F486702
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 955 | 443 | 870 | 534 |
Family's Representative Sequence
| Representative Sequence | 3300005340|Ga0070689_100008741|Ga0070689_1000087412 |
| Length | 599 |
| Sequence | MGDGWQGFQNRMAVMHSDASVRPHYPPPVPIPLQSPDSITPPPMLTSLYVRHFAVVEEAEIAFGPGLTVVSGETGAGKSLLVDALMLLAGARADSGMVRAGSDRAELTAEFDLTQLPEAREWLRRQELDEEDSCQLRRVIRAEGSSRAWINGRPANASQLGELATLLVEIHGQHEHQALLSRAHQMELLDAYAGNEALVAQVRELAQQWXXXXNRIRKLSGGDDRDQRIELLSHELGELDKWALPADELTELEASHKRLANAGRLAEGAGGVVELLDGESEFALRRALGRAQLEMTKLAALDDRLAPLLELLDNASIQLSEAADGLGRYALDVDLDPNRYAEVDTHLTRLHELSRRHRVTVAELHDKAGTLRIELSELEGAGDALEKLATQRMRLQQQYGEHAAQLSQARQQAAERLGGEVSVLMGELGMSGGRLVVELEATSESDPDPQGRERCELLVSANPGQPPRALRKVASGGELARISLAIEVATLGKDTIGTMVFDEVDTGIGGAVAEVVGQKLRALGGQRQVLCVTHLPQVAAQGHAHLRVSKDSDGESTRTRIEKLDANGRRDELARMLGGVEITRETRAHAKQMLERAQV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512564039 | Paenibacillus mucilaginosus 3016 | Isolate | Rhizosphere |
| 2 | 2524023129 | Paenibacillus pinihumi DSM 23905 | Isolate | Rhizosphere |
| 3 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 4 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 5 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 6 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 7 | 2585428059 | Paenibacillus chondroitinus OK414 | Isolate | Rhizosphere |
| 8 | 2593339198 | Paenibacillus sp. UNCCL117 | Isolate | Unclassified |
| 9 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 10 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 11 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 12 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 13 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 14 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 15 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 16 | 2643221676 | Paenibacillus sp. Root444D2 | Isolate | Unclassified |
| 17 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 18 | 2671180694 | Paenibacillus sp. A3 | Isolate | Unclassified |
| 19 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 20 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 21 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 22 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 23 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 24 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 25 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 26 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 27 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 28 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 29 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 30 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 31 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 32 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 33 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 34 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 35 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 36 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 37 | 2857453340 | Paenibacillus sp. R-74130 | Isolate | Unclassified |
| 38 | 2864997549 | Paenibacillus sp. R-72005 | Isolate | Unclassified |
| 39 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 40 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 41 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 42 | 2889295896 | Paenibacillus sp. PvR098 | Isolate | Rhizosphere |
| 43 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 44 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 45 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 46 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 47 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 48 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 49 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 50 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 51 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 52 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 53 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 54 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 55 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 56 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 57 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 58 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 59 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 60 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 61 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 62 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 63 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 64 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 65 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 66 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 67 | 2971410472 | Paenibacillus oryzisoli 1ZS3-15 | Isolate | Unclassified |
| 68 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 69 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 70 | 2980125574 | Paenibacillus sp. tmac-D7 | Isolate | Unclassified |
| 71 | 2981284811 | Paenibacillus sp. PvR052 | Isolate | Rhizosphere |
| 72 | 2981289755 | Paenibacillus sp. PvR148 | Isolate | Rhizosphere |
| 73 | 2981980479 | Paenibacillus sp. PvR018 | Isolate | Rhizosphere |
| 74 | 2981985349 | Paenibacillus sp. PvR053 | Isolate | Rhizosphere |
| 75 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 76 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 77 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 78 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 79 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 80 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 81 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 82 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 83 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 84 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 85 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 86 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 87 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 88 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 89 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 90 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 91 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 92 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 93 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 94 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 95 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 96 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 97 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 98 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 99 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 100 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 101 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 102 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 103 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 104 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 105 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 106 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 107 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 108 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 112 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 113 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 114 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 116 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 117 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 125 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 128 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 129 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 130 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 131 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 132 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 133 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 134 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 139 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 140 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 141 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 142 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 143 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 144 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 145 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 146 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 147 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 148 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 149 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 150 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 151 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 153 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 154 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 155 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 156 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 157 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 159 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 172 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 184 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 187 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 188 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 189 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 190 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 191 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 193 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 194 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 195 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 196 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 205 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 206 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 207 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 210 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 211 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 213 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 215 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 217 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 220 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 223 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 270 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 271 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 272 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 273 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 274 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 275 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 276 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 277 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 278 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 279 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 280 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 281 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 282 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 283 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 284 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 285 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 286 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 287 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 288 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 289 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 290 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 291 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 292 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 293 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 294 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 295 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 296 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 297 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 298 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 299 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 300 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 301 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 302 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 303 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 304 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 305 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 306 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 307 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 308 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 309 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 310 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 311 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 312 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 313 | 3300044663 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR | Metagenome | Unclassified |
| 314 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 315 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 316 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 317 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 318 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 319 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 320 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 321 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 322 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 323 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 324 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 325 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 326 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 327 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 362 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 363 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 364 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 365 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 367 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 368 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 369 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 370 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 371 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 372 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 373 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 374 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 375 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 376 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 377 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 378 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 379 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 380 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 381 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 415 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 420 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 421 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 422 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 423 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 424 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 425 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 426 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 427 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 428 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 429 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 431 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 433 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 434 | 8002317523 | Cohnella sp. GbtcB17 | Isolate | Unclassified |
| 435 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 436 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 437 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 438 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 439 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
| 440 | 8046991243 | Cohnella rhizosphaerae DSM 28161 | Isolate | Rhizosphere |
| 441 | 8054795415 | Paenibacillus periandrae PM10 | Isolate | Nodule |
| 442 | 8056533031 | Paenibacillus qinlingensis TEGT-2 | Isolate | Unclassified |
| 443 | 8057473075 | Paenibacillus endoradicis T3-5-0-4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.37 |
| Metatranscriptomes | 0.73 |
| Isolates | 8.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.1 |
| Bulb | 0 |
| Endosphere | 16.34 |
| Nodule | 0.21 |
| Rhizoplane | 2.41 |
| Rhizosphere | 65.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1009606 | 3300001915 | Bacteria | 1769 |
| 2 | JGI24740J21852_10004853 | 3300001979 | Bacteria | 5719 |
| 3 | JGI24739J22299_10000167 | 3300001989 | Bacteria | 21671 |
| 4 | JGI25156J39149_1001689 | 3300002705 | Bacteria | 8887 |
| 5 | JGI25156J39149_1008279 | 3300002705 | Bacteria | 2635 |
| 6 | JGI25162J39368_1002522 | 3300002737 | Bacteria | 7004 |
| 7 | JGI25162J39368_1002756 | 3300002737 | Bacteria | 6268 |
| 8 | JGI25162J39368_1002946 | 3300002737 | Bacteria | 5748 |
| 9 | JGI25162J39368_1003492 | 3300002737 | Bacteria | 4485 |
| 10 | JGI25157J39369_1000760 | 3300002741 | Bacteria | 16774 |
| 11 | JGI25157J39369_1001514 | 3300002741 | Bacteria | 8465 |
| 12 | JGI25157J39369_1001601 | 3300002741 | Bacteria | 7926 |
| 13 | JGI25163J39215_1001514 | 3300002771 | Bacteria | 3659 |
| 14 | JGI25164J39214_1000049 | 3300002772 | Bacteria | 123464 |
