ga0436364_1438839 3300037853 Bacteria 7181
559 Ga0395901_0006625 3300038443 Bacteria 11701
560 Ga0395901_0023196 3300038443 Bacteria 6361
561 Ga0395901_0046562 3300038443 Bacteria 4505
562 Ga0395901_0060245 3300038443 Bacteria 3949
563 Ga0395901_0108404 3300038443 Bacteria 2915
564 Ga0395901_0178969 3300038443 Bacteria 2224
565 Ga0395901_0260621 3300038443 Bacteria 1804
566 Ga0395901_0285899 3300038443 Bacteria 1712
567 Ga0395901_0394036 3300038443 Bacteria 1423
568 Ga0395901_0522312 3300038443 Bacteria 1206
569 Ga0395901_0684975 3300038443 Bacteria 1024
570 Ga0436365_0044388 3300039437 Bacteria 123489
571 Ga0436365_0256427 3300039437 Bacteria 9558
572 Ga0436362_1051662 3300039453 Bacteria 138391
573 Ga0439436_0038446 3300041404 Bacteria 1376
574 Ga0439461_0000171 3300041410 Bacteria 8872
575 Ga0439465_0000356 3300041413 Bacteria 13110
576 Ga0451789_0805958 3300041443 Bacteria 1974
577 Ga0439431_0000437 3300041997 Bacteria 8834
578 Ga0439431_0008149 3300041997 Bacteria 2351
579 Ga0439431_0047518 3300041997 Bacteria 1107
580 Ga0439442_000878 3300042002 Bacteria 6192
581 Ga0439445_0000176 3300042004 Bacteria 11385
582 Ga0439432_000215 3300042006 Bacteria 20677
583 Ga0439452_012403 3300042010 Bacteria 2426
584 Ga0439455_0005448 3300042012 Bacteria 2587
585 Ga0450907_008880 3300042146 Bacteria 1667
586 Ga0439458_0000153 3300042157 Bacteria 15161
587 Ga0439434_0010753 3300042435 Bacteria 2700
588 Ga0439435_0106492 3300042436 Bacteria 866
589 Ga0466969_0001617 3300044656 Bacteria 12070
590 Ga0466969_0025519 3300044656 Bacteria 3037
591 Ga0466969_0183248 3300044656 Bacteria 958
592 Ga0466966_0000143 3300044684 Bacteria 45651
593 Ga0466966_0000492 3300044684 Bacteria 25352
594 Ga0466966_0033607 3300044684 Bacteria 3320
595 Ga0466966_0057894 3300044684 Bacteria 2450
596 Ga0466961_0000301 3300044693 Bacteria 32898
597 Ga0466961_0000868 3300044693 Bacteria 18843
598 Ga0466961_0047964 3300044693 Bacteria 2730
599 Ga0466961_0054737 3300044693 Bacteria 2544
600 Ga0466963_0007629 3300044694 Bacteria 6457
601 Ga0466963_0028365 3300044694 Bacteria 3593
602 Ga0466963_0039798 3300044694 Bacteria 3080
603 Ga0466963_0058547 3300044694 Bacteria 2569
604 Ga0466963_0090938 3300044694 Bacteria 2078
605 Ga0466963_0179827 3300044694 Bacteria 1476
606 Ga0453684_0224176 3300044712 Bacteria 2175
607 Ga0466971_0000632 3300044719 Bacteria 14039
608 Ga0466957_0013744 3300044842 Bacteria 4702
609 Ga0466957_0024784 3300044842 Bacteria 3553
610 Ga0466957_0033496 3300044842 Bacteria 3082
611 Ga0466957_0056737 3300044842 Bacteria 2395
612 Ga0466957_0087640 3300044842 Bacteria 1946
613 Ga0466957_0107267 3300044842 Bacteria 1768
614 Ga0466957_0177495 3300044842 Bacteria 1390
615 Ga0466960_0031638 3300044901 Bacteria 2443
616 Ga0466960_0115223 3300044901 Bacteria 1401
617 Ga0466959_0000511 3300045049 Bacteria 22572
618 Ga0466959_0035270 3300045049 Bacteria 3701
619 Ga0466959_0067777 3300045049 Bacteria 2586
620 Ga0466959_0194664 3300045049 Bacteria 1414
621 Ga0451576_0157512 3300045051 Bacteria 2369
622 Ga0466958_0000818 3300045836 Bacteria 13744
623 Ga0466958_0003818 3300045836 Bacteria 7868
624 Ga0466958_0014464 3300045836 Bacteria 4506
625 Ga0466958_0058042 3300045836 Unclassified 2353
626 Ga0466958_0106886 3300045836 Bacteria 1745
627 Ga0466958_0340064 3300045836 Bacteria 965
628 Ga0466967_0016590 3300045976 Bacteria 5816
629 Ga0466967_0046786 3300045976 Bacteria 3769
630 Ga0466967_0077393 3300045976 Bacteria 2994
631 Ga0466967_0078287 3300045976 Bacteria 2978
632 Ga0466967_0132819 3300045976 Bacteria 2312
633 Ga0466967_0179519 3300045976 Bacteria 1996
634 Ga0466967_0247942 3300045976 Bacteria 1700
635 Ga0466967_0369298 3300045976 Bacteria 1391
636 Ga0495617_000003 3300046452 Bacteria 541914
637 Ga0495592_0008744 3300046454 Bacteria 7603
638 Ga0495603_0136563 3300046455 Bacteria 1427
639 Ga0495590_0037793 3300046457 Bacteria 1683
640 Ga0495591_003143 3300046458 Bacteria 8724
641 Ga0495629_0035464 3300046459 Bacteria 3524
642 Ga0495638_0000552 3300046460 Bacteria 42693
643 Ga0495638_0001206 3300046460 Bacteria 24684
644 Ga0495638_0040724 3300046460 Bacteria 2943
645 Ga0495638_0058522 3300046460 Bacteria 2387
646 Ga0495638_0060759 3300046460 Bacteria 2336
647 Ga0495638_0075402 3300046460 Bacteria 2055
648 Ga0495651_0017339 3300046462 Bacteria 5577
649 Ga0495653_0020018 3300046463 Bacteria 5422
650 Ga0495653_0328559 3300046463 Bacteria 989
651 Ga0495650_0000069 3300046471 Bacteria 261124
652 Ga0495650_0000240 3300046471 Bacteria 109029
653 Ga0495650_0000417 3300046471 Bacteria 69289
654 Ga0495650_0061970 3300046471 Bacteria 1496
655 Ga0495582_0004825 3300046473 Bacteria 7567
656 Ga0495605_0000287 3300046474 Bacteria 55659
657 Ga0495662_0023700 3300046476 Bacteria 2964
658 Ga0495664_0009074 3300046477 Bacteria 5560
659 Ga0495584_0000026 3300046491 Bacteria 114028
660 Ga0495585_0001974 3300046492 Bacteria 15274
661 Ga0495585_0129036 3300046492 Bacteria 1332
662 Ga0495596_0001769 3300046500 Bacteria 12094
663 Ga0495607_0001107 3300046501 Bacteria 24522
664 Ga0495607_0009814 3300046501 Bacteria 6462
665 Ga0495583_0000141 3300046506 Bacteria 121899
666 Ga0495583_0016351 3300046506 Bacteria 3992
667 Ga0495606_0000147 3300046507 Bacteria 122261
668 Ga0495606_0001676 3300046507 Bacteria 28604
669 Ga0495606_0004031 3300046507 Bacteria 14979
670 Ga0495606_0011517 3300046507 Bacteria 7206
671 Ga0495606_0113420 3300046507 Bacteria 1632
672 Ga0495608_0004834 3300046511 Bacteria 9629
673 Ga0495610_0000003 3300046512 Bacteria 1203910
674 Ga0495610_0000378 3300046512 Bacteria 45991
675 Ga0495610_0001931 3300046512 Bacteria 17864
676 Ga0495610_0008022 3300046512 Bacteria 6912
677 Ga0495610_0083620 3300046512 Bacteria 1460
678 Ga0495618_0071975 3300046514 Bacteria 2199
679 Ga0495620_0005035 3300046515 Bacteria 7406
680 Ga0495628_0197997 3300046516 Bacteria 1514
681 Ga0495630_0010628 3300046517 Bacteria 6646
682 Ga0495631_0009499 3300046518 Bacteria 4857
683 Ga0495631_0163185 3300046518 Bacteria 956
684 Ga0495637_0002413 3300046520 Bacteria 10339
685 Ga0495643_0000051 3300046522 Bacteria 207804
686 Ga0495643_0003645 3300046522 Bacteria 11185
687 Ga0495643_0003725 3300046522 Bacteria 11043
688 Ga0495643_0034138 3300046522 Bacteria 2809
689 Ga0495644_0149282 3300046523 Bacteria 894
690 Ga0495648_0002396 3300046524 Bacteria 17400
691 Ga0495648_0008443 3300046524 Bacteria 8103
692 Ga0495648_0015666 3300046524 Bacteria 5491
693 Ga0495648_0079901 3300046524 Bacteria 1864
694 Ga0495666_0002451 3300046526 Bacteria 9211
695 Ga0495642_0004326 3300046528 Bacteria 5515
696 Ga0495652_0018649 3300046529 Bacteria 6184
697 Ga0495654_0000285 3300046530 Bacteria 46016
698 Ga0495654_0009943 3300046530 Bacteria 5198
699 Ga0495665_0005192 3300046531 Bacteria 7020
700 Ga0495640_0029546 3300046533 Bacteria 3934
701 Ga0495587_0002021 3300046536 Bacteria 13522
702 Ga0495609_0143046 3300046538 Bacteria 1020
703 Ga0495622_0000450 3300046557 Bacteria 26491
704 Ga0495633_0029699 3300046558 Bacteria 2658
705 Ga0495633_0124787 3300046558 Bacteria 1192
706 Ga0495656_0071538 3300046615 Bacteria 1542
707 Ga0495668_0004440 3300046616 Bacteria 9956
708 Ga0495668_0015655 3300046616 Bacteria 4424
709 Ga0495668_0210111 3300046616 Bacteria 1066
710 Ga0495625_0000857 3300046660 Bacteria 41346
711 Ga0495625_0003460 3300046660 Bacteria 15720
712 Ga0495625_0010507 3300046660 Bacteria 7650
713 Ga0495625_0014409 3300046660 Bacteria 6311
714 Ga0495625_0050255 3300046660 Bacteria 2992
715 Ga0495625_0141659 3300046660 Bacteria 1621
716 Ga0495659_0005556 3300046664 Bacteria 3967
717 Ga0495661_0004617 3300046665 Bacteria 9912
718 Ga0495661_0004853 3300046665 Bacteria 9632
719 Ga0495661_0011766 3300046665 Bacteria 5927
720 Ga0495661_0027910 3300046665 Bacteria 3619
721 Ga0495588_0000062 3300046674 Bacteria 253674
722 Ga0495588_0002924 3300046674 Bacteria 7371
723 Ga0495588_0122854 3300046674 Bacteria 1369
724 Ga0495657_0022634 3300046675 Bacteria 4499
725 Ga0495599_0038021 3300046678 Bacteria 3023
726 Ga0495646_0015977 3300046680 Bacteria 4764
727 Ga0495669_0059944 3300046684 Bacteria 1720
728 Ga0495613_0006859 3300046689 Bacteria 8501
729 Ga0495624_0058704 3300046690 Bacteria 2415
730 Ga0495671_0001894 3300046692 Bacteria 13432
731 Ga0495649_0002968 3300046694 Bacteria 11684
732 Ga0495649_0072327 3300046694 Bacteria 1848
733 Ga0495589_0000991 3300046794 Bacteria 17231
734 Ga0495589_0009545 3300046794 Bacteria 5042
735 Ga0495600_0005267 3300046809 Bacteria 7785
736 Ga0495660_0000101 3300046810 Bacteria 91466
737 Ga0495660_0004120 3300046810 Bacteria 8859
738 Ga0495660_0129408 3300046810 Bacteria 1268
739 Ga0495581_0018204 3300047315 Bacteria 4080
740 Ga0495672_0000030 3300047320 Bacteria 305021
741 Ga0495672_0000348 3300047320 Bacteria 59143
742 Ga0495672_0000663 3300047320 Bacteria 38282
743 Ga0495676_0021038 3300047321 Bacteria 5709
744 Ga0495683_0009372 3300047323 Bacteria 5216
745 Ga0495683_0013024 3300047323 Bacteria 4355
746 Ga0495683_0019971 3300047323 Bacteria 3457
747 Ga0495687_000036 3300047443 Bacteria 255427
748 Ga0495687_000938 3300047443 Bacteria 30149
749 Ga0495687_010251 3300047443 Bacteria 5151
750 Ga0495675_0000605 3300047444 Bacteria 23113
751 Ga0495677_0000422 3300047445 Bacteria 18190
752 Ga0495677_0014289 3300047445 Bacteria 2892
753 Ga0495679_001358 3300047446 Bacteria 14076
754 Ga0495679_009161 3300047446 Bacteria 3982
