F486702

General Info

Members Datasets Scaffolds Average Seq Length
955 443 870 534

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100008741|Ga0070689_1000087412
Length 599
Sequence MGDGWQGFQNRMAVMHSDASVRPHYPPPVPIPLQSPDSITPPPMLTSLYVRHFAVVEEAEIAFGPGLTVVSGETGAGKSLLVDALMLLAGARADSGMVRAGSDRAELTAEFDLTQLPEAREWLRRQELDEEDSCQLRRVIRAEGSSRAWINGRPANASQLGELATLLVEIHGQHEHQALLSRAHQMELLDAYAGNEALVAQVRELAQQWXXXXNRIRKLSGGDDRDQRIELLSHELGELDKWALPADELTELEASHKRLANAGRLAEGAGGVVELLDGESEFALRRALGRAQLEMTKLAALDDRLAPLLELLDNASIQLSEAADGLGRYALDVDLDPNRYAEVDTHLTRLHELSRRHRVTVAELHDKAGTLRIELSELEGAGDALEKLATQRMRLQQQYGEHAAQLSQARQQAAERLGGEVSVLMGELGMSGGRLVVELEATSESDPDPQGRERCELLVSANPGQPPRALRKVASGGELARISLAIEVATLGKDTIGTMVFDEVDTGIGGAVAEVVGQKLRALGGQRQVLCVTHLPQVAAQGHAHLRVSKDSDGESTRTRIEKLDANGRRDELARMLGGVEITRETRAHAKQMLERAQV

Samples

Sample ID Description Type Environment
1 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
2 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
3 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
4 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
5 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
6 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
7 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
8 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
9 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
10 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
11 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
12 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
13 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
14 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
15 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
16 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
17 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
18 2671180694 Paenibacillus sp. A3 Isolate Unclassified
19 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
20 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
21 2734482264 Dyella sp. AD052 Isolate Unclassified
22 2738543009 Luteibacter sp. OK325 Isolate Unclassified
23 2739367700 Dyella sp. YR388 Isolate Unclassified
24 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
25 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
26 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
27 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
28 2818991457 Xanthomonas translucens 569 Isolate Unclassified
29 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
30 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
31 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
32 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
33 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
34 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
35 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
36 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
37 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
38 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
39 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
40 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
41 2884411467 Dyella sp. AD56 Isolate Rhizosphere
42 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
43 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
44 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
45 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
46 2919085039 Luteibacter sp. 1214 Isolate Unclassified
47 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
48 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
49 2919404418 Luteibacter sp. 3190 Isolate Unclassified
50 2919513703 Luteimonas sp. 3794 Isolate Unclassified
51 2919675420 Luteimonas terrae 4099 Isolate Unclassified
52 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
53 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
54 2928963466 Dyella japonica 1073 Isolate Unclassified
55 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
56 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
57 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
58 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
59 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
60 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
61 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
62 2941471342 Luteibacter sp. 621 Isolate Unclassified
63 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
64 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
65 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
66 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
67 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
68 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
69 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
70 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
71 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
72 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
73 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
74 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
75 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
76 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
77 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
78 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
79 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
80 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
81 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
82 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
83 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
84 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
85 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
86 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
87 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
88 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
89 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
90 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
91 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
92 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
93 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
94 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
95 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
96 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
97 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
98 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
99 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
100 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
101 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
102 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
103 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
104 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
105 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
106 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
107 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
108 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
109 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
110 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
111 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
112 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
113 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
114 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
115 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
116 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
117 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
118 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
119 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
120 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
121 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
122 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
123 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
124 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
125 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
126 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
127 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
128 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
129 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
130 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
131 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
132 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
133 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
134 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
135 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
136 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
137 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
138 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
139 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
140 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
141 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
142 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
143 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
144 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
145 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
146 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
147 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
148 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
149 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
150 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
151 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
152 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
153 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
154 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
155 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
156 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
157 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
158 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
159 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
160 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
161 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
162 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
163 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
164 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
165 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
166 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
167 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
168 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
169 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
170 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
171 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
172 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
173 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
174 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
175 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
176 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
177 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
178 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
179 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
180 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
181 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
182 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
183 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
184 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
185 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
186 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
187 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
188 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
189 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
190 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
191 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
192 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
193 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
194 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
195 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
196 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
202 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
203 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
205 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
206 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
207 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
210 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
211 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
212 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
213 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
215 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
216 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
217 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
219 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
220 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
221 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
223 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
266 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
270 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
271 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
272 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
273 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
274 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
275 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
276 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
277 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
278 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
279 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
280 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
281 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
282 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
283 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
284 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
285 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
286 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
287 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
288 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
289 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
290 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
291 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
292 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
293 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
294 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
295 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
296 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
297 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
298 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
299 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
300 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
301 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
302 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
303 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
304 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
305 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
306 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
307 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
308 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
309 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
310 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
311 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
312 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
313 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
314 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
315 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
316 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
317 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
318 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
319 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
320 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
321 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
322 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
323 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
324 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
325 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
326 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
327 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
328 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
329 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
330 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
331 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
332 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
333 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
334 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
335 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
336 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
337 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
338 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
339 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
340 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
341 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
342 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
343 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
344 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
345 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
346 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
347 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
348 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
349 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
350 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
351 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
352 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
353 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
354 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
355 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
356 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
357 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
358 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
359 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
360 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
361 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
362 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
363 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
364 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
365 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
366 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
367 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
368 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
369 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
370 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
371 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
372 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
373 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
374 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
375 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
376 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
377 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
378 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
379 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
380 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
381 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
382 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
398 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
399 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
400 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
401 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
402 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
403 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
404 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
405 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
406 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
407 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
408 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
409 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
410 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
411 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
414 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
415 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
416 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
417 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
418 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
419 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
420 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
421 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
422 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
423 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
424 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
425 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
426 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
427 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
428 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
429 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
430 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
431 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
432 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
433 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
434 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
435 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
436 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
437 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
438 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
439 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
440 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
441 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
442 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
443 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.37
Metatranscriptomes 0.73
Isolates 8.9