| 15 | JGI25164J39214_1000088 | 3300002772 | Bacteria | 91375 |
| 16 | JGI25164J39214_1001313 | 3300002772 | Bacteria | 6260 |
| 17 | JGI25164J39214_1001318 | 3300002772 | Bacteria | 6234 |
| 18 | JGI25152J39213_1000102 | 3300002773 | Bacteria | 59507 |
| 19 | JGI25150J39212_1000099 | 3300002774 | Bacteria | 49634 |
| 20 | JGI25150J39212_1000290 | 3300002774 | Bacteria | 26031 |
| 21 | JGI25151J46595_10000041 | 3300003187 | Bacteria | 174472 |
| 22 | JGI25151J46595_10000269 | 3300003187 | Bacteria | 59507 |
| 23 | JGI25151J46595_10011611 | 3300003187 | Bacteria | 4042 |
| 24 | JGI25165J46597_1000009 | 3300003214 | Bacteria | 467965 |
| 25 | JGI25165J46597_1000088 | 3300003214 | Bacteria | 169821 |
| 26 | JGI25165J46597_1002376 | 3300003214 | Bacteria | 6268 |
| 27 | JGI25165J46597_1002837 | 3300003214 | Bacteria | 4966 |
| 28 | JGI25153J46596_10000189 | 3300003215 | Bacteria | 59507 |
| 29 | rootH2_10092143 | 3300003320 | Bacteria | 5533 |
| 30 | Ga0006562J51391_1029636 | 3300003578 | Bacteria | 10630 |
| 31 | Ga0006562J51391_1029638 | 3300003578 | Bacteria | 2260 |
| 32 | Ga0055525_1000146 | 3300003759 | Bacteria | 97114 |
| 33 | Ga0055527_1000328 | 3300003760 | Bacteria | 25551 |
| 34 | Ga0055527_1000605 | 3300003760 | Bacteria | 11556 |
| 35 | Ga0055535_1000082 | 3300003761 | Bacteria | 106958 |
| 36 | Ga0055535_1000745 | 3300003761 | Bacteria | 24313 |
| 37 | Ga0055535_1000756 | 3300003761 | Bacteria | 24051 |
| 38 | Ga0055535_1001284 | 3300003761 | Bacteria | 13598 |
| 39 | Ga0055542_1000765 | 3300003762 | Bacteria | 24313 |
| 40 | Ga0055542_1000774 | 3300003762 | Bacteria | 24051 |
| 41 | Ga0055542_1000856 | 3300003762 | Bacteria | 21343 |
| 42 | Ga0055542_1001065 | 3300003762 | Bacteria | 16915 |
| 43 | Ga0055542_1002159 | 3300003762 | Bacteria | 7122 |
| 44 | Ga0055542_1002186 | 3300003762 | Bacteria | 7004 |
| 45 | Ga0055529_1000020 | 3300003763 | Bacteria | 324857 |
| 46 | Ga0055529_1000663 | 3300003763 | Bacteria | 24291 |
| 47 | Ga0055529_1000666 | 3300003763 | Bacteria | 24043 |
| 48 | Ga0055529_1000887 | 3300003763 | Bacteria | 16921 |
| 49 | Ga0055526_1006635 | 3300003771 | Bacteria | 6219 |
| 50 | Ga0055537_1000407 | 3300003773 | Bacteria | 28206 |
| 51 | Ga0055524_1017968 | 3300003775 | Bacteria | 2475 |
| 52 | Ga0055536_1005286 | 3300003781 | Bacteria | 6357 |
| 53 | Ga0055536_1005928 | 3300003781 | Bacteria | 5844 |
| 54 | Ga0055536_1006000 | 3300003781 | Bacteria | 5776 |
| 55 | Ga0055536_1019665 | 3300003781 | Bacteria | 2115 |
| 56 | Ga0055534_1000039 | 3300003784 | Bacteria | 104863 |
| 57 | Ga0055528_1000529 | 3300003790 | Bacteria | 29538 |
| 58 | Ga0055530_10002892 | 3300003791 | Bacteria | 10448 |
| 59 | Ga0055530_10005063 | 3300003791 | Bacteria | 6471 |
| 60 | Ga0055530_10008054 | 3300003791 | Bacteria | 4296 |
| 61 | Ga0055531_10006146 | 3300003794 | Bacteria | 6871 |
| 62 | Ga0055531_10007661 | 3300003794 | Bacteria | 5844 |
| 63 | Ga0055531_10007781 | 3300003794 | Bacteria | 5776 |
| 64 | Ga0055531_10011589 | 3300003794 | Bacteria | 4231 |
| 65 | Ga0058692_1000018 | 3300003856 | Bacteria | 264544 |
| 66 | Ga0065165_1003051 | 3300005262 | Bacteria | 12552 |
| 67 | Ga0065704_10002333 | 3300005289 | Bacteria | 7689 |
| 68 | Ga0065704_10072174 | 3300005289 | Bacteria | 9007 |
| 69 | Ga0065715_10093484 | 3300005293 | Bacteria | 4663 |
| 70 | Ga0065715_10110437 | 3300005293 | Bacteria | 2620 |
| 71 | Ga0070658_10012294 | 3300005327 | Bacteria | 6873 |
| 72 | Ga0070670_100007924 | 3300005331 | Bacteria | 9039 |
| 73 | Ga0070666_10000003 | 3300005335 | Bacteria | 463666 |
| 74 | Ga0070666_10000757 | 3300005335 | Bacteria | 19578 |
| 75 | Ga0070666_10009654 | 3300005335 | Bacteria | 6024 |
| 76 | Ga0070680_100008297 | 3300005336 | Bacteria | 7947 |
| 77 | Ga0070680_100073618 | 3300005336 | Bacteria | 2810 |
| 78 | Ga0070682_100002136 | 3300005337 | Bacteria | 10982 |
| 79 | Ga0070682_100008145 | 3300005337 | Bacteria | 5911 |
| 80 | Ga0068868_100007207 | 3300005338 | Bacteria | 7901 |
| 81 | Ga0068868_100027499 | 3300005338 | Bacteria | 4340 |
| 82 | Ga0068868_100032309 | 3300005338 | Bacteria | 4026 |
| 83 | Ga0070660_100011933 | 3300005339 | Bacteria | 6199 |
| 84 | Ga0070660_100025556 | 3300005339 | Bacteria | 4390 |
| 85 | Ga0070660_100051136 | 3300005339 | Bacteria | 3181 |
| 86 | Ga0070689_100008741 | 3300005340 | Bacteria | 7150 |
| 87 | Ga0070691_10000561 | 3300005341 | Bacteria | 14128 |
| 88 | Ga0070661_100001862 | 3300005344 | Bacteria | 14599 |
| 89 | Ga0070661_100033926 | 3300005344 | Bacteria | 3700 |
| 90 | Ga0070661_100104718 | 3300005344 | Bacteria | 2108 |
| 91 | Ga0070692_10000139 | 3300005345 | Bacteria | 17503 |
| 92 | Ga0070692_10001873 | 3300005345 | Bacteria | 7918 |
| 93 | Ga0070669_100016268 | 3300005353 | Bacteria | 5306 |
| 94 | Ga0070669_100079690 | 3300005353 | Bacteria | 2436 |
| 95 | Ga0070675_100013380 | 3300005354 | Bacteria | 6448 |
| 96 | Ga0070659_100007436 | 3300005366 | Bacteria | 7959 |
| 97 | Ga0070667_100000084 | 3300005367 | Bacteria | 118027 |
| 98 | Ga0070667_100009456 | 3300005367 | Bacteria | 8086 |
| 99 | Ga0070667_100149360 | 3300005367 | Bacteria | 2052 |
| 100 | Ga0070714_100000372 | 3300005435 | Bacteria | 33436 |
| 101 | Ga0070714_100000713 | 3300005435 | Bacteria | 23558 |
| 102 | Ga0070714_100013529 | 3300005435 | Bacteria | 6540 |
| 103 | Ga0070714_100021754 | 3300005435 | Bacteria | 5249 |
| 104 | Ga0070714_100022773 | 3300005435 | Bacteria | 5139 |
| 105 | Ga0070694_100032508 | 3300005444 | Bacteria | 3426 |
| 106 | Ga0070663_100041672 | 3300005455 | Bacteria | 3223 |
| 107 | Ga0070663_100069432 | 3300005455 | Bacteria | 2560 |
| 108 | Ga0070678_100003696 | 3300005456 | Bacteria | 8558 |
| 109 | Ga0070681_10009408 | 3300005458 | Bacteria | 9616 |
| 110 | Ga0070681_10017636 | 3300005458 | Bacteria | 7134 |
| 111 | Ga0070681_10025596 | 3300005458 | Bacteria | 5936 |
| 112 | Ga0068867_100071691 | 3300005459 | Bacteria | 2592 |
| 113 | Ga0070685_10004666 | 3300005466 | Bacteria | 6934 |
| 114 | Ga0070698_100064803 | 3300005471 | Bacteria | 3680 |
| 115 | Ga0070679_100016456 | 3300005530 | Bacteria | 7134 |
| 116 | Ga0070679_100081626 | 3300005530 | Bacteria | 3222 |
| 117 | Ga0070679_100106460 | 3300005530 | Bacteria | 2790 |
| 118 | Ga0070679_100127285 | 3300005530 | Bacteria | 2529 |
| 119 | Ga0070684_100033959 | 3300005535 | Bacteria | 4359 |
| 120 | Ga0068853_100002068 | 3300005539 | Bacteria | 14881 |
| 121 | Ga0068853_100004423 | 3300005539 | Bacteria | 10877 |
| 122 | Ga0068853_100012109 | 3300005539 | Bacteria | 7016 |
| 123 | Ga0068853_100139593 | 3300005539 | Bacteria | 2175 |
| 124 | Ga0070672_100009562 | 3300005543 | Bacteria | 6689 |
| 125 | Ga0070696_100000851 | 3300005546 | Bacteria | 19698 |
| 126 | Ga0070696_100001442 | 3300005546 | Bacteria | 15555 |
| 127 | Ga0070696_100011770 | 3300005546 | Bacteria | 5863 |
| 128 | Ga0070693_100004059 | 3300005547 | Bacteria | 6892 |
| 129 | Ga0070665_100013099 | 3300005548 | Bacteria | 8350 |
| 130 | Ga0070665_100023453 | 3300005548 | Bacteria | 6213 |
| 131 | Ga0070665_100037857 | 3300005548 | Bacteria | 4849 |
| 132 | Ga0068855_100020753 | 3300005563 | Bacteria | 7879 |
| 133 | Ga0068855_100031696 | 3300005563 | Bacteria | 6311 |
| 134 | Ga0068855_100108259 | 3300005563 | Bacteria | 3192 |
| 135 | Ga0068855_100171159 | 3300005563 | Bacteria | 2460 |
| 136 | Ga0068857_100004292 | 3300005577 | Bacteria | 12022 |
| 137 | Ga0068857_100020788 | 3300005577 | Bacteria | 5775 |
| 138 | Ga0068854_100003470 | 3300005578 | Bacteria | 9844 |
| 139 | Ga0068854_100007127 | 3300005578 | Bacteria | 7138 |
| 140 | Ga0068854_100010098 | 3300005578 | Bacteria | 6116 |
| 141 | Ga0068856_100000983 | 3300005614 | Bacteria | 30421 |
| 142 | Ga0068856_100052772 | 3300005614 | Bacteria | 4010 |
| 143 | Ga0068852_100021578 | 3300005616 | Bacteria | 5146 |
| 144 | Ga0068852_100057982 | 3300005616 | Bacteria | 3352 |
| 145 | Ga0068859_100021151 | 3300005617 | Bacteria | 6529 |
| 146 | Ga0068859_100061891 | 3300005617 | Bacteria | 3772 |
| 147 | Ga0068859_100186169 | 3300005617 | Bacteria | 2160 |
| 148 | Ga0068864_100030923 | 3300005618 | Bacteria | 4540 |
| 149 | Ga0068864_100128090 | 3300005618 | Bacteria | 2277 |
| 150 | Ga0068851_10004998 | 3300005834 | Bacteria | 6006 |
| 151 | Ga0068870_10009151 | 3300005840 | Bacteria | 4489 |
| 152 | Ga0068863_100013560 | 3300005841 | Bacteria | 7863 |
| 153 | Ga0068863_100127670 | 3300005841 | Bacteria | 2427 |
| 154 | Ga0068860_100009881 | 3300005843 | Bacteria | 9460 |
| 155 | Ga0068860_100105026 | 3300005843 | Bacteria | 2697 |
| 156 | Ga0068862_100064307 | 3300005844 | Bacteria | 3158 |
| 157 | Ga0075364_10001000 | 3300006051 | Bacteria | 14962 |
| 158 | Ga0097621_100019126 | 3300006237 | Bacteria | 5250 |
| 159 | Ga0068871_100012103 | 3300006358 | Bacteria | 6350 |
| 160 | Ga0075428_100009101 | 3300006844 | Bacteria | 11018 |
| 161 | Ga0075428_100057180 | 3300006844 | Bacteria | 4270 |
| 162 | Ga0075433_10005362 | 3300006852 | Bacteria | 10068 |
| 163 | Ga0075434_100000572 | 3300006871 | Bacteria | 28363 |
| 164 | Ga0075434_100071461 | 3300006871 | Bacteria | 3462 |
| 165 | Ga0068865_100042758 | 3300006881 | Bacteria | 3092 |
| 166 | Ga0097620_100021151 | 3300006931 | Bacteria | 6529 |
| 167 | Ga0097620_100061888 | 3300006931 | Bacteria | 3772 |
| 168 | Ga0097620_100186173 | 3300006931 | Bacteria | 2160 |
| 169 | Ga0075435_100063636 | 3300007076 | Bacteria | 2996 |
| 170 | Ga0105251_10000880 | 3300009011 | Bacteria | 26879 |
| 171 | Ga0105251_10009176 | 3300009011 | Bacteria | 5877 |
| 172 | Ga0105240_10012346 | 3300009093 | Bacteria | 11795 |
| 173 | Ga0105240_10035843 | 3300009093 | Bacteria | 6388 |
| 174 | Ga0105240_10043064 | 3300009093 | Bacteria | 5748 |
| 175 | Ga0105240_10049909 | 3300009093 | Bacteria | 5278 |
| 176 | Ga0105240_10063542 | 3300009093 | Bacteria | 4592 |
| 177 | Ga0105240_10084533 | 3300009093 | Bacteria | 3891 |
| 178 | Ga0105240_10097448 | 3300009093 | Bacteria | 3583 |
| 179 | Ga0111539_10006755 | 3300009094 | Bacteria | 14763 |
| 180 | Ga0105245_10003428 | 3300009098 | Bacteria | 14208 |
| 181 | Ga0105245_10116590 | 3300009098 | Bacteria | 2490 |
| 182 | Ga0105247_10010854 | 3300009101 | Bacteria | 5502 |
| 183 | Ga0105243_10021826 | 3300009148 | Bacteria | 4861 |
| 184 | Ga0105241_10042237 | 3300009174 | Bacteria | 3448 |
| 185 | Ga0105241_10076264 | 3300009174 | Bacteria | 2614 |
| 186 | Ga0105242_10001298 | 3300009176 | Bacteria | 19754 |
| 187 | Ga0105242_10044328 | 3300009176 | Bacteria | 3602 |
| 188 | Ga0105248_10000429 | 3300009177 | Bacteria | 47562 |
| 189 | Ga0105248_10005167 | 3300009177 | Bacteria | 14394 |
| 190 | Ga0105248_10054583 | 3300009177 | Bacteria | 4481 |
| 191 | Ga0105237_10000016 | 3300009545 | Bacteria | 256506 |
| 192 | Ga0105237_10000388 | 3300009545 | Bacteria | 62620 |
| 193 | Ga0105238_10000362 | 3300009551 | Bacteria | 48708 |
| 194 | Ga0105238_10002989 | 3300009551 | Bacteria | 16888 |
| 195 | Ga0105238_10024524 | 3300009551 | Bacteria | 6147 |
| 196 | Ga0105238_10032850 | 3300009551 | Bacteria | 5282 |
| 197 | Ga0105238_10072023 | 3300009551 | Bacteria | 3453 |
| 198 | Ga0105238_10097547 | 3300009551 | Bacteria | 2925 |
| 199 | Ga0105249_10009937 | 3300009553 | Bacteria | 8345 |
| 200 | Ga0105030_100130 | 3300009987 | Bacteria | 5905 |
| 201 | Ga0105239_10000063 | 3300010375 | Bacteria | 151845 |
| 202 | Ga0105239_10007002 | 3300010375 | Bacteria | 12975 |
| 203 | Ga0105239_10012123 | 3300010375 | Bacteria | 9611 |
| 204 | Ga0105239_10013284 | 3300010375 | Bacteria | 9149 |
| 205 | Ga0105239_10038848 | 3300010375 | Bacteria | 5215 |
| 206 | Ga0105239_10069647 | 3300010375 | Bacteria | 3865 |
| 207 | Ga0157373_10005152 | 3300013100 | Bacteria | 9826 |
| 208 | Ga0157373_10022169 | 3300013100 | Bacteria | 4608 |
| 209 | Ga0157371_10000487 | 3300013102 | Bacteria | 48309 |
| 210 | Ga0157371_10002814 | 3300013102 | Bacteria | 16290 |
| 211 | Ga0157371_10010486 | 3300013102 | Bacteria | 7211 |
| 212 | Ga0157371_10028762 | 3300013102 | Bacteria | 4023 |
| 213 | Ga0157370_10010813 | 3300013104 | Bacteria | 9591 |
| 214 | Ga0157370_10013028 | 3300013104 | Bacteria | 8587 |
| 215 | Ga0157370_10014321 | 3300013104 | Bacteria | 8115 |
| 216 | Ga0157370_10025566 | 3300013104 | Bacteria | 5844 |
| 217 | Ga0157369_10000027 | 3300013105 | Bacteria | 213988 |
| 218 | Ga0157369_10002364 | 3300013105 | Bacteria | 22678 |
| 219 | Ga0157369_10016391 | 3300013105 | Bacteria | 8335 |
| 220 | Ga0157369_10042658 | 3300013105 | Bacteria | 4949 |
| 221 | Ga0157374_10080245 | 3300013296 | Bacteria | 3094 |
| 222 | Ga0157378_10000006 | 3300013297 | Bacteria | 192683 |
| 223 | Ga0157378_10026393 | 3300013297 | Bacteria | 5120 |
| 224 | Ga0163162_10000357 | 3300013306 | Bacteria | 41422 |
| 225 | Ga0163162_10002734 | 3300013306 | Bacteria | 16743 |
| 226 | Ga0163162_10031567 | 3300013306 | Bacteria | 5255 |
| 227 | Ga0157372_10003304 | 3300013307 | Bacteria | 17420 |
| 228 | Ga0157372_10027342 | 3300013307 | Bacteria | 6211 |
| 229 | Ga0157372_10036984 | 3300013307 | Bacteria | 5382 |
| 230 | Ga0157372_10053894 | 3300013307 | Bacteria | 4484 |
| 231 | Ga0157372_10121842 | 3300013307 | Bacteria | 2996 |
| 232 | Ga0157375_10000102 | 3300013308 | Bacteria | 86408 |
| 233 | Ga0157375_10004302 | 3300013308 | Bacteria | 12350 |
| 234 | Ga0157375_10055469 | 3300013308 | Bacteria | 3907 |
| 235 | Ga0157375_10287370 | 3300013308 | Bacteria | 1807 |
| 236 | Ga0163163_10000877 | 3300014325 | Bacteria | 25623 |
| 237 | Ga0163163_10023588 | 3300014325 | Bacteria | 5840 |
| 238 | Ga0182008_10000143 | 3300014497 | Bacteria | 55118 |
| 239 | Ga0182008_10007235 | 3300014497 | Bacteria | 6138 |
| 240 | Ga0182008_10018312 | 3300014497 | Bacteria | 3626 |
| 241 | Ga0182008_10026014 | 3300014497 | Bacteria | 2969 |
| 242 | Ga0157379_10000992 | 3300014968 | Bacteria | 23037 |
| 243 | Ga0157379_10001842 | 3300014968 | Bacteria | 17527 |
| 244 | Ga0157376_10003668 | 3300014969 | Bacteria | 10602 |
| 245 | Ga0157376_10008252 | 3300014969 | Bacteria | 7501 |
| 246 | Ga0157376_10206001 | 3300014969 | Bacteria | 1813 |
| 247 | Ga0182006_1000074 | 3300015261 | Bacteria | 130403 |
| 248 | Ga0182006_1001229 | 3300015261 | Bacteria | 15917 |
| 249 | Ga0182006_1018348 | 3300015261 | Bacteria | 2958 |
| 250 | Ga0182007_10000043 | 3300015262 | Bacteria | 107693 |
| 251 | Ga0182007_10004954 | 3300015262 | Bacteria | 5938 |
| 252 | Ga0182005_1000267 | 3300015265 | Bacteria | 32953 |
| 253 | Ga0182005_1000326 | 3300015265 | Bacteria | 28190 |
| 254 | Ga0182005_1001110 | 3300015265 | Bacteria | 11246 |
| 255 | Ga0182005_1002979 | 3300015265 | Bacteria | 5862 |
| 256 | Ga0183369_1006 | 3300015685 | Bacteria | 449058 |
| 257 | Ga0183368_1004 | 3300015687 | Bacteria | 1211761 |
| 258 | Ga0163161_10007748 | 3300017792 | Bacteria | 7428 |
| 259 | Ga0197907_10862894 | 3300020069 | Bacteria | 2956 |
| 260 | Ga0197907_11474155 | 3300020069 | Bacteria | 2395 |
| 261 | Ga0206356_10168839 | 3300020070 | Bacteria | 6249 |
| 262 | Ga0206351_10908139 | 3300020077 | Bacteria | 2664 |
| 263 | Ga0206353_10073144 | 3300020082 | Bacteria | 2454 |
| 264 | Ga0209784_100013 | 3300025224 | Bacteria | 518664 |
| 265 | Ga0209566_100544 | 3300025225 | Bacteria | 25458 |
| 266 | Ga0209674_100026 | 3300025226 | Bacteria | 490631 |
| 267 | Ga0209674_100062 | 3300025226 | Bacteria | 276316 |
| 268 | Ga0209674_100974 | 3300025226 | Bacteria | 8974 |
| 269 | Ga0209672_100007 | 3300025228 | Bacteria | 959482 |
| 270 | Ga0209672_100017 | 3300025228 | Bacteria | 514236 |
| 271 | Ga0209672_100743 | 3300025228 | Bacteria | 15906 |
| 272 | Ga0209672_100839 | 3300025228 | Bacteria | 14268 |
| 273 | Ga0209672_102291 | 3300025228 | Bacteria | 4891 |
| 274 | Ga0209563_100131 | 3300025230 | Bacteria | 97465 |
| 275 | Ga0207427_100021 | 3300025231 | Bacteria | 494115 |
| 276 | Ga0207427_100073 | 3300025231 | Bacteria | 156503 |
| 277 | Ga0207427_100289 | 3300025231 | Bacteria | 35918 |
| 278 | Ga0207427_100306 | 3300025231 | Bacteria | 34125 |
| 279 | Ga0209437_100012 | 3300025233 | Bacteria | 792625 |
| 280 | Ga0209437_100039 | 3300025233 | Bacteria | 448321 |
| 281 | Ga0209437_100087 | 3300025233 | Bacteria | 253432 |
| 282 | Ga0209437_100129 | 3300025233 | Bacteria | 184661 |
| 283 | Ga0209437_100159 | 3300025233 | Bacteria | 149598 |
| 284 | Ga0209437_100637 | 3300025233 | Bacteria | 20495 |
| 285 | Ga0209258_100017 | 3300025242 | Bacteria | 590785 |
| 286 | Ga0209258_100019 | 3300025242 | Bacteria | 566728 |
| 287 | Ga0209258_100206 | 3300025242 | Bacteria | 119449 |
| 288 | Ga0209258_100213 | 3300025242 | Bacteria | 115394 |
| 289 | Ga0209258_100594 | 3300025242 | Bacteria | 29847 |
| 290 | Ga0209258_102146 | 3300025242 | Bacteria | 5484 |
| 291 | Ga0207425_1000092 | 3300025245 | Bacteria | 87673 |
| 292 | Ga0209646_1001828 | 3300025246 | Bacteria | 5261 |
| 293 | Ga0209026_1000051 | 3300025250 | Bacteria | 250792 |
| 294 | Ga0209026_1000079 | 3300025250 | Bacteria | 198355 |
| 295 | Ga0209026_1000125 | 3300025250 | Bacteria | 124729 |
| 296 | Ga0209026_1000592 | 3300025250 | Bacteria | 23632 |
| 297 | Ga0209026_1002773 | 3300025250 | Bacteria | 6249 |
| 298 | Ga0209677_100969 | 3300025253 | Bacteria | 13954 |
| 299 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 300 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 301 | Ga0209148_1000009 | 3300025254 | Bacteria | 1395625 |
| 302 | Ga0209148_1000044 | 3300025254 | Bacteria | 458417 |
| 303 | Ga0209148_1000176 | 3300025254 | Bacteria | 128357 |