755 Ga0495679_011495 3300047446 Bacteria 3415
756 Ga0495673_0000016 3300047469 Bacteria 580643
757 Ga0495673_0001751 3300047469 Bacteria 16546
758 Ga0495673_0008711 3300047469 Bacteria 5669
759 Ga0495684_0106004 3300047471 Bacteria 2124
760 Ga0495686_0018455 3300047472 Bacteria 4681
761 Ga0495593_0001577 3300047673 Bacteria 13443
762 Ga0495614_0003703 3300048089 Bacteria 6862
763 Ga0495626_0000347 3300048091 Bacteria 48706
764 Ga0495626_0009286 3300048091 Bacteria 5320
765 Ga0496100_0109877 3300048903 Bacteria 1914
766 Ga0496101_0001508 3300048904 Bacteria 13943
767 Ga0496101_0003840 3300048904 Bacteria 9392
768 Ga0496101_0059856 3300048904 Bacteria 2762
769 Ga0496102_0001994 3300048905 Bacteria 17631
770 Ga0496102_0074546 3300048905 Bacteria 3119
771 Ga0496103_0043549 3300048906 Bacteria 2764
772 Ga0496103_0050994 3300048906 Bacteria 2561
773 Ga0496104_0158905 3300048907 Bacteria 2168
774 Ga0496104_0335616 3300048907 Bacteria 1424
775 Ga0496105_0033646 3300048908 Bacteria 4211
776 Ga0496105_0181017 3300048908 Unclassified 1726
777 Ga0496106_0001460 3300048909 Bacteria 17764
778 Ga0496106_0009518 3300048909 Bacteria 7177
779 Ga0496106_0022804 3300048909 Bacteria 4650
780 Ga0496106_0232170 3300048909 Bacteria 1473
781 Ga0496107_0012251 3300048910 Bacteria 5985
782 Ga0496107_0014479 3300048910 Bacteria 5522
783 Ga0496107_0022881 3300048910 Bacteria 4418
784 Ga0496107_0137584 3300048910 Bacteria 1805
785 Ga0496108_0015084 3300048911 Bacteria 6308
786 Ga0496108_0015113 3300048911 Bacteria 6300
787 Ga0496108_0177142 3300048911 Bacteria 1846
788 Ga0496109_0001761 3300048912 Bacteria 17994
789 Ga0496109_0009942 3300048912 Bacteria 8124
790 Ga0496110_0007368 3300048913 Bacteria 8782
791 Ga0496110_0009390 3300048913 Bacteria 7919
792 Ga0496110_0033799 3300048913 Bacteria 4426
793 Ga0496111_0003665 3300048914 Bacteria 9538
794 Ga0496111_0025636 3300048914 Bacteria 4160
795 Ga0496111_0035838 3300048914 Bacteria 3547
796 Ga0496112_0043890 3300048915 Bacteria 4378
797 Ga0496112_0075067 3300048915 Bacteria 3343
798 Ga0496113_0011054 3300048916 Bacteria 6002
799 Ga0496113_0012540 3300048916 Bacteria 5702
800 Ga0496113_0136283 3300048916 Bacteria 1929
801 Ga0496113_0183241 3300048916 Bacteria 1660
802 Ga0496114_0258027 3300048917 Bacteria 1534
803 Ga0496115_0001431 3300048918 Bacteria 17100
804 Ga0496116_0000097 3300048919 Bacteria 200658
805 Ga0496116_0067861 3300048919 Bacteria 2275
806 Ga0496116_0087427 3300048919 Bacteria 1907
807 Ga0496116_0088894 3300048919 Bacteria 1886
808 Ga0496117_0002771 3300048920 Bacteria 21469
809 Ga0496117_0037227 3300048920 Bacteria 3627
810 Ga0496118_0000553 3300048921 Bacteria 61663
811 Ga0496119_0045030 3300048922 Bacteria 2771
812 Ga0496120_0153548 3300048923 Bacteria 1155
813 Ga0496121_0092538 3300048924 Bacteria 2357
814 Ga0496121_0224326 3300048924 Bacteria 1321
815 Ga0496122_0090059 3300048925 Bacteria 2095
816 Ga0496122_0096670 3300048925 Bacteria 1990
817 Ga0496123_0054996 3300048926 Bacteria 2615
818 Ga0496123_0055342 3300048926 Bacteria 2604
819 Ga0496123_0096186 3300048926 Bacteria 1739
820 Ga0496123_0222039 3300048926 Bacteria 952
821 Ga0496124_0000610 3300048927 Bacteria 60097
822 Ga0496124_0017766 3300048927 Bacteria 6689
823 Ga0496124_0047966 3300048927 Bacteria 3651
824 Ga0496124_0238711 3300048927 Bacteria 1353
825 Ga0496125_0112157 3300048928 Bacteria 1971
826 Ga0496125_0130922 3300048928 Bacteria 1766
827 Ga0496126_0000119 3300048929 Bacteria 184211
828 Ga0496126_0006673 3300048929 Bacteria 12827
829 Ga0496126_0037392 3300048929 Bacteria 4531
830 Ga0496126_0087057 3300048929 Bacteria 2753
831 Ga0496126_0129141 3300048929 Bacteria 2185
832 Ga0496126_0234917 3300048929 Bacteria 1534
833 Ga0495678_000040 3300049459 Bacteria 190664
834 Ga0495678_062128 3300049459 Bacteria 1399
835 Ga0501033_0000351 3300049570 Bacteria 43920
836 Ga0501033_0002610 3300049570 Bacteria 15185
837 Ga0501033_0063214 3300049570 Bacteria 2725
838 Ga0501034_0506027 3300049571 Bacteria 1121
839 Ga0501047_0306747 3300049581 Bacteria 1429
840 Ga0501067_0115013 3300049583 Bacteria 1496
841 Ga0501068_0203191 3300049584 Bacteria 1257
842 Ga0501080_0077504 3300049742 Bacteria 3091
843 Ga0501035_0000263 3300049822 Bacteria 62255
844 Ga0501044_0004321 3300049823 Bacteria 15928
845 nmdc:mga03683_130406_c1 3300050489 Bacteria 1124
846 nmdc:mga03n38_82242_c1 3300050490 Bacteria 1516
847 nmdc:mga0yw44_1655_c1 3300050492 Bacteria 8986
848 nmdc:mga0k408_142822_c1 3300050493 Bacteria 1424
849 nmdc:mga0k408_17241_c1 3300050493 Bacteria 4020
850 nmdc:mga07m45_32184_c2 3300050496 Bacteria 1274
851 nmdc:mga07m45_97021_c1 3300050496 Bacteria 1692
852 nmdc:mga08y16_247919_c1 3300050511 Bacteria 1840
853 nmdc:mga0sz30_2903_c2 3300050516 Bacteria 1562
854 Ga0500635_0010287 3300053080 Bacteria 2621
855 Ga0500578_0167329 3300053086 Bacteria 1361
856 Ga0500583_0017161 3300053092 Bacteria 2908
857 Ga0500566_0003407 3300053094 Bacteria 9484
858 Ga0500641_0052903 3300053096 Bacteria 1675
859 Ga0500660_095581 3300053100 Bacteria 1313
860 Ga0500554_001873 3300053102 Bacteria 4071
861 Ga0500556_0004789 3300053104 Bacteria 3838
862 Ga0500608_000133 3300053122 Bacteria 30212
863 Ga0500608_034018 3300053122 Bacteria 2427
864 Ga0500618_000071 3300053125 Bacteria 85596
865 Ga0500658_0001144 3300053134 Bacteria 10827
866 Ga0500568_0027058 3300053139 Bacteria 2401
867 Ga0500586_000126 3300053145 Bacteria 13845
868 Ga0500586_000471 3300053145 Bacteria 8055
869 Ga0500616_0001263 3300053153 Bacteria 25267
870 Ga0500616_0012191 3300053153 Bacteria 5039
871 Ga0500620_000371 3300053155 Bacteria 8345
872 Ga0500622_0000746 3300053156 Bacteria 28397
873 Ga0500622_0005146 3300053156 Bacteria 7932
874 Ga0500622_0008310 3300053156 Bacteria 5817
875 Ga0500630_074893 3300053159 Bacteria 1595
876 Ga0500637_0000887 3300053178 Bacteria 12034
877 Ga0500611_031464 3300053727 Bacteria 1102
878 Ga0500645_002368 3300053730 Bacteria 8489
879 Ga0466962_0000509 3300061719 Bacteria 16925
880 Ga0466962_0004059 3300061719 Bacteria 7006
881 Ga0466962_0026394 3300061719 Bacteria 2789

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0009942 Ga0496109_0009942_6519_7256 245
2 3300042436 Ga0439435_0106492 Ga0439435_0106492_115_855 246
3 3300048922 Ga0496119_0045030 Ga0496119_0045030_12_755 247
4 3300005347 Ga0070668_100207109 Ga0070668_1002071092 249
5 3300005455 Ga0070663_100056616 Ga0070663_1000566162 249
6 3300009011 Ga0105251_10029906 Ga0105251_100299061 249
7 3300009036 Ga0105244_10147377 Ga0105244_101473772 249
8 3300009553 Ga0105249_10160730 Ga0105249_101607302 249
9 3300025961 Ga0207712_10089157 Ga0207712_100891572 249
10 3300048907 Ga0496104_0335616 Ga0496104_0335616_354_1205 249
11 3300048908 Ga0496105_0033646 Ga0496105_0033646_553_1404 249
12 3300048916 Ga0496113_0183241 Ga0496113_0183241_321_1172 249
13 3300048926 Ga0496123_0054996 Ga0496123_0054996_537_1388 249
14 3300048928 Ga0496125_0112157 Ga0496125_0112157_571_1422 249
15 3300048929 Ga0496126_0129141 Ga0496126_0129141_1267_2166 250
16 3300046454 Ga0495592_0008744 Ga0495592_0008744_4476_5390 251
17 3300046455 Ga0495603_0136563 Ga0495603_0136563_347_1234 251
18 3300046458 Ga0495591_003143 Ga0495591_003143_4474_5388 251
19 3300046459 Ga0495629_0035464 Ga0495629_0035464_1352_2266 251
20 3300046462 Ga0495651_0017339 Ga0495651_0017339_818_1705 251
21 3300046463 Ga0495653_0020018 Ga0495653_0020018_2087_3001 251
22 3300046473 Ga0495582_0004825 Ga0495582_0004825_4307_5194 251
23 3300046476 Ga0495662_0023700 Ga0495662_0023700_1402_2316 251
24 3300046477 Ga0495664_0009074 Ga0495664_0009074_3113_4000 251
25 3300046500 Ga0495596_0001769 Ga0495596_0001769_6100_6987 251
26 3300046511 Ga0495608_0004834 Ga0495608_0004834_5243_6157 251
27 3300046514 Ga0495618_0071975 Ga0495618_0071975_49_963 251
28 3300046516 Ga0495628_0197997 Ga0495628_0197997_467_1381 251
29 3300046517 Ga0495630_0010628 Ga0495630_0010628_2387_3274 251
30 3300046524 Ga0495648_0079901 Ga0495648_0079901_876_1763 251
31 3300046526 Ga0495666_0002451 Ga0495666_0002451_6109_6996 251
32 3300046529 Ga0495652_0018649 Ga0495652_0018649_3485_4399 251
33 3300046531 Ga0495665_0005192 Ga0495665_0005192_3725_4639 251
34 3300046533 Ga0495640_0029546 Ga0495640_0029546_798_1712 251
35 3300046536 Ga0495587_0002021 Ga0495587_0002021_5026_5913 251
36 3300046557 Ga0495622_0000450 Ga0495622_0000450_21150_22064 251
37 3300046665 Ga0495661_0004617 Ga0495661_0004617_3843_4730 251
38 3300046675 Ga0495657_0022634 Ga0495657_0022634_1123_2037 251
39 3300046678 Ga0495599_0038021 Ga0495599_0038021_1451_2365 251
40 3300046680 Ga0495646_0015977 Ga0495646_0015977_1662_2576 251
41 3300046689 Ga0495613_0006859 Ga0495613_0006859_1728_2642 251
42 3300046690 Ga0495624_0058704 Ga0495624_0058704_50_937 251
43 3300046794 Ga0495589_0009545 Ga0495589_0009545_2678_3565 251
44 3300046809 Ga0495600_0005267 Ga0495600_0005267_2301_3188 251
45 3300047315 Ga0495581_0018204 Ga0495581_0018204_1616_2503 251
46 3300047321 Ga0495676_0021038 Ga0495676_0021038_4690_5577 251
47 3300047323 Ga0495683_0009372 Ga0495683_0009372_4132_5019 251
48 3300047444 Ga0495675_0000605 Ga0495675_0000605_8158_9045 251
49 3300047446 Ga0495679_001358 Ga0495679_001358_12365_13279 251
50 3300047469 Ga0495673_0008711 Ga0495673_0008711_42_929 251
51 3300047471 Ga0495684_0106004 Ga0495684_0106004_469_1356 251
52 3300047673 Ga0495593_0001577 Ga0495593_0001577_4043_4930 251