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 16.34
Nodule 0.21
Rhizoplane 2.41
Rhizosphere 65.34
Stem 0
Stem Tuber 0
Unclassified 15.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1009606 3300001915 Bacteria 1769
2 JGI24740J21852_10004853 3300001979 Bacteria 5719
3 JGI24739J22299_10000167 3300001989 Bacteria 21671
4 JGI25156J39149_1001689 3300002705 Bacteria 8887
5 JGI25156J39149_1008279 3300002705 Bacteria 2635
6 JGI25162J39368_1002522 3300002737 Bacteria 7004
7 JGI25162J39368_1002756 3300002737 Bacteria 6268
8 JGI25162J39368_1002946 3300002737 Bacteria 5748
9 JGI25162J39368_1003492 3300002737 Bacteria 4485
10 JGI25157J39369_1000760 3300002741 Bacteria 16774
11 JGI25157J39369_1001514 3300002741 Bacteria 8465
12 JGI25157J39369_1001601 3300002741 Bacteria 7926
13 JGI25163J39215_1001514 3300002771 Bacteria 3659
14 JGI25164J39214_1000049 3300002772 Bacteria 123464
15 JGI25164J39214_1000088 3300002772 Bacteria 91375
16 JGI25164J39214_1001313 3300002772 Bacteria 6260
17 JGI25164J39214_1001318 3300002772 Bacteria 6234
18 JGI25152J39213_1000102 3300002773 Bacteria 59507
19 JGI25150J39212_1000099 3300002774 Bacteria 49634
20 JGI25150J39212_1000290 3300002774 Bacteria 26031
21 JGI25151J46595_10000041 3300003187 Bacteria 174472
22 JGI25151J46595_10000269 3300003187 Bacteria 59507
23 JGI25151J46595_10011611 3300003187 Bacteria 4042
24 JGI25165J46597_1000009 3300003214 Bacteria 467965
25 JGI25165J46597_1000088 3300003214 Bacteria 169821
26 JGI25165J46597_1002376 3300003214 Bacteria 6268
27 JGI25165J46597_1002837 3300003214 Bacteria 4966
28 JGI25153J46596_10000189 3300003215 Bacteria 59507
29 rootH2_10092143 3300003320 Bacteria 5533
30 Ga0006562J51391_1029636 3300003578 Bacteria 10630
31 Ga0006562J51391_1029638 3300003578 Bacteria 2260
32 Ga0055525_1000146 3300003759 Bacteria 97114
33 Ga0055527_1000328 3300003760 Bacteria 25551
34 Ga0055527_1000605 3300003760 Bacteria 11556
35 Ga0055535_1000082 3300003761 Bacteria 106958
36 Ga0055535_1000745 3300003761 Bacteria 24313
37 Ga0055535_1000756 3300003761 Bacteria 24051
38 Ga0055535_1001284 3300003761 Bacteria 13598
39 Ga0055542_1000765 3300003762 Bacteria 24313
40 Ga0055542_1000774 3300003762 Bacteria 24051
41 Ga0055542_1000856 3300003762 Bacteria 21343
42 Ga0055542_1001065 3300003762 Bacteria 16915
43 Ga0055542_1002159 3300003762 Bacteria 7122
44 Ga0055542_1002186 3300003762 Bacteria 7004
45 Ga0055529_1000020 3300003763 Bacteria 324857
46 Ga0055529_1000663 3300003763 Bacteria 24291
47 Ga0055529_1000666 3300003763 Bacteria 24043
48 Ga0055529_1000887 3300003763 Bacteria 16921
49 Ga0055526_1006635 3300003771 Bacteria 6219
50 Ga0055537_1000407 3300003773 Bacteria 28206
51 Ga0055524_1017968 3300003775 Bacteria 2475
52 Ga0055536_1005286 3300003781 Bacteria 6357
53 Ga0055536_1005928 3300003781 Bacteria 5844
54 Ga0055536_1006000 3300003781 Bacteria 5776
55 Ga0055536_1019665 3300003781 Bacteria 2115
56 Ga0055534_1000039 3300003784 Bacteria 104863
57 Ga0055528_1000529 3300003790 Bacteria 29538
58 Ga0055530_10002892 3300003791 Bacteria 10448
59 Ga0055530_10005063 3300003791 Bacteria 6471
60 Ga0055530_10008054 3300003791 Bacteria 4296
61 Ga0055531_10006146 3300003794 Bacteria 6871
62 Ga0055531_10007661 3300003794 Bacteria 5844
63 Ga0055531_10007781 3300003794 Bacteria 5776
64 Ga0055531_10011589 3300003794 Bacteria 4231
65 Ga0058692_1000018 3300003856 Bacteria 264544
66 Ga0065165_1003051 3300005262 Bacteria 12552
67 Ga0065704_10002333 3300005289 Bacteria 7689
68 Ga0065704_10072174 3300005289 Bacteria 9007
69 Ga0065715_10093484 3300005293 Bacteria 4663
70 Ga0065715_10110437 3300005293 Bacteria 2620
71 Ga0070658_10012294 3300005327 Bacteria 6873
72 Ga0070670_100007924 3300005331 Bacteria 9039
73 Ga0070666_10000003 3300005335 Bacteria 463666
74 Ga0070666_10000757 3300005335 Bacteria 19578
75 Ga0070666_10009654 3300005335 Bacteria 6024
76 Ga0070680_100008297 3300005336 Bacteria 7947
77 Ga0070680_100073618 3300005336 Bacteria 2810
78 Ga0070682_100002136 3300005337 Bacteria 10982
79 Ga0070682_100008145 3300005337 Bacteria 5911
80 Ga0068868_100007207 3300005338 Bacteria 7901
81 Ga0068868_100027499 3300005338 Bacteria 4340
82 Ga0068868_100032309 3300005338 Bacteria 4026
83 Ga0070660_100011933 3300005339 Bacteria 6199
84 Ga0070660_100025556 3300005339 Bacteria 4390
85 Ga0070660_100051136 3300005339 Bacteria 3181
86 Ga0070689_100008741 3300005340 Bacteria 7150
87 Ga0070691_10000561 3300005341 Bacteria 14128
88 Ga0070661_100001862 3300005344 Bacteria 14599
89 Ga0070661_100033926 3300005344 Bacteria 3700
90 Ga0070661_100104718 3300005344 Bacteria 2108
91 Ga0070692_10000139 3300005345 Bacteria 17503
92 Ga0070692_10001873 3300005345 Bacteria 7918
93 Ga0070669_100016268 3300005353 Bacteria 5306
94 Ga0070669_100079690 3300005353 Bacteria 2436
95 Ga0070675_100013380 3300005354 Bacteria 6448
96 Ga0070659_100007436 3300005366 Bacteria 7959
97 Ga0070667_100000084 3300005367 Bacteria 118027
98 Ga0070667_100009456 3300005367 Bacteria 8086
99 Ga0070667_100149360 3300005367 Bacteria 2052
100 Ga0070714_100000372 3300005435 Bacteria 33436
101 Ga0070714_100000713 3300005435 Bacteria 23558
102 Ga0070714_100013529 3300005435 Bacteria 6540
103 Ga0070714_100021754 3300005435 Bacteria 5249
104 Ga0070714_100022773 3300005435 Bacteria 5139
105 Ga0070694_100032508 3300005444 Bacteria 3426
106 Ga0070663_100041672 3300005455 Bacteria 3223
107 Ga0070663_100069432 3300005455 Bacteria 2560
108 Ga0070678_100003696 3300005456 Bacteria 8558
109 Ga0070681_10009408 3300005458 Bacteria 9616
110 Ga0070681_10017636 3300005458 Bacteria 7134
111 Ga0070681_10025596 3300005458 Bacteria 5936
112 Ga0068867_100071691 3300005459 Bacteria 2592
113 Ga0070685_10004666 3300005466 Bacteria 6934
114 Ga0070698_100064803 3300005471 Bacteria 3680
115 Ga0070679_100016456 3300005530 Bacteria 7134
116 Ga0070679_100081626 3300005530 Bacteria 3222
117 Ga0070679_100106460 3300005530 Bacteria 2790
118 Ga0070679_100127285 3300005530 Bacteria 2529
119 Ga0070684_100033959 3300005535 Bacteria 4359
120 Ga0068853_100002068 3300005539 Bacteria 14881
121 Ga0068853_100004423 3300005539 Bacteria 10877
122 Ga0068853_100012109 3300005539 Bacteria 7016
123 Ga0068853_100139593 3300005539 Bacteria 2175
124 Ga0070672_100009562 3300005543 Bacteria 6689
125 Ga0070696_100000851 3300005546 Bacteria 19698
126 Ga0070696_100001442 3300005546 Bacteria 15555
127 Ga0070696_100011770 3300005546 Bacteria 5863
128 Ga0070693_100004059 3300005547 Bacteria 6892
129 Ga0070665_100013099 3300005548 Bacteria 8350
130 Ga0070665_100023453 3300005548 Bacteria 6213
131 Ga0070665_100037857 3300005548 Bacteria 4849
132 Ga0068855_100020753 3300005563 Bacteria 7879
133 Ga0068855_100031696 3300005563 Bacteria 6311
134 Ga0068855_100108259 3300005563 Bacteria 3192
135 Ga0068855_100171159 3300005563 Bacteria 2460
136 Ga0068857_100004292 3300005577 Bacteria 12022
137 Ga0068857_100020788 3300005577 Bacteria 5775
138 Ga0068854_100003470 3300005578 Bacteria 9844
139 Ga0068854_100007127 3300005578 Bacteria 7138
140 Ga0068854_100010098 3300005578 Bacteria 6116
141 Ga0068856_100000983 3300005614 Bacteria 30421
142 Ga0068856_100052772 3300005614 Bacteria 4010
143 Ga0068852_100021578 3300005616 Bacteria 5146
144 Ga0068852_100057982 3300005616 Bacteria 3352
145 Ga0068859_100021151 3300005617 Bacteria 6529
146 Ga0068859_100061891 3300005617 Bacteria 3772
147 Ga0068859_100186169 3300005617 Bacteria 2160
148 Ga0068864_100030923 3300005618 Bacteria 4540
149 Ga0068864_100128090 3300005618 Bacteria 2277
150 Ga0068851_10004998 3300005834 Bacteria 6006
151 Ga0068870_10009151 3300005840 Bacteria 4489
152 Ga0068863_100013560 3300005841 Bacteria 7863
153 Ga0068863_100127670 3300005841 Bacteria 2427
154 Ga0068860_100009881 3300005843 Bacteria 9460
155 Ga0068860_100105026 3300005843 Bacteria 2697
156 Ga0068862_100064307 3300005844 Bacteria 3158
157 Ga0075364_10001000 3300006051 Bacteria 14962
158 Ga0097621_100019126 3300006237 Bacteria 5250
159 Ga0068871_100012103 3300006358 Bacteria 6350
160 Ga0075428_100009101 3300006844 Bacteria 11018
161 Ga0075428_100057180 3300006844 Bacteria 4270
162 Ga0075433_10005362 3300006852 Bacteria 10068
163 Ga0075434_100000572 3300006871 Bacteria 28363
164 Ga0075434_100071461 3300006871 Bacteria 3462
165 Ga0068865_100042758 3300006881 Bacteria 3092
166 Ga0097620_100021151 3300006931 Bacteria 6529
167 Ga0097620_100061888 3300006931 Bacteria 3772
168 Ga0097620_100186173 3300006931 Bacteria 2160
169 Ga0075435_100063636 3300007076 Bacteria 2996
170 Ga0105251_10000880 3300009011 Bacteria 26879
171 Ga0105251_10009176 3300009011 Bacteria 5877
172 Ga0105240_10012346 3300009093 Bacteria 11795
173 Ga0105240_10035843 3300009093 Bacteria 6388
174 Ga0105240_10043064 3300009093 Bacteria 5748
175 Ga0105240_10049909 3300009093 Bacteria 5278
176 Ga0105240_10063542 3300009093 Bacteria 4592
177 Ga0105240_10084533 3300009093 Bacteria 3891
178 Ga0105240_10097448 3300009093 Bacteria 3583
179 Ga0111539_10006755 3300009094 Bacteria 14763
180 Ga0105245_10003428 3300009098 Bacteria 14208
181 Ga0105245_10116590 3300009098 Bacteria 2490
182 Ga0105247_10010854 3300009101 Bacteria 5502
183 Ga0105243_10021826 3300009148 Bacteria 4861
184 Ga0105241_10042237 3300009174 Bacteria 3448
185 Ga0105241_10076264 3300009174 Bacteria 2614
186 Ga0105242_10001298 3300009176 Bacteria 19754
187 Ga0105242_10044328 3300009176 Bacteria 3602
188 Ga0105248_10000429 3300009177 Bacteria 47562
189 Ga0105248_10005167 3300009177 Bacteria 14394
190 Ga0105248_10054583 3300009177 Bacteria 4481
191 Ga0105237_10000016 3300009545 Bacteria 256506
192 Ga0105237_10000388 3300009545 Bacteria 62620
193 Ga0105238_10000362 3300009551 Bacteria 48708
194 Ga0105238_10002989 3300009551 Bacteria 16888
195 Ga0105238_10024524 3300009551 Bacteria 6147
196 Ga0105238_10032850 3300009551 Bacteria 5282
197 Ga0105238_10072023 3300009551 Bacteria 3453
198 Ga0105238_10097547 3300009551 Bacteria 2925
199 Ga0105249_10009937 3300009553 Bacteria 8345
200 Ga0105030_100130 3300009987 Bacteria 5905
201 Ga0105239_10000063 3300010375 Bacteria 151845
202 Ga0105239_10007002 3300010375 Bacteria 12975
203 Ga0105239_10012123 3300010375 Bacteria 9611
204 Ga0105239_10013284 3300010375 Bacteria 9149
205 Ga0105239_10038848 3300010375 Bacteria 5215
206 Ga0105239_10069647 3300010375 Bacteria 3865
207 Ga0157373_10005152 3300013100 Bacteria 9826
208 Ga0157373_10022169 3300013100 Bacteria 4608
209 Ga0157371_10000487 3300013102 Bacteria 48309
210 Ga0157371_10002814 3300013102 Bacteria 16290
211 Ga0157371_10010486 3300013102 Bacteria 7211
212 Ga0157371_10028762 3300013102 Bacteria 4023
213 Ga0157370_10010813 3300013104 Bacteria 9591
214 Ga0157370_10013028 3300013104 Bacteria 8587
215 Ga0157370_10014321 3300013104 Bacteria 8115
216 Ga0157370_10025566 3300013104 Bacteria 5844
217 Ga0157369_10000027 3300013105 Bacteria 213988
218 Ga0157369_10002364 3300013105 Bacteria 22678
219 Ga0157369_10016391 3300013105 Bacteria 8335
220 Ga0157369_10042658 3300013105 Bacteria 4949
221 Ga0157374_10080245 3300013296 Bacteria 3094
222 Ga0157378_10000006 3300013297 Bacteria 192683
223 Ga0157378_10026393 3300013297 Bacteria 5120
224 Ga0163162_10000357 3300013306 Bacteria 41422
225 Ga0163162_10002734 3300013306 Bacteria 16743
226 Ga0163162_10031567 3300013306 Bacteria 5255
227 Ga0157372_10003304 3300013307 Bacteria 17420
228 Ga0157372_10027342 3300013307 Bacteria 6211
229 Ga0157372_10036984 3300013307 Bacteria 5382
230 Ga0157372_10053894 3300013307 Bacteria 4484
231 Ga0157372_10121842 3300013307 Bacteria 2996
232 Ga0157375_10000102 3300013308 Bacteria 86408
233 Ga0157375_10004302 3300013308 Bacteria 12350
234 Ga0157375_10055469 3300013308 Bacteria 3907
235 Ga0157375_10287370 3300013308 Bacteria 1807
236 Ga0163163_10000877 3300014325 Bacteria 25623
237 Ga0163163_10023588 3300014325 Bacteria 5840
238 Ga0182008_10000143 3300014497 Bacteria 55118
239 Ga0182008_10007235 3300014497 Bacteria 6138
240 Ga0182008_10018312 3300014497 Bacteria 3626
241 Ga0182008_10026014 3300014497 Bacteria 2969
242 Ga0157379_10000992 3300014968 Bacteria 23037
243 Ga0157379_10001842 3300014968 Bacteria 17527
244 Ga0157376_10003668 3300014969 Bacteria 10602
245 Ga0157376_10008252 3300014969 Bacteria 7501
246 Ga0157376_10206001 3300014969 Bacteria 1813
247 Ga0182006_1000074 3300015261 Bacteria 130403
248 Ga0182006_1001229 3300015261 Bacteria 15917
249 Ga0182006_1018348 3300015261 Bacteria 2958
250 Ga0182007_10000043 3300015262 Bacteria 107693
251 Ga0182007_10004954 3300015262 Bacteria 5938
252 Ga0182005_1000267 3300015265 Bacteria 32953
253 Ga0182005_1000326 3300015265 Bacteria 28190
254 Ga0182005_1001110 3300015265 Bacteria 11246
255 Ga0182005_1002979 3300015265 Bacteria 5862
256 Ga0183369_1006 3300015685 Bacteria 449058
257 Ga0183368_1004 3300015687 Bacteria 1211761
258 Ga0163161_10007748 3300017792 Bacteria 7428
259 Ga0197907_10862894 3300020069 Bacteria 2956
260 Ga0197907_11474155 3300020069 Bacteria 2395
261 Ga0206356_10168839 3300020070 Bacteria 6249
262 Ga0206351_10908139 3300020077 Bacteria 2664
263 Ga0206353_10073144 3300020082 Bacteria 2454
264 Ga0209784_100013 3300025224 Bacteria 518664
265 Ga0209566_100544 3300025225 Bacteria 25458
266 Ga0209674_100026 3300025226 Bacteria 490631
267 Ga0209674_100062 3300025226 Bacteria 276316
268 Ga0209674_100974 3300025226 Bacteria 8974
269 Ga0209672_100007 3300025228 Bacteria 959482
270 Ga0209672_100017 3300025228 Bacteria 514236
271 Ga0209672_100743 3300025228 Bacteria 15906
272 Ga0209672_100839 3300025228 Bacteria 14268
273 Ga0209672_102291 3300025228 Bacteria 4891
274 Ga0209563_100131 3300025230 Bacteria 97465
275 Ga0207427_100021 3300025231 Bacteria 494115
276 Ga0207427_100073 3300025231 Bacteria 156503
277 Ga0207427_100289 3300025231 Bacteria 35918
278 Ga0207427_100306 3300025231 Bacteria 34125
279 Ga0209437_100012 3300025233 Bacteria 792625
280 Ga0209437_100039 3300025233 Bacteria 448321
281 Ga0209437_100087 3300025233 Bacteria 253432
282 Ga0209437_100129 3300025233 Bacteria 184661
283 Ga0209437_100159 3300025233 Bacteria 149598
284 Ga0209437_100637 3300025233 Bacteria 20495
285 Ga0209258_100017 3300025242 Bacteria 590785
286 Ga0209258_100019 3300025242 Bacteria 566728
287 Ga0209258_100206 3300025242 Bacteria 119449
288 Ga0209258_100213 3300025242 Bacteria 115394
289 Ga0209258_100594 3300025242 Bacteria 29847
290 Ga0209258_102146 3300025242 Bacteria 5484
291 Ga0207425_1000092 3300025245 Bacteria 87673
292 Ga0209646_1001828 3300025246 Bacteria 5261
293 Ga0209026_1000051 3300025250 Bacteria 250792
294 Ga0209026_1000079 3300025250 Bacteria 198355
295 Ga0209026_1000125 3300025250 Bacteria 124729
296 Ga0209026_1000592 3300025250 Bacteria 23632
297 Ga0209026_1002773 3300025250 Bacteria 6249
298 Ga0209677_100969 3300025253 Bacteria 13954
299 Ga0209148_1000001 3300025254 Bacteria 2545271
300 Ga0209148_1000005 3300025254 Bacteria 1806504
301 Ga0209148_1000009 3300025254 Bacteria 1395625
302 Ga0209148_1000044 3300025254 Bacteria 458417
303 Ga0209148_1000176 3300025254 Bacteria 128357
304 Ga0209148_1000185 3300025254 Bacteria 118117
305 Ga0209759_1000145 3300025256 Bacteria 121772
306 Ga0209759_1000328 3300025256 Bacteria 62531
307 Ga0209759_1002334 3300025256 Bacteria 8510
308 Ga0209759_1005371 3300025256 Bacteria 4509
309 Ga0209129_1000151 3300025258 Bacteria 113221
310 Ga0209129_1003459 3300025258 Bacteria 6852
311 Ga0209129_1007561 3300025258 Bacteria 3205
312 Ga0209233_1000002 3300025261 Bacteria 2501366
313 Ga0209233_1000020 3300025261 Bacteria 798224
314 Ga0209233_1000023 3300025261 Bacteria 738870
315 Ga0209233_1000090 3300025261 Bacteria 315680
316 Ga0209565_1000014 3300025263 Bacteria 530302
317 Ga0209455_1000010 3300025272 Bacteria 959482
318 Ga0209455_1000027 3300025272 Bacteria 566710
319 Ga0209455_1000032 3300025272 Bacteria 514243
320 Ga0209455_1000081 3300025272 Bacteria 263674
321 Ga0209673_1000171 3300025273 Bacteria 133493
322 Ga0209130_1012874 3300025284 Bacteria 2166
323 Ga0209675_1000011 3300025291 Bacteria 520597
324 Ga0209675_1016461 3300025291 Bacteria 2152
325 Ga0209676_1000079 3300025292 Bacteria 290447
326 Ga0209676_1000086 3300025292 Bacteria 264155
327 Ga0209676_1000092 3300025292 Bacteria 250453
328 Ga0209676_1002465 3300025292 Bacteria 13076
329 Ga0209676_1003076 3300025292 Bacteria 10754
330 Ga0209676_1003077 3300025292 Bacteria 10754
331 Ga0209676_1006826 3300025292 Bacteria 5536
332 Ga0209025_1000012 3300025294 Bacteria 924362
333 Ga0209025_1000015 3300025294 Bacteria 808120
334 Ga0209025_1002444 3300025294 Bacteria 19667
335 Ga0209025_1008928 3300025294 Bacteria 7094
336 Ga0209564_1000221 3300025295 Bacteria 129537
337 Ga0209758_1000018 3300025297 Bacteria 753320
338 Ga0209758_1005446 3300025297 Bacteria 9799
339 Ga0209758_1008116 3300025297 Bacteria 6909
340 Ga0209758_1015576 3300025297 Bacteria 3924
341 Ga0209758_1016918 3300025297 Bacteria 3671
342 Ga0209050_1000329 3300025298 Bacteria 94932
343 Ga0209050_1000415 3300025298 Bacteria 79058
344 Ga0209050_1000528 3300025298 Bacteria 63464
345 Ga0209050_1004837 3300025298 Bacteria 8846
346 Ga0209050_1005515 3300025298 Bacteria 7908
347 Ga0209256_1004521 3300025299 Bacteria 8679
348 Ga0209256_1018718 3300025299 Bacteria 2235
349 Ga0209051_1002764 3300025303 Bacteria 12119
350 Ga0209051_1007093 3300025303 Bacteria 6193
351 Ga0209051_1032538 3300025303 Bacteria 1987
352 Ga0209257_1000080 3300025304 Bacteria 312038
353 Ga0209257_1000081 3300025304 Bacteria 306577
354 Ga0209257_1000121 3300025304 Bacteria 222588
355 Ga0209257_1000145 3300025304 Bacteria 195152
356 Ga0209257_1002505 3300025304 Bacteria 18133
357 Ga0209257_1004877 3300025304 Bacteria 9909
358 Ga0209257_1005274 3300025304 Bacteria 9213
359 Ga0209257_1015664 3300025304 Bacteria 3135
360 Ga0207656_10001780 3300025321 Bacteria 7168
361 Ga0207713_1000710 3300025735 Bacteria 31158
362 Ga0207713_1009080 3300025735 Bacteria 5647
363 Ga0207710_10034415 3300025900 Bacteria 2226
364 Ga0207680_10000006 3300025903 Bacteria 635950
365 Ga0207680_10020353 3300025903 Bacteria 3569
366 Ga0207647_10000607 3300025904 Bacteria 27924
367 Ga0207647_10001539 3300025904 Bacteria 17764
368 Ga0207647_10002712 3300025904 Bacteria 13374
369 Ga0207647_10012222 3300025904 Bacteria 5985
370 Ga0207647_10024280 3300025904 Bacteria 3999
371 Ga0207645_10013275 3300025907 Bacteria 5557
372 Ga0207705_10000165 3300025909 Bacteria 71603
373 Ga0207705_10000353 3300025909 Bacteria 41498
374 Ga0207705_10000355 3300025909 Bacteria 41474
375 Ga0207705_10001403 3300025909 Bacteria 19215
376 Ga0207705_10008340 3300025909 Bacteria 7564
377 Ga0207707_10000391 3300025912 Bacteria 45809
378 Ga0207707_10001033 3300025912 Bacteria 26719
379 Ga0207707_10001308 3300025912 Bacteria 23205
380 Ga0207707_10010325 3300025912 Bacteria 8102
381 Ga0207707_10011013 3300025912 Bacteria 7869
382 Ga0207707_10012035 3300025912 Bacteria 7521
383 Ga0207707_10017065 3300025912 Bacteria 6325
384 Ga0207707_10046729 3300025912 Bacteria 3771
385 Ga0207707_10051686 3300025912 Bacteria 3579
386 Ga0207695_10000975 3300025913 Bacteria 50860
387 Ga0207695_10006463 3300025913 Bacteria 15214
388 Ga0207695_10007085 3300025913 Bacteria 14367
389 Ga0207695_10009557 3300025913 Bacteria 11986
390 Ga0207695_10011615 3300025913 Bacteria 10651
391 Ga0207695_10012347 3300025913 Bacteria 10263
392 Ga0207695_10031715 3300025913 Bacteria 5791
393 Ga0207695_10046563 3300025913 Bacteria 4597
394 Ga0207695_10087165 3300025913 Bacteria 3145
395 Ga0207671_10000137 3300025914 Bacteria 112029
396 Ga0207671_10003811 3300025914 Bacteria 14763
397 Ga0207671_10004200 3300025914 Bacteria 13892
398 Ga0207660_10000931 3300025917 Bacteria 19331
399 Ga0207660_10001391 3300025917 Bacteria 16259
400 Ga0207660_10003395 3300025917 Bacteria 10378
401 Ga0207660_10005061 3300025917 Bacteria 8583
402 Ga0207657_10010252 3300025919 Bacteria 9360
403 Ga0207657_10017203 3300025919 Bacteria 6945
404 Ga0207649_10005594 3300025920 Bacteria 6795
405 Ga0207649_10031454 3300025920 Bacteria 3154
406 Ga0207649_10089027 3300025920 Bacteria 2017
407 Ga0207652_10000030 3300025921 Bacteria 144884
408 Ga0207652_10001197 3300025921 Bacteria 23349
409 Ga0207652_10041489 3300025921 Bacteria 3912
410 Ga0207681_10004705 3300025923 Bacteria 8395
411 Ga0207694_10000563 3300025924 Bacteria 33592
412 Ga0207694_10004402 3300025924 Bacteria 11002
413 Ga0207694_10012219 3300025924 Bacteria 6473
414 Ga0207694_10012898 3300025924 Bacteria 6292
415 Ga0207694_10041831 3300025924 Bacteria 3532
416 Ga0207650_10044596 3300025925 Bacteria 3260
417 Ga0207700_10000822 3300025928 Bacteria 17939
418 Ga0207664_10000474 3300025929 Bacteria 28453
419 Ga0207664_10000584 3300025929 Bacteria 25442
420 Ga0207664_10000585 3300025929 Bacteria 25440
421 Ga0207644_10000313 3300025931 Bacteria 31603
422 Ga0207644_10060403 3300025931 Bacteria 2743
423 Ga0207690_10000443 3300025932 Bacteria 26830
424 Ga0207690_10001772 3300025932 Bacteria 13272
425 Ga0207690_10001851 3300025932 Bacteria 13004
426 Ga0207690_10001946 3300025932 Bacteria 12658
427 Ga0207690_10007510 3300025932 Bacteria 6470
428 Ga0207690_10008552 3300025932 Bacteria 6074
429 Ga0207690_10009506 3300025932 Bacteria 5775