| 304 | Ga0209148_1000185 | 3300025254 | Bacteria | 118117 |
| 305 | Ga0209759_1000145 | 3300025256 | Bacteria | 121772 |
| 306 | Ga0209759_1000328 | 3300025256 | Bacteria | 62531 |
| 307 | Ga0209759_1002334 | 3300025256 | Bacteria | 8510 |
| 308 | Ga0209759_1005371 | 3300025256 | Bacteria | 4509 |
| 309 | Ga0209129_1000151 | 3300025258 | Bacteria | 113221 |
| 310 | Ga0209129_1003459 | 3300025258 | Bacteria | 6852 |
| 311 | Ga0209129_1007561 | 3300025258 | Bacteria | 3205 |
| 312 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 313 | Ga0209233_1000020 | 3300025261 | Bacteria | 798224 |
| 314 | Ga0209233_1000023 | 3300025261 | Bacteria | 738870 |
| 315 | Ga0209233_1000090 | 3300025261 | Bacteria | 315680 |
| 316 | Ga0209565_1000014 | 3300025263 | Bacteria | 530302 |
| 317 | Ga0209455_1000010 | 3300025272 | Bacteria | 959482 |
| 318 | Ga0209455_1000027 | 3300025272 | Bacteria | 566710 |
| 319 | Ga0209455_1000032 | 3300025272 | Bacteria | 514243 |
| 320 | Ga0209455_1000081 | 3300025272 | Bacteria | 263674 |
| 321 | Ga0209673_1000171 | 3300025273 | Bacteria | 133493 |
| 322 | Ga0209130_1012874 | 3300025284 | Bacteria | 2166 |
| 323 | Ga0209675_1000011 | 3300025291 | Bacteria | 520597 |
| 324 | Ga0209675_1016461 | 3300025291 | Bacteria | 2152 |
| 325 | Ga0209676_1000079 | 3300025292 | Bacteria | 290447 |
| 326 | Ga0209676_1000086 | 3300025292 | Bacteria | 264155 |
| 327 | Ga0209676_1000092 | 3300025292 | Bacteria | 250453 |
| 328 | Ga0209676_1002465 | 3300025292 | Bacteria | 13076 |
| 329 | Ga0209676_1003076 | 3300025292 | Bacteria | 10754 |
| 330 | Ga0209676_1003077 | 3300025292 | Bacteria | 10754 |
| 331 | Ga0209676_1006826 | 3300025292 | Bacteria | 5536 |
| 332 | Ga0209025_1000012 | 3300025294 | Bacteria | 924362 |
| 333 | Ga0209025_1000015 | 3300025294 | Bacteria | 808120 |
| 334 | Ga0209025_1002444 | 3300025294 | Bacteria | 19667 |
| 335 | Ga0209025_1008928 | 3300025294 | Bacteria | 7094 |
| 336 | Ga0209564_1000221 | 3300025295 | Bacteria | 129537 |
| 337 | Ga0209758_1000018 | 3300025297 | Bacteria | 753320 |
| 338 | Ga0209758_1005446 | 3300025297 | Bacteria | 9799 |
| 339 | Ga0209758_1008116 | 3300025297 | Bacteria | 6909 |
| 340 | Ga0209758_1015576 | 3300025297 | Bacteria | 3924 |
| 341 | Ga0209758_1016918 | 3300025297 | Bacteria | 3671 |
| 342 | Ga0209050_1000329 | 3300025298 | Bacteria | 94932 |
| 343 | Ga0209050_1000415 | 3300025298 | Bacteria | 79058 |
| 344 | Ga0209050_1000528 | 3300025298 | Bacteria | 63464 |
| 345 | Ga0209050_1004837 | 3300025298 | Bacteria | 8846 |
| 346 | Ga0209050_1005515 | 3300025298 | Bacteria | 7908 |
| 347 | Ga0209256_1004521 | 3300025299 | Bacteria | 8679 |
| 348 | Ga0209256_1018718 | 3300025299 | Bacteria | 2235 |
| 349 | Ga0209051_1002764 | 3300025303 | Bacteria | 12119 |
| 350 | Ga0209051_1007093 | 3300025303 | Bacteria | 6193 |
| 351 | Ga0209051_1032538 | 3300025303 | Bacteria | 1987 |
| 352 | Ga0209257_1000080 | 3300025304 | Bacteria | 312038 |
| 353 | Ga0209257_1000081 | 3300025304 | Bacteria | 306577 |
| 354 | Ga0209257_1000121 | 3300025304 | Bacteria | 222588 |
| 355 | Ga0209257_1000145 | 3300025304 | Bacteria | 195152 |
| 356 | Ga0209257_1002505 | 3300025304 | Bacteria | 18133 |
| 357 | Ga0209257_1004877 | 3300025304 | Bacteria | 9909 |
| 358 | Ga0209257_1005274 | 3300025304 | Bacteria | 9213 |
| 359 | Ga0209257_1015664 | 3300025304 | Bacteria | 3135 |
| 360 | Ga0207656_10001780 | 3300025321 | Bacteria | 7168 |
| 361 | Ga0207713_1000710 | 3300025735 | Bacteria | 31158 |
| 362 | Ga0207713_1009080 | 3300025735 | Bacteria | 5647 |
| 363 | Ga0207710_10034415 | 3300025900 | Bacteria | 2226 |
| 364 | Ga0207680_10000006 | 3300025903 | Bacteria | 635950 |
| 365 | Ga0207680_10020353 | 3300025903 | Bacteria | 3569 |
| 366 | Ga0207647_10000607 | 3300025904 | Bacteria | 27924 |
| 367 | Ga0207647_10001539 | 3300025904 | Bacteria | 17764 |
| 368 | Ga0207647_10002712 | 3300025904 | Bacteria | 13374 |
| 369 | Ga0207647_10012222 | 3300025904 | Bacteria | 5985 |
| 370 | Ga0207647_10024280 | 3300025904 | Bacteria | 3999 |
| 371 | Ga0207645_10013275 | 3300025907 | Bacteria | 5557 |
| 372 | Ga0207705_10000165 | 3300025909 | Bacteria | 71603 |
| 373 | Ga0207705_10000353 | 3300025909 | Bacteria | 41498 |
| 374 | Ga0207705_10000355 | 3300025909 | Bacteria | 41474 |
| 375 | Ga0207705_10001403 | 3300025909 | Bacteria | 19215 |
| 376 | Ga0207705_10008340 | 3300025909 | Bacteria | 7564 |
| 377 | Ga0207707_10000391 | 3300025912 | Bacteria | 45809 |
| 378 | Ga0207707_10001033 | 3300025912 | Bacteria | 26719 |
| 379 | Ga0207707_10001308 | 3300025912 | Bacteria | 23205 |
| 380 | Ga0207707_10010325 | 3300025912 | Bacteria | 8102 |
| 381 | Ga0207707_10011013 | 3300025912 | Bacteria | 7869 |
| 382 | Ga0207707_10012035 | 3300025912 | Bacteria | 7521 |
| 383 | Ga0207707_10017065 | 3300025912 | Bacteria | 6325 |
| 384 | Ga0207707_10046729 | 3300025912 | Bacteria | 3771 |
| 385 | Ga0207707_10051686 | 3300025912 | Bacteria | 3579 |
| 386 | Ga0207695_10000975 | 3300025913 | Bacteria | 50860 |
| 387 | Ga0207695_10006463 | 3300025913 | Bacteria | 15214 |
| 388 | Ga0207695_10007085 | 3300025913 | Bacteria | 14367 |
| 389 | Ga0207695_10009557 | 3300025913 | Bacteria | 11986 |
| 390 | Ga0207695_10011615 | 3300025913 | Bacteria | 10651 |
| 391 | Ga0207695_10012347 | 3300025913 | Bacteria | 10263 |
| 392 | Ga0207695_10031715 | 3300025913 | Bacteria | 5791 |
| 393 | Ga0207695_10046563 | 3300025913 | Bacteria | 4597 |
| 394 | Ga0207695_10087165 | 3300025913 | Bacteria | 3145 |
| 395 | Ga0207671_10000137 | 3300025914 | Bacteria | 112029 |
| 396 | Ga0207671_10003811 | 3300025914 | Bacteria | 14763 |
| 397 | Ga0207671_10004200 | 3300025914 | Bacteria | 13892 |
| 398 | Ga0207660_10000931 | 3300025917 | Bacteria | 19331 |
| 399 | Ga0207660_10001391 | 3300025917 | Bacteria | 16259 |
| 400 | Ga0207660_10003395 | 3300025917 | Bacteria | 10378 |
| 401 | Ga0207660_10005061 | 3300025917 | Bacteria | 8583 |
| 402 | Ga0207657_10010252 | 3300025919 | Bacteria | 9360 |
| 403 | Ga0207657_10017203 | 3300025919 | Bacteria | 6945 |
| 404 | Ga0207649_10005594 | 3300025920 | Bacteria | 6795 |
| 405 | Ga0207649_10031454 | 3300025920 | Bacteria | 3154 |
| 406 | Ga0207649_10089027 | 3300025920 | Bacteria | 2017 |
| 407 | Ga0207652_10000030 | 3300025921 | Bacteria | 144884 |
| 408 | Ga0207652_10001197 | 3300025921 | Bacteria | 23349 |
| 409 | Ga0207652_10041489 | 3300025921 | Bacteria | 3912 |
| 410 | Ga0207681_10004705 | 3300025923 | Bacteria | 8395 |
| 411 | Ga0207694_10000563 | 3300025924 | Bacteria | 33592 |
| 412 | Ga0207694_10004402 | 3300025924 | Bacteria | 11002 |
| 413 | Ga0207694_10012219 | 3300025924 | Bacteria | 6473 |
| 414 | Ga0207694_10012898 | 3300025924 | Bacteria | 6292 |
| 415 | Ga0207694_10041831 | 3300025924 | Bacteria | 3532 |
| 416 | Ga0207650_10044596 | 3300025925 | Bacteria | 3260 |
| 417 | Ga0207700_10000822 | 3300025928 | Bacteria | 17939 |
| 418 | Ga0207664_10000474 | 3300025929 | Bacteria | 28453 |
| 419 | Ga0207664_10000584 | 3300025929 | Bacteria | 25442 |
| 420 | Ga0207664_10000585 | 3300025929 | Bacteria | 25440 |
| 421 | Ga0207644_10000313 | 3300025931 | Bacteria | 31603 |
| 422 | Ga0207644_10060403 | 3300025931 | Bacteria | 2743 |
| 423 | Ga0207690_10000443 | 3300025932 | Bacteria | 26830 |
| 424 | Ga0207690_10001772 | 3300025932 | Bacteria | 13272 |
| 425 | Ga0207690_10001851 | 3300025932 | Bacteria | 13004 |
| 426 | Ga0207690_10001946 | 3300025932 | Bacteria | 12658 |
| 427 | Ga0207690_10007510 | 3300025932 | Bacteria | 6470 |
| 428 | Ga0207690_10008552 | 3300025932 | Bacteria | 6074 |
| 429 | Ga0207690_10009506 | 3300025932 | Bacteria | 5775 |
| 430 | Ga0207706_10029417 | 3300025933 | Bacteria | 4903 |
| 431 | Ga0207709_10018744 | 3300025935 | Bacteria | 3880 |
| 432 | Ga0207670_10005060 | 3300025936 | Bacteria | 7190 |
| 433 | Ga0207704_10001296 | 3300025938 | Bacteria | 11176 |
| 434 | Ga0207691_10007639 | 3300025940 | Bacteria | 10406 |
| 435 | Ga0207711_10001015 | 3300025941 | Bacteria | 26915 |
| 436 | Ga0207711_10004854 | 3300025941 | Bacteria | 11428 |
| 437 | Ga0207711_10061557 | 3300025941 | Bacteria | 3237 |
| 438 | Ga0207661_10004417 | 3300025944 | Bacteria | 9865 |
| 439 | Ga0207667_10000250 | 3300025949 | Bacteria | 75738 |
| 440 | Ga0207667_10000679 | 3300025949 | Bacteria | 44080 |
| 441 | Ga0207667_10001003 | 3300025949 | Bacteria | 36039 |
| 442 | Ga0207667_10001167 | 3300025949 | Bacteria | 32985 |
| 443 | Ga0207667_10005715 | 3300025949 | Bacteria | 15171 |
| 444 | Ga0207667_10016516 | 3300025949 | Bacteria | 8337 |
| 445 | Ga0207712_10000343 | 3300025961 | Bacteria | 42053 |
| 446 | Ga0207640_10001071 | 3300025981 | Bacteria | 15167 |
| 447 | Ga0207640_10003830 | 3300025981 | Bacteria | 8116 |
| 448 | Ga0207640_10005529 | 3300025981 | Bacteria | 6887 |
| 449 | Ga0207658_10000093 | 3300025986 | Bacteria | 98928 |
| 450 | Ga0207677_10094535 | 3300026023 | Bacteria | 2182 |
| 451 | Ga0207639_10001634 | 3300026041 | Bacteria | 15086 |
| 452 | Ga0207639_10002124 | 3300026041 | Bacteria | 13352 |
| 453 | Ga0207639_10005666 | 3300026041 | Bacteria | 8451 |
| 454 | Ga0207639_10007609 | 3300026041 | Bacteria | 7389 |
| 455 | Ga0207678_10000433 | 3300026067 | Bacteria | 37961 |
| 456 | Ga0207678_10005962 | 3300026067 | Bacteria | 10852 |
| 457 | Ga0207678_10050893 | 3300026067 | Bacteria | 3578 |
| 458 | Ga0207678_10080157 | 3300026067 | Bacteria | 2795 |
| 459 | Ga0207702_10000943 | 3300026078 | Bacteria | 29865 |
| 460 | Ga0207702_10003531 | 3300026078 | Bacteria | 14234 |
| 461 | Ga0207702_10140169 | 3300026078 | Bacteria | 2187 |
| 462 | Ga0207648_10029340 | 3300026089 | Bacteria | 4878 |
| 463 | Ga0207674_10007214 | 3300026116 | Bacteria | 12971 |
| 464 | Ga0207674_10019944 | 3300026116 | Bacteria | 7255 |
| 465 | Ga0207674_10024820 | 3300026116 | Bacteria | 6399 |
| 466 | Ga0207674_10065193 | 3300026116 | Bacteria | 3672 |
| 467 | Ga0207674_10066528 | 3300026116 | Bacteria | 3630 |
| 468 | Ga0207683_10025237 | 3300026121 | Bacteria | 5125 |
| 469 | Ga0207698_10000592 | 3300026142 | Bacteria | 21149 |
| 470 | Ga0207698_10002980 | 3300026142 | Bacteria | 10149 |
| 471 | Ga0207698_10038811 | 3300026142 | Bacteria | 3522 |
| 472 | Ga0209371_1000011 | 3300027312 | Bacteria | 848456 |
| 473 | Ga0268266_10000043 | 3300028379 | Bacteria | 316604 |
| 474 | Ga0268266_10045565 | 3300028379 | Bacteria | 3752 |
| 475 | Ga0268265_10094964 | 3300028380 | Bacteria | 2393 |
| 476 | Ga0268264_10022370 | 3300028381 | Bacteria | 5163 |
| 477 | Ga0268264_10069503 | 3300028381 | Bacteria | 2978 |
| 478 | Ga0265334_10000009 | 3300028573 | Bacteria | 194312 |
| 479 | Ga0265338_10009730 | 3300028800 | Bacteria | 11404 |
| 480 | Ga0268256_1000011 | 3300030500 | Bacteria | 848625 |
| 481 | Ga0316177_1203723 | 3300030731 | Bacteria | 6164 |
| 482 | Ga0307513_10053920 | 3300031456 | Bacteria | 4316 |
| 483 | Ga0307408_100046420 | 3300031548 | Bacteria | 3107 |
| 484 | Ga0265313_10007989 | 3300031595 | Bacteria | 7104 |
| 485 | Ga0316575_10011930 | 3300031665 | Bacteria | 3224 |
| 486 | Ga0316575_10040661 | 3300031665 | Bacteria | 1837 |
| 487 | Ga0316578_10016352 | 3300031728 | Bacteria | 4012 |
| 488 | Ga0307516_10001401 | 3300031730 | Bacteria | 33337 |
| 489 | Ga0307516_10018328 | 3300031730 | Bacteria | 7275 |
| 490 | Ga0307516_10035332 | 3300031730 | Bacteria | 5015 |
| 491 | Ga0307405_10003809 | 3300031731 | Bacteria | 7013 |
| 492 | Ga0316577_10009829 | 3300031733 | Bacteria | 5155 |
| 493 | Ga0307413_10001746 | 3300031824 | Bacteria | 8494 |
| 494 | Ga0307410_10005487 | 3300031852 | Bacteria | 6720 |
| 495 | Ga0307407_10013528 | 3300031903 | Bacteria | 3965 |
| 496 | Ga0307412_10006145 | 3300031911 | Bacteria | 6768 |
| 497 | Ga0307409_100126975 | 3300031995 | Bacteria | 2171 |
| 498 | Ga0307416_100000500 | 3300032002 | Bacteria | 19946 |
| 499 | Ga0307414_10003986 | 3300032004 | Bacteria | 7967 |
| 500 | Ga0307414_10017858 | 3300032004 | Bacteria | 4351 |
| 501 | Ga0307411_10017445 | 3300032005 | Bacteria | 4091 |
| 502 | Ga0307415_100014074 | 3300032126 | Bacteria | 4690 |
| 503 | Ga0316583_10000626 | 3300032133 | Bacteria | 10804 |
| 504 | Ga0316585_10000572 | 3300032137 | Bacteria | 9022 |
| 505 | Ga0316580_10003247 | 3300032139 | Bacteria | 4592 |
| 506 | Ga0307510_10001938 | 3300033180 | Bacteria | 23267 |
| 507 | Ga0316574_0002354 | 3300035398 | Bacteria | 9458 |
| 508 | Ga0316574_0008582 | 3300035398 | Bacteria | 5682 |
| 509 | Ga0316574_0009969 | 3300035398 | Bacteria | 5346 |
| 510 | Ga0373927_0000003 | 3300035695 | Bacteria | 480348 |
| 511 | Ga0316582_0002212 | 3300036647 | Bacteria | 9026 |
| 512 | Ga0316584_0002179 | 3300036712 | Bacteria | 12271 |
| 513 | Ga0316584_0042445 | 3300036712 | Bacteria | 3392 |
| 514 | Ga0395899_0000142 | 3300037312 | Bacteria | 109659 |
| 515 | Ga0395899_0009818 | 3300037312 | Bacteria | 7342 |
| 516 | Ga0395899_0016093 | 3300037312 | Bacteria | 5701 |
| 517 | Ga0395899_0022754 | 3300037312 | Bacteria | 4749 |
| 518 | Ga0395899_0053918 | 3300037312 | Bacteria | 2976 |
| 519 | Ga0395899_0134478 | 3300037312 | Bacteria | 1763 |
| 520 | Ga0395900_0000069 | 3300037418 | Bacteria | 190578 |
| 521 | Ga0395900_0002387 | 3300037418 | Bacteria | 20737 |
| 522 | Ga0395900_0010793 | 3300037418 | Bacteria | 9345 |
| 523 | Ga0395900_0031124 | 3300037418 | Bacteria | 5481 |
| 524 | Ga0395900_0082649 | 3300037418 | Bacteria | 3300 |
| 525 | Ga0395898_0000097 | 3300037466 | Bacteria | 230579 |
| 526 | Ga0395898_0001079 | 3300037466 | Bacteria | 42224 |
| 527 | Ga0395898_0015073 | 3300037466 | Bacteria | 7934 |
| 528 | Ga0395898_0025910 | 3300037466 | Bacteria | 5904 |
| 529 | Ga0395901_0000983 | 3300038443 | Bacteria | 30866 |
| 530 | Ga0395901_0002935 | 3300038443 | Bacteria | 17206 |
| 531 | Ga0395901_0010713 | 3300038443 | Bacteria | 9295 |
| 532 | Ga0395901_0149263 | 3300038443 | Bacteria | 2456 |
| 533 | Ga0237819_00127 | 3300038705 | Bacteria | 28645 |
| 534 | Ga0439436_0000010 | 3300041404 | Bacteria | 104480 |
| 535 | Ga0439436_0006040 | 3300041404 | Bacteria | 3712 |
| 536 | Ga0439465_0000123 | 3300041413 | Bacteria | 18623 |
| 537 | Ga0439465_0003861 | 3300041413 | Bacteria | 4889 |
| 538 | Ga0439465_0018945 | 3300041413 | Bacteria | 2151 |
| 539 | Ga0451791_0612411 | 3300041451 | Bacteria | 1981 |
| 540 | Ga0439433_0012744 | 3300041999 | Bacteria | 1845 |
| 541 | Ga0439432_007320 | 3300042006 | Bacteria | 3915 |
| 542 | Ga0439432_019438 | 3300042006 | Bacteria | 2262 |
| 543 | Ga0439449_0000905 | 3300042007 | Bacteria | 11573 |
| 544 | Ga0450908_000564 | 3300042184 | Bacteria | 7116 |
| 545 | Ga0450908_000860 | 3300042184 | Bacteria | 5854 |
| 546 | Ga0451577_0009927 | 3300042876 | Bacteria | 9126 |
| 547 | Ga0466969_0002807 | 3300044656 | Bacteria | 9304 |
| 548 | Ga0466969_0003343 | 3300044656 | Bacteria | 8536 |
| 549 | Ga0466969_0004136 | 3300044656 | Bacteria | 7701 |
| 550 | Ga0466969_0017661 | 3300044656 | Bacteria | 3722 |
| 551 | Ga0466972_0016098 | 3300044658 | Bacteria | 3738 |
| 552 | Ga0466989_0020182 | 3300044663 | Bacteria | 3832 |
| 553 | Ga0466982_0000019 | 3300044672 | Bacteria | 111595 |
| 554 | Ga0466982_0000098 | 3300044672 | Bacteria | 21160 |
| 555 | Ga0453683_0008814 | 3300044673 | Bacteria | 6755 |
| 556 | Ga0466965_0019349 | 3300044683 | Bacteria | 3269 |
| 557 | Ga0466966_0020730 | 3300044684 | Bacteria | 4320 |
| 558 | Ga0466961_0007963 | 3300044693 | Bacteria | 6754 |
| 559 | Ga0466961_0013744 | 3300044693 | Bacteria | 5188 |
| 560 | Ga0466961_0075758 | 3300044693 | Bacteria | 2132 |
| 561 | Ga0466961_0091704 | 3300044693 | Bacteria | 1918 |
| 562 | Ga0466964_0015082 | 3300044706 | Bacteria | 2942 |
| 563 | Ga0466971_0016812 | 3300044719 | Bacteria | 3232 |
| 564 | Ga0466968_0004448 | 3300044735 | Bacteria | 5244 |
| 565 | Ga0466968_0030742 | 3300044735 | Bacteria | 2225 |
| 566 | Ga0466970_0001674 | 3300044765 | Bacteria | 10642 |
| 567 | Ga0466970_0009926 | 3300044765 | Bacteria | 4819 |
| 568 | Ga0466970_0057341 | 3300044765 | Bacteria | 2082 |
| 569 | Ga0466960_0031658 | 3300044901 | Bacteria | 2442 |
| 570 | Ga0466959_0024013 | 3300045049 | Bacteria | 4514 |
| 571 | Ga0466959_0053115 | 3300045049 | Bacteria | 2963 |
| 572 | Ga0451576_0000821 | 3300045051 | Bacteria | 60704 |
| 573 | Ga0451576_0072609 | 3300045051 | Bacteria | 3581 |
| 574 | Ga0466967_0041735 | 3300045976 | Bacteria | 3959 |
| 575 | Ga0495617_003046 | 3300046452 | Bacteria | 6383 |
| 576 | Ga0495617_003503 | 3300046452 | Bacteria | 5881 |
| 577 | Ga0495627_006082 | 3300046453 | Bacteria | 4770 |
| 578 | Ga0495638_0000069 | 3300046460 | Bacteria | 167503 |
| 579 | Ga0495638_0000122 | 3300046460 | Bacteria | 125872 |
| 580 | Ga0495638_0001156 | 3300046460 | Bacteria | 25430 |
| 581 | Ga0495638_0001504 | 3300046460 | Bacteria | 20993 |
| 582 | Ga0495638_0005088 | 3300046460 | Bacteria | 9854 |
| 583 | Ga0495650_0000209 | 3300046471 | Bacteria | 125495 |
| 584 | Ga0495650_0003763 | 3300046471 | Bacteria | 10827 |
| 585 | Ga0495605_0023124 | 3300046474 | Bacteria | 3272 |
| 586 | Ga0495585_0000423 | 3300046492 | Bacteria | 40748 |
| 587 | Ga0495585_0010514 | 3300046492 | Bacteria | 5504 |
| 588 | Ga0495607_0000080 | 3300046501 | Bacteria | 97217 |
| 589 | Ga0495607_0008882 | 3300046501 | Bacteria | 6846 |
| 590 | Ga0495607_0021638 | 3300046501 | Bacteria | 4044 |
| 591 | Ga0495607_0077432 | 3300046501 | Bacteria | 1837 |
| 592 | Ga0495606_0000203 | 3300046507 | Bacteria | 103887 |
| 593 | Ga0495606_0000348 | 3300046507 | Bacteria | 79254 |