53 3300048089 Ga0495614_0003703 Ga0495614_0003703_3589_4503 251
54 3300048905 Ga0496102_0001994 Ga0496102_0001994_3023_3910 251
55 3300048906 Ga0496103_0043549 Ga0496103_0043549_569_1456 251
56 3300048920 Ga0496117_0002771 Ga0496117_0002771_3087_3974 251
57 3300048921 Ga0496118_0000553 Ga0496118_0000553_47152_48039 251
58 3300031616 Ga0307508_10103537 Ga0307508_101035372 252
59 3300003323 rootH1_10247060 rootH1_102470603 254
60 3300003790 Ga0055528_1012540 Ga0055528_10125402 254
61 3300006353 Ga0075370_10176661 Ga0075370_101766612 254
62 3300013102 Ga0157371_10124599 Ga0157371_101245992 254
63 3300026078 Ga0207702_10247017 Ga0207702_102470172 254
64 3300037418 Ga0395900_0235325 Ga0395900_0235325_602_1366 254
65 3300044901 Ga0466960_0115223 Ga0466960_0115223_14_778 254
66 3300046660 Ga0495625_0141659 Ga0495625_0141659_841_1605 254
67 3300048904 Ga0496101_0001508 Ga0496101_0001508_6091_6855 254
68 3300048905 Ga0496102_0074546 Ga0496102_0074546_678_1442 254
69 3300048908 Ga0496105_0181017 Ga0496105_0181017_477_1241 254
70 3300048909 Ga0496106_0022804 Ga0496106_0022804_2337_3101 254
71 3300048910 Ga0496107_0014479 Ga0496107_0014479_880_1644 254
72 3300048911 Ga0496108_0015084 Ga0496108_0015084_2136_2900 254
73 3300048911 Ga0496108_0177142 Ga0496108_0177142_1053_1817 254
74 3300048913 Ga0496110_0007368 Ga0496110_0007368_406_1170 254
75 3300048914 Ga0496111_0025636 Ga0496111_0025636_2112_2876 254
76 3300048916 Ga0496113_0011054 Ga0496113_0011054_4693_5457 254
77 3300048926 Ga0496123_0222039 Ga0496123_0222039_177_941 254
78 3300049584 Ga0501068_0203191 Ga0501068_0203191_468_1232 254
79 3300049742 Ga0501080_0077504 Ga0501080_0077504_1039_1803 254
80 3300050496 nmdc:mga07m45_32184_c2 nmdc:mga07m45_32184_c2_167_1015 254
81 3300002773 JGI25152J39213_1000557 JGI25152J39213_100055717 255
82 3300003771 Ga0055526_1011964 Ga0055526_10119643 255
83 3300003790 Ga0055528_1001758 Ga0055528_10017589 255
84 3300005355 Ga0070671_100051862 Ga0070671_1000518623 255
85 3300009098 Ga0105245_10183385 Ga0105245_101833852 255
86 3300009098 Ga0105245_10322338 Ga0105245_103223381 255
87 3300009545 Ga0105237_10392298 Ga0105237_103922981 255
88 3300025256 Ga0209759_1003548 Ga0209759_10035485 255
89 3300025258 Ga0209129_1001054 Ga0209129_10010544 255
90 3300025273 Ga0209673_1015890 Ga0209673_10158903 255
91 3300025295 Ga0209564_1007331 Ga0209564_10073313 255
92 3300025302 Ga0207426_1002244 Ga0207426_100224411 255
93 3300025927 Ga0207687_10055397 Ga0207687_100553971 255
94 3300037853 Ga0436364_1438839 Ga0436364_1438839_3365_4204 255
95 3300048903 Ga0496100_0109877 Ga0496100_0109877_754_1605 255
96 3300048909 Ga0496106_0232170 Ga0496106_0232170_266_1117 255
97 3300048919 Ga0496116_0088894 Ga0496116_0088894_457_1308 255
98 3300048924 Ga0496121_0092538 Ga0496121_0092538_1222_2073 255
99 3300031456 Ga0307513_10185070 Ga0307513_101850702 257
100 3300053156 Ga0500622_0008310 Ga0500622_0008310_1788_2636 257
101 3300037471 Ga0395905_0102121 Ga0395905_0102121_1473_2309 258
102 3300044656 Ga0466969_0183248 Ga0466969_0183248_165_944 259
103 3300053153 Ga0500616_0012191 Ga0500616_0012191_2940_3788 259
104 3300021320 Ga0214544_1000017 Ga0214544_1000017125 260
105 3300021321 Ga0214542_1000006 Ga0214542_1000006105 260
106 3300021327 Ga0214543_1000014 Ga0214543_1000014218 260
107 3300037471 Ga0395905_0111374 Ga0395905_0111374_62_847 261
108 3300038443 Ga0395901_0285899 Ga0395901_0285899_73_858 261
109 3300005435 Ga0070714_100204275 Ga0070714_1002042752 262
110 3300009094 Ga0111539_10721864 Ga0111539_107218641 262
111 3300037418 Ga0395900_0130943 Ga0395900_0130943_1147_1992 262
112 3300037471 Ga0395905_0005730 Ga0395905_0005730_2291_3136 262
113 3300044656 Ga0466969_0025519 Ga0466969_0025519_1415_2203 262
114 3300044684 Ga0466966_0057894 Ga0466966_0057894_759_1547 262
115 3300044712 Ga0453684_0224176 Ga0453684_0224176_156_1013 262
116 3300045051 Ga0451576_0157512 Ga0451576_0157512_216_1073 262
117 3300046460 Ga0495638_0060759 Ga0495638_0060759_579_1427 263
118 3300046674 Ga0495588_0000062 Ga0495588_0000062_187188_188030 263
119 3300053122 Ga0500608_034018 Ga0500608_034018_150_998 263
120 3300030521 Ga0307511_10066775 Ga0307511_100667753 264
121 3300033180 Ga0307510_10000007 Ga0307510_1000000727 264
122 3300035113 Ga0373936_0012860 Ga0373936_0012860_189_989 264
123 3300042012 Ga0439455_0005448 Ga0439455_0005448_538_1332 264
124 3300042157 Ga0439458_0000153 Ga0439458_0000153_4580_5374 264
125 3300046457 Ga0495590_0037793 Ga0495590_0037793_690_1526 264
126 3300046506 Ga0495583_0000141 Ga0495583_0000141_101440_102276 264
127 3300046507 Ga0495606_0113420 Ga0495606_0113420_330_1166 264
128 3300047443 Ga0495687_010251 Ga0495687_010251_646_1482 264
129 3300048091 Ga0495626_0009286 Ga0495626_0009286_87_923 264
130 3300053159 Ga0500630_074893 Ga0500630_074893_149_946 264
131 3300021384 Ga0213876_10006514 Ga0213876_100065146 265
132 3300037312 Ga0395899_0006239 Ga0395899_0006239_5443_6240 265
133 3300037418 Ga0395900_0068757 Ga0395900_0068757_908_1705 265
134 3300039437 Ga0436365_0256427 Ga0436365_0256427_4374_5180 265
135 3300044684 Ga0466966_0033607 Ga0466966_0033607_2003_2839 265
136 3300044693 Ga0466961_0054737 Ga0466961_0054737_916_1752 265
137 3300044694 Ga0466963_0039798 Ga0466963_0039798_612_1448 265
138 3300044842 Ga0466957_0087640 Ga0466957_0087640_602_1438 265
139 3300045049 Ga0466959_0067777 Ga0466959_0067777_1521_2357 265
140 3300045836 Ga0466958_0014464 Ga0466958_0014464_1093_1929 265
141 3300061719 Ga0466962_0026394 Ga0466962_0026394_1069_1905 265
142 3300013105 Ga0157369_10126147 Ga0157369_101261472 266
143 3300027876 Ga0209974_10069589 Ga0209974_100695892 267
144 iso_pu_bacteria 2643221622 2644128424 267
145 3300005614 Ga0068856_100653785 Ga0068856_1006537852 268
146 3300053080 Ga0500635_0010287 Ga0500635_0010287_788_1603 268
147 3300053122 Ga0500608_000133 Ga0500608_000133_13695_14510 268
148 3300053178 Ga0500637_0000887 Ga0500637_0000887_4592_5401 268
149 3300005458 Ga0070681_10001905 Ga0070681_100019057 269
150 3300005530 Ga0070679_100065796 Ga0070679_1000657963 269
151 3300025912 Ga0207707_10005427 Ga0207707_100054277 269
152 3300031911 Ga0307412_10226097 Ga0307412_102260971 269
153 3300037471 Ga0395905_0342111 Ga0395905_0342111_197_1006 269
154 3300041404 Ga0439436_0038446 Ga0439436_0038446_268_1077 269
155 3300045976 Ga0466967_0046786 Ga0466967_0046786_2339_3148 269
156 iso_pu_bacteria 2758568016 2758638063 269
157 iso_pu_bacteria 2891048133 2891051301 269
158 3300003203 JGI25406J46586_10010542 JGI25406J46586_100105425 270
159 3300003215 JGI25153J46596_10023166 JGI25153J46596_100231662 270
160 3300003773 Ga0055537_1000646 Ga0055537_10006468 270
161 3300003775 Ga0055524_1009262 Ga0055524_10092622 270
162 3300003790 Ga0055528_1002895 Ga0055528_10028955 270
163 3300005548 Ga0070665_100225279 Ga0070665_1002252792 270
164 3300005985 Ga0081539_10000038 Ga0081539_1000003865 270
165 3300009093 Ga0105240_10124835 Ga0105240_101248352 270
166 3300010375 Ga0105239_10075638 Ga0105239_100756382 270
167 3300025263 Ga0209565_1000118 Ga0209565_1000118107 270
168 3300025273 Ga0209673_1001150 Ga0209673_100115010 270
169 3300025291 Ga0209675_1011805 Ga0209675_10118053 270
170 3300025297 Ga0209758_1000835 Ga0209758_100083518 270
171 3300025297 Ga0209758_1011719 Ga0209758_10117195 270
172 3300025299 Ga0209256_1011665 Ga0209256_10116653 270
173 3300025304 Ga0209257_1000506 Ga0209257_100050622 270
174 3300025913 Ga0207695_10098981 Ga0207695_100989811 270
175 3300037471 Ga0395905_0365567 Ga0395905_0365567_479_1321 270
176 3300046460 Ga0495638_0001206 Ga0495638_0001206_13407_14255 270
177 3300046460 Ga0495638_0058522 Ga0495638_0058522_1135_1983 270
178 3300046471 Ga0495650_0000069 Ga0495650_0000069_226289_227137 270
179 3300046507 Ga0495606_0004031 Ga0495606_0004031_12316_13164 270
180 3300046512 Ga0495610_0000378 Ga0495610_0000378_8783_9631 270
181 3300046515 Ga0495620_0005035 Ga0495620_0005035_3994_4842 270
182 3300046520 Ga0495637_0002413 Ga0495637_0002413_519_1367 270
183 3300046522 Ga0495643_0034138 Ga0495643_0034138_1445_2293 270
184 3300046523 Ga0495644_0149282 Ga0495644_0149282_11_859 270
185 3300046530 Ga0495654_0000285 Ga0495654_0000285_36034_36882 270
186 3300046538 Ga0495609_0143046 Ga0495609_0143046_38_889 270
187 3300046616 Ga0495668_0210111 Ga0495668_0210111_147_995 270
188 3300046660 Ga0495625_0003460 Ga0495625_0003460_13889_14737 270
189 3300046660 Ga0495625_0014409 Ga0495625_0014409_4018_4866 270
190 3300046660 Ga0495625_0050255 Ga0495625_0050255_2095_2943 270
191 3300046810 Ga0495660_0004120 Ga0495660_0004120_4710_5558 270
192 3300046810 Ga0495660_0129408 Ga0495660_0129408_159_1007 270
193 3300047320 Ga0495672_0000663 Ga0495672_0000663_18793_19641 270
194 3300047446 Ga0495679_009161 Ga0495679_009161_915_1763 270
195 3300047469 Ga0495673_0001751 Ga0495673_0001751_7300_8148 270
196 3300048918 Ga0496115_0001431 Ga0496115_0001431_8395_9243 270
197 3300048929 Ga0496126_0234917 Ga0496126_0234917_255_1103 270
198 3300050493 nmdc:mga0k408_17241_c1 nmdc:mga0k408_17241_c1_661_1509 270
199 3300053086 Ga0500578_0167329 Ga0500578_0167329_493_1341 270
200 3300053102 Ga0500554_001873 Ga0500554_001873_1502_2350 270
201 3300053104 Ga0500556_0004789 Ga0500556_0004789_514_1362 270
202 3300053125 Ga0500618_000071 Ga0500618_000071_81779_82627 270
203 3300053139 Ga0500568_0027058 Ga0500568_0027058_466_1314 270