430 Ga0207706_10029417 3300025933 Bacteria 4903
431 Ga0207709_10018744 3300025935 Bacteria 3880
432 Ga0207670_10005060 3300025936 Bacteria 7190
433 Ga0207704_10001296 3300025938 Bacteria 11176
434 Ga0207691_10007639 3300025940 Bacteria 10406
435 Ga0207711_10001015 3300025941 Bacteria 26915
436 Ga0207711_10004854 3300025941 Bacteria 11428
437 Ga0207711_10061557 3300025941 Bacteria 3237
438 Ga0207661_10004417 3300025944 Bacteria 9865
439 Ga0207667_10000250 3300025949 Bacteria 75738
440 Ga0207667_10000679 3300025949 Bacteria 44080
441 Ga0207667_10001003 3300025949 Bacteria 36039
442 Ga0207667_10001167 3300025949 Bacteria 32985
443 Ga0207667_10005715 3300025949 Bacteria 15171
444 Ga0207667_10016516 3300025949 Bacteria 8337
445 Ga0207712_10000343 3300025961 Bacteria 42053
446 Ga0207640_10001071 3300025981 Bacteria 15167
447 Ga0207640_10003830 3300025981 Bacteria 8116
448 Ga0207640_10005529 3300025981 Bacteria 6887
449 Ga0207658_10000093 3300025986 Bacteria 98928
450 Ga0207677_10094535 3300026023 Bacteria 2182
451 Ga0207639_10001634 3300026041 Bacteria 15086
452 Ga0207639_10002124 3300026041 Bacteria 13352
453 Ga0207639_10005666 3300026041 Bacteria 8451
454 Ga0207639_10007609 3300026041 Bacteria 7389
455 Ga0207678_10000433 3300026067 Bacteria 37961
456 Ga0207678_10005962 3300026067 Bacteria 10852
457 Ga0207678_10050893 3300026067 Bacteria 3578
458 Ga0207678_10080157 3300026067 Bacteria 2795
459 Ga0207702_10000943 3300026078 Bacteria 29865
460 Ga0207702_10003531 3300026078 Bacteria 14234
461 Ga0207702_10140169 3300026078 Bacteria 2187
462 Ga0207648_10029340 3300026089 Bacteria 4878
463 Ga0207674_10007214 3300026116 Bacteria 12971
464 Ga0207674_10019944 3300026116 Bacteria 7255
465 Ga0207674_10024820 3300026116 Bacteria 6399
466 Ga0207674_10065193 3300026116 Bacteria 3672
467 Ga0207674_10066528 3300026116 Bacteria 3630
468 Ga0207683_10025237 3300026121 Bacteria 5125
469 Ga0207698_10000592 3300026142 Bacteria 21149
470 Ga0207698_10002980 3300026142 Bacteria 10149
471 Ga0207698_10038811 3300026142 Bacteria 3522
472 Ga0209371_1000011 3300027312 Bacteria 848456
473 Ga0268266_10000043 3300028379 Bacteria 316604
474 Ga0268266_10045565 3300028379 Bacteria 3752
475 Ga0268265_10094964 3300028380 Bacteria 2393
476 Ga0268264_10022370 3300028381 Bacteria 5163
477 Ga0268264_10069503 3300028381 Bacteria 2978
478 Ga0265334_10000009 3300028573 Bacteria 194312
479 Ga0265338_10009730 3300028800 Bacteria 11404
480 Ga0268256_1000011 3300030500 Bacteria 848625
481 Ga0316177_1203723 3300030731 Bacteria 6164
482 Ga0307513_10053920 3300031456 Bacteria 4316
483 Ga0307408_100046420 3300031548 Bacteria 3107
484 Ga0265313_10007989 3300031595 Bacteria 7104
485 Ga0316575_10011930 3300031665 Bacteria 3224
486 Ga0316575_10040661 3300031665 Bacteria 1837
487 Ga0316578_10016352 3300031728 Bacteria 4012
488 Ga0307516_10001401 3300031730 Bacteria 33337
489 Ga0307516_10018328 3300031730 Bacteria 7275
490 Ga0307516_10035332 3300031730 Bacteria 5015
491 Ga0307405_10003809 3300031731 Bacteria 7013
492 Ga0316577_10009829 3300031733 Bacteria 5155
493 Ga0307413_10001746 3300031824 Bacteria 8494
494 Ga0307410_10005487 3300031852 Bacteria 6720
495 Ga0307407_10013528 3300031903 Bacteria 3965
496 Ga0307412_10006145 3300031911 Bacteria 6768
497 Ga0307409_100126975 3300031995 Bacteria 2171
498 Ga0307416_100000500 3300032002 Bacteria 19946
499 Ga0307414_10003986 3300032004 Bacteria 7967
500 Ga0307414_10017858 3300032004 Bacteria 4351
501 Ga0307411_10017445 3300032005 Bacteria 4091
502 Ga0307415_100014074 3300032126 Bacteria 4690
503 Ga0316583_10000626 3300032133 Bacteria 10804
504 Ga0316585_10000572 3300032137 Bacteria 9022
505 Ga0316580_10003247 3300032139 Bacteria 4592
506 Ga0307510_10001938 3300033180 Bacteria 23267
507 Ga0316574_0002354 3300035398 Bacteria 9458
508 Ga0316574_0008582 3300035398 Bacteria 5682
509 Ga0316574_0009969 3300035398 Bacteria 5346
510 Ga0373927_0000003 3300035695 Bacteria 480348
511 Ga0316582_0002212 3300036647 Bacteria 9026
512 Ga0316584_0002179 3300036712 Bacteria 12271
513 Ga0316584_0042445 3300036712 Bacteria 3392
514 Ga0395899_0000142 3300037312 Bacteria 109659
515 Ga0395899_0009818 3300037312 Bacteria 7342
516 Ga0395899_0016093 3300037312 Bacteria 5701
517 Ga0395899_0022754 3300037312 Bacteria 4749
518 Ga0395899_0053918 3300037312 Bacteria 2976
519 Ga0395899_0134478 3300037312 Bacteria 1763
520 Ga0395900_0000069 3300037418 Bacteria 190578
521 Ga0395900_0002387 3300037418 Bacteria 20737
522 Ga0395900_0010793 3300037418 Bacteria 9345
523 Ga0395900_0031124 3300037418 Bacteria 5481
524 Ga0395900_0082649 3300037418 Bacteria 3300
525 Ga0395898_0000097 3300037466 Bacteria 230579
526 Ga0395898_0001079 3300037466 Bacteria 42224
527 Ga0395898_0015073 3300037466 Bacteria 7934
528 Ga0395898_0025910 3300037466 Bacteria 5904
529 Ga0395901_0000983 3300038443 Bacteria 30866
530 Ga0395901_0002935 3300038443 Bacteria 17206
531 Ga0395901_0010713 3300038443 Bacteria 9295
532 Ga0395901_0149263 3300038443 Bacteria 2456
533 Ga0237819_00127 3300038705 Bacteria 28645
534 Ga0439436_0000010 3300041404 Bacteria 104480
535 Ga0439436_0006040 3300041404 Bacteria 3712
536 Ga0439465_0000123 3300041413 Bacteria 18623
537 Ga0439465_0003861 3300041413 Bacteria 4889
538 Ga0439465_0018945 3300041413 Bacteria 2151
539 Ga0451791_0612411 3300041451 Bacteria 1981
540 Ga0439433_0012744 3300041999 Bacteria 1845
541 Ga0439432_007320 3300042006 Bacteria 3915
542 Ga0439432_019438 3300042006 Bacteria 2262
543 Ga0439449_0000905 3300042007 Bacteria 11573
544 Ga0450908_000564 3300042184 Bacteria 7116
545 Ga0450908_000860 3300042184 Bacteria 5854
546 Ga0451577_0009927 3300042876 Bacteria 9126
547 Ga0466969_0002807 3300044656 Bacteria 9304
548 Ga0466969_0003343 3300044656 Bacteria 8536
549 Ga0466969_0004136 3300044656 Bacteria 7701
550 Ga0466969_0017661 3300044656 Bacteria 3722
551 Ga0466972_0016098 3300044658 Bacteria 3738
552 Ga0466989_0020182 3300044663 Bacteria 3832
553 Ga0466982_0000019 3300044672 Bacteria 111595
554 Ga0466982_0000098 3300044672 Bacteria 21160
555 Ga0453683_0008814 3300044673 Bacteria 6755
556 Ga0466965_0019349 3300044683 Bacteria 3269
557 Ga0466966_0020730 3300044684 Bacteria 4320
558 Ga0466961_0007963 3300044693 Bacteria 6754
559 Ga0466961_0013744 3300044693 Bacteria 5188
560 Ga0466961_0075758 3300044693 Bacteria 2132
561 Ga0466961_0091704 3300044693 Bacteria 1918
562 Ga0466964_0015082 3300044706 Bacteria 2942
563 Ga0466971_0016812 3300044719 Bacteria 3232
564 Ga0466968_0004448 3300044735 Bacteria 5244
565 Ga0466968_0030742 3300044735 Bacteria 2225
566 Ga0466970_0001674 3300044765 Bacteria 10642
567 Ga0466970_0009926 3300044765 Bacteria 4819
568 Ga0466970_0057341 3300044765 Bacteria 2082
569 Ga0466960_0031658 3300044901 Bacteria 2442
570 Ga0466959_0024013 3300045049 Bacteria 4514
571 Ga0466959_0053115 3300045049 Bacteria 2963
572 Ga0451576_0000821 3300045051 Bacteria 60704
573 Ga0451576_0072609 3300045051 Bacteria 3581
574 Ga0466967_0041735 3300045976 Bacteria 3959
575 Ga0495617_003046 3300046452 Bacteria 6383
576 Ga0495617_003503 3300046452 Bacteria 5881
577 Ga0495627_006082 3300046453 Bacteria 4770
578 Ga0495638_0000069 3300046460 Bacteria 167503
579 Ga0495638_0000122 3300046460 Bacteria 125872
580 Ga0495638_0001156 3300046460 Bacteria 25430
581 Ga0495638_0001504 3300046460 Bacteria 20993
582 Ga0495638_0005088 3300046460 Bacteria 9854
583 Ga0495650_0000209 3300046471 Bacteria 125495
584 Ga0495650_0003763 3300046471 Bacteria 10827
585 Ga0495605_0023124 3300046474 Bacteria 3272
586 Ga0495585_0000423 3300046492 Bacteria 40748
587 Ga0495585_0010514 3300046492 Bacteria 5504
588 Ga0495607_0000080 3300046501 Bacteria 97217
589 Ga0495607_0008882 3300046501 Bacteria 6846
590 Ga0495607_0021638 3300046501 Bacteria 4044
591 Ga0495607_0077432 3300046501 Bacteria 1837
592 Ga0495606_0000203 3300046507 Bacteria 103887
593 Ga0495606_0000348 3300046507 Bacteria 79254
594 Ga0495606_0016437 3300046507 Bacteria 5640
595 Ga0495610_0004716 3300046512 Bacteria 9951
596 Ga0495610_0043035 3300046512 Bacteria 2253
597 Ga0495616_0000067 3300046513 Bacteria 89610
598 Ga0495616_0025426 3300046513 Bacteria 3164
599 Ga0495620_0003391 3300046515 Bacteria 9116
600 Ga0495631_0003301 3300046518 Bacteria 8873
601 Ga0495631_0004603 3300046518 Bacteria 7301
602 Ga0495632_0000046 3300046519 Bacteria 139365
603 Ga0495637_0014700 3300046520 Bacteria 3688
604 Ga0495643_0001740 3300046522 Bacteria 18773
605 Ga0495648_0018232 3300046524 Bacteria 4983
606 Ga0495663_0000872 3300046525 Bacteria 10172
607 Ga0495663_0001432 3300046525 Bacteria 7534
608 Ga0495621_0003739 3300046539 Bacteria 4217
609 Ga0495633_0013730 3300046558 Bacteria 4257
610 Ga0495633_0022068 3300046558 Bacteria 3173
611 Ga0495668_0000804 3300046616 Bacteria 36089
612 Ga0495611_0000001 3300046648 Bacteria 2628469
613 Ga0495625_0000001 3300046660 Bacteria 1641829
614 Ga0495625_0024027 3300046660 Bacteria 4646
615 Ga0495625_0044660 3300046660 Bacteria 3206
616 Ga0495661_0004547 3300046665 Bacteria 9991
617 Ga0495647_0021574 3300046681 Bacteria 2320
618 Ga0495670_0009454 3300046691 Bacteria 4791
619 Ga0495671_0000875 3300046692 Bacteria 21477
620 Ga0495649_0012109 3300046694 Bacteria 5034
621 Ga0495649_0015980 3300046694 Bacteria 4261
622 Ga0495589_0000138 3300046794 Bacteria 66651
623 Ga0495660_0004009 3300046810 Bacteria 8989
624 Ga0495672_0000373 3300047320 Bacteria 55844
625 Ga0495679_000029 3300047446 Bacteria 190883
626 Ga0495673_0000001 3300047469 Bacteria 1630730
627 Ga0495673_0014223 3300047469 Bacteria 4144
628 Ga0495686_0000043 3300047472 Bacteria 291565
629 Ga0495686_0085291 3300047472 Bacteria 1923
630 Ga0496101_0016866 3300048904 Bacteria 4944
631 Ga0496104_0000022 3300048907 Bacteria 237390
632 Ga0496104_0012882 3300048907 Bacteria 7532
633 Ga0496105_0000012 3300048908 Bacteria 261713
634 Ga0496105_0006290 3300048908 Bacteria 9118
635 Ga0496105_0018943 3300048908 Bacteria 5545
636 Ga0496105_0090311 3300048908 Bacteria 2530
637 Ga0496106_0009989 3300048909 Bacteria 7009
638 Ga0496106_0014736 3300048909 Bacteria 5780
639 Ga0496108_0030769 3300048911 Bacteria 4448
640 Ga0496109_0200161 3300048912 Bacteria 1877
641 Ga0496110_0005613 3300048913 Bacteria 9846
642 Ga0496110_0035169 3300048913 Bacteria 4344
643 Ga0496113_0067201 3300048916 Bacteria 2717
644 Ga0496114_0001917 3300048917 Bacteria 15837
645 Ga0496114_0046500 3300048917 Bacteria 3607
646 Ga0496115_0000163 3300048918 Bacteria 62399
647 Ga0496115_0000181 3300048918 Bacteria 58749
648 Ga0496115_0013485 3300048918 Bacteria 6184
649 Ga0496115_0020279 3300048918 Bacteria 5126
650 Ga0496115_0038116 3300048918 Bacteria 3812
651 Ga0496115_0071919 3300048918 Bacteria 2805
652 Ga0496116_0000005 3300048919 Bacteria 827804
653 Ga0496116_0017392 3300048919 Bacteria 5580
654 Ga0496117_0005762 3300048920 Bacteria 12872
655 Ga0496117_0009952 3300048920 Bacteria 8743
656 Ga0496117_0013593 3300048920 Bacteria 7089
657 Ga0496117_0015798 3300048920 Bacteria 6407
658 Ga0496117_0020923 3300048920 Bacteria 5319
659 Ga0496117_0024725 3300048920 Bacteria 4739
660 Ga0496117_0028315 3300048920 Bacteria 4342
661 Ga0496117_0057321 3300048920 Bacteria 2706
662 Ga0496118_0000528 3300048921 Bacteria 62711
663 Ga0496118_0000848 3300048921 Bacteria 48534
664 Ga0496118_0004154 3300048921 Bacteria 17490
665 Ga0496118_0005474 3300048921 Bacteria 14415
666 Ga0496118_0016346 3300048921 Bacteria 6811
667 Ga0496118_0017635 3300048921 Bacteria 6485
668 Ga0496118_0025548 3300048921 Bacteria 5059
669 Ga0496118_0029280 3300048921 Bacteria 4621
670 Ga0496118_0031026 3300048921 Bacteria 4443
671 Ga0496119_0000184 3300048922 Bacteria 87765
672 Ga0496119_0000659 3300048922 Bacteria 46235
673 Ga0496119_0001426 3300048922 Bacteria 28899
674 Ga0496119_0021762 3300048922 Bacteria 4619
675 Ga0496120_0000217 3300048923 Bacteria 99402
676 Ga0496120_0000307 3300048923 Bacteria 81552
677 Ga0496120_0001091 3300048923 Bacteria 35465
678 Ga0496120_0004293 3300048923 Bacteria 12085
679 Ga0496121_0000029 3300048924 Bacteria 430303
680 Ga0496121_0000045 3300048924 Bacteria 336130
681 Ga0496121_0004159 3300048924 Bacteria 19788
682 Ga0496121_0009184 3300048924 Bacteria 11428
683 Ga0496121_0009283 3300048924 Bacteria 11346
684 Ga0496121_0017494 3300048924 Bacteria 7318
685 Ga0496121_0029782 3300048924 Bacteria 5034
686 Ga0496121_0037992 3300048924 Bacteria 4270
687 Ga0496121_0040589 3300048924 Bacteria 4080
688 Ga0496122_0000267 3300048925 Bacteria 116950
689 Ga0496122_0001038 3300048925 Bacteria 48750
690 Ga0496122_0001998 3300048925 Bacteria 30375
691 Ga0496122_0005854 3300048925 Bacteria 14421
692 Ga0496122_0016541 3300048925 Bacteria 6966
693 Ga0496122_0019191 3300048925 Bacteria 6261
694 Ga0496122_0019274 3300048925 Bacteria 6242
695 Ga0496122_0030232 3300048925 Bacteria 4546
696 Ga0496123_0000161 3300048926 Bacteria 134623
697 Ga0496123_0000848 3300048926 Bacteria 48801
698 Ga0496123_0001899 3300048926 Bacteria 27259
699 Ga0496123_0015448 3300048926 Bacteria 6261
700 Ga0496123_0024797 3300048926 Bacteria 4543
701 Ga0496123_0026628 3300048926 Bacteria 4327
702 Ga0496123_0031037 3300048926 Bacteria 3897
703 Ga0496124_0000009 3300048927 Bacteria 734820
704 Ga0496124_0000734 3300048927 Bacteria 53581
705 Ga0496124_0001490 3300048927 Bacteria 34391
706 Ga0496124_0004066 3300048927 Bacteria 17329
707 Ga0496124_0025689 3300048927 Bacteria 5328
708 Ga0496124_0042962 3300048927 Bacteria 3888
709 Ga0496125_0000149 3300048928 Bacteria 154223
710 Ga0496125_0010887 3300048928 Bacteria 9147
711 Ga0496125_0031770 3300048928 Bacteria 4699
712 Ga0496125_0031902 3300048928 Bacteria 4687
713 Ga0496125_0036240 3300048928 Bacteria 4311
714 Ga0496125_0041611 3300048928 Bacteria 3926
715 Ga0496126_0002149 3300048929 Bacteria 27466
716 Ga0496126_0003384 3300048929 Bacteria 20200
717 Ga0496126_0004290 3300048929 Bacteria 17144
718 Ga0496126_0013547 3300048929 Bacteria 8286
719 Ga0496126_0020995 3300048929 Bacteria 6391
720 Ga0496126_0060008 3300048929 Bacteria 3423
721 Ga0496126_0060980 3300048929 Bacteria 3390
722 Ga0496126_0120754 3300048929 Bacteria 2273
723 Ga0495678_000718 3300049459 Bacteria 30159
724 Ga0501031_0013662 3300049568 Bacteria 5290
725 Ga0501031_0059928 3300049568 Bacteria 2480
726 Ga0501032_0027853 3300049569 Bacteria 3883
727 Ga0501032_0037308 3300049569 Bacteria 3314
728 Ga0501033_0000747 3300049570 Bacteria 29937
729 Ga0501033_0001508 3300049570 Bacteria 20623
730 Ga0501033_0005847 3300049570 Bacteria 9668
731 Ga0501033_0015113 3300049570 Bacteria 5858
732 Ga0501033_0032897 3300049570 Bacteria 3893
733 Ga0501033_0062985 3300049570 Bacteria 2730
734 Ga0501034_0000344 3300049571 Bacteria 80851
735 Ga0501034_0000355 3300049571 Bacteria 78528
736 Ga0501034_0012809 3300049571 Bacteria 8650
737 Ga0501034_0032668 3300049571 Bacteria 5285
738 Ga0501034_0055878 3300049571 Bacteria 3972
739 Ga0501036_0011935 3300049572 Bacteria 7202
740 Ga0501036_0035985 3300049572 Bacteria 4189
741 Ga0501036_0042201 3300049572 Bacteria 3862
742 Ga0501037_0005211 3300049573 Bacteria 9454
743 Ga0501037_0006927 3300049573 Bacteria 8278
744 Ga0501037_0012184 3300049573 Bacteria 6330
745 Ga0501037_0029467 3300049573 Bacteria 4055
746 Ga0501037_0033049 3300049573 Bacteria 3822
747 Ga0501038_0025329 3300049574 Bacteria 5289
748 Ga0501038_0026037 3300049574 Bacteria 5209
749 Ga0501038_0079480 3300049574 Bacteria 2765
750 Ga0501039_0007584 3300049575 Bacteria 8286
751 Ga0501039_0127614 3300049575 Bacteria 1995
752 Ga0501040_0001093 3300049576 Bacteria 17147
753 Ga0501040_0008567 3300049576 Bacteria 6637
754 Ga0501040_0009299 3300049576 Bacteria 6402
755 Ga0501040_0009725 3300049576 Bacteria 6276
756 Ga0501040_0012191 3300049576 Bacteria 5628
757 Ga0501041_0037583 3300049577 Bacteria 2934
758 Ga0501042_0004185 3300049578 Bacteria 9175
759 Ga0501042_0004613 3300049578 Bacteria 8796
760 Ga0501042_0007705 3300049578 Bacteria 7071
761 Ga0501042_0043650 3300049578 Bacteria 3193
762 Ga0501043_0002540 3300049579 Bacteria 15433
763 Ga0501043_0019418 3300049579 Bacteria 5335
764 Ga0501043_0041262 3300049579 Bacteria 3626
765 Ga0501046_0002537 3300049580 Bacteria 17078
766 Ga0501046_0012062 3300049580 Bacteria 7368
767 Ga0501046_0022811 3300049580 Bacteria 5155
768 Ga0501047_0004475 3300049581 Bacteria 13151
769 Ga0501047_0010659 3300049581 Bacteria 8686
770 Ga0501047_0015450 3300049581 Bacteria 7274
771 Ga0501047_0069784 3300049581 Bacteria 3383
772 Ga0501047_0076899 3300049581 Bacteria 3212
773 Ga0501047_0141866 3300049581 Bacteria 2280
774 Ga0501048_0013116 3300049582 Bacteria 6151
775 Ga0501048_0018366 3300049582 Bacteria 5144
776 Ga0501048_0020049 3300049582 Bacteria 4904
777 Ga0501048_0055113 3300049582 Bacteria 2823
778 Ga0501048_0069922 3300049582 Bacteria 2479
779 Ga0501068_0024287 3300049584 Bacteria 3559
780 Ga0501068_0030043 3300049584 Bacteria 3221
781 Ga0501069_0001683 3300049585 Bacteria 10987
782 Ga0501069_0023366 3300049585 Bacteria 3371
783 Ga0501070_0001120 3300049586 Bacteria 24055
784 Ga0501070_0011003 3300049586 Bacteria 7637
785 Ga0501070_0013738 3300049586 Bacteria 6820
786 Ga0501070_0018995 3300049586 Bacteria 5765
787 Ga0501070_0023611 3300049586 Bacteria 5152
788 Ga0501070_0075225 3300049586 Bacteria 2795
789 Ga0501071_0008278 3300049587 Bacteria 6867
790 Ga0501071_0033521 3300049587 Bacteria 3648
791 Ga0501071_0046255 3300049587 Bacteria 3125
792 Ga0501072_0004152 3300049588 Bacteria 10964
793 Ga0501072_0008841 3300049588 Bacteria 7653
794 Ga0501072_0019046 3300049588 Bacteria 5300
795 Ga0501072_0027365 3300049588 Bacteria 4447
796 Ga0501073_0003721 3300049589 Bacteria 11458
797 Ga0501073_0005507 3300049589 Bacteria 9483
798 Ga0501073_0010681 3300049589 Bacteria 6724
799 Ga0501073_0012681 3300049589 Bacteria 6147
800 Ga0501073_0069917 3300049589 Bacteria 2446
801 Ga0501073_0107067 3300049589 Bacteria 1940
802 Ga0501074_0004079 3300049590 Bacteria 10423
803 Ga0501074_0024713 3300049590 Bacteria 4365
804 Ga0501074_0037632 3300049590 Bacteria 3507
805 Ga0501075_0065660 3300049591 Bacteria 2738
806 Ga0501076_0002535 3300049592 Bacteria 12567
807 Ga0501076_0004710 3300049592 Bacteria 9727
808 Ga0501076_0023151 3300049592 Bacteria 4784
809 Ga0501077_0018306 3300049593 Bacteria 4433
810 Ga0501077_0103282 3300049593 Bacteria 1806
811 Ga0501079_0007763 3300049741 Bacteria 8121
812 Ga0501079_0059639 3300049741 Bacteria 2943
813 Ga0501079_0199192 3300049741 Bacteria 1564
814 Ga0501080_0004279 3300049742 Bacteria 12672
815 Ga0501080_0028382 3300049742 Bacteria 5205
816 Ga0501080_0028686 3300049742 Bacteria 5180
817 Ga0501080_0084412 3300049742 Bacteria 2950
818 Ga0501081_0004658 3300049743 Bacteria 8817
819 Ga0501081_0005725 3300049743 Bacteria 8042
820 Ga0501081_0009346 3300049743 Bacteria 6387
821 Ga0501081_0021742 3300049743 Bacteria 4283
822 Ga0501083_0012139 3300049744 Bacteria 6029
823 Ga0501035_0003148 3300049822 Bacteria 15853
824 Ga0501035_0010022 3300049822 Bacteria 8792
825 Ga0501035_0019320 3300049822 Bacteria 6270
826 Ga0501035_0022285 3300049822 Bacteria 5817
827 Ga0501035_0025947 3300049822 Bacteria 5368
828 Ga0501035_0032024 3300049822 Bacteria 4787
829 Ga0501035_0095280 3300049822 Bacteria 2616
830 Ga0501035_0141934 3300049822 Bacteria 2088
831 Ga0501035_0161756 3300049822 Bacteria 1937
832 Ga0501044_0007144 3300049823 Bacteria 12285
833 Ga0501044_0011428 3300049823 Bacteria 9619
834 Ga0501044_0029738 3300049823 Bacteria 5759
835 Ga0501044_0041271 3300049823 Bacteria 4803
836 Ga0501044_0043549 3300049823 Bacteria 4662
837 Ga0501044_0083293 3300049823 Bacteria 3235
838 Ga0501044_0121429 3300049823 Bacteria 2613
839 Ga0501044_0151906 3300049823 Bacteria 2297
840 Ga0501045_0000225 3300049824 Bacteria 32621
841 Ga0501045_0019176 3300049824 Bacteria 4872
842 nmdc:mga00v17_10476_c1 3300050491 Bacteria 5064
843 nmdc:mga00v17_5307_c1 3300050491 Bacteria 6789
844 nmdc:mga08y16_54621_c1 3300050511 Bacteria 4174
845 nmdc:mga0n895_17491_c1 3300050512 Bacteria 6608
846 nmdc:mga0rr50_152611_c1 3300050513 Bacteria 1868
847 nmdc:mga0a205_603_c1 3300050515 Bacteria 28564
848 nmdc:mga0sz30_14786_c1 3300050516 Bacteria 3078
849 Ga0500610_0023463 3300053079 Bacteria 3055
850 Ga0500643_000002 3300053087 Bacteria 1277657
851 Ga0500643_001805 3300053087 Bacteria 11703
852 Ga0500651_0000088 3300053093 Bacteria 59179
853 Ga0500556_0000234 3300053104 Bacteria 45118
854 Ga0500594_0001943 3300053118 Bacteria 4465
855 Ga0500597_000873 3300053120 Bacteria 6975
856 Ga0500642_0000014 3300053130 Bacteria 182110
857 Ga0500634_0001229 3300053161 Bacteria 9679
858 Ga0500645_000395 3300053730 Bacteria 30555
859 Ga0500645_005302 3300053730 Bacteria 4773
860 Ga0501084_0014642 3300054114 Bacteria 6502
861 Ga0501084_0042413 3300054114 Bacteria 3806
862 Ga0501084_0094713 3300054114 Bacteria 2507
863 Ga0501084_0128527 3300054114 Bacteria 2132
864 Ga0500661_005416 3300055283 Bacteria 2386
865 Ga0501082_0009187 3300060353 Bacteria 8525
866 Ga0501082_0030869 3300060353 Bacteria 4619
867 Ga0466962_0027328 3300061719 Bacteria 2738
868 Ga0466962_0042936 3300061719 Bacteria 2164
869 Ga0530510_0004136 3300061734 Bacteria 10019
870 Ga0530510_0025249 3300061734 Bacteria 4247