| 594 | Ga0495606_0016437 | 3300046507 | Bacteria | 5640 |
| 595 | Ga0495610_0004716 | 3300046512 | Bacteria | 9951 |
| 596 | Ga0495610_0043035 | 3300046512 | Bacteria | 2253 |
| 597 | Ga0495616_0000067 | 3300046513 | Bacteria | 89610 |
| 598 | Ga0495616_0025426 | 3300046513 | Bacteria | 3164 |
| 599 | Ga0495620_0003391 | 3300046515 | Bacteria | 9116 |
| 600 | Ga0495631_0003301 | 3300046518 | Bacteria | 8873 |
| 601 | Ga0495631_0004603 | 3300046518 | Bacteria | 7301 |
| 602 | Ga0495632_0000046 | 3300046519 | Bacteria | 139365 |
| 603 | Ga0495637_0014700 | 3300046520 | Bacteria | 3688 |
| 604 | Ga0495643_0001740 | 3300046522 | Bacteria | 18773 |
| 605 | Ga0495648_0018232 | 3300046524 | Bacteria | 4983 |
| 606 | Ga0495663_0000872 | 3300046525 | Bacteria | 10172 |
| 607 | Ga0495663_0001432 | 3300046525 | Bacteria | 7534 |
| 608 | Ga0495621_0003739 | 3300046539 | Bacteria | 4217 |
| 609 | Ga0495633_0013730 | 3300046558 | Bacteria | 4257 |
| 610 | Ga0495633_0022068 | 3300046558 | Bacteria | 3173 |
| 611 | Ga0495668_0000804 | 3300046616 | Bacteria | 36089 |
| 612 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 613 | Ga0495625_0000001 | 3300046660 | Bacteria | 1641829 |
| 614 | Ga0495625_0024027 | 3300046660 | Bacteria | 4646 |
| 615 | Ga0495625_0044660 | 3300046660 | Bacteria | 3206 |
| 616 | Ga0495661_0004547 | 3300046665 | Bacteria | 9991 |
| 617 | Ga0495647_0021574 | 3300046681 | Bacteria | 2320 |
| 618 | Ga0495670_0009454 | 3300046691 | Bacteria | 4791 |
| 619 | Ga0495671_0000875 | 3300046692 | Bacteria | 21477 |
| 620 | Ga0495649_0012109 | 3300046694 | Bacteria | 5034 |
| 621 | Ga0495649_0015980 | 3300046694 | Bacteria | 4261 |
| 622 | Ga0495589_0000138 | 3300046794 | Bacteria | 66651 |
| 623 | Ga0495660_0004009 | 3300046810 | Bacteria | 8989 |
| 624 | Ga0495672_0000373 | 3300047320 | Bacteria | 55844 |
| 625 | Ga0495679_000029 | 3300047446 | Bacteria | 190883 |
| 626 | Ga0495673_0000001 | 3300047469 | Bacteria | 1630730 |
| 627 | Ga0495673_0014223 | 3300047469 | Bacteria | 4144 |
| 628 | Ga0495686_0000043 | 3300047472 | Bacteria | 291565 |
| 629 | Ga0495686_0085291 | 3300047472 | Bacteria | 1923 |
| 630 | Ga0496101_0016866 | 3300048904 | Bacteria | 4944 |
| 631 | Ga0496104_0000022 | 3300048907 | Bacteria | 237390 |
| 632 | Ga0496104_0012882 | 3300048907 | Bacteria | 7532 |
| 633 | Ga0496105_0000012 | 3300048908 | Bacteria | 261713 |
| 634 | Ga0496105_0006290 | 3300048908 | Bacteria | 9118 |
| 635 | Ga0496105_0018943 | 3300048908 | Bacteria | 5545 |
| 636 | Ga0496105_0090311 | 3300048908 | Bacteria | 2530 |
| 637 | Ga0496106_0009989 | 3300048909 | Bacteria | 7009 |
| 638 | Ga0496106_0014736 | 3300048909 | Bacteria | 5780 |
| 639 | Ga0496108_0030769 | 3300048911 | Bacteria | 4448 |
| 640 | Ga0496109_0200161 | 3300048912 | Bacteria | 1877 |
| 641 | Ga0496110_0005613 | 3300048913 | Bacteria | 9846 |
| 642 | Ga0496110_0035169 | 3300048913 | Bacteria | 4344 |
| 643 | Ga0496113_0067201 | 3300048916 | Bacteria | 2717 |
| 644 | Ga0496114_0001917 | 3300048917 | Bacteria | 15837 |
| 645 | Ga0496114_0046500 | 3300048917 | Bacteria | 3607 |
| 646 | Ga0496115_0000163 | 3300048918 | Bacteria | 62399 |
| 647 | Ga0496115_0000181 | 3300048918 | Bacteria | 58749 |
| 648 | Ga0496115_0013485 | 3300048918 | Bacteria | 6184 |
| 649 | Ga0496115_0020279 | 3300048918 | Bacteria | 5126 |
| 650 | Ga0496115_0038116 | 3300048918 | Bacteria | 3812 |
| 651 | Ga0496115_0071919 | 3300048918 | Bacteria | 2805 |
| 652 | Ga0496116_0000005 | 3300048919 | Bacteria | 827804 |
| 653 | Ga0496116_0017392 | 3300048919 | Bacteria | 5580 |
| 654 | Ga0496117_0005762 | 3300048920 | Bacteria | 12872 |
| 655 | Ga0496117_0009952 | 3300048920 | Bacteria | 8743 |
| 656 | Ga0496117_0013593 | 3300048920 | Bacteria | 7089 |
| 657 | Ga0496117_0015798 | 3300048920 | Bacteria | 6407 |
| 658 | Ga0496117_0020923 | 3300048920 | Bacteria | 5319 |
| 659 | Ga0496117_0024725 | 3300048920 | Bacteria | 4739 |
| 660 | Ga0496117_0028315 | 3300048920 | Bacteria | 4342 |
| 661 | Ga0496117_0057321 | 3300048920 | Bacteria | 2706 |
| 662 | Ga0496118_0000528 | 3300048921 | Bacteria | 62711 |
| 663 | Ga0496118_0000848 | 3300048921 | Bacteria | 48534 |
| 664 | Ga0496118_0004154 | 3300048921 | Bacteria | 17490 |
| 665 | Ga0496118_0005474 | 3300048921 | Bacteria | 14415 |
| 666 | Ga0496118_0016346 | 3300048921 | Bacteria | 6811 |
| 667 | Ga0496118_0017635 | 3300048921 | Bacteria | 6485 |
| 668 | Ga0496118_0025548 | 3300048921 | Bacteria | 5059 |
| 669 | Ga0496118_0029280 | 3300048921 | Bacteria | 4621 |
| 670 | Ga0496118_0031026 | 3300048921 | Bacteria | 4443 |
| 671 | Ga0496119_0000184 | 3300048922 | Bacteria | 87765 |
| 672 | Ga0496119_0000659 | 3300048922 | Bacteria | 46235 |
| 673 | Ga0496119_0001426 | 3300048922 | Bacteria | 28899 |
| 674 | Ga0496119_0021762 | 3300048922 | Bacteria | 4619 |
| 675 | Ga0496120_0000217 | 3300048923 | Bacteria | 99402 |
| 676 | Ga0496120_0000307 | 3300048923 | Bacteria | 81552 |
| 677 | Ga0496120_0001091 | 3300048923 | Bacteria | 35465 |
| 678 | Ga0496120_0004293 | 3300048923 | Bacteria | 12085 |
| 679 | Ga0496121_0000029 | 3300048924 | Bacteria | 430303 |
| 680 | Ga0496121_0000045 | 3300048924 | Bacteria | 336130 |
| 681 | Ga0496121_0004159 | 3300048924 | Bacteria | 19788 |
| 682 | Ga0496121_0009184 | 3300048924 | Bacteria | 11428 |
| 683 | Ga0496121_0009283 | 3300048924 | Bacteria | 11346 |
| 684 | Ga0496121_0017494 | 3300048924 | Bacteria | 7318 |
| 685 | Ga0496121_0029782 | 3300048924 | Bacteria | 5034 |
| 686 | Ga0496121_0037992 | 3300048924 | Bacteria | 4270 |
| 687 | Ga0496121_0040589 | 3300048924 | Bacteria | 4080 |
| 688 | Ga0496122_0000267 | 3300048925 | Bacteria | 116950 |
| 689 | Ga0496122_0001038 | 3300048925 | Bacteria | 48750 |
| 690 | Ga0496122_0001998 | 3300048925 | Bacteria | 30375 |
| 691 | Ga0496122_0005854 | 3300048925 | Bacteria | 14421 |
| 692 | Ga0496122_0016541 | 3300048925 | Bacteria | 6966 |
| 693 | Ga0496122_0019191 | 3300048925 | Bacteria | 6261 |
| 694 | Ga0496122_0019274 | 3300048925 | Bacteria | 6242 |
| 695 | Ga0496122_0030232 | 3300048925 | Bacteria | 4546 |
| 696 | Ga0496123_0000161 | 3300048926 | Bacteria | 134623 |
| 697 | Ga0496123_0000848 | 3300048926 | Bacteria | 48801 |
| 698 | Ga0496123_0001899 | 3300048926 | Bacteria | 27259 |
| 699 | Ga0496123_0015448 | 3300048926 | Bacteria | 6261 |
| 700 | Ga0496123_0024797 | 3300048926 | Bacteria | 4543 |
| 701 | Ga0496123_0026628 | 3300048926 | Bacteria | 4327 |
| 702 | Ga0496123_0031037 | 3300048926 | Bacteria | 3897 |
| 703 | Ga0496124_0000009 | 3300048927 | Bacteria | 734820 |
| 704 | Ga0496124_0000734 | 3300048927 | Bacteria | 53581 |
| 705 | Ga0496124_0001490 | 3300048927 | Bacteria | 34391 |
| 706 | Ga0496124_0004066 | 3300048927 | Bacteria | 17329 |
| 707 | Ga0496124_0025689 | 3300048927 | Bacteria | 5328 |
| 708 | Ga0496124_0042962 | 3300048927 | Bacteria | 3888 |
| 709 | Ga0496125_0000149 | 3300048928 | Bacteria | 154223 |
| 710 | Ga0496125_0010887 | 3300048928 | Bacteria | 9147 |
| 711 | Ga0496125_0031770 | 3300048928 | Bacteria | 4699 |
| 712 | Ga0496125_0031902 | 3300048928 | Bacteria | 4687 |
| 713 | Ga0496125_0036240 | 3300048928 | Bacteria | 4311 |
| 714 | Ga0496125_0041611 | 3300048928 | Bacteria | 3926 |
| 715 | Ga0496126_0002149 | 3300048929 | Bacteria | 27466 |
| 716 | Ga0496126_0003384 | 3300048929 | Bacteria | 20200 |
| 717 | Ga0496126_0004290 | 3300048929 | Bacteria | 17144 |
| 718 | Ga0496126_0013547 | 3300048929 | Bacteria | 8286 |
| 719 | Ga0496126_0020995 | 3300048929 | Bacteria | 6391 |
| 720 | Ga0496126_0060008 | 3300048929 | Bacteria | 3423 |
| 721 | Ga0496126_0060980 | 3300048929 | Bacteria | 3390 |
| 722 | Ga0496126_0120754 | 3300048929 | Bacteria | 2273 |
| 723 | Ga0495678_000718 | 3300049459 | Bacteria | 30159 |
| 724 | Ga0501031_0013662 | 3300049568 | Bacteria | 5290 |
| 725 | Ga0501031_0059928 | 3300049568 | Bacteria | 2480 |
| 726 | Ga0501032_0027853 | 3300049569 | Bacteria | 3883 |
| 727 | Ga0501032_0037308 | 3300049569 | Bacteria | 3314 |
| 728 | Ga0501033_0000747 | 3300049570 | Bacteria | 29937 |
| 729 | Ga0501033_0001508 | 3300049570 | Bacteria | 20623 |
| 730 | Ga0501033_0005847 | 3300049570 | Bacteria | 9668 |
| 731 | Ga0501033_0015113 | 3300049570 | Bacteria | 5858 |
| 732 | Ga0501033_0032897 | 3300049570 | Bacteria | 3893 |
| 733 | Ga0501033_0062985 | 3300049570 | Bacteria | 2730 |
| 734 | Ga0501034_0000344 | 3300049571 | Bacteria | 80851 |
| 735 | Ga0501034_0000355 | 3300049571 | Bacteria | 78528 |
| 736 | Ga0501034_0012809 | 3300049571 | Bacteria | 8650 |
| 737 | Ga0501034_0032668 | 3300049571 | Bacteria | 5285 |
| 738 | Ga0501034_0055878 | 3300049571 | Bacteria | 3972 |
| 739 | Ga0501036_0011935 | 3300049572 | Bacteria | 7202 |
| 740 | Ga0501036_0035985 | 3300049572 | Bacteria | 4189 |
| 741 | Ga0501036_0042201 | 3300049572 | Bacteria | 3862 |
| 742 | Ga0501037_0005211 | 3300049573 | Bacteria | 9454 |
| 743 | Ga0501037_0006927 | 3300049573 | Bacteria | 8278 |
| 744 | Ga0501037_0012184 | 3300049573 | Bacteria | 6330 |
| 745 | Ga0501037_0029467 | 3300049573 | Bacteria | 4055 |
| 746 | Ga0501037_0033049 | 3300049573 | Bacteria | 3822 |
| 747 | Ga0501038_0025329 | 3300049574 | Bacteria | 5289 |
| 748 | Ga0501038_0026037 | 3300049574 | Bacteria | 5209 |
| 749 | Ga0501038_0079480 | 3300049574 | Bacteria | 2765 |
| 750 | Ga0501039_0007584 | 3300049575 | Bacteria | 8286 |
| 751 | Ga0501039_0127614 | 3300049575 | Bacteria | 1995 |
| 752 | Ga0501040_0001093 | 3300049576 | Bacteria | 17147 |
| 753 | Ga0501040_0008567 | 3300049576 | Bacteria | 6637 |
| 754 | Ga0501040_0009299 | 3300049576 | Bacteria | 6402 |
| 755 | Ga0501040_0009725 | 3300049576 | Bacteria | 6276 |
| 756 | Ga0501040_0012191 | 3300049576 | Bacteria | 5628 |
| 757 | Ga0501041_0037583 | 3300049577 | Bacteria | 2934 |
| 758 | Ga0501042_0004185 | 3300049578 | Bacteria | 9175 |
| 759 | Ga0501042_0004613 | 3300049578 | Bacteria | 8796 |
| 760 | Ga0501042_0007705 | 3300049578 | Bacteria | 7071 |
| 761 | Ga0501042_0043650 | 3300049578 | Bacteria | 3193 |
| 762 | Ga0501043_0002540 | 3300049579 | Bacteria | 15433 |
| 763 | Ga0501043_0019418 | 3300049579 | Bacteria | 5335 |
| 764 | Ga0501043_0041262 | 3300049579 | Bacteria | 3626 |
| 765 | Ga0501046_0002537 | 3300049580 | Bacteria | 17078 |
| 766 | Ga0501046_0012062 | 3300049580 | Bacteria | 7368 |
| 767 | Ga0501046_0022811 | 3300049580 | Bacteria | 5155 |
| 768 | Ga0501047_0004475 | 3300049581 | Bacteria | 13151 |
| 769 | Ga0501047_0010659 | 3300049581 | Bacteria | 8686 |
| 770 | Ga0501047_0015450 | 3300049581 | Bacteria | 7274 |
| 771 | Ga0501047_0069784 | 3300049581 | Bacteria | 3383 |
| 772 | Ga0501047_0076899 | 3300049581 | Bacteria | 3212 |
| 773 | Ga0501047_0141866 | 3300049581 | Bacteria | 2280 |
| 774 | Ga0501048_0013116 | 3300049582 | Bacteria | 6151 |
| 775 | Ga0501048_0018366 | 3300049582 | Bacteria | 5144 |
| 776 | Ga0501048_0020049 | 3300049582 | Bacteria | 4904 |
| 777 | Ga0501048_0055113 | 3300049582 | Bacteria | 2823 |
| 778 | Ga0501048_0069922 | 3300049582 | Bacteria | 2479 |
| 779 | Ga0501068_0024287 | 3300049584 | Bacteria | 3559 |
| 780 | Ga0501068_0030043 | 3300049584 | Bacteria | 3221 |
| 781 | Ga0501069_0001683 | 3300049585 | Bacteria | 10987 |
| 782 | Ga0501069_0023366 | 3300049585 | Bacteria | 3371 |
| 783 | Ga0501070_0001120 | 3300049586 | Bacteria | 24055 |
| 784 | Ga0501070_0011003 | 3300049586 | Bacteria | 7637 |
| 785 | Ga0501070_0013738 | 3300049586 | Bacteria | 6820 |
| 786 | Ga0501070_0018995 | 3300049586 | Bacteria | 5765 |
| 787 | Ga0501070_0023611 | 3300049586 | Bacteria | 5152 |
| 788 | Ga0501070_0075225 | 3300049586 | Bacteria | 2795 |
| 789 | Ga0501071_0008278 | 3300049587 | Bacteria | 6867 |
| 790 | Ga0501071_0033521 | 3300049587 | Bacteria | 3648 |
| 791 | Ga0501071_0046255 | 3300049587 | Bacteria | 3125 |
| 792 | Ga0501072_0004152 | 3300049588 | Bacteria | 10964 |
| 793 | Ga0501072_0008841 | 3300049588 | Bacteria | 7653 |
| 794 | Ga0501072_0019046 | 3300049588 | Bacteria | 5300 |
| 795 | Ga0501072_0027365 | 3300049588 | Bacteria | 4447 |
| 796 | Ga0501073_0003721 | 3300049589 | Bacteria | 11458 |
| 797 | Ga0501073_0005507 | 3300049589 | Bacteria | 9483 |
| 798 | Ga0501073_0010681 | 3300049589 | Bacteria | 6724 |
| 799 | Ga0501073_0012681 | 3300049589 | Bacteria | 6147 |
| 800 | Ga0501073_0069917 | 3300049589 | Bacteria | 2446 |
| 801 | Ga0501073_0107067 | 3300049589 | Bacteria | 1940 |
| 802 | Ga0501074_0004079 | 3300049590 | Bacteria | 10423 |
| 803 | Ga0501074_0024713 | 3300049590 | Bacteria | 4365 |
| 804 | Ga0501074_0037632 | 3300049590 | Bacteria | 3507 |
| 805 | Ga0501075_0065660 | 3300049591 | Bacteria | 2738 |
| 806 | Ga0501076_0002535 | 3300049592 | Bacteria | 12567 |
| 807 | Ga0501076_0004710 | 3300049592 | Bacteria | 9727 |
| 808 | Ga0501076_0023151 | 3300049592 | Bacteria | 4784 |
| 809 | Ga0501077_0018306 | 3300049593 | Bacteria | 4433 |
| 810 | Ga0501077_0103282 | 3300049593 | Bacteria | 1806 |
| 811 | Ga0501079_0007763 | 3300049741 | Bacteria | 8121 |
| 812 | Ga0501079_0059639 | 3300049741 | Bacteria | 2943 |
| 813 | Ga0501079_0199192 | 3300049741 | Bacteria | 1564 |
| 814 | Ga0501080_0004279 | 3300049742 | Bacteria | 12672 |
| 815 | Ga0501080_0028382 | 3300049742 | Bacteria | 5205 |
| 816 | Ga0501080_0028686 | 3300049742 | Bacteria | 5180 |
| 817 | Ga0501080_0084412 | 3300049742 | Bacteria | 2950 |
| 818 | Ga0501081_0004658 | 3300049743 | Bacteria | 8817 |
| 819 | Ga0501081_0005725 | 3300049743 | Bacteria | 8042 |
| 820 | Ga0501081_0009346 | 3300049743 | Bacteria | 6387 |
| 821 | Ga0501081_0021742 | 3300049743 | Bacteria | 4283 |
| 822 | Ga0501083_0012139 | 3300049744 | Bacteria | 6029 |
| 823 | Ga0501035_0003148 | 3300049822 | Bacteria | 15853 |
| 824 | Ga0501035_0010022 | 3300049822 | Bacteria | 8792 |
| 825 | Ga0501035_0019320 | 3300049822 | Bacteria | 6270 |
| 826 | Ga0501035_0022285 | 3300049822 | Bacteria | 5817 |
| 827 | Ga0501035_0025947 | 3300049822 | Bacteria | 5368 |
| 828 | Ga0501035_0032024 | 3300049822 | Bacteria | 4787 |
| 829 | Ga0501035_0095280 | 3300049822 | Bacteria | 2616 |
| 830 | Ga0501035_0141934 | 3300049822 | Bacteria | 2088 |
| 831 | Ga0501035_0161756 | 3300049822 | Bacteria | 1937 |
| 832 | Ga0501044_0007144 | 3300049823 | Bacteria | 12285 |
| 833 | Ga0501044_0011428 | 3300049823 | Bacteria | 9619 |
| 834 | Ga0501044_0029738 | 3300049823 | Bacteria | 5759 |
| 835 | Ga0501044_0041271 | 3300049823 | Bacteria | 4803 |
| 836 | Ga0501044_0043549 | 3300049823 | Bacteria | 4662 |
| 837 | Ga0501044_0083293 | 3300049823 | Bacteria | 3235 |
| 838 | Ga0501044_0121429 | 3300049823 | Bacteria | 2613 |
| 839 | Ga0501044_0151906 | 3300049823 | Bacteria | 2297 |
| 840 | Ga0501045_0000225 | 3300049824 | Bacteria | 32621 |
| 841 | Ga0501045_0019176 | 3300049824 | Bacteria | 4872 |
| 842 | nmdc:mga00v17_10476_c1 | 3300050491 | Bacteria | 5064 |
| 843 | nmdc:mga00v17_5307_c1 | 3300050491 | Bacteria | 6789 |
| 844 | nmdc:mga08y16_54621_c1 | 3300050511 | Bacteria | 4174 |
| 845 | nmdc:mga0n895_17491_c1 | 3300050512 | Bacteria | 6608 |
| 846 | nmdc:mga0rr50_152611_c1 | 3300050513 | Bacteria | 1868 |
| 847 | nmdc:mga0a205_603_c1 | 3300050515 | Bacteria | 28564 |
| 848 | nmdc:mga0sz30_14786_c1 | 3300050516 | Bacteria | 3078 |
| 849 | Ga0500610_0023463 | 3300053079 | Bacteria | 3055 |
| 850 | Ga0500643_000002 | 3300053087 | Bacteria | 1277657 |
| 851 | Ga0500643_001805 | 3300053087 | Bacteria | 11703 |
| 852 | Ga0500651_0000088 | 3300053093 | Bacteria | 59179 |
| 853 | Ga0500556_0000234 | 3300053104 | Bacteria | 45118 |
| 854 | Ga0500594_0001943 | 3300053118 | Bacteria | 4465 |
| 855 | Ga0500597_000873 | 3300053120 | Bacteria | 6975 |
| 856 | Ga0500642_0000014 | 3300053130 | Bacteria | 182110 |
| 857 | Ga0500634_0001229 | 3300053161 | Bacteria | 9679 |
| 858 | Ga0500645_000395 | 3300053730 | Bacteria | 30555 |
| 859 | Ga0500645_005302 | 3300053730 | Bacteria | 4773 |
| 860 | Ga0501084_0014642 | 3300054114 | Bacteria | 6502 |
| 861 | Ga0501084_0042413 | 3300054114 | Bacteria | 3806 |
| 862 | Ga0501084_0094713 | 3300054114 | Bacteria | 2507 |
| 863 | Ga0501084_0128527 | 3300054114 | Bacteria | 2132 |
| 864 | Ga0500661_005416 | 3300055283 | Bacteria | 2386 |
| 865 | Ga0501082_0009187 | 3300060353 | Bacteria | 8525 |
| 866 | Ga0501082_0030869 | 3300060353 | Bacteria | 4619 |
| 867 | Ga0466962_0027328 | 3300061719 | Bacteria | 2738 |
| 868 | Ga0466962_0042936 | 3300061719 | Bacteria | 2164 |
| 869 | Ga0530510_0004136 | 3300061734 | Bacteria | 10019 |
| 870 | Ga0530510_0025249 | 3300061734 | Bacteria | 4247 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048927 | Ga0496124_0001490 | Ga0496124_0001490_27_1349 | 418 |
| 2 | 3300025941 | Ga0207711_10061557 | Ga0207711_100615573 | 446 |
| 3 | 3300049570 | Ga0501033_0015113 | Ga0501033_0015113_2952_4649 | 450 |
| 4 | 3300049572 | Ga0501036_0042201 | Ga0501036_0042201_2051_3748 | 450 |
| 5 | 3300049576 | Ga0501040_0008567 | Ga0501040_0008567_2587_4284 | 450 |
| 6 | 3300049578 | Ga0501042_0007705 | Ga0501042_0007705_2774_4471 | 450 |
| 7 | 3300049579 | Ga0501043_0041262 | Ga0501043_0041262_656_2353 | 450 |
| 8 | 3300049580 | Ga0501046_0002537 | Ga0501046_0002537_3711_5408 | 450 |
| 9 | 3300049587 | Ga0501071_0033521 | Ga0501071_0033521_1191_2888 | 450 |
| 10 | 3300049592 | Ga0501076_0004710 | Ga0501076_0004710_2749_4446 | 450 |
| 11 | 3300049741 | Ga0501079_0007763 | Ga0501079_0007763_2714_4411 | 450 |
| 12 | 3300049743 | Ga0501081_0004658 | Ga0501081_0004658_5582_7279 | 450 |
| 13 | 3300049822 | Ga0501035_0032024 | Ga0501035_0032024_640_2337 | 450 |