204 3300053156 Ga0500622_0005146 Ga0500622_0005146_2665_3513 270
205 3300053727 Ga0500611_031464 Ga0500611_031464_169_1017 270
206 3300053730 Ga0500645_002368 Ga0500645_002368_7241_8089 270
207 iso_pu_bacteria 2582581280 2585155360 270
208 iso_pu_bacteria 2582581293 2585198924 270
209 iso_pu_bacteria 2643221545 2643748261 270
210 iso_pu_bacteria 2643221552 2643779075 270
211 iso_pu_bacteria 2643221584 2643927642 270
212 iso_pu_bacteria 2643221691 2644508006 270
213 iso_pu_bacteria 2818991435 2819539583 270
214 iso_pu_bacteria 2818991454 2819648791 270
215 3300001989 JGI24739J22299_10011198 JGI24739J22299_100111983 271
216 3300002067 JGI24735J21928_10004904 JGI24735J21928_100049044 271
217 3300002737 JGI25162J39368_1000322 JGI25162J39368_100032215 271
218 3300002773 JGI25152J39213_1000784 JGI25152J39213_100078410 271
219 3300002773 JGI25152J39213_1007244 JGI25152J39213_10072442 271
220 3300002774 JGI25150J39212_1000119 JGI25150J39212_100011925 271
221 3300002987 JGI25159J45721_1005825 JGI25159J45721_10058252 271
222 3300003187 JGI25151J46595_10000007 JGI25151J46595_1000000784 271
223 3300003187 JGI25151J46595_10000834 JGI25151J46595_100008345 271
224 3300003214 JGI25165J46597_1000248 JGI25165J46597_100024850 271
225 3300003215 JGI25153J46596_10001312 JGI25153J46596_100013126 271
226 3300003322 rootL2_10065467 rootL2_100654673 271
227 3300003323 rootH1_10100938 rootH1_101009383 271
228 3300003323 rootH1_10287660 rootH1_102876602 271
229 3300003771 Ga0055526_1010747 Ga0055526_10107473 271
230 3300003775 Ga0055524_1012966 Ga0055524_10129662 271
231 3300003791 Ga0055530_10000082 Ga0055530_100000825 271
232 3300003791 Ga0055530_10001087 Ga0055530_100010875 271
233 3300003794 Ga0055531_10000012 Ga0055531_100000125 271
234 3300005262 Ga0065165_1001607 Ga0065165_10016075 271
235 3300005331 Ga0070670_100056212 Ga0070670_1000562122 271
236 3300005335 Ga0070666_10149040 Ga0070666_101490402 271
237 3300005347 Ga0070668_100117672 Ga0070668_1001176722 271
238 3300005354 Ga0070675_100101476 Ga0070675_1001014762 271
239 3300005355 Ga0070671_100165356 Ga0070671_1001653562 271
240 3300005455 Ga0070663_100141264 Ga0070663_1001412642 271
241 3300005457 Ga0070662_100191359 Ga0070662_1001913592 271
242 3300005548 Ga0070665_100203399 Ga0070665_1002033992 271
243 3300005577 Ga0068857_100061853 Ga0068857_1000618532 271
244 3300005614 Ga0068856_100268147 Ga0068856_1002681472 271
245 3300005983 Ga0081540_1028100 Ga0081540_10281002 271
246 3300006038 Ga0075365_10015038 Ga0075365_100150386 271
247 3300006038 Ga0075365_10107863 Ga0075365_101078632 271
248 3300006042 Ga0075368_10014911 Ga0075368_100149112 271
249 3300006178 Ga0075367_10001368 Ga0075367_100013682 271
250 3300006178 Ga0075367_10021130 Ga0075367_100211303 271
251 3300006178 Ga0075367_10070893 Ga0075367_100708932 271
252 3300006186 Ga0075369_10003078 Ga0075369_100030783 271
253 3300006186 Ga0075369_10039051 Ga0075369_100390512 271
254 3300006186 Ga0075369_10039943 Ga0075369_100399432 271
255 3300009011 Ga0105251_10034833 Ga0105251_100348332 271
256 3300009093 Ga0105240_10219562 Ga0105240_102195623 271
257 3300009094 Ga0111539_10119724 Ga0111539_101197242 271
258 3300009176 Ga0105242_10382834 Ga0105242_103828342 271
259 3300009553 Ga0105249_10152102 Ga0105249_101521023 271
260 3300010375 Ga0105239_10275202 Ga0105239_102752022 271
261 3300010375 Ga0105239_10379452 Ga0105239_103794522 271
262 3300013102 Ga0157371_10005134 Ga0157371_1000513410 271
263 3300013105 Ga0157369_10308625 Ga0157369_103086252 271
264 3300013105 Ga0157369_10324562 Ga0157369_103245622 271
265 3300013297 Ga0157378_10182842 Ga0157378_101828422 271
266 3300014325 Ga0163163_10212719 Ga0163163_102127192 271
267 3300025230 Ga0209563_101879 Ga0209563_1018794 271
268 3300025233 Ga0209437_100040 Ga0209437_10004015 271
269 3300025245 Ga0207425_1000018 Ga0207425_1000018246 271
270 3300025258 Ga0209129_1000026 Ga0209129_100002683 271
271 3300025258 Ga0209129_1005221 Ga0209129_10052214 271
272 3300025261 Ga0209233_1000051 Ga0209233_100005116 271
273 3300025273 Ga0209673_1021733 Ga0209673_10217333 271
274 3300025284 Ga0209130_1001632 Ga0209130_10016325 271
275 3300025294 Ga0209025_1000035 Ga0209025_100003583 271
276 3300025294 Ga0209025_1001871 Ga0209025_100187120 271
277 3300025294 Ga0209025_1009341 Ga0209025_10093415 271
278 3300025295 Ga0209564_1005948 Ga0209564_10059484 271
279 3300025297 Ga0209758_1000040 Ga0209758_100004083 271
280 3300025297 Ga0209758_1018810 Ga0209758_10188103 271
281 3300025297 Ga0209758_1033961 Ga0209758_10339612 271
282 3300025297 Ga0209758_1035188 Ga0209758_10351882 271
283 3300025298 Ga0209050_1000039 Ga0209050_1000039205 271
284 3300025299 Ga0209256_1025930 Ga0209256_10259302 271
285 3300025302 Ga0207426_1000182 Ga0207426_100018269 271
286 3300025302 Ga0207426_1001984 Ga0207426_10019843 271
287 3300025304 Ga0209257_1000051 Ga0209257_1000051205 271
288 3300025904 Ga0207647_10002711 Ga0207647_1000271110 271
289 3300025913 Ga0207695_10088474 Ga0207695_100884743 271
290 3300025914 Ga0207671_10267299 Ga0207671_102672992 271
291 3300025925 Ga0207650_10068784 Ga0207650_100687842 271
292 3300025931 Ga0207644_10095824 Ga0207644_100958242 271
293 3300025941 Ga0207711_10242777 Ga0207711_102427772 271
294 3300025986 Ga0207658_10309064 Ga0207658_103090642 271
295 3300026067 Ga0207678_10083862 Ga0207678_100838622 271
296 3300026078 Ga0207702_10063343 Ga0207702_100633432 271
297 3300026116 Ga0207674_10264394 Ga0207674_102643942 271
298 3300027312 Ga0209371_1030682 Ga0209371_10306822 271
299 3300028794 Ga0307515_10017859 Ga0307515_100178598 271
300 3300028794 Ga0307515_10018412 Ga0307515_1001841212 271
301 3300028794 Ga0307515_10324848 Ga0307515_103248482 271
302 3300030500 Ga0268256_1034886 Ga0268256_10348862 271
303 3300031731 Ga0307405_10014708 Ga0307405_100147085 271
304 3300031995 Ga0307409_100299651 Ga0307409_1002996511 271
305 3300037312 Ga0395899_0000007 Ga0395899_0000007_418407_419270 271
306 3300037418 Ga0395900_0000026 Ga0395900_0000026_102748_103611 271
307 3300037418 Ga0395900_0105335 Ga0395900_0105335_310_1137 271
308 3300037466 Ga0395898_0000085 Ga0395898_0000085_30283_31146 271
309 3300037466 Ga0395898_0035607 Ga0395898_0035607_3501_4328 271
310 3300037466 Ga0395898_0072874 Ga0395898_0072874_91_918 271
311 3300037471 Ga0395905_0002257 Ga0395905_0002257_14424_15251 271
312 3300037471 Ga0395905_0009882 Ga0395905_0009882_6923_7750 271
313 3300037471 Ga0395905_0030896 Ga0395905_0030896_804_1631 271
314 3300037471 Ga0395905_0055365 Ga0395905_0055365_2430_3257 271
315 3300037471 Ga0395905_0201968 Ga0395905_0201968_16_858 271
316 3300037471 Ga0395905_0225800 Ga0395905_0225800_53_880 271
317 3300038443 Ga0395901_0006625 Ga0395901_0006625_1629_2456 271
318 3300038443 Ga0395901_0023196 Ga0395901_0023196_3589_4416 271
319 3300038443 Ga0395901_0046562 Ga0395901_0046562_554_1396 271
320 3300038443 Ga0395901_0108404 Ga0395901_0108404_165_1007 271
321 3300041410 Ga0439461_0000171 Ga0439461_0000171_4962_5777 271
322 3300041413 Ga0439465_0000356 Ga0439465_0000356_11799_12614 271
323 3300041443 Ga0451789_0805958 Ga0451789_0805958_327_1175 271
324 3300041997 Ga0439431_0000437 Ga0439431_0000437_5447_6262 271
325 3300041997 Ga0439431_0008149 Ga0439431_0008149_1226_2041 271
326 3300041997 Ga0439431_0047518 Ga0439431_0047518_211_1074 271
327 3300042002 Ga0439442_000878 Ga0439442_000878_2017_2832 271
328 3300042004 Ga0439445_0000176 Ga0439445_0000176_625_1440 271
329 3300042006 Ga0439432_000215 Ga0439432_000215_7689_8504 271
330 3300042010 Ga0439452_012403 Ga0439452_012403_185_1000 271
331 3300042146 Ga0450907_008880 Ga0450907_008880_786_1649 271
332 3300042435 Ga0439434_0010753 Ga0439434_0010753_1818_2633 271
333 3300044656 Ga0466969_0001617 Ga0466969_0001617_8284_9120 271
334 3300044684 Ga0466966_0000143 Ga0466966_0000143_29730_30593 271
335 3300044684 Ga0466966_0000492 Ga0466966_0000492_7471_8307 271
336 3300044693 Ga0466961_0000301 Ga0466961_0000301_28841_29704 271
337 3300044693 Ga0466961_0000868 Ga0466961_0000868_5518_6354 271
338 3300044719 Ga0466971_0000632 Ga0466971_0000632_2738_3574 271
339 3300044842 Ga0466957_0013744 Ga0466957_0013744_3077_3913 271
340 3300045049 Ga0466959_0000511 Ga0466959_0000511_12147_12983 271
341 3300045836 Ga0466958_0000818 Ga0466958_0000818_3297_4133 271
342 3300045836 Ga0466958_0003818 Ga0466958_0003818_4346_5209 271
343 3300046452 Ga0495617_000003 Ga0495617_000003_7363_8199 271
344 3300046460 Ga0495638_0000552 Ga0495638_0000552_35014_35841 271
345 3300046460 Ga0495638_0040724 Ga0495638_0040724_1070_1906 271
346 3300046460 Ga0495638_0075402 Ga0495638_0075402_1029_1877 271
347 3300046463 Ga0495653_0328559 Ga0495653_0328559_29_865 271
348 3300046471 Ga0495650_0000240 Ga0495650_0000240_64031_64867 271
349 3300046471 Ga0495650_0000417 Ga0495650_0000417_14951_15787 271
350 3300046471 Ga0495650_0061970 Ga0495650_0061970_301_1152 271
351 3300046474 Ga0495605_0000287 Ga0495605_0000287_30790_31632 271
352 3300046491 Ga0495584_0000026 Ga0495584_0000026_66624_67466 271
353 3300046492 Ga0495585_0001974 Ga0495585_0001974_3791_4627 271
354 3300046492 Ga0495585_0129036 Ga0495585_0129036_21_848 271
355 3300046501 Ga0495607_0001107 Ga0495607_0001107_20058_20894 271
356 3300046501 Ga0495607_0009814 Ga0495607_0009814_5589_6431 271
357 3300046506 Ga0495583_0016351 Ga0495583_0016351_2769_3617 271