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048927 Ga0496124_0001490 Ga0496124_0001490_27_1349 418
2 3300025941 Ga0207711_10061557 Ga0207711_100615573 446
3 3300049570 Ga0501033_0015113 Ga0501033_0015113_2952_4649 450
4 3300049572 Ga0501036_0042201 Ga0501036_0042201_2051_3748 450
5 3300049576 Ga0501040_0008567 Ga0501040_0008567_2587_4284 450
6 3300049578 Ga0501042_0007705 Ga0501042_0007705_2774_4471 450
7 3300049579 Ga0501043_0041262 Ga0501043_0041262_656_2353 450
8 3300049580 Ga0501046_0002537 Ga0501046_0002537_3711_5408 450
9 3300049587 Ga0501071_0033521 Ga0501071_0033521_1191_2888 450
10 3300049592 Ga0501076_0004710 Ga0501076_0004710_2749_4446 450
11 3300049741 Ga0501079_0007763 Ga0501079_0007763_2714_4411 450
12 3300049743 Ga0501081_0004658 Ga0501081_0004658_5582_7279 450
13 3300049822 Ga0501035_0032024 Ga0501035_0032024_640_2337 450
14 3300049824 Ga0501045_0000225 Ga0501045_0000225_2142_3839 450
15 3300054114 Ga0501084_0128527 Ga0501084_0128527_50_1747 450
16 3300060353 Ga0501082_0009187 Ga0501082_0009187_5689_7386 450
17 3300061734 Ga0530510_0004136 Ga0530510_0004136_4123_5820 450
18 3300046501 Ga0495607_0077432 Ga0495607_0077432_35_1705 461
19 3300009094 Ga0111539_10006755 Ga0111539_1000675514 464
20 3300050511 nmdc:mga08y16_54621_c1 nmdc:mga08y16_54621_c1_1763_3445 464
21 3300006844 Ga0075428_100009101 Ga0075428_1000091012 465
22 3300006852 Ga0075433_10005362 Ga0075433_100053627 465
23 3300006871 Ga0075434_100000572 Ga0075434_10000057225 465
24 3300007076 Ga0075435_100063636 Ga0075435_1000636363 465
25 3300050512 nmdc:mga0n895_17491_c1 nmdc:mga0n895_17491_c1_2302_3984 465
26 3300050513 nmdc:mga0rr50_152611_c1 nmdc:mga0rr50_152611_c1_46_1728 465
27 3300050515 nmdc:mga0a205_603_c1 nmdc:mga0a205_603_c1_2981_4663 465
28 3300049584 Ga0501068_0030043 Ga0501068_0030043_889_2571 469
29 3300046507 Ga0495606_0016437 Ga0495606_0016437_2574_4244 473
30 3300046513 Ga0495616_0000067 Ga0495616_0000067_84690_86360 473
31 3300046691 Ga0495670_0009454 Ga0495670_0009454_1889_3559 473
32 3300047472 Ga0495686_0085291 Ga0495686_0085291_234_1904 473
33 3300048924 Ga0496121_0009283 Ga0496121_0009283_9565_11235 473
34 3300053130 Ga0500642_0000014 Ga0500642_0000014_15975_17639 473
35 3300005338 Ga0068868_100032309 Ga0068868_1000323092 475
36 3300005539 Ga0068853_100139593 Ga0068853_1001395931 475
37 3300013102 Ga0157371_10000487 Ga0157371_100004874 476
38 3300015262 Ga0182007_10000043 Ga0182007_100000434 476
39 3300015265 Ga0182005_1000267 Ga0182005_10002674 476
40 3300037312 Ga0395899_0134478 Ga0395899_0134478_220_1734 476
41 3300048908 Ga0496105_0090311 Ga0496105_0090311_406_2067 476
42 3300048919 Ga0496116_0017392 Ga0496116_0017392_1420_3081 476
43 3300048925 Ga0496122_0030232 Ga0496122_0030232_1947_3608 476
44 3300048928 Ga0496125_0031770 Ga0496125_0031770_45_1706 476
45 3300048929 Ga0496126_0004290 Ga0496126_0004290_2843_4504 476
46 3300003781 Ga0055536_1005286 Ga0055536_10052862 477
47 3300025292 Ga0209676_1000092 Ga0209676_1000092144 477
48 3300025298 Ga0209050_1005515 Ga0209050_10055158 477
49 3300048922 Ga0496119_0000659 Ga0496119_0000659_152_1813 477
50 3300048923 Ga0496120_0000217 Ga0496120_0000217_94696_96357 477
51 3300005338 Ga0068868_100027499 Ga0068868_1000274992 479
52 3300042184 Ga0450908_000860 Ga0450908_000860_2969_4651 480
53 3300047472 Ga0495686_0000043 Ga0495686_0000043_131168_132859 480
54 3300005335 Ga0070666_10009654 Ga0070666_100096545 481
55 3300005338 Ga0068868_100007207 Ga0068868_1000072077 481
56 3300005367 Ga0070667_100009456 Ga0070667_1000094563 481
57 3300005548 Ga0070665_100013099 Ga0070665_1000130995 481
58 3300005841 Ga0068863_100013560 Ga0068863_1000135606 481
59 3300006237 Ga0097621_100019126 Ga0097621_1000191264 481
60 3300006358 Ga0068871_100012103 Ga0068871_1000121037 481
61 3300009098 Ga0105245_10003428 Ga0105245_100034286 481
62 3300009177 Ga0105248_10005167 Ga0105248_100051676 481
63 3300013306 Ga0163162_10031567 Ga0163162_100315673 481
64 3300013308 Ga0157375_10004302 Ga0157375_100043025 481
65 3300014968 Ga0157379_10001842 Ga0157379_100018426 481
66 3300014969 Ga0157376_10003668 Ga0157376_1000366810 481
67 3300025903 Ga0207680_10020353 Ga0207680_100203532 481
68 3300025931 Ga0207644_10060403 Ga0207644_100604033 481
69 3300025941 Ga0207711_10004854 Ga0207711_100048543 481
70 3300026023 Ga0207677_10094535 Ga0207677_100945352 481
71 3300048907 Ga0496104_0012882 Ga0496104_0012882_1781_3514 481
72 3300048908 Ga0496105_0018943 Ga0496105_0018943_3180_4913 481
73 3300048911 Ga0496108_0030769 Ga0496108_0030769_60_1793 481
74 3300048912 Ga0496109_0200161 Ga0496109_0200161_10_1743 481
75 3300048913 Ga0496110_0005613 Ga0496110_0005613_2970_4703 481
76 3300048917 Ga0496114_0046500 Ga0496114_0046500_489_2222 481
77 3300049741 Ga0501079_0199192 Ga0501079_0199192_29_1549 481
78 3300005618 Ga0068864_100030923 Ga0068864_1000309233 482
79 3300005546 Ga0070696_100011770 Ga0070696_1000117702 483
80 3300009987 Ga0105030_100130 Ga0105030_1001305 483
81 3300046492 Ga0495585_0010514 Ga0495585_0010514_2574_4244 483
82 3300048925 Ga0496122_0005854 Ga0496122_0005854_3145_4809 483
83 3300048926 Ga0496123_0001899 Ga0496123_0001899_21650_23314 483
84 3300049568 Ga0501031_0013662 Ga0501031_0013662_2485_4167 483
85 3300049569 Ga0501032_0027853 Ga0501032_0027853_675_2357 483
86 3300049573 Ga0501037_0029467 Ga0501037_0029467_1753_3435 483
87 3300049576 Ga0501040_0009725 Ga0501040_0009725_1084_2766 483
88 3300049578 Ga0501042_0004185 Ga0501042_0004185_5188_6870 483
89 3300049582 Ga0501048_0020049 Ga0501048_0020049_2331_4013 483
90 3300049587 Ga0501071_0046255 Ga0501071_0046255_1379_3061 483
91 3300049588 Ga0501072_0008841 Ga0501072_0008841_2562_4244 483
92 3300049590 Ga0501074_0037632 Ga0501074_0037632_825_2507 483
93 3300049591 Ga0501075_0065660 Ga0501075_0065660_865_2547 483
94 3300049592 Ga0501076_0002535 Ga0501076_0002535_2320_4002 483
95 3300049743 Ga0501081_0009346 Ga0501081_0009346_4691_6373 483
96 3300049823 Ga0501044_0083293 Ga0501044_0083293_865_2547 483
97 3300054114 Ga0501084_0094713 Ga0501084_0094713_461_2137 483
98 3300005353 Ga0070669_100016268 Ga0070669_1000162685 485
99 3300005456 Ga0070678_100003696 Ga0070678_1000036967 485
100 3300005548 Ga0070665_100037857 Ga0070665_1000378577 485
101 3300005840 Ga0068870_10009151 Ga0068870_100091511 485
102 3300006881 Ga0068865_100042758 Ga0068865_1000427581 485
103 3300025907 Ga0207645_10013275 Ga0207645_100132754 485
104 3300028379 Ga0268266_10045565 Ga0268266_100455652 485
105 3300005563 Ga0068855_100108259 Ga0068855_1001082592 486
106 3300009093 Ga0105240_10097448 Ga0105240_100974483 486
107 3300025949 Ga0207667_10000250 Ga0207667_1000025050 486
108 3300025981 Ga0207640_10001071 Ga0207640_1000107114 486
109 3300026078 Ga0207702_10140169 Ga0207702_101401692 486
110 3300046460 Ga0495638_0001156 Ga0495638_0001156_21384_23045 486
111 3300046512 Ga0495610_0004716 Ga0495610_0004716_5993_7657 486
112 3300046518 Ga0495631_0004603 Ga0495631_0004603_2522_4186 486
113 3300005335 Ga0070666_10000757 Ga0070666_100007575 487
114 3300013297 Ga0157378_10026393 Ga0157378_100263936 487
115 3300003781 Ga0055536_1006000 Ga0055536_10060004 488
116 3300003791 Ga0055530_10005063 Ga0055530_100050633 488
117 3300003794 Ga0055531_10007781 Ga0055531_100077814 488
118 3300025292 Ga0209676_1000079 Ga0209676_1000079257 488
119 3300025292 Ga0209676_1003077 Ga0209676_10030779 488
120 3300025298 Ga0209050_1000329 Ga0209050_100032991 488
121 3300025303 Ga0209051_1002764 Ga0209051_10027649 488
122 3300025304 Ga0209257_1000081 Ga0209257_1000081267 488
123 3300025304 Ga0209257_1005274 Ga0209257_10052745 488
124 3300044658 Ga0466972_0016098 Ga0466972_0016098_582_2258 488
125 3300044672 Ga0466982_0000019 Ga0466982_0000019_10834_12510 488
126 3300044684 Ga0466966_0020730 Ga0466966_0020730_2097_3773 488
127 3300044706 Ga0466964_0015082 Ga0466964_0015082_834_2510 488
128 3300044735 Ga0466968_0030742 Ga0466968_0030742_252_1928 488
129 3300044901 Ga0466960_0031658 Ga0466960_0031658_326_2002 488
130 3300046507 Ga0495606_0000203 Ga0495606_0000203_99007_100677 488
131 3300049588 Ga0501072_0027365 Ga0501072_0027365_2500_4188 488
132 3300061719 Ga0466962_0027328 Ga0466962_0027328_940_2616 488
133 3300047469 Ga0495673_0014223 Ga0495673_0014223_2588_4132 489
134 3300049576 Ga0501040_0009299 Ga0501040_0009299_2872_4560 489
135 3300049577 Ga0501041_0037583 Ga0501041_0037583_981_2669 489
136 3300049578 Ga0501042_0043650 Ga0501042_0043650_1170_2858 489
137 3300049743 Ga0501081_0005725 Ga0501081_0005725_3712_5400 489
138 3300025303 Ga0209051_1007093 Ga0209051_10070934 490
139 3300049582 Ga0501048_0013116 Ga0501048_0013116_3488_5185 490
140 3300049584 Ga0501068_0024287 Ga0501068_0024287_1483_3180 490
141 3300049588 Ga0501072_0004152 Ga0501072_0004152_6593_8290 490
142 3300049742 Ga0501080_0004279 Ga0501080_0004279_7588_9285 490
143 3300025299 Ga0209256_1004521 Ga0209256_10045218 491
144 3300049588 Ga0501072_0019046 Ga0501072_0019046_19_1638 491
145 3300046492 Ga0495585_0000423 Ga0495585_0000423_2599_4269 492
146 3300046518 Ga0495631_0003301 Ga0495631_0003301_5231_6901 492
147 3300046524 Ga0495648_0018232 Ga0495648_0018232_63_1733 492
148 3300046665 Ga0495661_0004547 Ga0495661_0004547_2364_4034 492
149 3300053730 Ga0500645_005302 Ga0500645_005302_989_2659 492
150 3300003781 Ga0055536_1005928 Ga0055536_10059282 493
151 3300003794 Ga0055531_10007661 Ga0055531_100076614 493
152 3300013297 Ga0157378_10000006 Ga0157378_10000006135 493
153 3300013308 Ga0157375_10055469 Ga0157375_100554692 493
154 3300048920 Ga0496117_0028315 Ga0496117_0028315_2196_3857 493
155 3300048921 Ga0496118_0031026 Ga0496118_0031026_542_2203 493
156 3300048927 Ga0496124_0042962 Ga0496124_0042962_2026_3687 493
157 3300049574 Ga0501038_0079480 Ga0501038_0079480_10_1707 493
158 3300002737 JGI25162J39368_1002756 JGI25162J39368_10027563 494
159 3300002772 JGI25164J39214_1001313 JGI25164J39214_10013133 494
160 3300003214 JGI25165J46597_1002376 JGI25165J46597_10023764 494
161 3300005353 Ga0070669_100079690 Ga0070669_1000796902 494
162 3300014969 Ga0157376_10206001 Ga0157376_102060011 494
163 3300025231 Ga0207427_100306 Ga0207427_10030616 494
164 3300025233 Ga0209437_100039 Ga0209437_100039136 494
165 3300025261 Ga0209233_1000090 Ga0209233_1000090260 494
166 3300025297 Ga0209758_1015576 Ga0209758_10155763 494
167 3300025923 Ga0207681_10004705 Ga0207681_100047052 494
168 3300009176 Ga0105242_10001298 Ga0105242_1000129818 495
169 3300013306 Ga0163162_10002734 Ga0163162_1000273412 495
170 3300013308 Ga0157375_10000102 Ga0157375_100001024 495
171 3300014969 Ga0157376_10008252 Ga0157376_100082522 495
172 3300025938 Ga0207704_10001296 Ga0207704_100012964 495
173 3300026121 Ga0207683_10025237 Ga0207683_100252374 495
174 3300046512 Ga0495610_0043035 Ga0495610_0043035_418_2028 495
175 3300048907 Ga0496104_0000022 Ga0496104_0000022_104572_106248 495
176 3300048908 Ga0496105_0000012 Ga0496105_0000012_232656_234332 495
177 3300048927 Ga0496124_0025689 Ga0496124_0025689_3013_4674 495
178 3300049593 Ga0501077_0103282 Ga0501077_0103282_55_1731 495
179 3300053730 Ga0500645_000395 Ga0500645_000395_24775_26439 495
180 3300044673 Ga0453683_0008814 Ga0453683_0008814_2859_4556 496
181 3300048925 Ga0496122_0001998 Ga0496122_0001998_23054_24745 496
182 3300049569 Ga0501032_0037308 Ga0501032_0037308_1291_2985 496
183 3300049570 Ga0501033_0000747 Ga0501033_0000747_2543_4237 496
184 3300049571 Ga0501034_0055878 Ga0501034_0055878_1643_3337 496
185 3300049572 Ga0501036_0011935 Ga0501036_0011935_4153_5847 496
186 3300049573 Ga0501037_0005211 Ga0501037_0005211_4103_5797 496
187 3300049575 Ga0501039_0007584 Ga0501039_0007584_5614_7308 496
188 3300049581 Ga0501047_0069784 Ga0501047_0069784_485_2179 496
189 3300049589 Ga0501073_0012681 Ga0501073_0012681_2797_4473 496
190 3300049590 Ga0501074_0024713 Ga0501074_0024713_101_1795 496
191 3300049742 Ga0501080_0028686 Ga0501080_0028686_1635_3329 496
192 3300060353 Ga0501082_0030869 Ga0501082_0030869_2578_4254 496
193 3300002737 JGI25162J39368_1003492 JGI25162J39368_10034923 497
194 3300002772 JGI25164J39214_1001318 JGI25164J39214_10013183 497
195 3300005455 Ga0070663_100041672 Ga0070663_1000416723 497
196 3300005843 Ga0068860_100009881 Ga0068860_1000098814 497
197 3300025231 Ga0207427_100289 Ga0207427_10028917 497
198 3300025233 Ga0209437_100129 Ga0209437_10012946 497
199 3300025261 Ga0209233_1000020 Ga0209233_1000020745 497
200 3300026067 Ga0207678_10080157 Ga0207678_100801572 497
201 3300028381 Ga0268264_10022370 Ga0268264_100223701 497
202 3300048909 Ga0496106_0009989 Ga0496106_0009989_4169_5839 497
203 3300046452 Ga0495617_003046 Ga0495617_003046_2429_4099 498
204 3300046515 Ga0495620_0003391 Ga0495620_0003391_5081_6751 498
205 3300028800 Ga0265338_10009730 Ga0265338_100097309 499
206 3300053104 Ga0500556_0000234 Ga0500556_0000234_16193_17857 499
207 3300009093 Ga0105240_10012346 Ga0105240_1001234612 500
208 3300009551 Ga0105238_10032850 Ga0105238_100328503 500
209 3300010375 Ga0105239_10038848 Ga0105239_100388485 500
210 3300013105 Ga0157369_10000027 Ga0157369_10000027168 500
211 3300014497 Ga0182008_10007235 Ga0182008_100072354 500
212 3300025258 Ga0209129_1007561 Ga0209129_10075612 500
213 3300025297 Ga0209758_1008116 Ga0209758_10081161 500
214 3300025913 Ga0207695_10006463 Ga0207695_1000646314 500
215 3300025914 Ga0207671_10003811 Ga0207671_1000381111 500
216 3300025924 Ga0207694_10000563 Ga0207694_1000056317 500
217 3300048924 Ga0496121_0037992 Ga0496121_0037992_20_1612 500
218 3300050516 nmdc:mga0sz30_14786_c1 nmdc:mga0sz30_14786_c1_206_1876 500
219 3300001989 JGI24739J22299_10000167 JGI24739J22299_100001671 501
220 3300003578 Ga0006562J51391_1029636 Ga0006562J51391_10296361 501
221 3300003578 Ga0006562J51391_1029638 Ga0006562J51391_10296382 501
222 3300005344 Ga0070661_100104718 Ga0070661_1001047181 501
223 3300005563 Ga0068855_100031696 Ga0068855_1000316963 501
224 3300005577 Ga0068857_100004292 Ga0068857_10000429214 501
225 3300005616 Ga0068852_100057982 Ga0068852_1000579823 501
226 3300005617 Ga0068859_100061891 Ga0068859_1000618911 501
227 3300006931 Ga0097620_100061888 Ga0097620_1000618881 501
228 3300009093 Ga0105240_10035843 Ga0105240_100358433 501
229 3300009545 Ga0105237_10000016 Ga0105237_10000016220 501
230 3300010375 Ga0105239_10012123 Ga0105239_100121239 501
231 3300013105 Ga0157369_10042658 Ga0157369_100426582 501