| 14 | 3300049824 | Ga0501045_0000225 | Ga0501045_0000225_2142_3839 | 450 |
| 15 | 3300054114 | Ga0501084_0128527 | Ga0501084_0128527_50_1747 | 450 |
| 16 | 3300060353 | Ga0501082_0009187 | Ga0501082_0009187_5689_7386 | 450 |
| 17 | 3300061734 | Ga0530510_0004136 | Ga0530510_0004136_4123_5820 | 450 |
| 18 | 3300046501 | Ga0495607_0077432 | Ga0495607_0077432_35_1705 | 461 |
| 19 | 3300009094 | Ga0111539_10006755 | Ga0111539_1000675514 | 464 |
| 20 | 3300050511 | nmdc:mga08y16_54621_c1 | nmdc:mga08y16_54621_c1_1763_3445 | 464 |
| 21 | 3300006844 | Ga0075428_100009101 | Ga0075428_1000091012 | 465 |
| 22 | 3300006852 | Ga0075433_10005362 | Ga0075433_100053627 | 465 |
| 23 | 3300006871 | Ga0075434_100000572 | Ga0075434_10000057225 | 465 |
| 24 | 3300007076 | Ga0075435_100063636 | Ga0075435_1000636363 | 465 |
| 25 | 3300050512 | nmdc:mga0n895_17491_c1 | nmdc:mga0n895_17491_c1_2302_3984 | 465 |
| 26 | 3300050513 | nmdc:mga0rr50_152611_c1 | nmdc:mga0rr50_152611_c1_46_1728 | 465 |
| 27 | 3300050515 | nmdc:mga0a205_603_c1 | nmdc:mga0a205_603_c1_2981_4663 | 465 |
| 28 | 3300049584 | Ga0501068_0030043 | Ga0501068_0030043_889_2571 | 469 |
| 29 | 3300046507 | Ga0495606_0016437 | Ga0495606_0016437_2574_4244 | 473 |
| 30 | 3300046513 | Ga0495616_0000067 | Ga0495616_0000067_84690_86360 | 473 |
| 31 | 3300046691 | Ga0495670_0009454 | Ga0495670_0009454_1889_3559 | 473 |
| 32 | 3300047472 | Ga0495686_0085291 | Ga0495686_0085291_234_1904 | 473 |
| 33 | 3300048924 | Ga0496121_0009283 | Ga0496121_0009283_9565_11235 | 473 |
| 34 | 3300053130 | Ga0500642_0000014 | Ga0500642_0000014_15975_17639 | 473 |
| 35 | 3300005338 | Ga0068868_100032309 | Ga0068868_1000323092 | 475 |
| 36 | 3300005539 | Ga0068853_100139593 | Ga0068853_1001395931 | 475 |
| 37 | 3300013102 | Ga0157371_10000487 | Ga0157371_100004874 | 476 |
| 38 | 3300015262 | Ga0182007_10000043 | Ga0182007_100000434 | 476 |
| 39 | 3300015265 | Ga0182005_1000267 | Ga0182005_10002674 | 476 |
| 40 | 3300037312 | Ga0395899_0134478 | Ga0395899_0134478_220_1734 | 476 |
| 41 | 3300048908 | Ga0496105_0090311 | Ga0496105_0090311_406_2067 | 476 |
| 42 | 3300048919 | Ga0496116_0017392 | Ga0496116_0017392_1420_3081 | 476 |
| 43 | 3300048925 | Ga0496122_0030232 | Ga0496122_0030232_1947_3608 | 476 |
| 44 | 3300048928 | Ga0496125_0031770 | Ga0496125_0031770_45_1706 | 476 |
| 45 | 3300048929 | Ga0496126_0004290 | Ga0496126_0004290_2843_4504 | 476 |
| 46 | 3300003781 | Ga0055536_1005286 | Ga0055536_10052862 | 477 |
| 47 | 3300025292 | Ga0209676_1000092 | Ga0209676_1000092144 | 477 |
| 48 | 3300025298 | Ga0209050_1005515 | Ga0209050_10055158 | 477 |
| 49 | 3300048922 | Ga0496119_0000659 | Ga0496119_0000659_152_1813 | 477 |
| 50 | 3300048923 | Ga0496120_0000217 | Ga0496120_0000217_94696_96357 | 477 |
| 51 | 3300005338 | Ga0068868_100027499 | Ga0068868_1000274992 | 479 |
| 52 | 3300042184 | Ga0450908_000860 | Ga0450908_000860_2969_4651 | 480 |
| 53 | 3300047472 | Ga0495686_0000043 | Ga0495686_0000043_131168_132859 | 480 |
| 54 | 3300005335 | Ga0070666_10009654 | Ga0070666_100096545 | 481 |
| 55 | 3300005338 | Ga0068868_100007207 | Ga0068868_1000072077 | 481 |
| 56 | 3300005367 | Ga0070667_100009456 | Ga0070667_1000094563 | 481 |
| 57 | 3300005548 | Ga0070665_100013099 | Ga0070665_1000130995 | 481 |
| 58 | 3300005841 | Ga0068863_100013560 | Ga0068863_1000135606 | 481 |
| 59 | 3300006237 | Ga0097621_100019126 | Ga0097621_1000191264 | 481 |
| 60 | 3300006358 | Ga0068871_100012103 | Ga0068871_1000121037 | 481 |
| 61 | 3300009098 | Ga0105245_10003428 | Ga0105245_100034286 | 481 |
| 62 | 3300009177 | Ga0105248_10005167 | Ga0105248_100051676 | 481 |
| 63 | 3300013306 | Ga0163162_10031567 | Ga0163162_100315673 | 481 |
| 64 | 3300013308 | Ga0157375_10004302 | Ga0157375_100043025 | 481 |
| 65 | 3300014968 | Ga0157379_10001842 | Ga0157379_100018426 | 481 |
| 66 | 3300014969 | Ga0157376_10003668 | Ga0157376_1000366810 | 481 |
| 67 | 3300025903 | Ga0207680_10020353 | Ga0207680_100203532 | 481 |
| 68 | 3300025931 | Ga0207644_10060403 | Ga0207644_100604033 | 481 |
| 69 | 3300025941 | Ga0207711_10004854 | Ga0207711_100048543 | 481 |
| 70 | 3300026023 | Ga0207677_10094535 | Ga0207677_100945352 | 481 |
| 71 | 3300048907 | Ga0496104_0012882 | Ga0496104_0012882_1781_3514 | 481 |
| 72 | 3300048908 | Ga0496105_0018943 | Ga0496105_0018943_3180_4913 | 481 |
| 73 | 3300048911 | Ga0496108_0030769 | Ga0496108_0030769_60_1793 | 481 |
| 74 | 3300048912 | Ga0496109_0200161 | Ga0496109_0200161_10_1743 | 481 |
| 75 | 3300048913 | Ga0496110_0005613 | Ga0496110_0005613_2970_4703 | 481 |
| 76 | 3300048917 | Ga0496114_0046500 | Ga0496114_0046500_489_2222 | 481 |
| 77 | 3300049741 | Ga0501079_0199192 | Ga0501079_0199192_29_1549 | 481 |
| 78 | 3300005618 | Ga0068864_100030923 | Ga0068864_1000309233 | 482 |
| 79 | 3300005546 | Ga0070696_100011770 | Ga0070696_1000117702 | 483 |
| 80 | 3300009987 | Ga0105030_100130 | Ga0105030_1001305 | 483 |
| 81 | 3300046492 | Ga0495585_0010514 | Ga0495585_0010514_2574_4244 | 483 |
| 82 | 3300048925 | Ga0496122_0005854 | Ga0496122_0005854_3145_4809 | 483 |
| 83 | 3300048926 | Ga0496123_0001899 | Ga0496123_0001899_21650_23314 | 483 |
| 84 | 3300049568 | Ga0501031_0013662 | Ga0501031_0013662_2485_4167 | 483 |
| 85 | 3300049569 | Ga0501032_0027853 | Ga0501032_0027853_675_2357 | 483 |
| 86 | 3300049573 | Ga0501037_0029467 | Ga0501037_0029467_1753_3435 | 483 |
| 87 | 3300049576 | Ga0501040_0009725 | Ga0501040_0009725_1084_2766 | 483 |
| 88 | 3300049578 | Ga0501042_0004185 | Ga0501042_0004185_5188_6870 | 483 |
| 89 | 3300049582 | Ga0501048_0020049 | Ga0501048_0020049_2331_4013 | 483 |
| 90 | 3300049587 | Ga0501071_0046255 | Ga0501071_0046255_1379_3061 | 483 |
| 91 | 3300049588 | Ga0501072_0008841 | Ga0501072_0008841_2562_4244 | 483 |
| 92 | 3300049590 | Ga0501074_0037632 | Ga0501074_0037632_825_2507 | 483 |
| 93 | 3300049591 | Ga0501075_0065660 | Ga0501075_0065660_865_2547 | 483 |
| 94 | 3300049592 | Ga0501076_0002535 | Ga0501076_0002535_2320_4002 | 483 |
| 95 | 3300049743 | Ga0501081_0009346 | Ga0501081_0009346_4691_6373 | 483 |
| 96 | 3300049823 | Ga0501044_0083293 | Ga0501044_0083293_865_2547 | 483 |
| 97 | 3300054114 | Ga0501084_0094713 | Ga0501084_0094713_461_2137 | 483 |
| 98 | 3300005353 | Ga0070669_100016268 | Ga0070669_1000162685 | 485 |
| 99 | 3300005456 | Ga0070678_100003696 | Ga0070678_1000036967 | 485 |
| 100 | 3300005548 | Ga0070665_100037857 | Ga0070665_1000378577 | 485 |
| 101 | 3300005840 | Ga0068870_10009151 | Ga0068870_100091511 | 485 |
| 102 | 3300006881 | Ga0068865_100042758 | Ga0068865_1000427581 | 485 |
| 103 | 3300025907 | Ga0207645_10013275 | Ga0207645_100132754 | 485 |
| 104 | 3300028379 | Ga0268266_10045565 | Ga0268266_100455652 | 485 |
| 105 | 3300005563 | Ga0068855_100108259 | Ga0068855_1001082592 | 486 |
| 106 | 3300009093 | Ga0105240_10097448 | Ga0105240_100974483 | 486 |
| 107 | 3300025949 | Ga0207667_10000250 | Ga0207667_1000025050 | 486 |
| 108 | 3300025981 | Ga0207640_10001071 | Ga0207640_1000107114 | 486 |
| 109 | 3300026078 | Ga0207702_10140169 | Ga0207702_101401692 | 486 |
| 110 | 3300046460 | Ga0495638_0001156 | Ga0495638_0001156_21384_23045 | 486 |
| 111 | 3300046512 | Ga0495610_0004716 | Ga0495610_0004716_5993_7657 | 486 |
| 112 | 3300046518 | Ga0495631_0004603 | Ga0495631_0004603_2522_4186 | 486 |
| 113 | 3300005335 | Ga0070666_10000757 | Ga0070666_100007575 | 487 |
| 114 | 3300013297 | Ga0157378_10026393 | Ga0157378_100263936 | 487 |
| 115 | 3300003781 | Ga0055536_1006000 | Ga0055536_10060004 | 488 |
| 116 | 3300003791 | Ga0055530_10005063 | Ga0055530_100050633 | 488 |
| 117 | 3300003794 | Ga0055531_10007781 | Ga0055531_100077814 | 488 |
| 118 | 3300025292 | Ga0209676_1000079 | Ga0209676_1000079257 | 488 |
| 119 | 3300025292 | Ga0209676_1003077 | Ga0209676_10030779 | 488 |
| 120 | 3300025298 | Ga0209050_1000329 | Ga0209050_100032991 | 488 |
| 121 | 3300025303 | Ga0209051_1002764 | Ga0209051_10027649 | 488 |
| 122 | 3300025304 | Ga0209257_1000081 | Ga0209257_1000081267 | 488 |
| 123 | 3300025304 | Ga0209257_1005274 | Ga0209257_10052745 | 488 |
| 124 | 3300044658 | Ga0466972_0016098 | Ga0466972_0016098_582_2258 | 488 |
| 125 | 3300044672 | Ga0466982_0000019 | Ga0466982_0000019_10834_12510 | 488 |
| 126 | 3300044684 | Ga0466966_0020730 | Ga0466966_0020730_2097_3773 | 488 |
| 127 | 3300044706 | Ga0466964_0015082 | Ga0466964_0015082_834_2510 | 488 |
| 128 | 3300044735 | Ga0466968_0030742 | Ga0466968_0030742_252_1928 | 488 |
| 129 | 3300044901 | Ga0466960_0031658 | Ga0466960_0031658_326_2002 | 488 |
| 130 | 3300046507 | Ga0495606_0000203 | Ga0495606_0000203_99007_100677 | 488 |
| 131 | 3300049588 | Ga0501072_0027365 | Ga0501072_0027365_2500_4188 | 488 |
| 132 | 3300061719 | Ga0466962_0027328 | Ga0466962_0027328_940_2616 | 488 |
| 133 | 3300047469 | Ga0495673_0014223 | Ga0495673_0014223_2588_4132 | 489 |
| 134 | 3300049576 | Ga0501040_0009299 | Ga0501040_0009299_2872_4560 | 489 |
| 135 | 3300049577 | Ga0501041_0037583 | Ga0501041_0037583_981_2669 | 489 |
| 136 | 3300049578 | Ga0501042_0043650 | Ga0501042_0043650_1170_2858 | 489 |
| 137 | 3300049743 | Ga0501081_0005725 | Ga0501081_0005725_3712_5400 | 489 |
| 138 | 3300025303 | Ga0209051_1007093 | Ga0209051_10070934 | 490 |
| 139 | 3300049582 | Ga0501048_0013116 | Ga0501048_0013116_3488_5185 | 490 |
| 140 | 3300049584 | Ga0501068_0024287 | Ga0501068_0024287_1483_3180 | 490 |
| 141 | 3300049588 | Ga0501072_0004152 | Ga0501072_0004152_6593_8290 | 490 |
| 142 | 3300049742 | Ga0501080_0004279 | Ga0501080_0004279_7588_9285 | 490 |
| 143 | 3300025299 | Ga0209256_1004521 | Ga0209256_10045218 | 491 |
| 144 | 3300049588 | Ga0501072_0019046 | Ga0501072_0019046_19_1638 | 491 |
| 145 | 3300046492 | Ga0495585_0000423 | Ga0495585_0000423_2599_4269 | 492 |
| 146 | 3300046518 | Ga0495631_0003301 | Ga0495631_0003301_5231_6901 | 492 |
| 147 | 3300046524 | Ga0495648_0018232 | Ga0495648_0018232_63_1733 | 492 |
| 148 | 3300046665 | Ga0495661_0004547 | Ga0495661_0004547_2364_4034 | 492 |
| 149 | 3300053730 | Ga0500645_005302 | Ga0500645_005302_989_2659 | 492 |
| 150 | 3300003781 | Ga0055536_1005928 | Ga0055536_10059282 | 493 |
| 151 | 3300003794 | Ga0055531_10007661 | Ga0055531_100076614 | 493 |
| 152 | 3300013297 | Ga0157378_10000006 | Ga0157378_10000006135 | 493 |
| 153 | 3300013308 | Ga0157375_10055469 | Ga0157375_100554692 | 493 |
| 154 | 3300048920 | Ga0496117_0028315 | Ga0496117_0028315_2196_3857 | 493 |
| 155 | 3300048921 | Ga0496118_0031026 | Ga0496118_0031026_542_2203 | 493 |
| 156 | 3300048927 | Ga0496124_0042962 | Ga0496124_0042962_2026_3687 | 493 |
| 157 | 3300049574 | Ga0501038_0079480 | Ga0501038_0079480_10_1707 | 493 |
| 158 | 3300002737 | JGI25162J39368_1002756 | JGI25162J39368_10027563 | 494 |
| 159 | 3300002772 | JGI25164J39214_1001313 | JGI25164J39214_10013133 | 494 |
| 160 | 3300003214 | JGI25165J46597_1002376 | JGI25165J46597_10023764 | 494 |
| 161 | 3300005353 | Ga0070669_100079690 | Ga0070669_1000796902 | 494 |
| 162 | 3300014969 | Ga0157376_10206001 | Ga0157376_102060011 | 494 |
| 163 | 3300025231 | Ga0207427_100306 | Ga0207427_10030616 | 494 |
| 164 | 3300025233 | Ga0209437_100039 | Ga0209437_100039136 | 494 |
| 165 | 3300025261 | Ga0209233_1000090 | Ga0209233_1000090260 | 494 |
| 166 | 3300025297 | Ga0209758_1015576 | Ga0209758_10155763 | 494 |
| 167 | 3300025923 | Ga0207681_10004705 | Ga0207681_100047052 | 494 |
| 168 | 3300009176 | Ga0105242_10001298 | Ga0105242_1000129818 | 495 |
| 169 | 3300013306 | Ga0163162_10002734 | Ga0163162_1000273412 | 495 |
| 170 | 3300013308 | Ga0157375_10000102 | Ga0157375_100001024 | 495 |
| 171 | 3300014969 | Ga0157376_10008252 | Ga0157376_100082522 | 495 |
| 172 | 3300025938 | Ga0207704_10001296 | Ga0207704_100012964 | 495 |
| 173 | 3300026121 | Ga0207683_10025237 | Ga0207683_100252374 | 495 |
| 174 | 3300046512 | Ga0495610_0043035 | Ga0495610_0043035_418_2028 | 495 |
| 175 | 3300048907 | Ga0496104_0000022 | Ga0496104_0000022_104572_106248 | 495 |
| 176 | 3300048908 | Ga0496105_0000012 | Ga0496105_0000012_232656_234332 | 495 |
| 177 | 3300048927 | Ga0496124_0025689 | Ga0496124_0025689_3013_4674 | 495 |
| 178 | 3300049593 | Ga0501077_0103282 | Ga0501077_0103282_55_1731 | 495 |
| 179 | 3300053730 | Ga0500645_000395 | Ga0500645_000395_24775_26439 | 495 |
| 180 | 3300044673 | Ga0453683_0008814 | Ga0453683_0008814_2859_4556 | 496 |
| 181 | 3300048925 | Ga0496122_0001998 | Ga0496122_0001998_23054_24745 | 496 |
| 182 | 3300049569 | Ga0501032_0037308 | Ga0501032_0037308_1291_2985 | 496 |
| 183 | 3300049570 | Ga0501033_0000747 | Ga0501033_0000747_2543_4237 | 496 |
| 184 | 3300049571 | Ga0501034_0055878 | Ga0501034_0055878_1643_3337 | 496 |
| 185 | 3300049572 | Ga0501036_0011935 | Ga0501036_0011935_4153_5847 | 496 |
| 186 | 3300049573 | Ga0501037_0005211 | Ga0501037_0005211_4103_5797 | 496 |
| 187 | 3300049575 | Ga0501039_0007584 | Ga0501039_0007584_5614_7308 | 496 |
| 188 | 3300049581 | Ga0501047_0069784 | Ga0501047_0069784_485_2179 | 496 |
| 189 | 3300049589 | Ga0501073_0012681 | Ga0501073_0012681_2797_4473 | 496 |
| 190 | 3300049590 | Ga0501074_0024713 | Ga0501074_0024713_101_1795 | 496 |
| 191 | 3300049742 | Ga0501080_0028686 | Ga0501080_0028686_1635_3329 | 496 |
| 192 | 3300060353 | Ga0501082_0030869 | Ga0501082_0030869_2578_4254 | 496 |
| 193 | 3300002737 | JGI25162J39368_1003492 | JGI25162J39368_10034923 | 497 |
| 194 | 3300002772 | JGI25164J39214_1001318 | JGI25164J39214_10013183 | 497 |
| 195 | 3300005455 | Ga0070663_100041672 | Ga0070663_1000416723 | 497 |
| 196 | 3300005843 | Ga0068860_100009881 | Ga0068860_1000098814 | 497 |
| 197 | 3300025231 | Ga0207427_100289 | Ga0207427_10028917 | 497 |
| 198 | 3300025233 | Ga0209437_100129 | Ga0209437_10012946 | 497 |
| 199 | 3300025261 | Ga0209233_1000020 | Ga0209233_1000020745 | 497 |
| 200 | 3300026067 | Ga0207678_10080157 | Ga0207678_100801572 | 497 |
| 201 | 3300028381 | Ga0268264_10022370 | Ga0268264_100223701 | 497 |
| 202 | 3300048909 | Ga0496106_0009989 | Ga0496106_0009989_4169_5839 | 497 |
| 203 | 3300046452 | Ga0495617_003046 | Ga0495617_003046_2429_4099 | 498 |
| 204 | 3300046515 | Ga0495620_0003391 | Ga0495620_0003391_5081_6751 | 498 |
| 205 | 3300028800 | Ga0265338_10009730 | Ga0265338_100097309 | 499 |
| 206 | 3300053104 | Ga0500556_0000234 | Ga0500556_0000234_16193_17857 | 499 |
| 207 | 3300009093 | Ga0105240_10012346 | Ga0105240_1001234612 | 500 |
| 208 | 3300009551 | Ga0105238_10032850 | Ga0105238_100328503 | 500 |
| 209 | 3300010375 | Ga0105239_10038848 | Ga0105239_100388485 | 500 |
| 210 | 3300013105 | Ga0157369_10000027 | Ga0157369_10000027168 | 500 |
| 211 | 3300014497 | Ga0182008_10007235 | Ga0182008_100072354 | 500 |
| 212 | 3300025258 | Ga0209129_1007561 | Ga0209129_10075612 | 500 |
| 213 | 3300025297 | Ga0209758_1008116 | Ga0209758_10081161 | 500 |
| 214 | 3300025913 | Ga0207695_10006463 | Ga0207695_1000646314 | 500 |
| 215 | 3300025914 | Ga0207671_10003811 | Ga0207671_1000381111 | 500 |
| 216 | 3300025924 | Ga0207694_10000563 | Ga0207694_1000056317 | 500 |
| 217 | 3300048924 | Ga0496121_0037992 | Ga0496121_0037992_20_1612 | 500 |
| 218 | 3300050516 | nmdc:mga0sz30_14786_c1 | nmdc:mga0sz30_14786_c1_206_1876 | 500 |
| 219 | 3300001989 | JGI24739J22299_10000167 | JGI24739J22299_100001671 | 501 |
| 220 | 3300003578 | Ga0006562J51391_1029636 | Ga0006562J51391_10296361 | 501 |
| 221 | 3300003578 | Ga0006562J51391_1029638 | Ga0006562J51391_10296382 | 501 |
| 222 | 3300005344 | Ga0070661_100104718 | Ga0070661_1001047181 | 501 |
| 223 | 3300005563 | Ga0068855_100031696 | Ga0068855_1000316963 | 501 |
| 224 | 3300005577 | Ga0068857_100004292 | Ga0068857_10000429214 | 501 |
| 225 | 3300005616 | Ga0068852_100057982 | Ga0068852_1000579823 | 501 |
| 226 | 3300005617 | Ga0068859_100061891 | Ga0068859_1000618911 | 501 |
| 227 | 3300006931 | Ga0097620_100061888 | Ga0097620_1000618881 | 501 |
| 228 | 3300009093 | Ga0105240_10035843 | Ga0105240_100358433 | 501 |
| 229 | 3300009545 | Ga0105237_10000016 | Ga0105237_10000016220 | 501 |
| 230 | 3300010375 | Ga0105239_10012123 | Ga0105239_100121239 | 501 |
| 231 | 3300013105 | Ga0157369_10042658 | Ga0157369_100426582 | 501 |
| 232 | 3300025225 | Ga0209566_100544 | Ga0209566_10054410 | 501 |
| 233 | 3300025904 | Ga0207647_10024280 | Ga0207647_100242801 | 501 |
| 234 | 3300025913 | Ga0207695_10009557 | Ga0207695_100095574 | 501 |
| 235 | 3300025914 | Ga0207671_10000137 | Ga0207671_1000013712 | 501 |
| 236 | 3300025920 | Ga0207649_10089027 | Ga0207649_100890272 | 501 |
| 237 | 3300025949 | Ga0207667_10001167 | Ga0207667_1000116722 | 501 |
| 238 | 3300025981 | Ga0207640_10005529 | Ga0207640_100055293 | 501 |
| 239 | 3300026116 | Ga0207674_10007214 | Ga0207674_100072144 | 501 |
| 240 | 3300026142 | Ga0207698_10038811 | Ga0207698_100388113 | 501 |
| 241 | 3300048924 | Ga0496121_0040589 | Ga0496121_0040589_2266_3942 | 501 |
| 242 | 3300048928 | Ga0496125_0000149 | Ga0496125_0000149_123670_125346 | 501 |
| 243 | 3300049823 | Ga0501044_0151906 | Ga0501044_0151906_547_2220 | 502 |
| 244 | 3300005262 | Ga0065165_1003051 | Ga0065165_100305110 | 503 |
| 245 | 3300025297 | Ga0209758_1016918 | Ga0209758_10169183 | 503 |
| 246 | 3300031730 | Ga0307516_10001401 | Ga0307516_100014018 | 503 |
| 247 | 3300031824 | Ga0307413_10001746 | Ga0307413_100017462 | 503 |
| 248 | 3300049581 | Ga0501047_0141866 | Ga0501047_0141866_222_1895 | 503 |
| 249 | 3300013296 | Ga0157374_10080245 | Ga0157374_100802452 | 504 |
| 250 | 3300014325 | Ga0163163_10023588 | Ga0163163_100235886 | 504 |