358 3300046507 Ga0495606_0000147 Ga0495606_0000147_42359_43195 271
359 3300046507 Ga0495606_0001676 Ga0495606_0001676_23201_24043 271
360 3300046507 Ga0495606_0011517 Ga0495606_0011517_3206_4042 271
361 3300046512 Ga0495610_0000003 Ga0495610_0000003_691428_692264 271
362 3300046512 Ga0495610_0001931 Ga0495610_0001931_6676_7512 271
363 3300046512 Ga0495610_0008022 Ga0495610_0008022_3198_4034 271
364 3300046512 Ga0495610_0083620 Ga0495610_0083620_333_1187 271
365 3300046518 Ga0495631_0009499 Ga0495631_0009499_3122_3973 271
366 3300046518 Ga0495631_0163185 Ga0495631_0163185_85_927 271
367 3300046522 Ga0495643_0000051 Ga0495643_0000051_110179_111015 271
368 3300046522 Ga0495643_0003645 Ga0495643_0003645_5671_6513 271
369 3300046522 Ga0495643_0003725 Ga0495643_0003725_5499_6341 271
370 3300046524 Ga0495648_0002396 Ga0495648_0002396_10660_11502 271
371 3300046524 Ga0495648_0008443 Ga0495648_0008443_1933_2769 271
372 3300046524 Ga0495648_0015666 Ga0495648_0015666_841_1677 271
373 3300046528 Ga0495642_0004326 Ga0495642_0004326_1865_2707 271
374 3300046530 Ga0495654_0009943 Ga0495654_0009943_3957_4793 271
375 3300046558 Ga0495633_0029699 Ga0495633_0029699_1525_2361 271
376 3300046558 Ga0495633_0124787 Ga0495633_0124787_86_934 271
377 3300046615 Ga0495656_0071538 Ga0495656_0071538_667_1509 271
378 3300046616 Ga0495668_0004440 Ga0495668_0004440_5223_6059 271
379 3300046616 Ga0495668_0015655 Ga0495668_0015655_3419_4246 271
380 3300046660 Ga0495625_0000857 Ga0495625_0000857_32495_33331 271
381 3300046660 Ga0495625_0010507 Ga0495625_0010507_6557_7384 271
382 3300046664 Ga0495659_0005556 Ga0495659_0005556_1758_2594 271
383 3300046665 Ga0495661_0004853 Ga0495661_0004853_4173_5015 271
384 3300046665 Ga0495661_0011766 Ga0495661_0011766_470_1306 271
385 3300046665 Ga0495661_0027910 Ga0495661_0027910_1379_2221 271
386 3300046674 Ga0495588_0002924 Ga0495588_0002924_4859_5707 271
387 3300046674 Ga0495588_0122854 Ga0495588_0122854_396_1244 271
388 3300046692 Ga0495671_0001894 Ga0495671_0001894_5451_6287 271
389 3300046694 Ga0495649_0002968 Ga0495649_0002968_6524_7360 271
390 3300046694 Ga0495649_0072327 Ga0495649_0072327_662_1504 271
391 3300046794 Ga0495589_0000991 Ga0495589_0000991_12939_13781 271
392 3300046810 Ga0495660_0000101 Ga0495660_0000101_61242_62084 271
393 3300047320 Ga0495672_0000030 Ga0495672_0000030_206119_206955 271
394 3300047320 Ga0495672_0000348 Ga0495672_0000348_27655_28497 271
395 3300047323 Ga0495683_0013024 Ga0495683_0013024_1728_2570 271
396 3300047323 Ga0495683_0019971 Ga0495683_0019971_1310_2146 271
397 3300047443 Ga0495687_000036 Ga0495687_000036_141666_142508 271
398 3300047443 Ga0495687_000938 Ga0495687_000938_15600_16442 271
399 3300047445 Ga0495677_0000422 Ga0495677_0000422_11486_12328 271
400 3300047446 Ga0495679_011495 Ga0495679_011495_911_1747 271
401 3300047469 Ga0495673_0000016 Ga0495673_0000016_495492_496328 271
402 3300047472 Ga0495686_0018455 Ga0495686_0018455_1003_1854 271
403 3300048091 Ga0495626_0000347 Ga0495626_0000347_34911_35753 271
404 3300048906 Ga0496103_0050994 Ga0496103_0050994_292_1140 271
405 3300048907 Ga0496104_0158905 Ga0496104_0158905_1205_2053 271
406 3300048909 Ga0496106_0009518 Ga0496106_0009518_3722_4564 271
407 3300048910 Ga0496107_0012251 Ga0496107_0012251_2944_3786 271
408 3300048910 Ga0496107_0137584 Ga0496107_0137584_870_1718 271
409 3300048916 Ga0496113_0136283 Ga0496113_0136283_822_1670 271
410 3300048919 Ga0496116_0000097 Ga0496116_0000097_15396_16244 271
411 3300048919 Ga0496116_0067861 Ga0496116_0067861_1407_2258 271
412 3300048919 Ga0496116_0087427 Ga0496116_0087427_228_1076 271
413 3300048920 Ga0496117_0037227 Ga0496117_0037227_1494_2345 271
414 3300048923 Ga0496120_0153548 Ga0496120_0153548_148_996 271
415 3300048924 Ga0496121_0224326 Ga0496121_0224326_308_1156 271
416 3300048925 Ga0496122_0090059 Ga0496122_0090059_1062_1910 271
417 3300048925 Ga0496122_0096670 Ga0496122_0096670_21_848 271
418 3300048926 Ga0496123_0055342 Ga0496123_0055342_1417_2265 271
419 3300048926 Ga0496123_0096186 Ga0496123_0096186_285_1136 271
420 3300048927 Ga0496124_0000610 Ga0496124_0000610_3092_3919 271
421 3300048927 Ga0496124_0017766 Ga0496124_0017766_3689_4537 271
422 3300048927 Ga0496124_0047966 Ga0496124_0047966_908_1759 271
423 3300048927 Ga0496124_0238711 Ga0496124_0238711_29_877 271
424 3300048928 Ga0496125_0130922 Ga0496125_0130922_300_1148 271
425 3300048929 Ga0496126_0000119 Ga0496126_0000119_168509_169357 271
426 3300048929 Ga0496126_0006673 Ga0496126_0006673_9850_10686 271
427 3300048929 Ga0496126_0037392 Ga0496126_0037392_623_1474 271
428 3300048929 Ga0496126_0087057 Ga0496126_0087057_395_1240 271
429 3300049459 Ga0495678_000040 Ga0495678_000040_109822_110658 271
430 3300049459 Ga0495678_062128 Ga0495678_062128_220_1071 271
431 3300049570 Ga0501033_0000351 Ga0501033_0000351_40141_40989 271
432 3300049570 Ga0501033_0063214 Ga0501033_0063214_910_1746 271
433 3300049571 Ga0501034_0506027 Ga0501034_0506027_46_894 271
434 3300049581 Ga0501047_0306747 Ga0501047_0306747_221_1069 271
435 3300049822 Ga0501035_0000263 Ga0501035_0000263_17345_18193 271
436 3300050489 nmdc:mga03683_130406_c1 nmdc:mga03683_130406_c1_110_958 271
437 3300050490 nmdc:mga03n38_82242_c1 nmdc:mga03n38_82242_c1_307_1155 271
438 3300050492 nmdc:mga0yw44_1655_c1 nmdc:mga0yw44_1655_c1_4531_5379 271
439 3300050493 nmdc:mga0k408_142822_c1 nmdc:mga0k408_142822_c1_192_1040 271
440 3300050496 nmdc:mga07m45_97021_c1 nmdc:mga07m45_97021_c1_185_1033 271
441 3300050511 nmdc:mga08y16_247919_c1 nmdc:mga08y16_247919_c1_917_1744 271
442 3300050516 nmdc:mga0sz30_2903_c2 nmdc:mga0sz30_2903_c2_43_891 271
443 3300053092 Ga0500583_0017161 Ga0500583_0017161_638_1465 271
444 3300053094 Ga0500566_0003407 Ga0500566_0003407_4778_5593 271
445 3300053096 Ga0500641_0052903 Ga0500641_0052903_540_1367 271
446 3300053100 Ga0500660_095581 Ga0500660_095581_330_1154 271
447 3300053134 Ga0500658_0001144 Ga0500658_0001144_2212_3027 271
448 3300053145 Ga0500586_000126 Ga0500586_000126_9333_10169 271
449 3300053145 Ga0500586_000471 Ga0500586_000471_6878_7714 271
450 3300053153 Ga0500616_0001263 Ga0500616_0001263_3664_4515 271
451 3300053155 Ga0500620_000371 Ga0500620_000371_888_1736 271
452 3300053156 Ga0500622_0000746 Ga0500622_0000746_14530_15378 271
453 3300061719 Ga0466962_0004059 Ga0466962_0004059_3370_4206 271
454 iso_pu_bacteria 2508501123 2509117348 271
455 iso_pu_bacteria 2510917028 2511185417 271
456 iso_pu_bacteria 2513237088 2513595238 271
457 iso_pu_bacteria 2513237090 2513607818 271
458 iso_pu_bacteria 2513237138 2513866684 271
459 iso_pu_bacteria 2513237159 2513999101 271
460 iso_pu_bacteria 2515154189 2516023237 271
461 iso_pu_bacteria 2523231067 2523470108 271
462 iso_pu_bacteria 2582581294 2585202323 271
463 iso_pu_bacteria 2582581294 2585204233 271
464 iso_pu_bacteria 2582581299 2585228220 271
465 iso_pu_bacteria 2582581304 2585258652 271
466 iso_pu_bacteria 2582581306 2585265893 271
467 iso_pu_bacteria 2582581865 2585390083 271
468 iso_pu_bacteria 2582581866 2585396962 271
469 iso_pu_bacteria 2582581867 2585401508 271
470 iso_pu_bacteria 2585427590 2585821202 271
471 iso_pu_bacteria 2585427594 2585842611 271
472 iso_pu_bacteria 2599185156 2599335336 271
473 iso_pu_bacteria 2599185301 2599936596 271
474 iso_pu_bacteria 2643221568 2643858173 271
475 iso_pu_bacteria 2643221599 2644003986 271
476 iso_pu_bacteria 2643221599 2644004093 271
477 iso_pu_bacteria 2643221634 2644191593 271
478 iso_pu_bacteria 2657244999 2657683201 271
479 iso_pu_bacteria 2718217991 2719638275 271
480 iso_pu_bacteria 2738541293 2738799900 271
481 iso_pu_bacteria 2738541297 2738829674 271
482 iso_pu_bacteria 2738541357 2739153470 271
483 iso_pu_bacteria 2738543003 2739195390 271
484 iso_pu_bacteria 2738543026 2739321866 271
485 iso_pu_bacteria 2738543029 2739340107 271
486 iso_pu_bacteria 2738543031 2739350797 271
487 iso_pu_bacteria 2739367756 2739791656 271
488 iso_pu_bacteria 2751185846 2753565401 271
489 iso_pu_bacteria 2775507266 2778176588 271
490 iso_pu_bacteria 2791355082 2792584226 271
491 iso_pu_bacteria 2791355091 2792622618 271
492 iso_pu_bacteria 2791355092 2792628462 271
493 iso_pu_bacteria 2791355253 2793280811 271
494 iso_pu_bacteria 2802429268 2804751411 271
495 iso_pu_bacteria 2821443989 2821448476 271
496 iso_pu_bacteria 2842482326 2842486329 271
497 iso_pu_bacteria 2842521101 2842524845 271
498 iso_pu_bacteria 2842922631 2842927040 271
499 iso_pu_bacteria 2844533157 2844534164 271
500 iso_pu_bacteria 2857357740 2857365311 271
501 iso_pu_bacteria 2883087390 2883093562 271
502 iso_pu_bacteria 2896184354 2896185665 271
503 iso_pu_bacteria 2909042592 2909048280 271
504 iso_pu_bacteria 2913295892 2913297380 271
505 iso_pu_bacteria 2919166419 2919169863 271
506 iso_pu_bacteria 2923556063 2923556911 271
507 iso_pu_bacteria 2977864932 2977867993 271
508 iso_pu_bacteria 2978969890 2978972280 271
509 iso_pu_bacteria 2984587000 2984590510 271
510 iso_pu_bacteria 2996887358 2996887498 271
511 iso_pu_bacteria 3000135777 3000140992 271
512 iso_pu_bacteria 3005452660 3005457138 271
513 iso_pu_bacteria 3005452660 3005458515 271
514 iso_pu_bacteria 8005258706 8005258831 271
515 iso_pu_bacteria 8005321885 8005322025 271
516 iso_pu_bacteria 8049293176 8049293984 271
517 iso_pu_bacteria 8054460903 8054465120 271
518 3300005435 Ga0070714_100106170 Ga0070714_1001061701 273