232 3300025225 Ga0209566_100544 Ga0209566_10054410 501
233 3300025904 Ga0207647_10024280 Ga0207647_100242801 501
234 3300025913 Ga0207695_10009557 Ga0207695_100095574 501
235 3300025914 Ga0207671_10000137 Ga0207671_1000013712 501
236 3300025920 Ga0207649_10089027 Ga0207649_100890272 501
237 3300025949 Ga0207667_10001167 Ga0207667_1000116722 501
238 3300025981 Ga0207640_10005529 Ga0207640_100055293 501
239 3300026116 Ga0207674_10007214 Ga0207674_100072144 501
240 3300026142 Ga0207698_10038811 Ga0207698_100388113 501
241 3300048924 Ga0496121_0040589 Ga0496121_0040589_2266_3942 501
242 3300048928 Ga0496125_0000149 Ga0496125_0000149_123670_125346 501
243 3300049823 Ga0501044_0151906 Ga0501044_0151906_547_2220 502
244 3300005262 Ga0065165_1003051 Ga0065165_100305110 503
245 3300025297 Ga0209758_1016918 Ga0209758_10169183 503
246 3300031730 Ga0307516_10001401 Ga0307516_100014018 503
247 3300031824 Ga0307413_10001746 Ga0307413_100017462 503
248 3300049581 Ga0501047_0141866 Ga0501047_0141866_222_1895 503
249 3300013296 Ga0157374_10080245 Ga0157374_100802452 504
250 3300014325 Ga0163163_10023588 Ga0163163_100235886 504
251 3300014968 Ga0157379_10000992 Ga0157379_100009925 504
252 3300025304 Ga0209257_1000121 Ga0209257_1000121100 504
253 3300041413 Ga0439465_0003861 Ga0439465_0003861_3181_4848 504
254 3300048926 Ga0496123_0024797 Ga0496123_0024797_2080_3747 504
255 3300048929 Ga0496126_0020995 Ga0496126_0020995_2575_4242 504
256 3300035398 Ga0316574_0009969 Ga0316574_0009969_953_2635 505
257 3300037418 Ga0395900_0031124 Ga0395900_0031124_936_2609 505
258 3300005614 Ga0068856_100000983 Ga0068856_10000098310 506
259 3300025226 Ga0209674_100026 Ga0209674_10002659 506
260 3300025253 Ga0209677_100969 Ga0209677_1009697 506
261 3300026078 Ga0207702_10000943 Ga0207702_1000094321 506
262 3300030731 Ga0316177_1203723 Ga0316177_12037235 507
263 3300037312 Ga0395899_0016093 Ga0395899_0016093_2409_4082 507
264 3300046519 Ga0495632_0000046 Ga0495632_0000046_97422_99092 507
265 3300046525 Ga0495663_0001432 Ga0495663_0001432_3516_5177 507
266 3300049581 Ga0501047_0010659 Ga0501047_0010659_935_2608 507
267 3300003781 Ga0055536_1019665 Ga0055536_10196651 508
268 3300005337 Ga0070682_100002136 Ga0070682_1000021369 508
269 3300005339 Ga0070660_100051136 Ga0070660_1000511363 508
270 3300025292 Ga0209676_1000086 Ga0209676_1000086187 508
271 3300025912 Ga0207707_10011013 Ga0207707_100110139 508
272 3300025919 Ga0207657_10017203 Ga0207657_100172037 508
273 3300025932 Ga0207690_10009506 Ga0207690_100095062 508
274 3300042876 Ga0451577_0009927 Ga0451577_0009927_3568_5316 508
275 3300048925 Ga0496122_0019191 Ga0496122_0019191_2006_3667 509
276 3300048926 Ga0496123_0015448 Ga0496123_0015448_2006_3667 509
277 3300003773 Ga0055537_1000407 Ga0055537_100040711 510
278 3300003790 Ga0055528_1000529 Ga0055528_100052916 510
279 3300005530 Ga0070679_100081626 Ga0070679_1000816264 510
280 3300013307 Ga0157372_10121842 Ga0157372_101218421 510
281 3300025263 Ga0209565_1000014 Ga0209565_100001491 510
282 3300025273 Ga0209673_1000171 Ga0209673_1000171134 510
283 3300025291 Ga0209675_1000011 Ga0209675_1000011371 510
284 3300025295 Ga0209564_1000221 Ga0209564_1000221100 510
285 3300036712 Ga0316584_0042445 Ga0316584_0042445_303_1985 510
286 3300048921 Ga0496118_0025548 Ga0496118_0025548_436_2100 510
287 3300049571 Ga0501034_0000355 Ga0501034_0000355_2814_4499 510
288 3300003771 Ga0055526_1006635 Ga0055526_10066352 511
289 3300003784 Ga0055534_1000039 Ga0055534_100003916 511
290 3300009101 Ga0105247_10010854 Ga0105247_100108542 511
291 3300009176 Ga0105242_10044328 Ga0105242_100443281 511
292 3300025226 Ga0209674_100974 Ga0209674_10097411 511
293 3300025900 Ga0207710_10034415 Ga0207710_100344151 511
294 3300037466 Ga0395898_0015073 Ga0395898_0015073_1114_2787 511
295 3300047469 Ga0495673_0000001 Ga0495673_0000001_97087_98757 511
296 3300048924 Ga0496121_0017494 Ga0496121_0017494_2115_3785 511
297 3300053118 Ga0500594_0001943 Ga0500594_0001943_2084_3763 511
298 3300025299 Ga0209256_1018718 Ga0209256_10187182 512
299 3300025932 Ga0207690_10001851 Ga0207690_100018515 512
300 3300037418 Ga0395900_0082649 Ga0395900_0082649_1337_3070 512
301 3300038443 Ga0395901_0000983 Ga0395901_0000983_23740_25473 512
302 3300046681 Ga0495647_0021574 Ga0495647_0021574_158_1834 512
303 3300049585 Ga0501069_0001683 Ga0501069_0001683_8766_10439 512
304 3300005336 Ga0070680_100073618 Ga0070680_1000736183 513
305 3300005339 Ga0070660_100011933 Ga0070660_1000119334 513
306 3300005458 Ga0070681_10009408 Ga0070681_100094084 513
307 3300005546 Ga0070696_100000851 Ga0070696_10000085116 513
308 3300005548 Ga0070665_100023453 Ga0070665_1000234533 513
309 3300005577 Ga0068857_100020788 Ga0068857_1000207884 513
310 3300013104 Ga0157370_10025566 Ga0157370_100255663 513
311 3300013307 Ga0157372_10053894 Ga0157372_100538942 513
312 3300014497 Ga0182008_10000143 Ga0182008_100001435 513
313 3300017792 Ga0163161_10007748 Ga0163161_100077485 513
314 3300025233 Ga0209437_100637 Ga0209437_10063718 513
315 3300025304 Ga0209257_1004877 Ga0209257_10048779 513
316 3300025912 Ga0207707_10017065 Ga0207707_100170653 513
317 3300025932 Ga0207690_10007510 Ga0207690_100075104 513
318 3300026116 Ga0207674_10024820 Ga0207674_100248204 513
319 3300046522 Ga0495643_0001740 Ga0495643_0001740_14690_16354 513
320 3300046660 Ga0495625_0044660 Ga0495625_0044660_1396_3060 513
321 3300047320 Ga0495672_0000373 Ga0495672_0000373_51329_52993 513
322 3300048920 Ga0496117_0013593 Ga0496117_0013593_2519_4180 513
323 3300048921 Ga0496118_0000528 Ga0496118_0000528_2585_4246 513
324 3300048921 Ga0496118_0029280 Ga0496118_0029280_66_1727 513
325 3300048924 Ga0496121_0004159 Ga0496121_0004159_2140_3801 513
326 3300048925 Ga0496122_0019274 Ga0496122_0019274_2036_3697 513
327 3300048926 Ga0496123_0031037 Ga0496123_0031037_201_1862 513
328 3300048928 Ga0496125_0036240 Ga0496125_0036240_1199_2863 513
329 3300049571 Ga0501034_0012809 Ga0501034_0012809_431_2158 513
330 3300003794 Ga0055531_10006146 Ga0055531_100061464 514
331 3300005614 Ga0068856_100052772 Ga0068856_1000527723 514
332 3300031456 Ga0307513_10053920 Ga0307513_100539206 514
333 3300031548 Ga0307408_100046420 Ga0307408_1000464203 514
334 3300031731 Ga0307405_10003809 Ga0307405_100038097 514
335 3300031852 Ga0307410_10005487 Ga0307410_100054875 514
336 3300031903 Ga0307407_10013528 Ga0307407_100135283 514
337 3300031995 Ga0307409_100126975 Ga0307409_1001269752 514
338 3300032002 Ga0307416_100000500 Ga0307416_1000005002 514
339 3300032005 Ga0307411_10017445 Ga0307411_100174454 514
340 3300032126 Ga0307415_100014074 Ga0307415_1000140743 514
341 3300049576 Ga0501040_0012191 Ga0501040_0012191_247_1935 514
342 3300049582 Ga0501048_0069922 Ga0501048_0069922_239_1927 514
343 3300049742 Ga0501080_0084412 Ga0501080_0084412_39_1766 514
344 3300049744 Ga0501083_0012139 Ga0501083_0012139_544_2271 514
345 3300049822 Ga0501035_0095280 Ga0501035_0095280_460_2187 514
346 3300054114 Ga0501084_0042413 Ga0501084_0042413_256_1983 514
347 iso_pu_bacteria 2874220319 2874221311 514
348 iso_pu_bacteria 2919134579 2919136107 514
349 iso_pu_bacteria 2928496128 2928496280 514
350 3300003214 JGI25165J46597_1002837 JGI25165J46597_10028372 515
351 3300005435 Ga0070714_100021754 Ga0070714_1000217542 515
352 3300006871 Ga0075434_100071461 Ga0075434_1000714612 515
353 3300025929 Ga0207664_10000474 Ga0207664_1000047420 515
354 3300048927 Ga0496124_0000734 Ga0496124_0000734_49762_51423 515
355 3300049586 Ga0501070_0075225 Ga0501070_0075225_886_2580 515
356 3300049589 Ga0501073_0069917 Ga0501073_0069917_36_1733 515
357 3300035398 Ga0316574_0002354 Ga0316574_0002354_369_2045 516
358 3300044672 Ga0466982_0000098 Ga0466982_0000098_2245_3915 516
359 3300048925 Ga0496122_0016541 Ga0496122_0016541_2639_4309 516
360 3300048926 Ga0496123_0026628 Ga0496123_0026628_75_1745 516
361 3300049575 Ga0501039_0127614 Ga0501039_0127614_61_1758 516
362 3300049576 Ga0501040_0001093 Ga0501040_0001093_6422_8119 516
363 3300049582 Ga0501048_0018366 Ga0501048_0018366_1116_2813 516
364 3300049587 Ga0501071_0008278 Ga0501071_0008278_5134_6831 516
365 3300049592 Ga0501076_0023151 Ga0501076_0023151_2677_4374 516
366 3300049593 Ga0501077_0018306 Ga0501077_0018306_2427_4124 516
367 3300049743 Ga0501081_0021742 Ga0501081_0021742_2423_4120 516
368 3300049824 Ga0501045_0019176 Ga0501045_0019176_2405_4102 516
369 3300054114 Ga0501084_0014642 Ga0501084_0014642_2431_4128 516
370 3300061734 Ga0530510_0025249 Ga0530510_0025249_2326_4023 516
371 3300005435 Ga0070714_100000372 Ga0070714_1000003724 518
372 3300025929 Ga0207664_10000585 Ga0207664_100005854 518
373 3300003187 JGI25151J46595_10000041 JGI25151J46595_10000041162 519
374 3300003187 JGI25151J46595_10011611 JGI25151J46595_100116115 519
375 3300003791 Ga0055530_10002892 Ga0055530_100028928 519
376 3300005435 Ga0070714_100000713 Ga0070714_1000007138 519
377 3300005539 Ga0068853_100004423 Ga0068853_1000044232 519
378 3300006844 Ga0075428_100057180 Ga0075428_1000571805 519
379 3300009177 Ga0105248_10054583 Ga0105248_100545836 519
380 3300025284 Ga0209130_1012874 Ga0209130_10128742 519
381 3300025292 Ga0209676_1002465 Ga0209676_10024654 519
382 3300025294 Ga0209025_1000015 Ga0209025_1000015722 519
383 3300025294 Ga0209025_1002444 Ga0209025_100244414 519
384 3300025298 Ga0209050_1000528 Ga0209050_100052851 519
385 3300025304 Ga0209257_1002505 Ga0209257_10025054 519
386 3300025904 Ga0207647_10002712 Ga0207647_100027124 519
387 3300025929 Ga0207664_10000584 Ga0207664_1000058410 519
388 3300025932 Ga0207690_10000443 Ga0207690_1000044316 519
389 3300025932 Ga0207690_10008552 Ga0207690_100085523 519
390 3300025933 Ga0207706_10029417 Ga0207706_100294172 519
391 3300041451 Ga0451791_0612411 Ga0451791_0612411_28_1623 519
392 3300046525 Ga0495663_0000872 Ga0495663_0000872_6185_7852 519
393 3300048925 Ga0496122_0001038 Ga0496122_0001038_2631_4301 519
394 3300048926 Ga0496123_0000848 Ga0496123_0000848_2768_4438 519
395 3300005435 Ga0070714_100022773 Ga0070714_1000227733 520
396 3300009098 Ga0105245_10116590 Ga0105245_101165902 520
397 3300013104 Ga0157370_10013028 Ga0157370_100130288 520
398 3300025928 Ga0207700_10000822 Ga0207700_1000082222 520
399 3300003760 Ga0055527_1000605 Ga0055527_10006057 521
400 3300003761 Ga0055535_1000756 Ga0055535_10007564 521
401 3300003762 Ga0055542_1000774 Ga0055542_10007744 521
402 3300003763 Ga0055529_1000666 Ga0055529_100066618 521
403 3300003775 Ga0055524_1017968 Ga0055524_10179681 521
404 3300005530 Ga0070679_100106460 Ga0070679_1001064602 521
405 3300015261 Ga0182006_1000074 Ga0182006_1000074103 521
406 3300025228 Ga0209672_100017 Ga0209672_100017394 521
407 3300025242 Ga0209258_100213 Ga0209258_1002139 521
408 3300025254 Ga0209148_1000009 Ga0209148_1000009819 521
409 3300025272 Ga0209455_1000032 Ga0209455_1000032394 521
410 3300025294 Ga0209025_1008928 Ga0209025_10089287 521
411 3300003794 Ga0055531_10011589 Ga0055531_100115892 522
412 3300009093 Ga0105240_10084533 Ga0105240_100845332 522
413 3300025304 Ga0209257_1000145 Ga0209257_100014595 522
414 3300044656 Ga0466969_0004136 Ga0466969_0004136_2315_3988 522
415 3300044663 Ga0466989_0020182 Ga0466989_0020182_1915_3588 522
416 3300044683 Ga0466965_0019349 Ga0466965_0019349_1348_3021 522
417 3300044693 Ga0466961_0075758 Ga0466961_0075758_80_1753 522
418 3300044719 Ga0466971_0016812 Ga0466971_0016812_1529_3202 522
419 3300044735 Ga0466968_0004448 Ga0466968_0004448_2250_3920 522
420 3300045049 Ga0466959_0053115 Ga0466959_0053115_160_1833 522
421 3300053087 Ga0500643_001805 Ga0500643_001805_2579_4249 522
422 3300053120 Ga0500597_000873 Ga0500597_000873_2890_4560 522
423 3300061719 Ga0466962_0042936 Ga0466962_0042936_67_1740 522
424 3300042006 Ga0439432_007320 Ga0439432_007320_2017_3696 524
425 3300002773 JGI25152J39213_1000102 JGI25152J39213_100010211 525
426 3300002774 JGI25150J39212_1000099 JGI25150J39212_100009945 525
427 3300002774 JGI25150J39212_1000290 JGI25150J39212_100029016 525
428 3300003187 JGI25151J46595_10000269 JGI25151J46595_1000026911 525
429 3300003215 JGI25153J46596_10000189 JGI25153J46596_1000018911 525
430 3300015262 Ga0182007_10004954 Ga0182007_100049545 525
431 3300025245 Ga0207425_1000092 Ga0207425_100009220 525
432 3300025258 Ga0209129_1000151 Ga0209129_100015186 525
433 3300025294 Ga0209025_1000012 Ga0209025_1000012205 525
434 3300025297 Ga0209758_1000018 Ga0209758_1000018453 525
435 3300042006 Ga0439432_019438 Ga0439432_019438_251_1939 525
436 3300048920 Ga0496117_0015798 Ga0496117_0015798_2357_4027 525
437 3300048921 Ga0496118_0005474 Ga0496118_0005474_10215_11885 525
438 3300005341 Ga0070691_10000561 Ga0070691_100005618 526
439 3300005344 Ga0070661_100001862 Ga0070661_1000018626 526
440 3300005345 Ga0070692_10000139 Ga0070692_100001396 526
441 3300005578 Ga0068854_100003470 Ga0068854_1000034707 526
442 3300005616 Ga0068852_100021578 Ga0068852_1000215781 526
443 3300013105 Ga0157369_10002364 Ga0157369_1000236416 526
444 3300020082 Ga0206353_10073144 Ga0206353_100731442 526
445 3300025909 Ga0207705_10000165 Ga0207705_1000016552 526
446 3300025913 Ga0207695_10000975 Ga0207695_1000097541 526
447 3300025919 Ga0207657_10010252 Ga0207657_100102527 526
448 3300025920 Ga0207649_10031454 Ga0207649_100314542 526
449 3300025932 Ga0207690_10001772 Ga0207690_1000177210 526
450 3300025949 Ga0207667_10001003 Ga0207667_1000100317 526
451 3300026041 Ga0207639_10001634 Ga0207639_100016347 526
452 3300026067 Ga0207678_10000433 Ga0207678_100004332 526
453 3300026142 Ga0207698_10000592 Ga0207698_1000059213 526
454 3300049570 Ga0501033_0005847 Ga0501033_0005847_6829_8589 527
455 3300005539 Ga0068853_100002068 Ga0068853_10000206810 528
456 3300005563 Ga0068855_100171159 Ga0068855_1001711593 528
457 3300015687 Ga0183368_1004 Ga0183368_10041051 528
458 3300025303 Ga0209051_1032538 Ga0209051_10325382 528
459 3300025904 Ga0207647_10012222 Ga0207647_100122224 528
460 3300026041 Ga0207639_10007609 Ga0207639_100076097 528
461 3300026116 Ga0207674_10065193 Ga0207674_100651933 528
462 3300037312 Ga0395899_0053918 Ga0395899_0053918_251_1924 528
463 3300037418 Ga0395900_0002387 Ga0395900_0002387_18238_19911 528
464 3300037466 Ga0395898_0025910 Ga0395898_0025910_3839_5512 528
465 3300038443 Ga0395901_0002935 Ga0395901_0002935_10270_11943 528
466 3300041404 Ga0439436_0006040 Ga0439436_0006040_169_1836 528
467 3300044656 Ga0466969_0017661 Ga0466969_0017661_183_1853 528