| 251 | 3300014968 | Ga0157379_10000992 | Ga0157379_100009925 | 504 |
| 252 | 3300025304 | Ga0209257_1000121 | Ga0209257_1000121100 | 504 |
| 253 | 3300041413 | Ga0439465_0003861 | Ga0439465_0003861_3181_4848 | 504 |
| 254 | 3300048926 | Ga0496123_0024797 | Ga0496123_0024797_2080_3747 | 504 |
| 255 | 3300048929 | Ga0496126_0020995 | Ga0496126_0020995_2575_4242 | 504 |
| 256 | 3300035398 | Ga0316574_0009969 | Ga0316574_0009969_953_2635 | 505 |
| 257 | 3300037418 | Ga0395900_0031124 | Ga0395900_0031124_936_2609 | 505 |
| 258 | 3300005614 | Ga0068856_100000983 | Ga0068856_10000098310 | 506 |
| 259 | 3300025226 | Ga0209674_100026 | Ga0209674_10002659 | 506 |
| 260 | 3300025253 | Ga0209677_100969 | Ga0209677_1009697 | 506 |
| 261 | 3300026078 | Ga0207702_10000943 | Ga0207702_1000094321 | 506 |
| 262 | 3300030731 | Ga0316177_1203723 | Ga0316177_12037235 | 507 |
| 263 | 3300037312 | Ga0395899_0016093 | Ga0395899_0016093_2409_4082 | 507 |
| 264 | 3300046519 | Ga0495632_0000046 | Ga0495632_0000046_97422_99092 | 507 |
| 265 | 3300046525 | Ga0495663_0001432 | Ga0495663_0001432_3516_5177 | 507 |
| 266 | 3300049581 | Ga0501047_0010659 | Ga0501047_0010659_935_2608 | 507 |
| 267 | 3300003781 | Ga0055536_1019665 | Ga0055536_10196651 | 508 |
| 268 | 3300005337 | Ga0070682_100002136 | Ga0070682_1000021369 | 508 |
| 269 | 3300005339 | Ga0070660_100051136 | Ga0070660_1000511363 | 508 |
| 270 | 3300025292 | Ga0209676_1000086 | Ga0209676_1000086187 | 508 |
| 271 | 3300025912 | Ga0207707_10011013 | Ga0207707_100110139 | 508 |
| 272 | 3300025919 | Ga0207657_10017203 | Ga0207657_100172037 | 508 |
| 273 | 3300025932 | Ga0207690_10009506 | Ga0207690_100095062 | 508 |
| 274 | 3300042876 | Ga0451577_0009927 | Ga0451577_0009927_3568_5316 | 508 |
| 275 | 3300048925 | Ga0496122_0019191 | Ga0496122_0019191_2006_3667 | 509 |
| 276 | 3300048926 | Ga0496123_0015448 | Ga0496123_0015448_2006_3667 | 509 |
| 277 | 3300003773 | Ga0055537_1000407 | Ga0055537_100040711 | 510 |
| 278 | 3300003790 | Ga0055528_1000529 | Ga0055528_100052916 | 510 |
| 279 | 3300005530 | Ga0070679_100081626 | Ga0070679_1000816264 | 510 |
| 280 | 3300013307 | Ga0157372_10121842 | Ga0157372_101218421 | 510 |
| 281 | 3300025263 | Ga0209565_1000014 | Ga0209565_100001491 | 510 |
| 282 | 3300025273 | Ga0209673_1000171 | Ga0209673_1000171134 | 510 |
| 283 | 3300025291 | Ga0209675_1000011 | Ga0209675_1000011371 | 510 |
| 284 | 3300025295 | Ga0209564_1000221 | Ga0209564_1000221100 | 510 |
| 285 | 3300036712 | Ga0316584_0042445 | Ga0316584_0042445_303_1985 | 510 |
| 286 | 3300048921 | Ga0496118_0025548 | Ga0496118_0025548_436_2100 | 510 |
| 287 | 3300049571 | Ga0501034_0000355 | Ga0501034_0000355_2814_4499 | 510 |
| 288 | 3300003771 | Ga0055526_1006635 | Ga0055526_10066352 | 511 |
| 289 | 3300003784 | Ga0055534_1000039 | Ga0055534_100003916 | 511 |
| 290 | 3300009101 | Ga0105247_10010854 | Ga0105247_100108542 | 511 |
| 291 | 3300009176 | Ga0105242_10044328 | Ga0105242_100443281 | 511 |
| 292 | 3300025226 | Ga0209674_100974 | Ga0209674_10097411 | 511 |
| 293 | 3300025900 | Ga0207710_10034415 | Ga0207710_100344151 | 511 |
| 294 | 3300037466 | Ga0395898_0015073 | Ga0395898_0015073_1114_2787 | 511 |
| 295 | 3300047469 | Ga0495673_0000001 | Ga0495673_0000001_97087_98757 | 511 |
| 296 | 3300048924 | Ga0496121_0017494 | Ga0496121_0017494_2115_3785 | 511 |
| 297 | 3300053118 | Ga0500594_0001943 | Ga0500594_0001943_2084_3763 | 511 |
| 298 | 3300025299 | Ga0209256_1018718 | Ga0209256_10187182 | 512 |
| 299 | 3300025932 | Ga0207690_10001851 | Ga0207690_100018515 | 512 |
| 300 | 3300037418 | Ga0395900_0082649 | Ga0395900_0082649_1337_3070 | 512 |
| 301 | 3300038443 | Ga0395901_0000983 | Ga0395901_0000983_23740_25473 | 512 |
| 302 | 3300046681 | Ga0495647_0021574 | Ga0495647_0021574_158_1834 | 512 |
| 303 | 3300049585 | Ga0501069_0001683 | Ga0501069_0001683_8766_10439 | 512 |
| 304 | 3300005336 | Ga0070680_100073618 | Ga0070680_1000736183 | 513 |
| 305 | 3300005339 | Ga0070660_100011933 | Ga0070660_1000119334 | 513 |
| 306 | 3300005458 | Ga0070681_10009408 | Ga0070681_100094084 | 513 |
| 307 | 3300005546 | Ga0070696_100000851 | Ga0070696_10000085116 | 513 |
| 308 | 3300005548 | Ga0070665_100023453 | Ga0070665_1000234533 | 513 |
| 309 | 3300005577 | Ga0068857_100020788 | Ga0068857_1000207884 | 513 |
| 310 | 3300013104 | Ga0157370_10025566 | Ga0157370_100255663 | 513 |
| 311 | 3300013307 | Ga0157372_10053894 | Ga0157372_100538942 | 513 |
| 312 | 3300014497 | Ga0182008_10000143 | Ga0182008_100001435 | 513 |
| 313 | 3300017792 | Ga0163161_10007748 | Ga0163161_100077485 | 513 |
| 314 | 3300025233 | Ga0209437_100637 | Ga0209437_10063718 | 513 |
| 315 | 3300025304 | Ga0209257_1004877 | Ga0209257_10048779 | 513 |
| 316 | 3300025912 | Ga0207707_10017065 | Ga0207707_100170653 | 513 |
| 317 | 3300025932 | Ga0207690_10007510 | Ga0207690_100075104 | 513 |
| 318 | 3300026116 | Ga0207674_10024820 | Ga0207674_100248204 | 513 |
| 319 | 3300046522 | Ga0495643_0001740 | Ga0495643_0001740_14690_16354 | 513 |
| 320 | 3300046660 | Ga0495625_0044660 | Ga0495625_0044660_1396_3060 | 513 |
| 321 | 3300047320 | Ga0495672_0000373 | Ga0495672_0000373_51329_52993 | 513 |
| 322 | 3300048920 | Ga0496117_0013593 | Ga0496117_0013593_2519_4180 | 513 |
| 323 | 3300048921 | Ga0496118_0000528 | Ga0496118_0000528_2585_4246 | 513 |
| 324 | 3300048921 | Ga0496118_0029280 | Ga0496118_0029280_66_1727 | 513 |
| 325 | 3300048924 | Ga0496121_0004159 | Ga0496121_0004159_2140_3801 | 513 |
| 326 | 3300048925 | Ga0496122_0019274 | Ga0496122_0019274_2036_3697 | 513 |
| 327 | 3300048926 | Ga0496123_0031037 | Ga0496123_0031037_201_1862 | 513 |
| 328 | 3300048928 | Ga0496125_0036240 | Ga0496125_0036240_1199_2863 | 513 |
| 329 | 3300049571 | Ga0501034_0012809 | Ga0501034_0012809_431_2158 | 513 |
| 330 | 3300003794 | Ga0055531_10006146 | Ga0055531_100061464 | 514 |
| 331 | 3300005614 | Ga0068856_100052772 | Ga0068856_1000527723 | 514 |
| 332 | 3300031456 | Ga0307513_10053920 | Ga0307513_100539206 | 514 |
| 333 | 3300031548 | Ga0307408_100046420 | Ga0307408_1000464203 | 514 |
| 334 | 3300031731 | Ga0307405_10003809 | Ga0307405_100038097 | 514 |
| 335 | 3300031852 | Ga0307410_10005487 | Ga0307410_100054875 | 514 |
| 336 | 3300031903 | Ga0307407_10013528 | Ga0307407_100135283 | 514 |
| 337 | 3300031995 | Ga0307409_100126975 | Ga0307409_1001269752 | 514 |
| 338 | 3300032002 | Ga0307416_100000500 | Ga0307416_1000005002 | 514 |
| 339 | 3300032005 | Ga0307411_10017445 | Ga0307411_100174454 | 514 |
| 340 | 3300032126 | Ga0307415_100014074 | Ga0307415_1000140743 | 514 |
| 341 | 3300049576 | Ga0501040_0012191 | Ga0501040_0012191_247_1935 | 514 |
| 342 | 3300049582 | Ga0501048_0069922 | Ga0501048_0069922_239_1927 | 514 |
| 343 | 3300049742 | Ga0501080_0084412 | Ga0501080_0084412_39_1766 | 514 |
| 344 | 3300049744 | Ga0501083_0012139 | Ga0501083_0012139_544_2271 | 514 |
| 345 | 3300049822 | Ga0501035_0095280 | Ga0501035_0095280_460_2187 | 514 |
| 346 | 3300054114 | Ga0501084_0042413 | Ga0501084_0042413_256_1983 | 514 |
| 347 | iso_pu_bacteria | 2874220319 | 2874221311 | 514 |
| 348 | iso_pu_bacteria | 2919134579 | 2919136107 | 514 |
| 349 | iso_pu_bacteria | 2928496128 | 2928496280 | 514 |
| 350 | 3300003214 | JGI25165J46597_1002837 | JGI25165J46597_10028372 | 515 |
| 351 | 3300005435 | Ga0070714_100021754 | Ga0070714_1000217542 | 515 |
| 352 | 3300006871 | Ga0075434_100071461 | Ga0075434_1000714612 | 515 |
| 353 | 3300025929 | Ga0207664_10000474 | Ga0207664_1000047420 | 515 |
| 354 | 3300048927 | Ga0496124_0000734 | Ga0496124_0000734_49762_51423 | 515 |
| 355 | 3300049586 | Ga0501070_0075225 | Ga0501070_0075225_886_2580 | 515 |
| 356 | 3300049589 | Ga0501073_0069917 | Ga0501073_0069917_36_1733 | 515 |
| 357 | 3300035398 | Ga0316574_0002354 | Ga0316574_0002354_369_2045 | 516 |
| 358 | 3300044672 | Ga0466982_0000098 | Ga0466982_0000098_2245_3915 | 516 |
| 359 | 3300048925 | Ga0496122_0016541 | Ga0496122_0016541_2639_4309 | 516 |
| 360 | 3300048926 | Ga0496123_0026628 | Ga0496123_0026628_75_1745 | 516 |
| 361 | 3300049575 | Ga0501039_0127614 | Ga0501039_0127614_61_1758 | 516 |
| 362 | 3300049576 | Ga0501040_0001093 | Ga0501040_0001093_6422_8119 | 516 |
| 363 | 3300049582 | Ga0501048_0018366 | Ga0501048_0018366_1116_2813 | 516 |
| 364 | 3300049587 | Ga0501071_0008278 | Ga0501071_0008278_5134_6831 | 516 |
| 365 | 3300049592 | Ga0501076_0023151 | Ga0501076_0023151_2677_4374 | 516 |
| 366 | 3300049593 | Ga0501077_0018306 | Ga0501077_0018306_2427_4124 | 516 |
| 367 | 3300049743 | Ga0501081_0021742 | Ga0501081_0021742_2423_4120 | 516 |
| 368 | 3300049824 | Ga0501045_0019176 | Ga0501045_0019176_2405_4102 | 516 |
| 369 | 3300054114 | Ga0501084_0014642 | Ga0501084_0014642_2431_4128 | 516 |
| 370 | 3300061734 | Ga0530510_0025249 | Ga0530510_0025249_2326_4023 | 516 |
| 371 | 3300005435 | Ga0070714_100000372 | Ga0070714_1000003724 | 518 |
| 372 | 3300025929 | Ga0207664_10000585 | Ga0207664_100005854 | 518 |
| 373 | 3300003187 | JGI25151J46595_10000041 | JGI25151J46595_10000041162 | 519 |
| 374 | 3300003187 | JGI25151J46595_10011611 | JGI25151J46595_100116115 | 519 |
| 375 | 3300003791 | Ga0055530_10002892 | Ga0055530_100028928 | 519 |
| 376 | 3300005435 | Ga0070714_100000713 | Ga0070714_1000007138 | 519 |
| 377 | 3300005539 | Ga0068853_100004423 | Ga0068853_1000044232 | 519 |
| 378 | 3300006844 | Ga0075428_100057180 | Ga0075428_1000571805 | 519 |
| 379 | 3300009177 | Ga0105248_10054583 | Ga0105248_100545836 | 519 |
| 380 | 3300025284 | Ga0209130_1012874 | Ga0209130_10128742 | 519 |
| 381 | 3300025292 | Ga0209676_1002465 | Ga0209676_10024654 | 519 |
| 382 | 3300025294 | Ga0209025_1000015 | Ga0209025_1000015722 | 519 |
| 383 | 3300025294 | Ga0209025_1002444 | Ga0209025_100244414 | 519 |
| 384 | 3300025298 | Ga0209050_1000528 | Ga0209050_100052851 | 519 |
| 385 | 3300025304 | Ga0209257_1002505 | Ga0209257_10025054 | 519 |
| 386 | 3300025904 | Ga0207647_10002712 | Ga0207647_100027124 | 519 |
| 387 | 3300025929 | Ga0207664_10000584 | Ga0207664_1000058410 | 519 |
| 388 | 3300025932 | Ga0207690_10000443 | Ga0207690_1000044316 | 519 |
| 389 | 3300025932 | Ga0207690_10008552 | Ga0207690_100085523 | 519 |
| 390 | 3300025933 | Ga0207706_10029417 | Ga0207706_100294172 | 519 |
| 391 | 3300041451 | Ga0451791_0612411 | Ga0451791_0612411_28_1623 | 519 |
| 392 | 3300046525 | Ga0495663_0000872 | Ga0495663_0000872_6185_7852 | 519 |
| 393 | 3300048925 | Ga0496122_0001038 | Ga0496122_0001038_2631_4301 | 519 |
| 394 | 3300048926 | Ga0496123_0000848 | Ga0496123_0000848_2768_4438 | 519 |
| 395 | 3300005435 | Ga0070714_100022773 | Ga0070714_1000227733 | 520 |
| 396 | 3300009098 | Ga0105245_10116590 | Ga0105245_101165902 | 520 |
| 397 | 3300013104 | Ga0157370_10013028 | Ga0157370_100130288 | 520 |
| 398 | 3300025928 | Ga0207700_10000822 | Ga0207700_1000082222 | 520 |
| 399 | 3300003760 | Ga0055527_1000605 | Ga0055527_10006057 | 521 |
| 400 | 3300003761 | Ga0055535_1000756 | Ga0055535_10007564 | 521 |
| 401 | 3300003762 | Ga0055542_1000774 | Ga0055542_10007744 | 521 |
| 402 | 3300003763 | Ga0055529_1000666 | Ga0055529_100066618 | 521 |
| 403 | 3300003775 | Ga0055524_1017968 | Ga0055524_10179681 | 521 |
| 404 | 3300005530 | Ga0070679_100106460 | Ga0070679_1001064602 | 521 |
| 405 | 3300015261 | Ga0182006_1000074 | Ga0182006_1000074103 | 521 |
| 406 | 3300025228 | Ga0209672_100017 | Ga0209672_100017394 | 521 |
| 407 | 3300025242 | Ga0209258_100213 | Ga0209258_1002139 | 521 |
| 408 | 3300025254 | Ga0209148_1000009 | Ga0209148_1000009819 | 521 |
| 409 | 3300025272 | Ga0209455_1000032 | Ga0209455_1000032394 | 521 |
| 410 | 3300025294 | Ga0209025_1008928 | Ga0209025_10089287 | 521 |
| 411 | 3300003794 | Ga0055531_10011589 | Ga0055531_100115892 | 522 |
| 412 | 3300009093 | Ga0105240_10084533 | Ga0105240_100845332 | 522 |
| 413 | 3300025304 | Ga0209257_1000145 | Ga0209257_100014595 | 522 |
| 414 | 3300044656 | Ga0466969_0004136 | Ga0466969_0004136_2315_3988 | 522 |
| 415 | 3300044663 | Ga0466989_0020182 | Ga0466989_0020182_1915_3588 | 522 |
| 416 | 3300044683 | Ga0466965_0019349 | Ga0466965_0019349_1348_3021 | 522 |
| 417 | 3300044693 | Ga0466961_0075758 | Ga0466961_0075758_80_1753 | 522 |
| 418 | 3300044719 | Ga0466971_0016812 | Ga0466971_0016812_1529_3202 | 522 |
| 419 | 3300044735 | Ga0466968_0004448 | Ga0466968_0004448_2250_3920 | 522 |
| 420 | 3300045049 | Ga0466959_0053115 | Ga0466959_0053115_160_1833 | 522 |
| 421 | 3300053087 | Ga0500643_001805 | Ga0500643_001805_2579_4249 | 522 |
| 422 | 3300053120 | Ga0500597_000873 | Ga0500597_000873_2890_4560 | 522 |
| 423 | 3300061719 | Ga0466962_0042936 | Ga0466962_0042936_67_1740 | 522 |
| 424 | 3300042006 | Ga0439432_007320 | Ga0439432_007320_2017_3696 | 524 |
| 425 | 3300002773 | JGI25152J39213_1000102 | JGI25152J39213_100010211 | 525 |
| 426 | 3300002774 | JGI25150J39212_1000099 | JGI25150J39212_100009945 | 525 |
| 427 | 3300002774 | JGI25150J39212_1000290 | JGI25150J39212_100029016 | 525 |
| 428 | 3300003187 | JGI25151J46595_10000269 | JGI25151J46595_1000026911 | 525 |
| 429 | 3300003215 | JGI25153J46596_10000189 | JGI25153J46596_1000018911 | 525 |
| 430 | 3300015262 | Ga0182007_10004954 | Ga0182007_100049545 | 525 |
| 431 | 3300025245 | Ga0207425_1000092 | Ga0207425_100009220 | 525 |
| 432 | 3300025258 | Ga0209129_1000151 | Ga0209129_100015186 | 525 |
| 433 | 3300025294 | Ga0209025_1000012 | Ga0209025_1000012205 | 525 |
| 434 | 3300025297 | Ga0209758_1000018 | Ga0209758_1000018453 | 525 |
| 435 | 3300042006 | Ga0439432_019438 | Ga0439432_019438_251_1939 | 525 |
| 436 | 3300048920 | Ga0496117_0015798 | Ga0496117_0015798_2357_4027 | 525 |
| 437 | 3300048921 | Ga0496118_0005474 | Ga0496118_0005474_10215_11885 | 525 |
| 438 | 3300005341 | Ga0070691_10000561 | Ga0070691_100005618 | 526 |
| 439 | 3300005344 | Ga0070661_100001862 | Ga0070661_1000018626 | 526 |
| 440 | 3300005345 | Ga0070692_10000139 | Ga0070692_100001396 | 526 |
| 441 | 3300005578 | Ga0068854_100003470 | Ga0068854_1000034707 | 526 |
| 442 | 3300005616 | Ga0068852_100021578 | Ga0068852_1000215781 | 526 |
| 443 | 3300013105 | Ga0157369_10002364 | Ga0157369_1000236416 | 526 |
| 444 | 3300020082 | Ga0206353_10073144 | Ga0206353_100731442 | 526 |
| 445 | 3300025909 | Ga0207705_10000165 | Ga0207705_1000016552 | 526 |
| 446 | 3300025913 | Ga0207695_10000975 | Ga0207695_1000097541 | 526 |
| 447 | 3300025919 | Ga0207657_10010252 | Ga0207657_100102527 | 526 |
| 448 | 3300025920 | Ga0207649_10031454 | Ga0207649_100314542 | 526 |
| 449 | 3300025932 | Ga0207690_10001772 | Ga0207690_1000177210 | 526 |
| 450 | 3300025949 | Ga0207667_10001003 | Ga0207667_1000100317 | 526 |
| 451 | 3300026041 | Ga0207639_10001634 | Ga0207639_100016347 | 526 |
| 452 | 3300026067 | Ga0207678_10000433 | Ga0207678_100004332 | 526 |
| 453 | 3300026142 | Ga0207698_10000592 | Ga0207698_1000059213 | 526 |
| 454 | 3300049570 | Ga0501033_0005847 | Ga0501033_0005847_6829_8589 | 527 |
| 455 | 3300005539 | Ga0068853_100002068 | Ga0068853_10000206810 | 528 |
| 456 | 3300005563 | Ga0068855_100171159 | Ga0068855_1001711593 | 528 |
| 457 | 3300015687 | Ga0183368_1004 | Ga0183368_10041051 | 528 |
| 458 | 3300025303 | Ga0209051_1032538 | Ga0209051_10325382 | 528 |
| 459 | 3300025904 | Ga0207647_10012222 | Ga0207647_100122224 | 528 |
| 460 | 3300026041 | Ga0207639_10007609 | Ga0207639_100076097 | 528 |
| 461 | 3300026116 | Ga0207674_10065193 | Ga0207674_100651933 | 528 |
| 462 | 3300037312 | Ga0395899_0053918 | Ga0395899_0053918_251_1924 | 528 |
| 463 | 3300037418 | Ga0395900_0002387 | Ga0395900_0002387_18238_19911 | 528 |
| 464 | 3300037466 | Ga0395898_0025910 | Ga0395898_0025910_3839_5512 | 528 |
| 465 | 3300038443 | Ga0395901_0002935 | Ga0395901_0002935_10270_11943 | 528 |
| 466 | 3300041404 | Ga0439436_0006040 | Ga0439436_0006040_169_1836 | 528 |
| 467 | 3300044656 | Ga0466969_0017661 | Ga0466969_0017661_183_1853 | 528 |
| 468 | 3300044765 | Ga0466970_0057341 | Ga0466970_0057341_299_1969 | 528 |
| 469 | 3300048916 | Ga0496113_0067201 | Ga0496113_0067201_49_1719 | 528 |
| 470 | 3300048918 | Ga0496115_0000181 | Ga0496115_0000181_12282_13952 | 528 |
| 471 | 3300049586 | Ga0501070_0001120 | Ga0501070_0001120_17148_18830 | 528 |
| 472 | 3300049589 | Ga0501073_0107067 | Ga0501073_0107067_247_1920 | 528 |
| 473 | 3300014497 | Ga0182008_10018312 | Ga0182008_100183123 | 529 |
| 474 | 3300015261 | Ga0182006_1018348 | Ga0182006_10183482 | 529 |
| 475 | 3300025250 | Ga0209026_1000051 | Ga0209026_1000051151 | 529 |
| 476 | 3300037418 | Ga0395900_0000069 | Ga0395900_0000069_176632_178305 | 529 |
| 477 | 3300044656 | Ga0466969_0002807 | Ga0466969_0002807_6551_8281 | 529 |
| 478 | 3300044656 | Ga0466969_0003343 | Ga0466969_0003343_4994_6667 | 529 |
| 479 | 3300045049 | Ga0466959_0024013 | Ga0466959_0024013_348_2078 | 529 |
| 480 | 3300045051 | Ga0451576_0000821 | Ga0451576_0000821_2640_4340 | 529 |
| 481 | 3300049570 | Ga0501033_0062985 | Ga0501033_0062985_34_1707 | 529 |
| 482 | 3300049585 | Ga0501069_0023366 | Ga0501069_0023366_124_1839 | 529 |
| 483 | 3300049589 | Ga0501073_0010681 | Ga0501073_0010681_2409_4124 | 529 |
| 484 | 3300049741 | Ga0501079_0059639 | Ga0501079_0059639_220_1935 | 529 |
| 485 | 3300049823 | Ga0501044_0029738 | Ga0501044_0029738_1018_2733 | 529 |
| 486 | 3300005530 | Ga0070679_100127285 | Ga0070679_1001272852 | 530 |
| 487 | 3300005841 | Ga0068863_100127670 | Ga0068863_1001276702 | 530 |
| 488 | 3300009551 | Ga0105238_10072023 | Ga0105238_100720231 | 530 |
| 489 | 3300025924 | Ga0207694_10012898 | Ga0207694_100128983 | 530 |