519 3300013100 Ga0157373_10194325 Ga0157373_101943252 273
520 3300025929 Ga0207664_10644988 Ga0207664_106449882 273
521 3300037418 Ga0395900_0123764 Ga0395900_0123764_107_928 273
522 3300044694 Ga0466963_0090938 Ga0466963_0090938_367_1188 273
523 3300044842 Ga0466957_0024784 Ga0466957_0024784_1200_2021 273
524 3300045976 Ga0466967_0179519 Ga0466967_0179519_1062_1883 273
525 3300001979 JGI24740J21852_10001232 JGI24740J21852_100012326 274
526 3300001979 JGI24740J21852_10002276 JGI24740J21852_100022764 274
527 3300001989 JGI24739J22299_10012889 JGI24739J22299_100128893 274
528 3300002067 JGI24735J21928_10009146 JGI24735J21928_100091463 274
529 3300002067 JGI24735J21928_10009735 JGI24735J21928_100097352 274
530 3300002067 JGI24735J21928_10033867 JGI24735J21928_100338672 274
531 3300002077 JGI24744J21845_10000200 JGI24744J21845_100002003 274
532 3300005327 Ga0070658_10016871 Ga0070658_100168712 274
533 3300005327 Ga0070658_10021683 Ga0070658_100216833 274
534 3300005327 Ga0070658_10076002 Ga0070658_100760022 274
535 3300005327 Ga0070658_10107708 Ga0070658_101077082 274
536 3300005327 Ga0070658_10159433 Ga0070658_101594332 274
537 3300005328 Ga0070676_10076204 Ga0070676_100762042 274
538 3300005329 Ga0070683_100005325 Ga0070683_1000053253 274
539 3300005329 Ga0070683_100075480 Ga0070683_1000754803 274
540 3300005330 Ga0070690_100004330 Ga0070690_1000043304 274
541 3300005331 Ga0070670_100052588 Ga0070670_1000525883 274
542 3300005331 Ga0070670_100126192 Ga0070670_1001261922 274
543 3300005333 Ga0070677_10011562 Ga0070677_100115623 274
544 3300005333 Ga0070677_10062094 Ga0070677_100620942 274
545 3300005334 Ga0068869_100548347 Ga0068869_1005483471 274
546 3300005335 Ga0070666_10007359 Ga0070666_100073594 274
547 3300005335 Ga0070666_10014250 Ga0070666_100142502 274
548 3300005335 Ga0070666_10034931 Ga0070666_100349312 274
549 3300005336 Ga0070680_100000896 Ga0070680_1000008967 274
550 3300005336 Ga0070680_100027734 Ga0070680_1000277342 274
551 3300005338 Ga0068868_100153899 Ga0068868_1001538992 274
552 3300005339 Ga0070660_100012465 Ga0070660_1000124652 274
553 3300005339 Ga0070660_100032761 Ga0070660_1000327613 274
554 3300005339 Ga0070660_100161342 Ga0070660_1001613422 274
555 3300005339 Ga0070660_100266824 Ga0070660_1002668242 274
556 3300005341 Ga0070691_10000243 Ga0070691_1000024315 274
557 3300005344 Ga0070661_100000114 Ga0070661_10000011414 274
558 3300005344 Ga0070661_100007497 Ga0070661_1000074973 274
559 3300005344 Ga0070661_100017301 Ga0070661_1000173013 274
560 3300005344 Ga0070661_100046420 Ga0070661_1000464203 274
561 3300005344 Ga0070661_100096305 Ga0070661_1000963053 274
562 3300005344 Ga0070661_100274019 Ga0070661_1002740192 274
563 3300005344 Ga0070661_100278344 Ga0070661_1002783442 274
564 3300005347 Ga0070668_100072978 Ga0070668_1000729782 274
565 3300005353 Ga0070669_100104748 Ga0070669_1001047482 274
566 3300005353 Ga0070669_100322345 Ga0070669_1003223451 274
567 3300005354 Ga0070675_100004750 Ga0070675_1000047503 274
568 3300005355 Ga0070671_100013084 Ga0070671_1000130843 274
569 3300005355 Ga0070671_100021902 Ga0070671_1000219022 274
570 3300005356 Ga0070674_100009553 Ga0070674_1000095533 274
571 3300005356 Ga0070674_100116810 Ga0070674_1001168102 274
572 3300005356 Ga0070674_100231453 Ga0070674_1002314532 274
573 3300005364 Ga0070673_100011648 Ga0070673_1000116483 274
574 3300005364 Ga0070673_100076810 Ga0070673_1000768102 274
575 3300005364 Ga0070673_100303197 Ga0070673_1003031972 274
576 3300005366 Ga0070659_100006154 Ga0070659_1000061544 274
577 3300005366 Ga0070659_100027988 Ga0070659_1000279884 274
578 3300005366 Ga0070659_100029874 Ga0070659_1000298743 274
579 3300005366 Ga0070659_100036187 Ga0070659_1000361873 274
580 3300005367 Ga0070667_100051710 Ga0070667_1000517102 274
581 3300005367 Ga0070667_100060515 Ga0070667_1000605152 274
582 3300005367 Ga0070667_100097175 Ga0070667_1000971752 274
583 3300005435 Ga0070714_100051080 Ga0070714_1000510802 274
584 3300005455 Ga0070663_100275765 Ga0070663_1002757651 274
585 3300005456 Ga0070678_100011116 Ga0070678_1000111163 274
586 3300005456 Ga0070678_100026944 Ga0070678_1000269443 274
587 3300005456 Ga0070678_100142327 Ga0070678_1001423271 274
588 3300005457 Ga0070662_100005842 Ga0070662_1000058424 274
589 3300005457 Ga0070662_100016221 Ga0070662_1000162212 274
590 3300005457 Ga0070662_100016262 Ga0070662_1000162623 274
591 3300005457 Ga0070662_100076892 Ga0070662_1000768922 274
592 3300005457 Ga0070662_100154096 Ga0070662_1001540962 274
593 3300005457 Ga0070662_100261332 Ga0070662_1002613322 274
594 3300005459 Ga0068867_100022953 Ga0068867_1000229534 274
595 3300005459 Ga0068867_100044237 Ga0068867_1000442372 274
596 3300005459 Ga0068867_100097356 Ga0068867_1000973562 274
597 3300005530 Ga0070679_100000084 Ga0070679_10000008434 274
598 3300005530 Ga0070679_100197098 Ga0070679_1001970982 274
599 3300005530 Ga0070679_100400011 Ga0070679_1004000112 274
600 3300005535 Ga0070684_100099624 Ga0070684_1000996243 274
601 3300005539 Ga0068853_100007461 Ga0068853_1000074614 274
602 3300005539 Ga0068853_100303291 Ga0068853_1003032912 274
603 3300005539 Ga0068853_100518696 Ga0068853_1005186962 274
604 3300005543 Ga0070672_100001479 Ga0070672_10000147915 274
605 3300005543 Ga0070672_100027362 Ga0070672_1000273623 274
606 3300005543 Ga0070672_100056292 Ga0070672_1000562922 274
607 3300005548 Ga0070665_100004829 Ga0070665_10000482910 274
608 3300005548 Ga0070665_100025110 Ga0070665_1000251109 274
609 3300005548 Ga0070665_100133769 Ga0070665_1001337692 274
610 3300005548 Ga0070665_100236395 Ga0070665_1002363952 274
611 3300005563 Ga0068855_100510988 Ga0068855_1005109882 274
612 3300005564 Ga0070664_100005462 Ga0070664_1000054625 274
613 3300005564 Ga0070664_100014140 Ga0070664_1000141403 274
614 3300005564 Ga0070664_100030890 Ga0070664_1000308905 274
615 3300005564 Ga0070664_100194836 Ga0070664_1001948362 274
616 3300005564 Ga0070664_100372620 Ga0070664_1003726202 274
617 3300005564 Ga0070664_100472244 Ga0070664_1004722442 274
618 3300005564 Ga0070664_100543573 Ga0070664_1005435732 274
619 3300005577 Ga0068857_100012566 Ga0068857_1000125664 274
620 3300005577 Ga0068857_100270538 Ga0068857_1002705382 274
621 3300005578 Ga0068854_100003724 Ga0068854_1000037244 274
622 3300005614 Ga0068856_100024453 Ga0068856_1000244533 274
623 3300005614 Ga0068856_100077106 Ga0068856_1000771062 274
624 3300005616 Ga0068852_100005727 Ga0068852_1000057273 274
625 3300005616 Ga0068852_100007056 Ga0068852_1000070564 274
626 3300005616 Ga0068852_100122427 Ga0068852_1001224272 274
627 3300005616 Ga0068852_100308098 Ga0068852_1003080982 274
628 3300005616 Ga0068852_100397856 Ga0068852_1003978561 274
629 3300005617 Ga0068859_100040456 Ga0068859_1000404563 274
630 3300005618 Ga0068864_100000487 Ga0068864_1000004878 274
631 3300005618 Ga0068864_100043457 Ga0068864_1000434572 274
632 3300005618 Ga0068864_100078492 Ga0068864_1000784922 274
633 3300005718 Ga0068866_10007066 Ga0068866_100070662 274
634 3300005834 Ga0068851_10009633 Ga0068851_100096333 274
635 3300005834 Ga0068851_10022060 Ga0068851_100220603 274
636 3300005834 Ga0068851_10164207 Ga0068851_101642072 274
637 3300005841 Ga0068863_100060266 Ga0068863_1000602663 274
638 3300005842 Ga0068858_100030052 Ga0068858_1000300523 274
639 3300005843 Ga0068860_100134317 Ga0068860_1001343172 274
640 3300005844 Ga0068862_100541626 Ga0068862_1005416262 274
641 3300006358 Ga0068871_100239414 Ga0068871_1002394142 274
642 3300006881 Ga0068865_100285155 Ga0068865_1002851551 274
643 3300006931 Ga0097620_100040456 Ga0097620_1000404563 274
644 3300009093 Ga0105240_10021229 Ga0105240_100212295 274
645 3300009098 Ga0105245_10031632 Ga0105245_100316327 274
646 3300009098 Ga0105245_10202837 Ga0105245_102028372 274
647 3300009101 Ga0105247_10125008 Ga0105247_101250082 274
648 3300009148 Ga0105243_10022964 Ga0105243_100229643 274
649 3300009148 Ga0105243_10183355 Ga0105243_101833552 274
650 3300009174 Ga0105241_10101119 Ga0105241_101011191 274
651 3300009174 Ga0105241_10106735 Ga0105241_101067352 274
652 3300009176 Ga0105242_10112065 Ga0105242_101120653 274
653 3300009176 Ga0105242_10765998 Ga0105242_107659982 274
654 3300009177 Ga0105248_10001528 Ga0105248_1000152813 274
655 3300009177 Ga0105248_10019256 Ga0105248_100192564 274
656 3300009177 Ga0105248_10023155 Ga0105248_100231552 274
657 3300009177 Ga0105248_10027431 Ga0105248_100274313 274
658 3300009177 Ga0105248_10286789 Ga0105248_102867892 274
659 3300009177 Ga0105248_10291577 Ga0105248_102915772 274
660 3300009177 Ga0105248_10613417 Ga0105248_106134172 274
661 3300009545 Ga0105237_10053612 Ga0105237_100536123 274
662 3300009551 Ga0105238_10006858 Ga0105238_100068585 274
663 3300009551 Ga0105238_10079714 Ga0105238_100797143 274
664 3300009553 Ga0105249_10460336 Ga0105249_104603362 274
665 3300010375 Ga0105239_10039797 Ga0105239_100397973 274
666 3300013100 Ga0157373_10024150 Ga0157373_100241504 274
667 3300013100 Ga0157373_10034558 Ga0157373_100345583 274
668 3300013102 Ga0157371_10024538 Ga0157371_100245384 274
669 3300013102 Ga0157371_10059690 Ga0157371_100596903 274
670 3300013102 Ga0157371_10180469 Ga0157371_101804692 274
671 3300013102 Ga0157371_10307491 Ga0157371_103074912 274
672 3300013102 Ga0157371_10405516 Ga0157371_104055161 274
673 3300013104 Ga0157370_10005211 Ga0157370_100052113 274
674 3300013104 Ga0157370_10102902 Ga0157370_101029022 274