468 3300044765 Ga0466970_0057341 Ga0466970_0057341_299_1969 528
469 3300048916 Ga0496113_0067201 Ga0496113_0067201_49_1719 528
470 3300048918 Ga0496115_0000181 Ga0496115_0000181_12282_13952 528
471 3300049586 Ga0501070_0001120 Ga0501070_0001120_17148_18830 528
472 3300049589 Ga0501073_0107067 Ga0501073_0107067_247_1920 528
473 3300014497 Ga0182008_10018312 Ga0182008_100183123 529
474 3300015261 Ga0182006_1018348 Ga0182006_10183482 529
475 3300025250 Ga0209026_1000051 Ga0209026_1000051151 529
476 3300037418 Ga0395900_0000069 Ga0395900_0000069_176632_178305 529
477 3300044656 Ga0466969_0002807 Ga0466969_0002807_6551_8281 529
478 3300044656 Ga0466969_0003343 Ga0466969_0003343_4994_6667 529
479 3300045049 Ga0466959_0024013 Ga0466959_0024013_348_2078 529
480 3300045051 Ga0451576_0000821 Ga0451576_0000821_2640_4340 529
481 3300049570 Ga0501033_0062985 Ga0501033_0062985_34_1707 529
482 3300049585 Ga0501069_0023366 Ga0501069_0023366_124_1839 529
483 3300049589 Ga0501073_0010681 Ga0501073_0010681_2409_4124 529
484 3300049741 Ga0501079_0059639 Ga0501079_0059639_220_1935 529
485 3300049823 Ga0501044_0029738 Ga0501044_0029738_1018_2733 529
486 3300005530 Ga0070679_100127285 Ga0070679_1001272852 530
487 3300005841 Ga0068863_100127670 Ga0068863_1001276702 530
488 3300009551 Ga0105238_10072023 Ga0105238_100720231 530
489 3300025924 Ga0207694_10012898 Ga0207694_100128983 530
490 3300025931 Ga0207644_10000313 Ga0207644_1000031321 530
491 3300037312 Ga0395899_0000142 Ga0395899_0000142_23088_24758 530
492 3300037312 Ga0395899_0009818 Ga0395899_0009818_4703_6376 530
493 3300037418 Ga0395900_0010793 Ga0395900_0010793_2511_4184 530
494 3300037466 Ga0395898_0000097 Ga0395898_0000097_201371_203041 530
495 3300038443 Ga0395901_0010713 Ga0395901_0010713_2448_4121 530
496 3300038443 Ga0395901_0149263 Ga0395901_0149263_105_1775 530
497 3300044765 Ga0466970_0001674 Ga0466970_0001674_5649_7352 530
498 3300053079 Ga0500610_0023463 Ga0500610_0023463_701_2368 530
499 3300028573 Ga0265334_10000009 Ga0265334_10000009100 531
500 3300031595 Ga0265313_10007989 Ga0265313_100079893 531
501 3300044765 Ga0466970_0009926 Ga0466970_0009926_1042_2712 531
502 3300046452 Ga0495617_003503 Ga0495617_003503_1658_3328 531
503 3300046460 Ga0495638_0000122 Ga0495638_0000122_27471_29141 531
504 3300046501 Ga0495607_0008882 Ga0495607_0008882_2798_4468 531
505 3300046520 Ga0495637_0014700 Ga0495637_0014700_1609_3279 531
506 3300046648 Ga0495611_0000001 Ga0495611_0000001_1762786_1764456 531
507 3300046660 Ga0495625_0000001 Ga0495625_0000001_151595_153265 531
508 3300046692 Ga0495671_0000875 Ga0495671_0000875_2814_4484 531
509 3300046694 Ga0495649_0012109 Ga0495649_0012109_479_2149 531
510 3300046794 Ga0495589_0000138 Ga0495589_0000138_62912_64582 531
511 3300046810 Ga0495660_0004009 Ga0495660_0004009_4531_6201 531
512 3300047446 Ga0495679_000029 Ga0495679_000029_12514_14184 531
513 3300048918 Ga0496115_0020279 Ga0496115_0020279_1187_2857 531
514 3300048920 Ga0496117_0024725 Ga0496117_0024725_78_1748 531
515 3300048921 Ga0496118_0004154 Ga0496118_0004154_3973_5643 531
516 3300048929 Ga0496126_0060980 Ga0496126_0060980_667_2337 531
517 3300049459 Ga0495678_000718 Ga0495678_000718_22325_23995 531
518 3300053087 Ga0500643_000002 Ga0500643_000002_54419_56089 531
519 3300013105 Ga0157369_10016391 Ga0157369_100163916 532
520 3300013307 Ga0157372_10036984 Ga0157372_100369843 532
521 3300015265 Ga0182005_1000326 Ga0182005_100032611 532
522 3300025228 Ga0209672_102291 Ga0209672_1022914 532
523 3300044693 Ga0466961_0013744 Ga0466961_0013744_2235_3905 532
524 3300046507 Ga0495606_0000348 Ga0495606_0000348_38566_40236 532
525 3300048925 Ga0496122_0000267 Ga0496122_0000267_23498_25165 532
526 3300048926 Ga0496123_0000161 Ga0496123_0000161_23572_25239 532
527 3300048928 Ga0496125_0031902 Ga0496125_0031902_864_2534 532
528 3300002705 JGI25156J39149_1008279 JGI25156J39149_10082792 533
529 3300002741 JGI25157J39369_1001514 JGI25157J39369_10015143 533
530 3300005367 Ga0070667_100000084 Ga0070667_100000084106 533
531 3300005543 Ga0070672_100009562 Ga0070672_1000095625 533
532 3300025250 Ga0209026_1000079 Ga0209026_10000799 533
533 3300025256 Ga0209759_1002334 Ga0209759_10023348 533
534 3300025292 Ga0209676_1006826 Ga0209676_10068264 533
535 3300025298 Ga0209050_1004837 Ga0209050_10048374 533
536 3300025304 Ga0209257_1000080 Ga0209257_1000080312 533
537 3300025986 Ga0207658_10000093 Ga0207658_100000936 533
538 3300048908 Ga0496105_0006290 Ga0496105_0006290_4888_6561 533
539 3300048922 Ga0496119_0000184 Ga0496119_0000184_33634_35307 533
540 3300048923 Ga0496120_0001091 Ga0496120_0001091_10939_12612 533
541 3300049579 Ga0501043_0002540 Ga0501043_0002540_11418_13085 533
542 3300005289 Ga0065704_10072174 Ga0065704_100721746 534
543 3300005331 Ga0070670_100007924 Ga0070670_1000079247 534
544 3300009011 Ga0105251_10000880 Ga0105251_1000088013 534
545 3300009177 Ga0105248_10000429 Ga0105248_1000042912 534
546 3300009545 Ga0105237_10000388 Ga0105237_1000038816 534
547 3300009553 Ga0105249_10009937 Ga0105249_100099372 534
548 3300010375 Ga0105239_10069647 Ga0105239_100696473 534
549 3300014325 Ga0163163_10000877 Ga0163163_100008776 534
550 3300025735 Ga0207713_1000710 Ga0207713_100071025 534
551 3300025914 Ga0207671_10004200 Ga0207671_100042002 534
552 3300025925 Ga0207650_10044596 Ga0207650_100445963 534
553 3300025941 Ga0207711_10001015 Ga0207711_100010156 534
554 3300025961 Ga0207712_10000343 Ga0207712_1000034311 534
555 3300026067 Ga0207678_10005962 Ga0207678_100059624 534
556 3300031665 Ga0316575_10011930 Ga0316575_100119303 534
557 3300031733 Ga0316577_10009829 Ga0316577_100098293 534
558 3300032133 Ga0316583_10000626 Ga0316583_100006266 534
559 3300032137 Ga0316585_10000572 Ga0316585_100005728 534
560 3300036647 Ga0316582_0002212 Ga0316582_0002212_1352_3052 534
561 3300036712 Ga0316584_0002179 Ga0316584_0002179_6772_8472 534
562 3300048920 Ga0496117_0005762 Ga0496117_0005762_4230_5897 534
563 3300048922 Ga0496119_0001426 Ga0496119_0001426_2549_4216 534
564 3300048923 Ga0496120_0000307 Ga0496120_0000307_56431_58098 534
565 3300048927 Ga0496124_0004066 Ga0496124_0004066_13073_14740 534
566 3300049581 Ga0501047_0004475 Ga0501047_0004475_5913_7592 534
567 3300049586 Ga0501070_0011003 Ga0501070_0011003_708_2387 534
568 3300049589 Ga0501073_0003721 Ga0501073_0003721_2793_4472 534
569 3300049590 Ga0501074_0004079 Ga0501074_0004079_5045_6724 534
570 3300049742 Ga0501080_0028382 Ga0501080_0028382_2492_4171 534
571 3300049822 Ga0501035_0161756 Ga0501035_0161756_190_1869 534
572 3300049823 Ga0501044_0011428 Ga0501044_0011428_669_2348 534
573 iso_pu_bacteria 2524023129 2524190819 534
574 iso_pu_bacteria 8002317523 8002323647 534
575 iso_pu_bacteria 8046991243 8046998894 534
576 iso_pu_bacteria 2512564039 2512732436 535
577 iso_pu_bacteria 2593339198 2595318519 535
578 iso_pu_bacteria 2671180694 2673822801 535
579 iso_pu_bacteria 2864997549 2864997913 535
580 iso_pu_bacteria 2889295896 2889297287 535
581 iso_pu_bacteria 2980125574 2980128969 535
582 iso_pu_bacteria 2981284811 2981285766 535
583 iso_pu_bacteria 2981289755 2981290713 535
584 iso_pu_bacteria 2981980479 2981980665 535
585 iso_pu_bacteria 2981985349 2981985543 535
586 iso_pu_bacteria 8054795415 8054798322 535
587 iso_pu_bacteria 8057473075 8057477228 535
588 3300048918 Ga0496115_0000163 Ga0496115_0000163_30440_32170 536
589 3300048918 Ga0496115_0071919 Ga0496115_0071919_378_2048 536
590 3300048929 Ga0496126_0002149 Ga0496126_0002149_8689_10419 536
591 3300005458 Ga0070681_10025596 Ga0070681_100255967 537
592 3300009551 Ga0105238_10024524 Ga0105238_100245245 537
593 3300013307 Ga0157372_10027342 Ga0157372_100273426 537
594 3300025912 Ga0207707_10051686 Ga0207707_100516862 537
595 3300025924 Ga0207694_10041831 Ga0207694_100418313 537
596 3300031730 Ga0307516_10018328 Ga0307516_100183285 537
597 3300045051 Ga0451576_0072609 Ga0451576_0072609_701_2410 537
598 3300046616 Ga0495668_0000804 Ga0495668_0000804_4313_5977 537
599 iso_pu_bacteria 2547132130 2547502785 537
600 iso_pu_bacteria 2576861471 2578458700 537
601 iso_pu_bacteria 2765235840 2765578683 537
602 iso_pu_bacteria 2816332141 2816516758 537
603 iso_pu_bacteria 2842391507 2842394993 537
604 iso_pu_bacteria 2842757796 2842758400 537
605 iso_pu_bacteria 2852649853 2852651069 537
606 iso_pu_bacteria 2857442823 2857446885 537
607 iso_pu_bacteria 2894414249 2894415659 537
608 iso_pu_bacteria 2931380184 2931381035 537
609 iso_pu_bacteria 2937610967 2937612132 537
610 iso_pu_bacteria 2939622612 2939622956 537
611 iso_pu_bacteria 2939626828 2939630871 537
612 iso_pu_bacteria 2941475908 2941478054 537
613 iso_pu_bacteria 2961047084 2961048077 537
614 iso_pu_bacteria 2961064222 2961065095 537
615 iso_pu_bacteria 8021622325 8021623762 537
616 iso_pu_bacteria 8021626552 8021630458 537
617 iso_pu_bacteria 8021648035 8021650620 537
618 3300005617 Ga0068859_100021151 Ga0068859_1000211514 538
619 3300006931 Ga0097620_100021151 Ga0097620_1000211514 538
620 3300041413 Ga0439465_0018945 Ga0439465_0018945_245_1912 538
621 3300042007 Ga0439449_0000905 Ga0439449_0000905_318_1985 538
622 iso_pu_bacteria 2747842501 2748015862 538
623 iso_pu_bacteria 2939589442 2939590774 538
624 iso_pu_bacteria 2974307012 2974309197 538
625 iso_pu_bacteria 2977247770 2977249916 538
626 iso_pu_bacteria 2984514374 2984515594 538
627 3300005471 Ga0070698_100064803 Ga0070698_1000648032 539
628 3300010375 Ga0105239_10007002 Ga0105239_1000700218 539
629 3300032004 Ga0307414_10003986 Ga0307414_100039865 539
630 3300046460 Ga0495638_0000069 Ga0495638_0000069_163447_165120 539
631 3300053093 Ga0500651_0000088 Ga0500651_0000088_56803_58479 539
632 iso_pu_bacteria 2585428059 2587738596 539
633 iso_pu_bacteria 2643221579 2643907792 539
634 iso_pu_bacteria 2643221581 2643916003 539
635 iso_pu_bacteria 2643221676 2644426890 539
636 iso_pu_bacteria 2818991457 2819662981 539
637 iso_pu_bacteria 2842780639 2842780775 539
638 iso_pu_bacteria 2852684882 2852686028 539
639 iso_pu_bacteria 2857453340 2857453701 539
640 iso_pu_bacteria 2919513703 2919514563 539
641 iso_pu_bacteria 2919675420 2919676605 539
642 iso_pu_bacteria 2923516293 2923518469 539
643 iso_pu_bacteria 2971410472 2971411064 539
644 iso_pu_bacteria 8002869464 8002872224 539
645 iso_pu_bacteria 8003014200 8003015923 539
646 iso_pu_bacteria 8056533031 8056536393 539
647 3300005444 Ga0070694_100032508 Ga0070694_1000325082 540
648 3300005539 Ga0068853_100012109 Ga0068853_1000121095 540
649 3300005617 Ga0068859_100186169 Ga0068859_1001861692 540
650 3300005618 Ga0068864_100128090 Ga0068864_1001280902 540
651 3300005844 Ga0068862_100064307 Ga0068862_1000643074 540
652 3300006931 Ga0097620_100186173 Ga0097620_1001861731 540
653 3300009551 Ga0105238_10002989 Ga0105238_100029894 540
654 3300013100 Ga0157373_10005152 Ga0157373_100051529 540
655 3300013102 Ga0157371_10002814 Ga0157371_1000281417 540
656 3300013104 Ga0157370_10014321 Ga0157370_100143215 540
657 3300013307 Ga0157372_10003304 Ga0157372_100033044 540
658 3300025258 Ga0209129_1003459 Ga0209129_10034591 540
659 3300025297 Ga0209758_1005446 Ga0209758_10054465 540
660 3300025924 Ga0207694_10012219 Ga0207694_100122194 540
661 3300025949 Ga0207667_10005715 Ga0207667_1000571514 540
662 3300026041 Ga0207639_10002124 Ga0207639_1000212413 540
663 3300026116 Ga0207674_10066528 Ga0207674_100665283 540
664 3300028380 Ga0268265_10094964 Ga0268265_100949642 540
665 iso_pu_bacteria 2593339238 2595446484 540
666 iso_pu_bacteria 2593339239 2595451985 540
667 iso_pu_bacteria 2718218334 2721026882 540
668 iso_pu_bacteria 2734482264 2735837567 540
669 iso_pu_bacteria 2738543009 2739228174 540
670 iso_pu_bacteria 2739367700 2739731596 540
671 iso_pu_bacteria 2818991440 2819565239 540
672 iso_pu_bacteria 2842914999 2842917424 540
673 iso_pu_bacteria 2842918807 2842919614 540
674 iso_pu_bacteria 2884338543 2884341164 540
675 iso_pu_bacteria 2884411467 2884413505 540
676 iso_pu_bacteria 2904463128 2904466907 540
677 iso_pu_bacteria 2919130084 2919133565 540
678 iso_pu_bacteria 2919404418 2919405093 540
679 iso_pu_bacteria 2929195423 2929197381 540
680 iso_pu_bacteria 2941471342 2941472620 540
681 iso_pu_bacteria 2953994433 2953994892 540
682 3300005435 Ga0070714_100013529 Ga0070714_1000135292 541
683 3300009011 Ga0105251_10009176 Ga0105251_100091763 541
684 3300025735 Ga0207713_1009080 Ga0207713_10090803 541
685 3300046453 Ga0495627_006082 Ga0495627_006082_2919_4580 541
686 3300046558 Ga0495633_0022068 Ga0495633_0022068_945_2606 541
687 3300048913 Ga0496110_0035169 Ga0496110_0035169_1317_3008 541
688 3300048920 Ga0496117_0057321 Ga0496117_0057321_161_1822 541
689 3300048921 Ga0496118_0016346 Ga0496118_0016346_2927_4588 541
690 3300049568 Ga0501031_0059928 Ga0501031_0059928_644_2329 541
691 3300049574 Ga0501038_0025329 Ga0501038_0025329_1974_3659 541
692 3300049822 Ga0501035_0010022 Ga0501035_0010022_4510_6195 541
693 3300049823 Ga0501044_0043549 Ga0501044_0043549_2528_4213 541
694 iso_pu_bacteria 2524614729 2525556682 541
695 iso_pu_bacteria 2537561836 2538832646 541
696 iso_pu_bacteria 2627854209 2630648278 541
697 iso_pu_bacteria 2643221562 2643830108 541
698 iso_pu_bacteria 2643221577 2643894365 541
699 iso_pu_bacteria 2643221685 2644476569 541
700 iso_pu_bacteria 2687453130 2687583262 541
701 iso_pu_bacteria 2895395659 2895395690 541
702 3300003791 Ga0055530_10008054 Ga0055530_100080543 542
703 3300005293 Ga0065715_10093484 Ga0065715_100934844 542
704 3300005293 Ga0065715_10110437 Ga0065715_101104371 542
705 3300005459 Ga0068867_100071691 Ga0068867_1000716912 542
706 3300013308 Ga0157375_10287370 Ga0157375_102873701 542
707 3300025298 Ga0209050_1000415 Ga0209050_100041571 542
708 3300025940 Ga0207691_10007639 Ga0207691_100076398 542
709 3300026089 Ga0207648_10029340 Ga0207648_100293408 542
710 3300035695 Ga0373927_0000003 Ga0373927_0000003_372922_374595 542
711 3300046558 Ga0495633_0013730 Ga0495633_0013730_2236_3900 542
712 3300048919 Ga0496116_0000005 Ga0496116_0000005_763596_765299 542
713 3300048924 Ga0496121_0000029 Ga0496121_0000029_67718_69421 542
714 3300053161 Ga0500634_0001229 Ga0500634_0001229_1160_2824 542
715 3300003856 Ga0058692_1000018 Ga0058692_100001815 543
716 3300005289 Ga0065704_10002333 Ga0065704_100023338 543
717 3300005327 Ga0070658_10012294 Ga0070658_100122943 543
718 3300005335 Ga0070666_10000003 Ga0070666_10000003137 543