| 490 | 3300025931 | Ga0207644_10000313 | Ga0207644_1000031321 | 530 |
| 491 | 3300037312 | Ga0395899_0000142 | Ga0395899_0000142_23088_24758 | 530 |
| 492 | 3300037312 | Ga0395899_0009818 | Ga0395899_0009818_4703_6376 | 530 |
| 493 | 3300037418 | Ga0395900_0010793 | Ga0395900_0010793_2511_4184 | 530 |
| 494 | 3300037466 | Ga0395898_0000097 | Ga0395898_0000097_201371_203041 | 530 |
| 495 | 3300038443 | Ga0395901_0010713 | Ga0395901_0010713_2448_4121 | 530 |
| 496 | 3300038443 | Ga0395901_0149263 | Ga0395901_0149263_105_1775 | 530 |
| 497 | 3300044765 | Ga0466970_0001674 | Ga0466970_0001674_5649_7352 | 530 |
| 498 | 3300053079 | Ga0500610_0023463 | Ga0500610_0023463_701_2368 | 530 |
| 499 | 3300028573 | Ga0265334_10000009 | Ga0265334_10000009100 | 531 |
| 500 | 3300031595 | Ga0265313_10007989 | Ga0265313_100079893 | 531 |
| 501 | 3300044765 | Ga0466970_0009926 | Ga0466970_0009926_1042_2712 | 531 |
| 502 | 3300046452 | Ga0495617_003503 | Ga0495617_003503_1658_3328 | 531 |
| 503 | 3300046460 | Ga0495638_0000122 | Ga0495638_0000122_27471_29141 | 531 |
| 504 | 3300046501 | Ga0495607_0008882 | Ga0495607_0008882_2798_4468 | 531 |
| 505 | 3300046520 | Ga0495637_0014700 | Ga0495637_0014700_1609_3279 | 531 |
| 506 | 3300046648 | Ga0495611_0000001 | Ga0495611_0000001_1762786_1764456 | 531 |
| 507 | 3300046660 | Ga0495625_0000001 | Ga0495625_0000001_151595_153265 | 531 |
| 508 | 3300046692 | Ga0495671_0000875 | Ga0495671_0000875_2814_4484 | 531 |
| 509 | 3300046694 | Ga0495649_0012109 | Ga0495649_0012109_479_2149 | 531 |
| 510 | 3300046794 | Ga0495589_0000138 | Ga0495589_0000138_62912_64582 | 531 |
| 511 | 3300046810 | Ga0495660_0004009 | Ga0495660_0004009_4531_6201 | 531 |
| 512 | 3300047446 | Ga0495679_000029 | Ga0495679_000029_12514_14184 | 531 |
| 513 | 3300048918 | Ga0496115_0020279 | Ga0496115_0020279_1187_2857 | 531 |
| 514 | 3300048920 | Ga0496117_0024725 | Ga0496117_0024725_78_1748 | 531 |
| 515 | 3300048921 | Ga0496118_0004154 | Ga0496118_0004154_3973_5643 | 531 |
| 516 | 3300048929 | Ga0496126_0060980 | Ga0496126_0060980_667_2337 | 531 |
| 517 | 3300049459 | Ga0495678_000718 | Ga0495678_000718_22325_23995 | 531 |
| 518 | 3300053087 | Ga0500643_000002 | Ga0500643_000002_54419_56089 | 531 |
| 519 | 3300013105 | Ga0157369_10016391 | Ga0157369_100163916 | 532 |
| 520 | 3300013307 | Ga0157372_10036984 | Ga0157372_100369843 | 532 |
| 521 | 3300015265 | Ga0182005_1000326 | Ga0182005_100032611 | 532 |
| 522 | 3300025228 | Ga0209672_102291 | Ga0209672_1022914 | 532 |
| 523 | 3300044693 | Ga0466961_0013744 | Ga0466961_0013744_2235_3905 | 532 |
| 524 | 3300046507 | Ga0495606_0000348 | Ga0495606_0000348_38566_40236 | 532 |
| 525 | 3300048925 | Ga0496122_0000267 | Ga0496122_0000267_23498_25165 | 532 |
| 526 | 3300048926 | Ga0496123_0000161 | Ga0496123_0000161_23572_25239 | 532 |
| 527 | 3300048928 | Ga0496125_0031902 | Ga0496125_0031902_864_2534 | 532 |
| 528 | 3300002705 | JGI25156J39149_1008279 | JGI25156J39149_10082792 | 533 |
| 529 | 3300002741 | JGI25157J39369_1001514 | JGI25157J39369_10015143 | 533 |
| 530 | 3300005367 | Ga0070667_100000084 | Ga0070667_100000084106 | 533 |
| 531 | 3300005543 | Ga0070672_100009562 | Ga0070672_1000095625 | 533 |
| 532 | 3300025250 | Ga0209026_1000079 | Ga0209026_10000799 | 533 |
| 533 | 3300025256 | Ga0209759_1002334 | Ga0209759_10023348 | 533 |
| 534 | 3300025292 | Ga0209676_1006826 | Ga0209676_10068264 | 533 |
| 535 | 3300025298 | Ga0209050_1004837 | Ga0209050_10048374 | 533 |
| 536 | 3300025304 | Ga0209257_1000080 | Ga0209257_1000080312 | 533 |
| 537 | 3300025986 | Ga0207658_10000093 | Ga0207658_100000936 | 533 |
| 538 | 3300048908 | Ga0496105_0006290 | Ga0496105_0006290_4888_6561 | 533 |
| 539 | 3300048922 | Ga0496119_0000184 | Ga0496119_0000184_33634_35307 | 533 |
| 540 | 3300048923 | Ga0496120_0001091 | Ga0496120_0001091_10939_12612 | 533 |
| 541 | 3300049579 | Ga0501043_0002540 | Ga0501043_0002540_11418_13085 | 533 |
| 542 | 3300005289 | Ga0065704_10072174 | Ga0065704_100721746 | 534 |
| 543 | 3300005331 | Ga0070670_100007924 | Ga0070670_1000079247 | 534 |
| 544 | 3300009011 | Ga0105251_10000880 | Ga0105251_1000088013 | 534 |
| 545 | 3300009177 | Ga0105248_10000429 | Ga0105248_1000042912 | 534 |
| 546 | 3300009545 | Ga0105237_10000388 | Ga0105237_1000038816 | 534 |
| 547 | 3300009553 | Ga0105249_10009937 | Ga0105249_100099372 | 534 |
| 548 | 3300010375 | Ga0105239_10069647 | Ga0105239_100696473 | 534 |
| 549 | 3300014325 | Ga0163163_10000877 | Ga0163163_100008776 | 534 |
| 550 | 3300025735 | Ga0207713_1000710 | Ga0207713_100071025 | 534 |
| 551 | 3300025914 | Ga0207671_10004200 | Ga0207671_100042002 | 534 |
| 552 | 3300025925 | Ga0207650_10044596 | Ga0207650_100445963 | 534 |
| 553 | 3300025941 | Ga0207711_10001015 | Ga0207711_100010156 | 534 |
| 554 | 3300025961 | Ga0207712_10000343 | Ga0207712_1000034311 | 534 |
| 555 | 3300026067 | Ga0207678_10005962 | Ga0207678_100059624 | 534 |
| 556 | 3300031665 | Ga0316575_10011930 | Ga0316575_100119303 | 534 |
| 557 | 3300031733 | Ga0316577_10009829 | Ga0316577_100098293 | 534 |
| 558 | 3300032133 | Ga0316583_10000626 | Ga0316583_100006266 | 534 |
| 559 | 3300032137 | Ga0316585_10000572 | Ga0316585_100005728 | 534 |
| 560 | 3300036647 | Ga0316582_0002212 | Ga0316582_0002212_1352_3052 | 534 |
| 561 | 3300036712 | Ga0316584_0002179 | Ga0316584_0002179_6772_8472 | 534 |
| 562 | 3300048920 | Ga0496117_0005762 | Ga0496117_0005762_4230_5897 | 534 |
| 563 | 3300048922 | Ga0496119_0001426 | Ga0496119_0001426_2549_4216 | 534 |
| 564 | 3300048923 | Ga0496120_0000307 | Ga0496120_0000307_56431_58098 | 534 |
| 565 | 3300048927 | Ga0496124_0004066 | Ga0496124_0004066_13073_14740 | 534 |
| 566 | 3300049581 | Ga0501047_0004475 | Ga0501047_0004475_5913_7592 | 534 |
| 567 | 3300049586 | Ga0501070_0011003 | Ga0501070_0011003_708_2387 | 534 |
| 568 | 3300049589 | Ga0501073_0003721 | Ga0501073_0003721_2793_4472 | 534 |
| 569 | 3300049590 | Ga0501074_0004079 | Ga0501074_0004079_5045_6724 | 534 |
| 570 | 3300049742 | Ga0501080_0028382 | Ga0501080_0028382_2492_4171 | 534 |
| 571 | 3300049822 | Ga0501035_0161756 | Ga0501035_0161756_190_1869 | 534 |
| 572 | 3300049823 | Ga0501044_0011428 | Ga0501044_0011428_669_2348 | 534 |
| 573 | iso_pu_bacteria | 2524023129 | 2524190819 | 534 |
| 574 | iso_pu_bacteria | 8002317523 | 8002323647 | 534 |
| 575 | iso_pu_bacteria | 8046991243 | 8046998894 | 534 |
| 576 | iso_pu_bacteria | 2512564039 | 2512732436 | 535 |
| 577 | iso_pu_bacteria | 2593339198 | 2595318519 | 535 |
| 578 | iso_pu_bacteria | 2671180694 | 2673822801 | 535 |
| 579 | iso_pu_bacteria | 2864997549 | 2864997913 | 535 |
| 580 | iso_pu_bacteria | 2889295896 | 2889297287 | 535 |
| 581 | iso_pu_bacteria | 2980125574 | 2980128969 | 535 |
| 582 | iso_pu_bacteria | 2981284811 | 2981285766 | 535 |
| 583 | iso_pu_bacteria | 2981289755 | 2981290713 | 535 |
| 584 | iso_pu_bacteria | 2981980479 | 2981980665 | 535 |
| 585 | iso_pu_bacteria | 2981985349 | 2981985543 | 535 |
| 586 | iso_pu_bacteria | 8054795415 | 8054798322 | 535 |
| 587 | iso_pu_bacteria | 8057473075 | 8057477228 | 535 |
| 588 | 3300048918 | Ga0496115_0000163 | Ga0496115_0000163_30440_32170 | 536 |
| 589 | 3300048918 | Ga0496115_0071919 | Ga0496115_0071919_378_2048 | 536 |
| 590 | 3300048929 | Ga0496126_0002149 | Ga0496126_0002149_8689_10419 | 536 |
| 591 | 3300005458 | Ga0070681_10025596 | Ga0070681_100255967 | 537 |
| 592 | 3300009551 | Ga0105238_10024524 | Ga0105238_100245245 | 537 |
| 593 | 3300013307 | Ga0157372_10027342 | Ga0157372_100273426 | 537 |
| 594 | 3300025912 | Ga0207707_10051686 | Ga0207707_100516862 | 537 |
| 595 | 3300025924 | Ga0207694_10041831 | Ga0207694_100418313 | 537 |
| 596 | 3300031730 | Ga0307516_10018328 | Ga0307516_100183285 | 537 |
| 597 | 3300045051 | Ga0451576_0072609 | Ga0451576_0072609_701_2410 | 537 |
| 598 | 3300046616 | Ga0495668_0000804 | Ga0495668_0000804_4313_5977 | 537 |
| 599 | iso_pu_bacteria | 2547132130 | 2547502785 | 537 |
| 600 | iso_pu_bacteria | 2576861471 | 2578458700 | 537 |
| 601 | iso_pu_bacteria | 2765235840 | 2765578683 | 537 |
| 602 | iso_pu_bacteria | 2816332141 | 2816516758 | 537 |
| 603 | iso_pu_bacteria | 2842391507 | 2842394993 | 537 |
| 604 | iso_pu_bacteria | 2842757796 | 2842758400 | 537 |
| 605 | iso_pu_bacteria | 2852649853 | 2852651069 | 537 |
| 606 | iso_pu_bacteria | 2857442823 | 2857446885 | 537 |
| 607 | iso_pu_bacteria | 2894414249 | 2894415659 | 537 |
| 608 | iso_pu_bacteria | 2931380184 | 2931381035 | 537 |
| 609 | iso_pu_bacteria | 2937610967 | 2937612132 | 537 |
| 610 | iso_pu_bacteria | 2939622612 | 2939622956 | 537 |
| 611 | iso_pu_bacteria | 2939626828 | 2939630871 | 537 |
| 612 | iso_pu_bacteria | 2941475908 | 2941478054 | 537 |
| 613 | iso_pu_bacteria | 2961047084 | 2961048077 | 537 |
| 614 | iso_pu_bacteria | 2961064222 | 2961065095 | 537 |
| 615 | iso_pu_bacteria | 8021622325 | 8021623762 | 537 |
| 616 | iso_pu_bacteria | 8021626552 | 8021630458 | 537 |
| 617 | iso_pu_bacteria | 8021648035 | 8021650620 | 537 |
| 618 | 3300005617 | Ga0068859_100021151 | Ga0068859_1000211514 | 538 |
| 619 | 3300006931 | Ga0097620_100021151 | Ga0097620_1000211514 | 538 |
| 620 | 3300041413 | Ga0439465_0018945 | Ga0439465_0018945_245_1912 | 538 |
| 621 | 3300042007 | Ga0439449_0000905 | Ga0439449_0000905_318_1985 | 538 |
| 622 | iso_pu_bacteria | 2747842501 | 2748015862 | 538 |
| 623 | iso_pu_bacteria | 2939589442 | 2939590774 | 538 |
| 624 | iso_pu_bacteria | 2974307012 | 2974309197 | 538 |
| 625 | iso_pu_bacteria | 2977247770 | 2977249916 | 538 |
| 626 | iso_pu_bacteria | 2984514374 | 2984515594 | 538 |
| 627 | 3300005471 | Ga0070698_100064803 | Ga0070698_1000648032 | 539 |
| 628 | 3300010375 | Ga0105239_10007002 | Ga0105239_1000700218 | 539 |
| 629 | 3300032004 | Ga0307414_10003986 | Ga0307414_100039865 | 539 |
| 630 | 3300046460 | Ga0495638_0000069 | Ga0495638_0000069_163447_165120 | 539 |
| 631 | 3300053093 | Ga0500651_0000088 | Ga0500651_0000088_56803_58479 | 539 |
| 632 | iso_pu_bacteria | 2585428059 | 2587738596 | 539 |
| 633 | iso_pu_bacteria | 2643221579 | 2643907792 | 539 |
| 634 | iso_pu_bacteria | 2643221581 | 2643916003 | 539 |
| 635 | iso_pu_bacteria | 2643221676 | 2644426890 | 539 |
| 636 | iso_pu_bacteria | 2818991457 | 2819662981 | 539 |
| 637 | iso_pu_bacteria | 2842780639 | 2842780775 | 539 |
| 638 | iso_pu_bacteria | 2852684882 | 2852686028 | 539 |
| 639 | iso_pu_bacteria | 2857453340 | 2857453701 | 539 |
| 640 | iso_pu_bacteria | 2919513703 | 2919514563 | 539 |
| 641 | iso_pu_bacteria | 2919675420 | 2919676605 | 539 |
| 642 | iso_pu_bacteria | 2923516293 | 2923518469 | 539 |
| 643 | iso_pu_bacteria | 2971410472 | 2971411064 | 539 |
| 644 | iso_pu_bacteria | 8002869464 | 8002872224 | 539 |
| 645 | iso_pu_bacteria | 8003014200 | 8003015923 | 539 |
| 646 | iso_pu_bacteria | 8056533031 | 8056536393 | 539 |
| 647 | 3300005444 | Ga0070694_100032508 | Ga0070694_1000325082 | 540 |
| 648 | 3300005539 | Ga0068853_100012109 | Ga0068853_1000121095 | 540 |
| 649 | 3300005617 | Ga0068859_100186169 | Ga0068859_1001861692 | 540 |
| 650 | 3300005618 | Ga0068864_100128090 | Ga0068864_1001280902 | 540 |
| 651 | 3300005844 | Ga0068862_100064307 | Ga0068862_1000643074 | 540 |
| 652 | 3300006931 | Ga0097620_100186173 | Ga0097620_1001861731 | 540 |
| 653 | 3300009551 | Ga0105238_10002989 | Ga0105238_100029894 | 540 |
| 654 | 3300013100 | Ga0157373_10005152 | Ga0157373_100051529 | 540 |
| 655 | 3300013102 | Ga0157371_10002814 | Ga0157371_1000281417 | 540 |
| 656 | 3300013104 | Ga0157370_10014321 | Ga0157370_100143215 | 540 |
| 657 | 3300013307 | Ga0157372_10003304 | Ga0157372_100033044 | 540 |
| 658 | 3300025258 | Ga0209129_1003459 | Ga0209129_10034591 | 540 |
| 659 | 3300025297 | Ga0209758_1005446 | Ga0209758_10054465 | 540 |
| 660 | 3300025924 | Ga0207694_10012219 | Ga0207694_100122194 | 540 |
| 661 | 3300025949 | Ga0207667_10005715 | Ga0207667_1000571514 | 540 |
| 662 | 3300026041 | Ga0207639_10002124 | Ga0207639_1000212413 | 540 |
| 663 | 3300026116 | Ga0207674_10066528 | Ga0207674_100665283 | 540 |
| 664 | 3300028380 | Ga0268265_10094964 | Ga0268265_100949642 | 540 |
| 665 | iso_pu_bacteria | 2593339238 | 2595446484 | 540 |
| 666 | iso_pu_bacteria | 2593339239 | 2595451985 | 540 |
| 667 | iso_pu_bacteria | 2718218334 | 2721026882 | 540 |
| 668 | iso_pu_bacteria | 2734482264 | 2735837567 | 540 |
| 669 | iso_pu_bacteria | 2738543009 | 2739228174 | 540 |
| 670 | iso_pu_bacteria | 2739367700 | 2739731596 | 540 |
| 671 | iso_pu_bacteria | 2818991440 | 2819565239 | 540 |
| 672 | iso_pu_bacteria | 2842914999 | 2842917424 | 540 |
| 673 | iso_pu_bacteria | 2842918807 | 2842919614 | 540 |
| 674 | iso_pu_bacteria | 2884338543 | 2884341164 | 540 |
| 675 | iso_pu_bacteria | 2884411467 | 2884413505 | 540 |
| 676 | iso_pu_bacteria | 2904463128 | 2904466907 | 540 |
| 677 | iso_pu_bacteria | 2919130084 | 2919133565 | 540 |
| 678 | iso_pu_bacteria | 2919404418 | 2919405093 | 540 |
| 679 | iso_pu_bacteria | 2929195423 | 2929197381 | 540 |
| 680 | iso_pu_bacteria | 2941471342 | 2941472620 | 540 |
| 681 | iso_pu_bacteria | 2953994433 | 2953994892 | 540 |
| 682 | 3300005435 | Ga0070714_100013529 | Ga0070714_1000135292 | 541 |
| 683 | 3300009011 | Ga0105251_10009176 | Ga0105251_100091763 | 541 |
| 684 | 3300025735 | Ga0207713_1009080 | Ga0207713_10090803 | 541 |
| 685 | 3300046453 | Ga0495627_006082 | Ga0495627_006082_2919_4580 | 541 |
| 686 | 3300046558 | Ga0495633_0022068 | Ga0495633_0022068_945_2606 | 541 |
| 687 | 3300048913 | Ga0496110_0035169 | Ga0496110_0035169_1317_3008 | 541 |
| 688 | 3300048920 | Ga0496117_0057321 | Ga0496117_0057321_161_1822 | 541 |
| 689 | 3300048921 | Ga0496118_0016346 | Ga0496118_0016346_2927_4588 | 541 |
| 690 | 3300049568 | Ga0501031_0059928 | Ga0501031_0059928_644_2329 | 541 |
| 691 | 3300049574 | Ga0501038_0025329 | Ga0501038_0025329_1974_3659 | 541 |
| 692 | 3300049822 | Ga0501035_0010022 | Ga0501035_0010022_4510_6195 | 541 |
| 693 | 3300049823 | Ga0501044_0043549 | Ga0501044_0043549_2528_4213 | 541 |
| 694 | iso_pu_bacteria | 2524614729 | 2525556682 | 541 |
| 695 | iso_pu_bacteria | 2537561836 | 2538832646 | 541 |
| 696 | iso_pu_bacteria | 2627854209 | 2630648278 | 541 |
| 697 | iso_pu_bacteria | 2643221562 | 2643830108 | 541 |
| 698 | iso_pu_bacteria | 2643221577 | 2643894365 | 541 |
| 699 | iso_pu_bacteria | 2643221685 | 2644476569 | 541 |
| 700 | iso_pu_bacteria | 2687453130 | 2687583262 | 541 |
| 701 | iso_pu_bacteria | 2895395659 | 2895395690 | 541 |
| 702 | 3300003791 | Ga0055530_10008054 | Ga0055530_100080543 | 542 |
| 703 | 3300005293 | Ga0065715_10093484 | Ga0065715_100934844 | 542 |
| 704 | 3300005293 | Ga0065715_10110437 | Ga0065715_101104371 | 542 |
| 705 | 3300005459 | Ga0068867_100071691 | Ga0068867_1000716912 | 542 |
| 706 | 3300013308 | Ga0157375_10287370 | Ga0157375_102873701 | 542 |
| 707 | 3300025298 | Ga0209050_1000415 | Ga0209050_100041571 | 542 |
| 708 | 3300025940 | Ga0207691_10007639 | Ga0207691_100076398 | 542 |
| 709 | 3300026089 | Ga0207648_10029340 | Ga0207648_100293408 | 542 |
| 710 | 3300035695 | Ga0373927_0000003 | Ga0373927_0000003_372922_374595 | 542 |
| 711 | 3300046558 | Ga0495633_0013730 | Ga0495633_0013730_2236_3900 | 542 |
| 712 | 3300048919 | Ga0496116_0000005 | Ga0496116_0000005_763596_765299 | 542 |
| 713 | 3300048924 | Ga0496121_0000029 | Ga0496121_0000029_67718_69421 | 542 |
| 714 | 3300053161 | Ga0500634_0001229 | Ga0500634_0001229_1160_2824 | 542 |
| 715 | 3300003856 | Ga0058692_1000018 | Ga0058692_100001815 | 543 |
| 716 | 3300005289 | Ga0065704_10002333 | Ga0065704_100023338 | 543 |
| 717 | 3300005327 | Ga0070658_10012294 | Ga0070658_100122943 | 543 |
| 718 | 3300005335 | Ga0070666_10000003 | Ga0070666_10000003137 | 543 |
| 719 | 3300005344 | Ga0070661_100033926 | Ga0070661_1000339262 | 543 |
| 720 | 3300005354 | Ga0070675_100013380 | Ga0070675_1000133806 | 543 |
| 721 | 3300005367 | Ga0070667_100149360 | Ga0070667_1001493602 | 543 |
| 722 | 3300006051 | Ga0075364_10001000 | Ga0075364_100010006 | 543 |
| 723 | 3300009148 | Ga0105243_10021826 | Ga0105243_100218264 | 543 |
| 724 | 3300009551 | Ga0105238_10000362 | Ga0105238_1000036238 | 543 |
| 725 | 3300010375 | Ga0105239_10013284 | Ga0105239_100132849 | 543 |
| 726 | 3300013306 | Ga0163162_10000357 | Ga0163162_1000035730 | 543 |
| 727 | 3300015265 | Ga0182005_1002979 | Ga0182005_10029792 | 543 |
| 728 | 3300025291 | Ga0209675_1016461 | Ga0209675_10164611 | 543 |
| 729 | 3300025292 | Ga0209676_1003076 | Ga0209676_10030769 | 543 |
| 730 | 3300025304 | Ga0209257_1015664 | Ga0209257_10156643 | 543 |
| 731 | 3300025903 | Ga0207680_10000006 | Ga0207680_10000006283 | 543 |
| 732 | 3300025909 | Ga0207705_10008340 | Ga0207705_100083403 | 543 |
| 733 | 3300025924 | Ga0207694_10004402 | Ga0207694_100044023 | 543 |
| 734 | 3300025935 | Ga0207709_10018744 | Ga0207709_100187443 | 543 |
| 735 | 3300027312 | Ga0209371_1000011 | Ga0209371_100001154 | 543 |
| 736 | 3300028379 | Ga0268266_10000043 | Ga0268266_1000004351 | 543 |
| 737 | 3300030500 | Ga0268256_1000011 | Ga0268256_100001154 | 543 |
| 738 | 3300031665 | Ga0316575_10040661 | Ga0316575_100406611 | 543 |
| 739 | 3300031728 | Ga0316578_10016352 | Ga0316578_100163522 | 543 |
| 740 | 3300031730 | Ga0307516_10035332 | Ga0307516_100353326 | 543 |
| 741 | 3300032004 | Ga0307414_10017858 | Ga0307414_100178583 | 543 |
| 742 | 3300032139 | Ga0316580_10003247 | Ga0316580_100032471 | 543 |
| 743 | 3300033180 | Ga0307510_10001938 | Ga0307510_1000193817 | 543 |
| 744 | 3300035398 | Ga0316574_0008582 | Ga0316574_0008582_1397_3115 | 543 |