675 3300013105 Ga0157369_10010073 Ga0157369_100100736 274
676 3300013105 Ga0157369_10058693 Ga0157369_100586934 274
677 3300013105 Ga0157369_10120004 Ga0157369_101200043 274
678 3300013105 Ga0157369_10175271 Ga0157369_101752712 274
679 3300013105 Ga0157369_10187962 Ga0157369_101879622 274
680 3300013296 Ga0157374_10316770 Ga0157374_103167701 274
681 3300013297 Ga0157378_10058402 Ga0157378_100584023 274
682 3300013297 Ga0157378_10483429 Ga0157378_104834292 274
683 3300013306 Ga0163162_10387233 Ga0163162_103872332 274
684 3300013307 Ga0157372_10026759 Ga0157372_100267592 274
685 3300014325 Ga0163163_10047514 Ga0163163_100475142 274
686 3300014326 Ga0157380_10505272 Ga0157380_105052722 274
687 3300014968 Ga0157379_10422937 Ga0157379_104229372 274
688 3300014969 Ga0157376_10048842 Ga0157376_100488422 274
689 3300017792 Ga0163161_10026938 Ga0163161_100269382 274
690 3300021358 Ga0213873_10000013 Ga0213873_1000001388 274
691 3300021384 Ga0213876_10000072 Ga0213876_1000007219 274
692 3300021384 Ga0213876_10010220 Ga0213876_100102202 274
693 3300025315 Ga0207697_10027588 Ga0207697_100275882 274
694 3300025321 Ga0207656_10006046 Ga0207656_100060462 274
695 3300025321 Ga0207656_10007905 Ga0207656_100079053 274
696 3300025893 Ga0207682_10006032 Ga0207682_100060325 274
697 3300025893 Ga0207682_10032212 Ga0207682_100322122 274
698 3300025901 Ga0207688_10002384 Ga0207688_100023842 274
699 3300025903 Ga0207680_10005418 Ga0207680_100054182 274
700 3300025903 Ga0207680_10044350 Ga0207680_100443502 274
701 3300025904 Ga0207647_10000769 Ga0207647_1000076918 274
702 3300025904 Ga0207647_10001347 Ga0207647_1000134717 274
703 3300025904 Ga0207647_10021746 Ga0207647_100217463 274
704 3300025904 Ga0207647_10145577 Ga0207647_101455772 274
705 3300025909 Ga0207705_10009397 Ga0207705_100093974 274
706 3300025909 Ga0207705_10016966 Ga0207705_100169663 274
707 3300025909 Ga0207705_10086738 Ga0207705_100867382 274
708 3300025909 Ga0207705_10092501 Ga0207705_100925012 274
709 3300025909 Ga0207705_10103663 Ga0207705_101036632 274
710 3300025909 Ga0207705_10118753 Ga0207705_101187532 274
711 3300025909 Ga0207705_10121531 Ga0207705_101215312 274
712 3300025909 Ga0207705_10158675 Ga0207705_101586752 274
713 3300025913 Ga0207695_10009389 Ga0207695_100093894 274
714 3300025917 Ga0207660_10000951 Ga0207660_100009515 274
715 3300025917 Ga0207660_10011228 Ga0207660_100112283 274
716 3300025917 Ga0207660_10065921 Ga0207660_100659213 274
717 3300025918 Ga0207662_10060289 Ga0207662_100602892 274
718 3300025919 Ga0207657_10003509 Ga0207657_100035097 274
719 3300025919 Ga0207657_10007321 Ga0207657_100073215 274
720 3300025919 Ga0207657_10034689 Ga0207657_100346894 274
721 3300025919 Ga0207657_10048872 Ga0207657_100488723 274
722 3300025919 Ga0207657_10081899 Ga0207657_100818992 274
723 3300025919 Ga0207657_10083170 Ga0207657_100831703 274
724 3300025919 Ga0207657_10096625 Ga0207657_100966252 274
725 3300025919 Ga0207657_10281457 Ga0207657_102814572 274
726 3300025920 Ga0207649_10000011 Ga0207649_1000001149 274
727 3300025920 Ga0207649_10005260 Ga0207649_100052603 274
728 3300025920 Ga0207649_10010641 Ga0207649_100106413 274
729 3300025920 Ga0207649_10018955 Ga0207649_100189552 274
730 3300025920 Ga0207649_10200544 Ga0207649_102005442 274
731 3300025920 Ga0207649_10235117 Ga0207649_102351172 274
732 3300025921 Ga0207652_10000001 Ga0207652_10000001540 274
733 3300025921 Ga0207652_10000002 Ga0207652_10000002188 274
734 3300025921 Ga0207652_10141214 Ga0207652_101412142 274
735 3300025921 Ga0207652_10167226 Ga0207652_101672261 274
736 3300025923 Ga0207681_10162389 Ga0207681_101623892 274
737 3300025923 Ga0207681_10182879 Ga0207681_101828792 274
738 3300025924 Ga0207694_10012853 Ga0207694_100128532 274
739 3300025924 Ga0207694_10026522 Ga0207694_100265223 274
740 3300025925 Ga0207650_10169574 Ga0207650_101695742 274
741 3300025925 Ga0207650_10374292 Ga0207650_103742922 274
742 3300025926 Ga0207659_10018045 Ga0207659_100180455 274
743 3300025926 Ga0207659_10019430 Ga0207659_100194303 274
744 3300025928 Ga0207700_10122472 Ga0207700_101224722 274
745 3300025931 Ga0207644_10001523 Ga0207644_100015237 274
746 3300025931 Ga0207644_10013384 Ga0207644_100133842 274
747 3300025931 Ga0207644_10030632 Ga0207644_100306322 274
748 3300025931 Ga0207644_10139090 Ga0207644_101390902 274
749 3300025932 Ga0207690_10001973 Ga0207690_100019732 274
750 3300025932 Ga0207690_10005548 Ga0207690_100055484 274
751 3300025932 Ga0207690_10014564 Ga0207690_100145643 274
752 3300025932 Ga0207690_10028343 Ga0207690_100283434 274
753 3300025932 Ga0207690_10038777 Ga0207690_100387773 274
754 3300025932 Ga0207690_10074543 Ga0207690_100745431 274
755 3300025932 Ga0207690_10104614 Ga0207690_101046142 274
756 3300025932 Ga0207690_10242763 Ga0207690_102427632 274
757 3300025932 Ga0207690_10243789 Ga0207690_102437892 274
758 3300025933 Ga0207706_10002853 Ga0207706_100028532 274
759 3300025933 Ga0207706_10005711 Ga0207706_100057112 274
760 3300025933 Ga0207706_10016430 Ga0207706_100164303 274
761 3300025933 Ga0207706_10024238 Ga0207706_100242384 274
762 3300025933 Ga0207706_10025153 Ga0207706_100251535 274
763 3300025933 Ga0207706_10078497 Ga0207706_100784972 274
764 3300025933 Ga0207706_10148231 Ga0207706_101482311 274
765 3300025933 Ga0207706_10464812 Ga0207706_104648122 274
766 3300025934 Ga0207686_10010042 Ga0207686_100100423 274
767 3300025937 Ga0207669_10016893 Ga0207669_100168933 274
768 3300025937 Ga0207669_10053759 Ga0207669_100537592 274
769 3300025937 Ga0207669_10158452 Ga0207669_101584522 274
770 3300025937 Ga0207669_10213230 Ga0207669_102132302 274
771 3300025940 Ga0207691_10004286 Ga0207691_1000428612 274
772 3300025940 Ga0207691_10012677 Ga0207691_100126774 274
773 3300025940 Ga0207691_10013663 Ga0207691_100136634 274
774 3300025940 Ga0207691_10045971 Ga0207691_100459713 274
775 3300025940 Ga0207691_10158714 Ga0207691_101587142 274
776 3300025941 Ga0207711_10000345 Ga0207711_1000034531 274
777 3300025941 Ga0207711_10004198 Ga0207711_100041985 274
778 3300025941 Ga0207711_10045263 Ga0207711_100452632 274
779 3300025941 Ga0207711_10051289 Ga0207711_100512892 274
780 3300025941 Ga0207711_10059324 Ga0207711_100593242 274
781 3300025941 Ga0207711_10161344 Ga0207711_101613442 274
782 3300025941 Ga0207711_10223058 Ga0207711_102230582 274
783 3300025942 Ga0207689_10090834 Ga0207689_100908342 274
784 3300025944 Ga0207661_10014283 Ga0207661_100142833 274
785 3300025944 Ga0207661_10027319 Ga0207661_100273192 274
786 3300025944 Ga0207661_10352254 Ga0207661_103522542 274
787 3300025944 Ga0207661_10657162 Ga0207661_106571622 274
788 3300025945 Ga0207679_10013785 Ga0207679_100137853 274
789 3300025945 Ga0207679_10032616 Ga0207679_100326162 274
790 3300025945 Ga0207679_10056492 Ga0207679_100564923 274
791 3300025945 Ga0207679_10085503 Ga0207679_100855032 274
792 3300025949 Ga0207667_10016893 Ga0207667_100168934 274
793 3300025949 Ga0207667_10257889 Ga0207667_102578891 274
794 3300025960 Ga0207651_10013678 Ga0207651_100136787 274
795 3300025960 Ga0207651_10014971 Ga0207651_100149714 274
796 3300025960 Ga0207651_10017450 Ga0207651_100174503 274
797 3300025960 Ga0207651_10289845 Ga0207651_102898452 274
798 3300025972 Ga0207668_10180833 Ga0207668_101808331 274
799 3300025981 Ga0207640_10002725 Ga0207640_100027255 274
800 3300025981 Ga0207640_10046671 Ga0207640_100466713 274
801 3300025981 Ga0207640_10193830 Ga0207640_101938302 274
802 3300025986 Ga0207658_10109899 Ga0207658_101098992 274
803 3300026023 Ga0207677_10036297 Ga0207677_100362972 274
804 3300026035 Ga0207703_10038455 Ga0207703_100384552 274
805 3300026041 Ga0207639_10009043 Ga0207639_100090433 274
806 3300026041 Ga0207639_10188416 Ga0207639_101884162 274
807 3300026041 Ga0207639_10281952 Ga0207639_102819522 274
808 3300026067 Ga0207678_10002237 Ga0207678_100022378 274
809 3300026067 Ga0207678_10020591 Ga0207678_100205913 274
810 3300026067 Ga0207678_10037661 Ga0207678_100376614 274
811 3300026078 Ga0207702_10017005 Ga0207702_100170053 274
812 3300026078 Ga0207702_10122322 Ga0207702_101223222 274
813 3300026078 Ga0207702_10170427 Ga0207702_101704272 274
814 3300026088 Ga0207641_10102045 Ga0207641_101020453 274
815 3300026088 Ga0207641_10281469 Ga0207641_102814691 274
816 3300026089 Ga0207648_10005937 Ga0207648_100059374 274
817 3300026089 Ga0207648_10016189 Ga0207648_100161895 274
818 3300026089 Ga0207648_10121101 Ga0207648_101211013 274
819 3300026095 Ga0207676_10014056 Ga0207676_100140563 274
820 3300026095 Ga0207676_10017609 Ga0207676_100176095 274
821 3300026116 Ga0207674_10005682 Ga0207674_100056825 274
822 3300026116 Ga0207674_10009767 Ga0207674_100097672 274
823 3300026116 Ga0207674_10068073 Ga0207674_100680732 274
824 3300026118 Ga0207675_100120056 Ga0207675_1001200562 274
825 3300026121 Ga0207683_10024569 Ga0207683_100245693 274
826 3300026121 Ga0207683_10040908 Ga0207683_100409083 274
827 3300026121 Ga0207683_10094928 Ga0207683_100949282 274
828 3300026142 Ga0207698_10005661 Ga0207698_100056613 274
829 3300026142 Ga0207698_10066124 Ga0207698_100661242 274
830 3300026142 Ga0207698_10070482 Ga0207698_100704822 274
831 3300026142 Ga0207698_10078488 Ga0207698_100784882 274
832 3300026142 Ga0207698_10329012 Ga0207698_103290122 274
833 3300028379 Ga0268266_10060804 Ga0268266_100608042 274
834 3300028380 Ga0268265_10604031 Ga0268265_106040312 274
835 3300028381 Ga0268264_10105978 Ga0268264_101059783 274
836 3300031548 Ga0307408_100215159 Ga0307408_1002151592 274
837 3300031548 Ga0307408_100231749 Ga0307408_1002317492 274
838 3300031731 Ga0307405_10015120 Ga0307405_100151205 274
839 3300031731 Ga0307405_10034239 Ga0307405_100342392 274
840 3300031824 Ga0307413_10011924 Ga0307413_100119242 274
841 3300031824 Ga0307413_10033469 Ga0307413_100334693 274
842 3300031824 Ga0307413_10211771 Ga0307413_102117712 274
843 3300031852 Ga0307410_10000658 Ga0307410_100006587 274
844 3300031852 Ga0307410_10003486 Ga0307410_100034863 274
845 3300031852 Ga0307410_10059009 Ga0307410_100590093 274
846 3300031852 Ga0307410_10062340 Ga0307410_100623402 274
847 3300031852 Ga0307410_10104777 Ga0307410_101047772 274
848 3300031852 Ga0307410_10134767 Ga0307410_101347672 274
849 3300031852 Ga0307410_10141484 Ga0307410_101414842 274
850 3300031852 Ga0307410_10558877 Ga0307410_105588772 274
851 3300031901 Ga0307406_10007490 Ga0307406_100074903 274
852 3300031901 Ga0307406_10036793 Ga0307406_100367933 274
853 3300031903 Ga0307407_10038425 Ga0307407_100384253 274
854 3300031903 Ga0307407_10088067 Ga0307407_100880672 274
855 3300031903 Ga0307407_10170308 Ga0307407_101703082 274
856 3300031903 Ga0307407_10270566 Ga0307407_102705662 274
857 3300031911 Ga0307412_10017634 Ga0307412_100176342 274
858 3300031911 Ga0307412_10040067 Ga0307412_100400672 274
859 3300031911 Ga0307412_10046028 Ga0307412_100460283 274
860 3300031995 Ga0307409_100016764 Ga0307409_1000167644 274
861 3300031995 Ga0307409_100115037 Ga0307409_1001150372 274
862 3300031995 Ga0307409_100146291 Ga0307409_1001462912 274
863 3300031995 Ga0307409_100616950 Ga0307409_1006169501 274
864 3300032002 Ga0307416_100052040 Ga0307416_1000520402 274
865 3300032002 Ga0307416_100129195 Ga0307416_1001291953 274
866 3300032004 Ga0307414_10020719 Ga0307414_100207192 274
867 3300032004 Ga0307414_10026608 Ga0307414_100266082 274
868 3300032004 Ga0307414_10039495 Ga0307414_100394953 274
869 3300032004 Ga0307414_10042888 Ga0307414_100428882 274
870 3300032004 Ga0307414_10078994 Ga0307414_100789942 274
871 3300032004 Ga0307414_10101051 Ga0307414_101010512 274
872 3300032004 Ga0307414_10461471 Ga0307414_104614712 274
873 3300032005 Ga0307411_10003235 Ga0307411_100032352 274
874 3300032005 Ga0307411_10006548 Ga0307411_100065482 274
875 3300032005 Ga0307411_10007485 Ga0307411_100074853 274
876 3300032005 Ga0307411_10020260 Ga0307411_100202602 274
877 3300032005 Ga0307411_10034980 Ga0307411_100349803 274
878 3300032005 Ga0307411_10060021 Ga0307411_100600213 274
879 3300032005 Ga0307411_10224071 Ga0307411_102240712 274
880 3300032126 Ga0307415_100003615 Ga0307415_1000036155 274
881 3300032126 Ga0307415_100184902 Ga0307415_1001849022 274
882 3300035171 Ga0373946_0070630 Ga0373946_0070630_296_1135 274
883 3300035171 Ga0373946_0090533 Ga0373946_0090533_448_1284 274
884 3300037312 Ga0395899_0067713 Ga0395899_0067713_1614_2450 274
885 3300037312 Ga0395899_0092635 Ga0395899_0092635_564_1400 274
886 3300037312 Ga0395899_0122140 Ga0395899_0122140_320_1156 274
887 3300037418 Ga0395900_0000849 Ga0395900_0000849_21095_21931 274
888 3300037418 Ga0395900_0020627 Ga0395900_0020627_4689_5516 274
889 3300037418 Ga0395900_0029935 Ga0395900_0029935_3998_4834 274
890 3300037418 Ga0395900_0057163 Ga0395900_0057163_2301_3137 274
891 3300037418 Ga0395900_0100913 Ga0395900_0100913_954_1790 274
892 3300037418 Ga0395900_0116182 Ga0395900_0116182_1428_2264 274
893 3300037418 Ga0395900_0128884 Ga0395900_0128884_347_1183 274
894 3300037418 Ga0395900_0281293 Ga0395900_0281293_690_1526 274
895 3300037418 Ga0395900_0339800 Ga0395900_0339800_480_1316 274
896 3300037418 Ga0395900_0503779 Ga0395900_0503779_135_971 274
897 3300037466 Ga0395898_0047421 Ga0395898_0047421_2085_2921 274
898 3300037466 Ga0395898_0216568 Ga0395898_0216568_700_1536 274
899 3300037471 Ga0395905_0000519 Ga0395905_0000519_31570_32406 274
900 3300037471 Ga0395905_0013679 Ga0395905_0013679_4481_5317 274
901 3300037471 Ga0395905_0047940 Ga0395905_0047940_2719_3555 274
902 3300037471 Ga0395905_0152432 Ga0395905_0152432_1231_2067 274
903 3300037471 Ga0395905_0159507 Ga0395905_0159507_933_1769 274
904 3300037471 Ga0395905_0161390 Ga0395905_0161390_322_1158 274
905 3300037471 Ga0395905_0277318 Ga0395905_0277318_518_1354 274
906 3300037471 Ga0395905_0308493 Ga0395905_0308493_622_1458 274
907 3300037471 Ga0395905_0372548 Ga0395905_0372548_295_1131 274
908 3300038443 Ga0395901_0060245 Ga0395901_0060245_2360_3196 274
909 3300038443 Ga0395901_0178969 Ga0395901_0178969_564_1400 274
910 3300038443 Ga0395901_0260621 Ga0395901_0260621_38_874 274
911 3300038443 Ga0395901_0394036 Ga0395901_0394036_534_1370 274
912 3300038443 Ga0395901_0522312 Ga0395901_0522312_82_918 274
913 3300038443 Ga0395901_0684975 Ga0395901_0684975_43_879 274
914 3300039437 Ga0436365_0044388 Ga0436365_0044388_94830_95654 274
915 3300039453 Ga0436362_1051662 Ga0436362_1051662_42765_43589 274
916 3300044693 Ga0466961_0047964 Ga0466961_0047964_697_1521 274
917 3300044694 Ga0466963_0007629 Ga0466963_0007629_639_1463 274
918 3300044694 Ga0466963_0028365 Ga0466963_0028365_1798_2634 274
919 3300044694 Ga0466963_0058547 Ga0466963_0058547_1378_2214 274
920 3300044694 Ga0466963_0179827 Ga0466963_0179827_562_1398 274
921 3300044842 Ga0466957_0033496 Ga0466957_0033496_688_1524 274
922 3300044842 Ga0466957_0056737 Ga0466957_0056737_683_1507 274
923 3300044842 Ga0466957_0107267 Ga0466957_0107267_833_1669 274
924 3300044842 Ga0466957_0177495 Ga0466957_0177495_129_965 274
925 3300044901 Ga0466960_0031638 Ga0466960_0031638_334_1173 274
926 3300045049 Ga0466959_0035270 Ga0466959_0035270_1994_2818 274
927 3300045049 Ga0466959_0194664 Ga0466959_0194664_400_1236 274
928 3300045836 Ga0466958_0058042 Ga0466958_0058042_672_1496 274
929 3300045836 Ga0466958_0106886 Ga0466958_0106886_72_908 274
930 3300045836 Ga0466958_0340064 Ga0466958_0340064_68_904 274
931 3300045976 Ga0466967_0016590 Ga0466967_0016590_2321_3157 274
932 3300045976 Ga0466967_0077393 Ga0466967_0077393_1520_2356 274
933 3300045976 Ga0466967_0078287 Ga0466967_0078287_524_1348 274
934 3300045976 Ga0466967_0132819 Ga0466967_0132819_1162_1986 274
935 3300045976 Ga0466967_0247942 Ga0466967_0247942_636_1472 274
936 3300045976 Ga0466967_0369298 Ga0466967_0369298_155_979 274
937 3300046684 Ga0495669_0059944 Ga0495669_0059944_191_1027 274
938 3300047445 Ga0495677_0014289 Ga0495677_0014289_1246_2082 274
939 3300048904 Ga0496101_0003840 Ga0496101_0003840_7039_7875 274
940 3300048904 Ga0496101_0059856 Ga0496101_0059856_824_1660 274
941 3300048909 Ga0496106_0001460 Ga0496106_0001460_2942_3778 274
942 3300048910 Ga0496107_0022881 Ga0496107_0022881_2161_2985 274
943 3300048911 Ga0496108_0015113 Ga0496108_0015113_4314_5150 274
944 3300048912 Ga0496109_0001761 Ga0496109_0001761_4768_5604 274
945 3300048913 Ga0496110_0009390 Ga0496110_0009390_1446_2282 274
946 3300048913 Ga0496110_0033799 Ga0496110_0033799_1098_1934 274
947 3300048914 Ga0496111_0003665 Ga0496111_0003665_5132_5968 274
948 3300048914 Ga0496111_0035838 Ga0496111_0035838_1715_2551 274
949 3300048915 Ga0496112_0043890 Ga0496112_0043890_2537_3373 274
950 3300048915 Ga0496112_0075067 Ga0496112_0075067_2489_3325 274
951 3300048916 Ga0496113_0012540 Ga0496113_0012540_1157_1993 274
952 3300048917 Ga0496114_0258027 Ga0496114_0258027_602_1438 274
953 3300049570 Ga0501033_0002610 Ga0501033_0002610_4248_5102 274
954 3300049583 Ga0501067_0115013 Ga0501067_0115013_314_1150 274
955 3300049823 Ga0501044_0004321 Ga0501044_0004321_8550_9404 274
956 3300061719 Ga0466962_0000509 Ga0466962_0000509_11165_12001 274

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

104

291

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tqu-assembly1.cif.gz_N crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.8504 1 262
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8317 2 265
3fh6-assembly2.cif.gz_I crystal structure of the resting state maltose transporter from e. coli 0.8255 1 265
2r6g-assembly1.cif.gz_F the crystal structure of the e. coli maltose transporter 0.823 51 258
3fh6-assembly2.cif.gz_I crystal structure of the resting state maltose transporter from e. coli 0.8194 1 265
ID Description Score Start End Superfamily
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9355 11 261 1.10.3720.10
af_P10906_2_274_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9306 2 266 1.10.3720.10
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9221 11 266 1.10.3720.10
af_L7N652_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9219 1 265 1.10.3720.10
af_L7N652_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9152 1 265 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A0C5VSP3-F1-model_v4 ABC-type sugar transport system, permease component 0.9592 9 274 GO:0005886
GO:0055085
AF-A0A2M8GZ55-F1-model_v4 sn-glycerol-3-phosphate transport system permease protein UgpE 0.9584 2 274 GO:0005886
GO:0055085
AF-A0A1M5G0H6-F1-model_v4 sn-glycerol-3-phosphate transport system permease protein UgpE 0.9578 9 274 GO:0005886
GO:0055085
AF-A0A095WVZ1-F1-model_v4 Permease 0.9572 8 272 GO:0005886
GO:0055085
AF-A8F371-F1-model_v4 Binding-protein-dependent transport systems inner membrane component 0.9563 49 274 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
88.65 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map