719 3300005344 Ga0070661_100033926 Ga0070661_1000339262 543
720 3300005354 Ga0070675_100013380 Ga0070675_1000133806 543
721 3300005367 Ga0070667_100149360 Ga0070667_1001493602 543
722 3300006051 Ga0075364_10001000 Ga0075364_100010006 543
723 3300009148 Ga0105243_10021826 Ga0105243_100218264 543
724 3300009551 Ga0105238_10000362 Ga0105238_1000036238 543
725 3300010375 Ga0105239_10013284 Ga0105239_100132849 543
726 3300013306 Ga0163162_10000357 Ga0163162_1000035730 543
727 3300015265 Ga0182005_1002979 Ga0182005_10029792 543
728 3300025291 Ga0209675_1016461 Ga0209675_10164611 543
729 3300025292 Ga0209676_1003076 Ga0209676_10030769 543
730 3300025304 Ga0209257_1015664 Ga0209257_10156643 543
731 3300025903 Ga0207680_10000006 Ga0207680_10000006283 543
732 3300025909 Ga0207705_10008340 Ga0207705_100083403 543
733 3300025924 Ga0207694_10004402 Ga0207694_100044023 543
734 3300025935 Ga0207709_10018744 Ga0207709_100187443 543
735 3300027312 Ga0209371_1000011 Ga0209371_100001154 543
736 3300028379 Ga0268266_10000043 Ga0268266_1000004351 543
737 3300030500 Ga0268256_1000011 Ga0268256_100001154 543
738 3300031665 Ga0316575_10040661 Ga0316575_100406611 543
739 3300031728 Ga0316578_10016352 Ga0316578_100163522 543
740 3300031730 Ga0307516_10035332 Ga0307516_100353326 543
741 3300032004 Ga0307414_10017858 Ga0307414_100178583 543
742 3300032139 Ga0316580_10003247 Ga0316580_100032471 543
743 3300033180 Ga0307510_10001938 Ga0307510_1000193817 543
744 3300035398 Ga0316574_0008582 Ga0316574_0008582_1397_3115 543
745 3300038705 Ga0237819_00127 Ga0237819_00127_21671_23338 543
746 3300041999 Ga0439433_0012744 Ga0439433_0012744_30_1697 543
747 3300046471 Ga0495650_0003763 Ga0495650_0003763_2634_4301 543
748 3300046474 Ga0495605_0023124 Ga0495605_0023124_814_2481 543
749 3300046501 Ga0495607_0021638 Ga0495607_0021638_1492_3159 543
750 3300046513 Ga0495616_0025426 Ga0495616_0025426_1397_3064 543
751 3300046539 Ga0495621_0003739 Ga0495621_0003739_2061_3734 543
752 3300048917 Ga0496114_0001917 Ga0496114_0001917_12665_14332 543
753 3300048927 Ga0496124_0000009 Ga0496124_0000009_553143_554810 543
754 3300048928 Ga0496125_0010887 Ga0496125_0010887_6691_8358 543
755 3300048928 Ga0496125_0041611 Ga0496125_0041611_1768_3435 543
756 3300048929 Ga0496126_0013547 Ga0496126_0013547_2639_4306 543
757 3300048929 Ga0496126_0120754 Ga0496126_0120754_355_2022 543
758 3300049571 Ga0501034_0000344 Ga0501034_0000344_64913_66580 543
759 3300049578 Ga0501042_0004613 Ga0501042_0004613_6324_8021 543
760 3300049581 Ga0501047_0076899 Ga0501047_0076899_952_2631 543
761 3300050491 nmdc:mga00v17_10476_c1 nmdc:mga00v17_10476_c1_3063_4730 543
762 3300050491 nmdc:mga00v17_5307_c1 nmdc:mga00v17_5307_c1_2580_4247 543
763 3300002705 JGI25156J39149_1001689 JGI25156J39149_10016898 544
764 3300002737 JGI25162J39368_1002522 JGI25162J39368_10025223 544
765 3300002737 JGI25162J39368_1002946 JGI25162J39368_10029463 544
766 3300002741 JGI25157J39369_1000760 JGI25157J39369_10007609 544
767 3300002741 JGI25157J39369_1001601 JGI25157J39369_10016018 544
768 3300002771 JGI25163J39215_1001514 JGI25163J39215_10015143 544
769 3300002772 JGI25164J39214_1000049 JGI25164J39214_100004956 544
770 3300002772 JGI25164J39214_1000088 JGI25164J39214_100008881 544
771 3300003214 JGI25165J46597_1000009 JGI25165J46597_1000009384 544
772 3300003214 JGI25165J46597_1000088 JGI25165J46597_100008842 544
773 3300003761 Ga0055535_1000082 Ga0055535_100008233 544
774 3300003761 Ga0055535_1001284 Ga0055535_10012843 544
775 3300003762 Ga0055542_1001065 Ga0055542_10010653 544
776 3300003762 Ga0055542_1002159 Ga0055542_10021593 544
777 3300003762 Ga0055542_1002186 Ga0055542_10021863 544
778 3300003763 Ga0055529_1000020 Ga0055529_1000020269 544
779 3300003763 Ga0055529_1000887 Ga0055529_100088711 544
780 3300005339 Ga0070660_100025556 Ga0070660_1000255561 544
781 3300005340 Ga0070689_100008741 Ga0070689_1000087412 544
782 3300005466 Ga0070685_10004666 Ga0070685_100046663 544
783 3300005535 Ga0070684_100033959 Ga0070684_1000339591 544
784 3300005843 Ga0068860_100105026 Ga0068860_1001050262 544
785 3300009174 Ga0105241_10076264 Ga0105241_100762642 544
786 3300015261 Ga0182006_1001229 Ga0182006_10012297 544
787 3300015265 Ga0182005_1001110 Ga0182005_10011103 544
788 3300020069 Ga0197907_10862894 Ga0197907_108628942 544
789 3300025224 Ga0209784_100013 Ga0209784_10001353 544
790 3300025226 Ga0209674_100062 Ga0209674_100062216 544
791 3300025228 Ga0209672_100743 Ga0209672_10074311 544
792 3300025231 Ga0207427_100021 Ga0207427_100021145 544
793 3300025231 Ga0207427_100073 Ga0207427_10007353 544
794 3300025233 Ga0209437_100012 Ga0209437_100012373 544
795 3300025233 Ga0209437_100087 Ga0209437_100087145 544
796 3300025233 Ga0209437_100159 Ga0209437_100159127 544
797 3300025242 Ga0209258_100019 Ga0209258_100019486 544
798 3300025242 Ga0209258_100206 Ga0209258_10020693 544
799 3300025242 Ga0209258_102146 Ga0209258_1021464 544
800 3300025246 Ga0209646_1001828 Ga0209646_10018281 544
801 3300025250 Ga0209026_1000125 Ga0209026_100012559 544
802 3300025250 Ga0209026_1000592 Ga0209026_100059212 544
803 3300025250 Ga0209026_1002773 Ga0209026_10027733 544
804 3300025254 Ga0209148_1000001 Ga0209148_10000011815 544
805 3300025254 Ga0209148_1000005 Ga0209148_1000005563 544
806 3300025254 Ga0209148_1000176 Ga0209148_1000176102 544
807 3300025256 Ga0209759_1000145 Ga0209759_100014510 544
808 3300025256 Ga0209759_1000328 Ga0209759_10003283 544
809 3300025256 Ga0209759_1005371 Ga0209759_10053713 544
810 3300025261 Ga0209233_1000002 Ga0209233_1000002416 544
811 3300025261 Ga0209233_1000023 Ga0209233_1000023478 544
812 3300025272 Ga0209455_1000027 Ga0209455_100002759 544
813 3300025272 Ga0209455_1000081 Ga0209455_1000081215 544
814 3300025909 Ga0207705_10001403 Ga0207705_100014039 544
815 3300025913 Ga0207695_10007085 Ga0207695_100070852 544
816 3300025917 Ga0207660_10005061 Ga0207660_100050617 544
817 3300025936 Ga0207670_10005060 Ga0207670_100050602 544
818 3300028381 Ga0268264_10069503 Ga0268264_100695032 544
819 3300031911 Ga0307412_10006145 Ga0307412_100061451 544
820 3300037466 Ga0395898_0001079 Ga0395898_0001079_419_2089 544
821 3300041404 Ga0439436_0000010 Ga0439436_0000010_62101_63771 544
822 3300041413 Ga0439465_0000123 Ga0439465_0000123_13897_15567 544
823 3300042184 Ga0450908_000564 Ga0450908_000564_2376_4046 544
824 3300044693 Ga0466961_0091704 Ga0466961_0091704_222_1892 544
825 3300046460 Ga0495638_0001504 Ga0495638_0001504_6003_7673 544
826 3300046460 Ga0495638_0005088 Ga0495638_0005088_6061_7731 544
827 3300046471 Ga0495650_0000209 Ga0495650_0000209_52611_54281 544
828 3300046501 Ga0495607_0000080 Ga0495607_0000080_2983_4653 544
829 3300046660 Ga0495625_0024027 Ga0495625_0024027_2949_4619 544
830 3300046694 Ga0495649_0015980 Ga0495649_0015980_1331_3001 544
831 3300048909 Ga0496106_0014736 Ga0496106_0014736_2182_3852 544
832 3300048918 Ga0496115_0038116 Ga0496115_0038116_1675_3345 544
833 3300048924 Ga0496121_0000045 Ga0496121_0000045_33897_35567 544
834 3300048924 Ga0496121_0029782 Ga0496121_0029782_91_1761 544
835 3300049580 Ga0501046_0012062 Ga0501046_0012062_235_1908 544
836 3300049823 Ga0501044_0007144 Ga0501044_0007144_28_1701 544
837 3300055283 Ga0500661_005416 Ga0500661_005416_110_1780 544
838 iso_pu_bacteria 2919085039 2919087871 544
839 iso_pu_bacteria 2928963466 2928967501 544
840 3300001915 JGI24741J21665_1009606 JGI24741J21665_10096061 545
841 3300001979 JGI24740J21852_10004853 JGI24740J21852_100048537 545
842 3300003320 rootH2_10092143 rootH2_100921433 545
843 3300003759 Ga0055525_1000146 Ga0055525_100014661 545
844 3300003760 Ga0055527_1000328 Ga0055527_100032819 545
845 3300003761 Ga0055535_1000745 Ga0055535_100074519 545
846 3300003762 Ga0055542_1000765 Ga0055542_100076518 545
847 3300003762 Ga0055542_1000856 Ga0055542_10008564 545
848 3300003763 Ga0055529_1000663 Ga0055529_10006633 545
849 3300005336 Ga0070680_100008297 Ga0070680_1000082974 545
850 3300005337 Ga0070682_100008145 Ga0070682_1000081457 545
851 3300005345 Ga0070692_10001873 Ga0070692_100018737 545
852 3300005366 Ga0070659_100007436 Ga0070659_1000074364 545
853 3300005455 Ga0070663_100069432 Ga0070663_1000694322 545
854 3300005458 Ga0070681_10017636 Ga0070681_100176367 545
855 3300005530 Ga0070679_100016456 Ga0070679_1000164563 545
856 3300005546 Ga0070696_100001442 Ga0070696_10000144211 545
857 3300005547 Ga0070693_100004059 Ga0070693_1000040591 545
858 3300005563 Ga0068855_100020753 Ga0068855_1000207534 545
859 3300005578 Ga0068854_100007127 Ga0068854_1000071273 545
860 3300005578 Ga0068854_100010098 Ga0068854_1000100983 545
861 3300005834 Ga0068851_10004998 Ga0068851_100049983 545
862 3300009093 Ga0105240_10043064 Ga0105240_100430642 545
863 3300009093 Ga0105240_10049909 Ga0105240_100499094 545
864 3300009093 Ga0105240_10063542 Ga0105240_100635421 545
865 3300009174 Ga0105241_10042237 Ga0105241_100422372 545
866 3300009551 Ga0105238_10097547 Ga0105238_100975472 545
867 3300010375 Ga0105239_10000063 Ga0105239_10000063109 545
868 3300013100 Ga0157373_10022169 Ga0157373_100221692 545
869 3300013102 Ga0157371_10010486 Ga0157371_100104862 545
870 3300013102 Ga0157371_10028762 Ga0157371_100287624 545
871 3300013104 Ga0157370_10010813 Ga0157370_100108134 545
872 3300014497 Ga0182008_10026014 Ga0182008_100260142 545
873 3300015685 Ga0183369_1006 Ga0183369_100690 545
874 3300020069 Ga0197907_11474155 Ga0197907_114741552 545
875 3300020070 Ga0206356_10168839 Ga0206356_101688395 545
876 3300020077 Ga0206351_10908139 Ga0206351_109081392 545
877 3300025228 Ga0209672_100007 Ga0209672_100007589 545
878 3300025228 Ga0209672_100839 Ga0209672_1008399 545
879 3300025230 Ga0209563_100131 Ga0209563_10013127 545
880 3300025242 Ga0209258_100017 Ga0209258_100017230 545
881 3300025242 Ga0209258_100594 Ga0209258_1005948 545
882 3300025254 Ga0209148_1000044 Ga0209148_1000044231 545
883 3300025254 Ga0209148_1000185 Ga0209148_100018597 545
884 3300025272 Ga0209455_1000010 Ga0209455_1000010589 545
885 3300025321 Ga0207656_10001780 Ga0207656_100017806 545
886 3300025904 Ga0207647_10000607 Ga0207647_1000060719 545
887 3300025904 Ga0207647_10001539 Ga0207647_100015397 545
888 3300025909 Ga0207705_10000353 Ga0207705_100003537 545
889 3300025909 Ga0207705_10000355 Ga0207705_1000035533 545
890 3300025912 Ga0207707_10000391 Ga0207707_1000039137 545
891 3300025912 Ga0207707_10001033 Ga0207707_1000103310 545
892 3300025912 Ga0207707_10001308 Ga0207707_1000130814 545
893 3300025912 Ga0207707_10010325 Ga0207707_100103254 545
894 3300025912 Ga0207707_10012035 Ga0207707_100120353 545
895 3300025912 Ga0207707_10046729 Ga0207707_100467293 545
896 3300025913 Ga0207695_10011615 Ga0207695_1001161514 545
897 3300025913 Ga0207695_10012347 Ga0207695_100123477 545
898 3300025913 Ga0207695_10031715 Ga0207695_100317153 545
899 3300025913 Ga0207695_10046563 Ga0207695_100465631 545
900 3300025913 Ga0207695_10087165 Ga0207695_100871652 545
901 3300025917 Ga0207660_10000931 Ga0207660_1000093111 545
902 3300025917 Ga0207660_10001391 Ga0207660_100013919 545
903 3300025917 Ga0207660_10003395 Ga0207660_100033957 545
904 3300025920 Ga0207649_10005594 Ga0207649_100055945 545
905 3300025921 Ga0207652_10000030 Ga0207652_1000003076 545
906 3300025921 Ga0207652_10001197 Ga0207652_100011977 545
907 3300025921 Ga0207652_10041489 Ga0207652_100414892 545
908 3300025932 Ga0207690_10001946 Ga0207690_100019467 545
909 3300025944 Ga0207661_10004417 Ga0207661_100044177 545
910 3300025949 Ga0207667_10000679 Ga0207667_100006797 545
911 3300025949 Ga0207667_10016516 Ga0207667_100165167 545
912 3300025981 Ga0207640_10003830 Ga0207640_100038308 545
913 3300026041 Ga0207639_10005666 Ga0207639_100056667 545
914 3300026067 Ga0207678_10050893 Ga0207678_100508932 545
915 3300026078 Ga0207702_10003531 Ga0207702_100035317 545
916 3300026116 Ga0207674_10019944 Ga0207674_100199447 545
917 3300026142 Ga0207698_10002980 Ga0207698_100029804 545
918 3300037312 Ga0395899_0022754 Ga0395899_0022754_793_2466 545
919 3300044693 Ga0466961_0007963 Ga0466961_0007963_1253_2926 545
920 3300045976 Ga0466967_0041735 Ga0466967_0041735_1808_3481 545
921 3300048904 Ga0496101_0016866 Ga0496101_0016866_60_1733 545
922 3300048918 Ga0496115_0013485 Ga0496115_0013485_2134_3807 545
923 3300048920 Ga0496117_0009952 Ga0496117_0009952_2721_4433 545
924 3300048920 Ga0496117_0020923 Ga0496117_0020923_11_1684 545
925 3300048921 Ga0496118_0000848 Ga0496118_0000848_21751_23463 545
926 3300048921 Ga0496118_0017635 Ga0496118_0017635_3695_5368 545
927 3300048922 Ga0496119_0021762 Ga0496119_0021762_135_1808 545
928 3300048923 Ga0496120_0004293 Ga0496120_0004293_1266_2939 545
929 3300048924 Ga0496121_0009184 Ga0496121_0009184_6974_8647 545
930 3300048929 Ga0496126_0003384 Ga0496126_0003384_15131_16804 545
931 3300048929 Ga0496126_0060008 Ga0496126_0060008_191_1864 545
932 3300049570 Ga0501033_0001508 Ga0501033_0001508_2563_4245 545
933 3300049570 Ga0501033_0032897 Ga0501033_0032897_2131_3804 545
934 3300049571 Ga0501034_0032668 Ga0501034_0032668_2099_3772 545
935 3300049572 Ga0501036_0035985 Ga0501036_0035985_1962_3635 545
936 3300049573 Ga0501037_0006927 Ga0501037_0006927_1791_3473 545
937 3300049573 Ga0501037_0012184 Ga0501037_0012184_1723_3396 545
938 3300049573 Ga0501037_0033049 Ga0501037_0033049_1652_3325 545
939 3300049574 Ga0501038_0026037 Ga0501038_0026037_2383_4065 545
940 3300049579 Ga0501043_0019418 Ga0501043_0019418_605_2278 545
941 3300049580 Ga0501046_0022811 Ga0501046_0022811_1382_3061 545
942 3300049581 Ga0501047_0015450 Ga0501047_0015450_4432_6105 545
943 3300049582 Ga0501048_0055113 Ga0501048_0055113_590_2272 545
944 3300049586 Ga0501070_0013738 Ga0501070_0013738_1534_3207 545
945 3300049586 Ga0501070_0018995 Ga0501070_0018995_2785_4461 545
946 3300049586 Ga0501070_0023611 Ga0501070_0023611_887_2560 545
947 3300049589 Ga0501073_0005507 Ga0501073_0005507_2915_4597 545
948 3300049822 Ga0501035_0003148 Ga0501035_0003148_12719_14392 545
949 3300049822 Ga0501035_0019320 Ga0501035_0019320_2357_4030 545
950 3300049822 Ga0501035_0022285 Ga0501035_0022285_2938_4611 545
951 3300049822 Ga0501035_0025947 Ga0501035_0025947_3321_4994 545
952 3300049822 Ga0501035_0141934 Ga0501035_0141934_60_1733 545
953 3300049823 Ga0501044_0041271 Ga0501044_0041271_2392_4065 545
954 3300049823 Ga0501044_0121429 Ga0501044_0121429_472_2145 545
955 iso_pu_bacteria 2939611941 2939611992 545

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02463

SMC_N

RecF/RecN/SMC N terminal domain

44

557

0.92

PF13476

AAA_23

AAA domain

47

263

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h66-assembly1.cif.gz_A crystal structure of the bacillus subtilis smc head domain complexed with the cognate scpa c-terminal domain 0.8473 2 120
1xew-assembly1.cif.gz_X structural biochemistry of atp-driven dimerization and dna stimulated activation of smc atpases. 0.8441 2 120
5h67-assembly1.cif.gz_A crystal structure of the bacillus subtilis smc head domain complexed with the cognate scpa c-terminal domain and soaked atp 0.8371 2 120
3kta-assembly2.cif.gz_C structural basis for adenylate kinase activity in abc atpases 0.8346 2 120
1xex-assembly1.cif.gz_A-2 structural biochemistry of atp-driven dimerization and dna stimulated activation of smc atpases. 0.8225 2 120
ID Description Score Start End Superfamily
af_Q9LFS8_23_178_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.854 4 120 3.40.50.300
5h66A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8473 2 120 3.40.50.300
af_Q8IPT2_15_211_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8425 1 123 3.40.50.300
af_P0A7H0_3_104_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8396 2 113 3.40.50.300
af_A0A1D6GTS1_30_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8381 1 120 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7C2K5X3-F1-model_v4 DNA repair protein RecN (Recombination protein N) 0.9861 1 124 GO:0005524
GO:0006302
GO:0006310
GO:0009432
GO:0016887
GO:0043590
AF-A0A7C2K5X3-F1-model_v4 DNA repair protein RecN (Recombination protein N) 0.9783 1 124 GO:0005524
GO:0006302
GO:0006310
GO:0009432
GO:0016887
GO:0043590
AF-F7K175-F1-model_v4 DNA repair protein RecN (Recombination protein N) 0.9766 442 542 GO:0005524
GO:0006281
GO:0006310
GO:0009432
GO:0043590
AF-M6T6B3-F1-model_v4 deleted 0.9735 442 544
AF-A0A3D5NK97-F1-model_v4 DNA repair protein RecN (Recombination protein N) 0.9729 1 115 GO:0005524
GO:0006302
GO:0006310
GO:0009432
GO:0016887
GO:0043590

Feature Viewer

pLDDT pTM Quality
89.92 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map