| 745 | 3300038705 | Ga0237819_00127 | Ga0237819_00127_21671_23338 | 543 |
| 746 | 3300041999 | Ga0439433_0012744 | Ga0439433_0012744_30_1697 | 543 |
| 747 | 3300046471 | Ga0495650_0003763 | Ga0495650_0003763_2634_4301 | 543 |
| 748 | 3300046474 | Ga0495605_0023124 | Ga0495605_0023124_814_2481 | 543 |
| 749 | 3300046501 | Ga0495607_0021638 | Ga0495607_0021638_1492_3159 | 543 |
| 750 | 3300046513 | Ga0495616_0025426 | Ga0495616_0025426_1397_3064 | 543 |
| 751 | 3300046539 | Ga0495621_0003739 | Ga0495621_0003739_2061_3734 | 543 |
| 752 | 3300048917 | Ga0496114_0001917 | Ga0496114_0001917_12665_14332 | 543 |
| 753 | 3300048927 | Ga0496124_0000009 | Ga0496124_0000009_553143_554810 | 543 |
| 754 | 3300048928 | Ga0496125_0010887 | Ga0496125_0010887_6691_8358 | 543 |
| 755 | 3300048928 | Ga0496125_0041611 | Ga0496125_0041611_1768_3435 | 543 |
| 756 | 3300048929 | Ga0496126_0013547 | Ga0496126_0013547_2639_4306 | 543 |
| 757 | 3300048929 | Ga0496126_0120754 | Ga0496126_0120754_355_2022 | 543 |
| 758 | 3300049571 | Ga0501034_0000344 | Ga0501034_0000344_64913_66580 | 543 |
| 759 | 3300049578 | Ga0501042_0004613 | Ga0501042_0004613_6324_8021 | 543 |
| 760 | 3300049581 | Ga0501047_0076899 | Ga0501047_0076899_952_2631 | 543 |
| 761 | 3300050491 | nmdc:mga00v17_10476_c1 | nmdc:mga00v17_10476_c1_3063_4730 | 543 |
| 762 | 3300050491 | nmdc:mga00v17_5307_c1 | nmdc:mga00v17_5307_c1_2580_4247 | 543 |
| 763 | 3300002705 | JGI25156J39149_1001689 | JGI25156J39149_10016898 | 544 |
| 764 | 3300002737 | JGI25162J39368_1002522 | JGI25162J39368_10025223 | 544 |
| 765 | 3300002737 | JGI25162J39368_1002946 | JGI25162J39368_10029463 | 544 |
| 766 | 3300002741 | JGI25157J39369_1000760 | JGI25157J39369_10007609 | 544 |
| 767 | 3300002741 | JGI25157J39369_1001601 | JGI25157J39369_10016018 | 544 |
| 768 | 3300002771 | JGI25163J39215_1001514 | JGI25163J39215_10015143 | 544 |
| 769 | 3300002772 | JGI25164J39214_1000049 | JGI25164J39214_100004956 | 544 |
| 770 | 3300002772 | JGI25164J39214_1000088 | JGI25164J39214_100008881 | 544 |
| 771 | 3300003214 | JGI25165J46597_1000009 | JGI25165J46597_1000009384 | 544 |
| 772 | 3300003214 | JGI25165J46597_1000088 | JGI25165J46597_100008842 | 544 |
| 773 | 3300003761 | Ga0055535_1000082 | Ga0055535_100008233 | 544 |
| 774 | 3300003761 | Ga0055535_1001284 | Ga0055535_10012843 | 544 |
| 775 | 3300003762 | Ga0055542_1001065 | Ga0055542_10010653 | 544 |
| 776 | 3300003762 | Ga0055542_1002159 | Ga0055542_10021593 | 544 |
| 777 | 3300003762 | Ga0055542_1002186 | Ga0055542_10021863 | 544 |
| 778 | 3300003763 | Ga0055529_1000020 | Ga0055529_1000020269 | 544 |
| 779 | 3300003763 | Ga0055529_1000887 | Ga0055529_100088711 | 544 |
| 780 | 3300005339 | Ga0070660_100025556 | Ga0070660_1000255561 | 544 |
| 781 | 3300005340 | Ga0070689_100008741 | Ga0070689_1000087412 | 544 |
| 782 | 3300005466 | Ga0070685_10004666 | Ga0070685_100046663 | 544 |
| 783 | 3300005535 | Ga0070684_100033959 | Ga0070684_1000339591 | 544 |
| 784 | 3300005843 | Ga0068860_100105026 | Ga0068860_1001050262 | 544 |
| 785 | 3300009174 | Ga0105241_10076264 | Ga0105241_100762642 | 544 |
| 786 | 3300015261 | Ga0182006_1001229 | Ga0182006_10012297 | 544 |
| 787 | 3300015265 | Ga0182005_1001110 | Ga0182005_10011103 | 544 |
| 788 | 3300020069 | Ga0197907_10862894 | Ga0197907_108628942 | 544 |
| 789 | 3300025224 | Ga0209784_100013 | Ga0209784_10001353 | 544 |
| 790 | 3300025226 | Ga0209674_100062 | Ga0209674_100062216 | 544 |
| 791 | 3300025228 | Ga0209672_100743 | Ga0209672_10074311 | 544 |
| 792 | 3300025231 | Ga0207427_100021 | Ga0207427_100021145 | 544 |
| 793 | 3300025231 | Ga0207427_100073 | Ga0207427_10007353 | 544 |
| 794 | 3300025233 | Ga0209437_100012 | Ga0209437_100012373 | 544 |
| 795 | 3300025233 | Ga0209437_100087 | Ga0209437_100087145 | 544 |
| 796 | 3300025233 | Ga0209437_100159 | Ga0209437_100159127 | 544 |
| 797 | 3300025242 | Ga0209258_100019 | Ga0209258_100019486 | 544 |
| 798 | 3300025242 | Ga0209258_100206 | Ga0209258_10020693 | 544 |
| 799 | 3300025242 | Ga0209258_102146 | Ga0209258_1021464 | 544 |
| 800 | 3300025246 | Ga0209646_1001828 | Ga0209646_10018281 | 544 |
| 801 | 3300025250 | Ga0209026_1000125 | Ga0209026_100012559 | 544 |
| 802 | 3300025250 | Ga0209026_1000592 | Ga0209026_100059212 | 544 |
| 803 | 3300025250 | Ga0209026_1002773 | Ga0209026_10027733 | 544 |
| 804 | 3300025254 | Ga0209148_1000001 | Ga0209148_10000011815 | 544 |
| 805 | 3300025254 | Ga0209148_1000005 | Ga0209148_1000005563 | 544 |
| 806 | 3300025254 | Ga0209148_1000176 | Ga0209148_1000176102 | 544 |
| 807 | 3300025256 | Ga0209759_1000145 | Ga0209759_100014510 | 544 |
| 808 | 3300025256 | Ga0209759_1000328 | Ga0209759_10003283 | 544 |
| 809 | 3300025256 | Ga0209759_1005371 | Ga0209759_10053713 | 544 |
| 810 | 3300025261 | Ga0209233_1000002 | Ga0209233_1000002416 | 544 |
| 811 | 3300025261 | Ga0209233_1000023 | Ga0209233_1000023478 | 544 |
| 812 | 3300025272 | Ga0209455_1000027 | Ga0209455_100002759 | 544 |
| 813 | 3300025272 | Ga0209455_1000081 | Ga0209455_1000081215 | 544 |
| 814 | 3300025909 | Ga0207705_10001403 | Ga0207705_100014039 | 544 |
| 815 | 3300025913 | Ga0207695_10007085 | Ga0207695_100070852 | 544 |
| 816 | 3300025917 | Ga0207660_10005061 | Ga0207660_100050617 | 544 |
| 817 | 3300025936 | Ga0207670_10005060 | Ga0207670_100050602 | 544 |
| 818 | 3300028381 | Ga0268264_10069503 | Ga0268264_100695032 | 544 |
| 819 | 3300031911 | Ga0307412_10006145 | Ga0307412_100061451 | 544 |
| 820 | 3300037466 | Ga0395898_0001079 | Ga0395898_0001079_419_2089 | 544 |
| 821 | 3300041404 | Ga0439436_0000010 | Ga0439436_0000010_62101_63771 | 544 |
| 822 | 3300041413 | Ga0439465_0000123 | Ga0439465_0000123_13897_15567 | 544 |
| 823 | 3300042184 | Ga0450908_000564 | Ga0450908_000564_2376_4046 | 544 |
| 824 | 3300044693 | Ga0466961_0091704 | Ga0466961_0091704_222_1892 | 544 |
| 825 | 3300046460 | Ga0495638_0001504 | Ga0495638_0001504_6003_7673 | 544 |
| 826 | 3300046460 | Ga0495638_0005088 | Ga0495638_0005088_6061_7731 | 544 |
| 827 | 3300046471 | Ga0495650_0000209 | Ga0495650_0000209_52611_54281 | 544 |
| 828 | 3300046501 | Ga0495607_0000080 | Ga0495607_0000080_2983_4653 | 544 |
| 829 | 3300046660 | Ga0495625_0024027 | Ga0495625_0024027_2949_4619 | 544 |
| 830 | 3300046694 | Ga0495649_0015980 | Ga0495649_0015980_1331_3001 | 544 |
| 831 | 3300048909 | Ga0496106_0014736 | Ga0496106_0014736_2182_3852 | 544 |
| 832 | 3300048918 | Ga0496115_0038116 | Ga0496115_0038116_1675_3345 | 544 |
| 833 | 3300048924 | Ga0496121_0000045 | Ga0496121_0000045_33897_35567 | 544 |
| 834 | 3300048924 | Ga0496121_0029782 | Ga0496121_0029782_91_1761 | 544 |
| 835 | 3300049580 | Ga0501046_0012062 | Ga0501046_0012062_235_1908 | 544 |
| 836 | 3300049823 | Ga0501044_0007144 | Ga0501044_0007144_28_1701 | 544 |
| 837 | 3300055283 | Ga0500661_005416 | Ga0500661_005416_110_1780 | 544 |
| 838 | iso_pu_bacteria | 2919085039 | 2919087871 | 544 |
| 839 | iso_pu_bacteria | 2928963466 | 2928967501 | 544 |
| 840 | 3300001915 | JGI24741J21665_1009606 | JGI24741J21665_10096061 | 545 |
| 841 | 3300001979 | JGI24740J21852_10004853 | JGI24740J21852_100048537 | 545 |
| 842 | 3300003320 | rootH2_10092143 | rootH2_100921433 | 545 |
| 843 | 3300003759 | Ga0055525_1000146 | Ga0055525_100014661 | 545 |
| 844 | 3300003760 | Ga0055527_1000328 | Ga0055527_100032819 | 545 |
| 845 | 3300003761 | Ga0055535_1000745 | Ga0055535_100074519 | 545 |
| 846 | 3300003762 | Ga0055542_1000765 | Ga0055542_100076518 | 545 |
| 847 | 3300003762 | Ga0055542_1000856 | Ga0055542_10008564 | 545 |
| 848 | 3300003763 | Ga0055529_1000663 | Ga0055529_10006633 | 545 |
| 849 | 3300005336 | Ga0070680_100008297 | Ga0070680_1000082974 | 545 |
| 850 | 3300005337 | Ga0070682_100008145 | Ga0070682_1000081457 | 545 |
| 851 | 3300005345 | Ga0070692_10001873 | Ga0070692_100018737 | 545 |
| 852 | 3300005366 | Ga0070659_100007436 | Ga0070659_1000074364 | 545 |
| 853 | 3300005455 | Ga0070663_100069432 | Ga0070663_1000694322 | 545 |
| 854 | 3300005458 | Ga0070681_10017636 | Ga0070681_100176367 | 545 |
| 855 | 3300005530 | Ga0070679_100016456 | Ga0070679_1000164563 | 545 |
| 856 | 3300005546 | Ga0070696_100001442 | Ga0070696_10000144211 | 545 |
| 857 | 3300005547 | Ga0070693_100004059 | Ga0070693_1000040591 | 545 |
| 858 | 3300005563 | Ga0068855_100020753 | Ga0068855_1000207534 | 545 |
| 859 | 3300005578 | Ga0068854_100007127 | Ga0068854_1000071273 | 545 |
| 860 | 3300005578 | Ga0068854_100010098 | Ga0068854_1000100983 | 545 |
| 861 | 3300005834 | Ga0068851_10004998 | Ga0068851_100049983 | 545 |
| 862 | 3300009093 | Ga0105240_10043064 | Ga0105240_100430642 | 545 |
| 863 | 3300009093 | Ga0105240_10049909 | Ga0105240_100499094 | 545 |
| 864 | 3300009093 | Ga0105240_10063542 | Ga0105240_100635421 | 545 |
| 865 | 3300009174 | Ga0105241_10042237 | Ga0105241_100422372 | 545 |
| 866 | 3300009551 | Ga0105238_10097547 | Ga0105238_100975472 | 545 |
| 867 | 3300010375 | Ga0105239_10000063 | Ga0105239_10000063109 | 545 |
| 868 | 3300013100 | Ga0157373_10022169 | Ga0157373_100221692 | 545 |
| 869 | 3300013102 | Ga0157371_10010486 | Ga0157371_100104862 | 545 |
| 870 | 3300013102 | Ga0157371_10028762 | Ga0157371_100287624 | 545 |
| 871 | 3300013104 | Ga0157370_10010813 | Ga0157370_100108134 | 545 |
| 872 | 3300014497 | Ga0182008_10026014 | Ga0182008_100260142 | 545 |
| 873 | 3300015685 | Ga0183369_1006 | Ga0183369_100690 | 545 |
| 874 | 3300020069 | Ga0197907_11474155 | Ga0197907_114741552 | 545 |
| 875 | 3300020070 | Ga0206356_10168839 | Ga0206356_101688395 | 545 |
| 876 | 3300020077 | Ga0206351_10908139 | Ga0206351_109081392 | 545 |
| 877 | 3300025228 | Ga0209672_100007 | Ga0209672_100007589 | 545 |
| 878 | 3300025228 | Ga0209672_100839 | Ga0209672_1008399 | 545 |
| 879 | 3300025230 | Ga0209563_100131 | Ga0209563_10013127 | 545 |
| 880 | 3300025242 | Ga0209258_100017 | Ga0209258_100017230 | 545 |
| 881 | 3300025242 | Ga0209258_100594 | Ga0209258_1005948 | 545 |
| 882 | 3300025254 | Ga0209148_1000044 | Ga0209148_1000044231 | 545 |
| 883 | 3300025254 | Ga0209148_1000185 | Ga0209148_100018597 | 545 |
| 884 | 3300025272 | Ga0209455_1000010 | Ga0209455_1000010589 | 545 |
| 885 | 3300025321 | Ga0207656_10001780 | Ga0207656_100017806 | 545 |
| 886 | 3300025904 | Ga0207647_10000607 | Ga0207647_1000060719 | 545 |
| 887 | 3300025904 | Ga0207647_10001539 | Ga0207647_100015397 | 545 |
| 888 | 3300025909 | Ga0207705_10000353 | Ga0207705_100003537 | 545 |
| 889 | 3300025909 | Ga0207705_10000355 | Ga0207705_1000035533 | 545 |
| 890 | 3300025912 | Ga0207707_10000391 | Ga0207707_1000039137 | 545 |
| 891 | 3300025912 | Ga0207707_10001033 | Ga0207707_1000103310 | 545 |
| 892 | 3300025912 | Ga0207707_10001308 | Ga0207707_1000130814 | 545 |
| 893 | 3300025912 | Ga0207707_10010325 | Ga0207707_100103254 | 545 |
| 894 | 3300025912 | Ga0207707_10012035 | Ga0207707_100120353 | 545 |
| 895 | 3300025912 | Ga0207707_10046729 | Ga0207707_100467293 | 545 |
| 896 | 3300025913 | Ga0207695_10011615 | Ga0207695_1001161514 | 545 |
| 897 | 3300025913 | Ga0207695_10012347 | Ga0207695_100123477 | 545 |
| 898 | 3300025913 | Ga0207695_10031715 | Ga0207695_100317153 | 545 |
| 899 | 3300025913 | Ga0207695_10046563 | Ga0207695_100465631 | 545 |
| 900 | 3300025913 | Ga0207695_10087165 | Ga0207695_100871652 | 545 |
| 901 | 3300025917 | Ga0207660_10000931 | Ga0207660_1000093111 | 545 |
| 902 | 3300025917 | Ga0207660_10001391 | Ga0207660_100013919 | 545 |
| 903 | 3300025917 | Ga0207660_10003395 | Ga0207660_100033957 | 545 |
| 904 | 3300025920 | Ga0207649_10005594 | Ga0207649_100055945 | 545 |
| 905 | 3300025921 | Ga0207652_10000030 | Ga0207652_1000003076 | 545 |
| 906 | 3300025921 | Ga0207652_10001197 | Ga0207652_100011977 | 545 |
| 907 | 3300025921 | Ga0207652_10041489 | Ga0207652_100414892 | 545 |
| 908 | 3300025932 | Ga0207690_10001946 | Ga0207690_100019467 | 545 |
| 909 | 3300025944 | Ga0207661_10004417 | Ga0207661_100044177 | 545 |
| 910 | 3300025949 | Ga0207667_10000679 | Ga0207667_100006797 | 545 |
| 911 | 3300025949 | Ga0207667_10016516 | Ga0207667_100165167 | 545 |
| 912 | 3300025981 | Ga0207640_10003830 | Ga0207640_100038308 | 545 |
| 913 | 3300026041 | Ga0207639_10005666 | Ga0207639_100056667 | 545 |
| 914 | 3300026067 | Ga0207678_10050893 | Ga0207678_100508932 | 545 |
| 915 | 3300026078 | Ga0207702_10003531 | Ga0207702_100035317 | 545 |
| 916 | 3300026116 | Ga0207674_10019944 | Ga0207674_100199447 | 545 |
| 917 | 3300026142 | Ga0207698_10002980 | Ga0207698_100029804 | 545 |
| 918 | 3300037312 | Ga0395899_0022754 | Ga0395899_0022754_793_2466 | 545 |
| 919 | 3300044693 | Ga0466961_0007963 | Ga0466961_0007963_1253_2926 | 545 |
| 920 | 3300045976 | Ga0466967_0041735 | Ga0466967_0041735_1808_3481 | 545 |
| 921 | 3300048904 | Ga0496101_0016866 | Ga0496101_0016866_60_1733 | 545 |
| 922 | 3300048918 | Ga0496115_0013485 | Ga0496115_0013485_2134_3807 | 545 |
| 923 | 3300048920 | Ga0496117_0009952 | Ga0496117_0009952_2721_4433 | 545 |
| 924 | 3300048920 | Ga0496117_0020923 | Ga0496117_0020923_11_1684 | 545 |
| 925 | 3300048921 | Ga0496118_0000848 | Ga0496118_0000848_21751_23463 | 545 |
| 926 | 3300048921 | Ga0496118_0017635 | Ga0496118_0017635_3695_5368 | 545 |
| 927 | 3300048922 | Ga0496119_0021762 | Ga0496119_0021762_135_1808 | 545 |
| 928 | 3300048923 | Ga0496120_0004293 | Ga0496120_0004293_1266_2939 | 545 |
| 929 | 3300048924 | Ga0496121_0009184 | Ga0496121_0009184_6974_8647 | 545 |
| 930 | 3300048929 | Ga0496126_0003384 | Ga0496126_0003384_15131_16804 | 545 |
| 931 | 3300048929 | Ga0496126_0060008 | Ga0496126_0060008_191_1864 | 545 |
| 932 | 3300049570 | Ga0501033_0001508 | Ga0501033_0001508_2563_4245 | 545 |
| 933 | 3300049570 | Ga0501033_0032897 | Ga0501033_0032897_2131_3804 | 545 |
| 934 | 3300049571 | Ga0501034_0032668 | Ga0501034_0032668_2099_3772 | 545 |
| 935 | 3300049572 | Ga0501036_0035985 | Ga0501036_0035985_1962_3635 | 545 |
| 936 | 3300049573 | Ga0501037_0006927 | Ga0501037_0006927_1791_3473 | 545 |
| 937 | 3300049573 | Ga0501037_0012184 | Ga0501037_0012184_1723_3396 | 545 |
| 938 | 3300049573 | Ga0501037_0033049 | Ga0501037_0033049_1652_3325 | 545 |
| 939 | 3300049574 | Ga0501038_0026037 | Ga0501038_0026037_2383_4065 | 545 |
| 940 | 3300049579 | Ga0501043_0019418 | Ga0501043_0019418_605_2278 | 545 |
| 941 | 3300049580 | Ga0501046_0022811 | Ga0501046_0022811_1382_3061 | 545 |
| 942 | 3300049581 | Ga0501047_0015450 | Ga0501047_0015450_4432_6105 | 545 |
| 943 | 3300049582 | Ga0501048_0055113 | Ga0501048_0055113_590_2272 | 545 |
| 944 | 3300049586 | Ga0501070_0013738 | Ga0501070_0013738_1534_3207 | 545 |
| 945 | 3300049586 | Ga0501070_0018995 | Ga0501070_0018995_2785_4461 | 545 |
| 946 | 3300049586 | Ga0501070_0023611 | Ga0501070_0023611_887_2560 | 545 |
| 947 | 3300049589 | Ga0501073_0005507 | Ga0501073_0005507_2915_4597 | 545 |
| 948 | 3300049822 | Ga0501035_0003148 | Ga0501035_0003148_12719_14392 | 545 |
| 949 | 3300049822 | Ga0501035_0019320 | Ga0501035_0019320_2357_4030 | 545 |
| 950 | 3300049822 | Ga0501035_0022285 | Ga0501035_0022285_2938_4611 | 545 |
| 951 | 3300049822 | Ga0501035_0025947 | Ga0501035_0025947_3321_4994 | 545 |
| 952 | 3300049822 | Ga0501035_0141934 | Ga0501035_0141934_60_1733 | 545 |
| 953 | 3300049823 | Ga0501044_0041271 | Ga0501044_0041271_2392_4065 | 545 |
| 954 | 3300049823 | Ga0501044_0121429 | Ga0501044_0121429_472_2145 | 545 |
| 955 | iso_pu_bacteria | 2939611941 | 2939611992 | 545 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5h66-assembly1.cif.gz_A | crystal structure of the bacillus subtilis smc head domain complexed with the cognate scpa c-terminal domain | 0.8473 | 2 | 120 |
| 1xew-assembly1.cif.gz_X | structural biochemistry of atp-driven dimerization and dna stimulated activation of smc atpases. | 0.8441 | 2 | 120 |
| 5h67-assembly1.cif.gz_A | crystal structure of the bacillus subtilis smc head domain complexed with the cognate scpa c-terminal domain and soaked atp | 0.8371 | 2 | 120 |
| 3kta-assembly2.cif.gz_C | structural basis for adenylate kinase activity in abc atpases | 0.8346 | 2 | 120 |
| 1xex-assembly1.cif.gz_A-2 | structural biochemistry of atp-driven dimerization and dna stimulated activation of smc atpases. | 0.8225 | 2 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9LFS8_23_178_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.854 | 4 | 120 | 3.40.50.300 |
| 5h66A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8473 | 2 | 120 | 3.40.50.300 |
| af_Q8IPT2_15_211_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8425 | 1 | 123 | 3.40.50.300 |
| af_P0A7H0_3_104_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8396 | 2 | 113 | 3.40.50.300 |
| af_A0A1D6GTS1_30_224_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8381 | 1 | 120 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C2K5X3-F1-model_v4 | DNA repair protein RecN (Recombination protein N) | 0.9861 | 1 | 124 |
GO:0005524
GO:0006302 GO:0006310 GO:0009432 GO:0016887 GO:0043590 |
| AF-A0A7C2K5X3-F1-model_v4 | DNA repair protein RecN (Recombination protein N) | 0.9783 | 1 | 124 |
GO:0005524
GO:0006302 GO:0006310 GO:0009432 GO:0016887 GO:0043590 |
| AF-F7K175-F1-model_v4 | DNA repair protein RecN (Recombination protein N) | 0.9766 | 442 | 542 |
GO:0005524
GO:0006281 GO:0006310 GO:0009432 GO:0043590 |
| AF-M6T6B3-F1-model_v4 | deleted | 0.9735 | 442 | 544 |
|
| AF-A0A3D5NK97-F1-model_v4 | DNA repair protein RecN (Recombination protein N) | 0.9729 | 1 | 115 |
GO:0005524
GO:0006302 GO:0006310 GO:0009432 GO:0016887 GO:0043590 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar