F486681
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 954 | 563 | 774 | 151 |
Family's Representative Sequence
| Representative Sequence | 3300041486|Ga0451807_2537906|Ga0451807_2537906_139_660 |
| Length | 173 |
| Sequence | MTANRVIVHTDGACSGNPGPGGWGAILDFNGTRKELSGGEAETTNNRMELMGAIAALESLKRPCKVEMHVDSNYVKDGITKWIHGWKRNGWKTADKKPVKNVELWQRLDAALATHDISWHWVKGHAGHNENERADELARQGMEPFKRKPESSAAGDEPGKLRAVPSQRRRPTR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 9 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 10 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 11 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 12 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 13 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 14 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 15 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 16 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 17 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 18 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 19 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 20 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 21 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 22 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 23 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 24 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 25 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 26 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 27 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 28 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 29 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 30 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 31 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 32 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 33 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 34 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 35 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 36 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 37 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 38 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 39 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 40 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 41 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 42 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 43 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 44 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 45 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 46 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 47 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 48 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 49 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 50 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 51 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 52 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 53 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 54 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 55 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 56 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 57 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 58 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 59 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 60 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 61 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 62 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 63 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 64 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 65 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 66 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 67 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 68 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 69 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 70 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 71 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 72 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 73 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 74 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 75 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 76 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 77 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 78 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 79 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 80 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 81 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 82 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 83 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 84 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 85 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 86 | 2922368715 | |||
| 87 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 88 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 89 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 90 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 91 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 92 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 93 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 94 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 95 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 96 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 97 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 98 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 99 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 100 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 101 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 102 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 103 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 104 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 105 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 106 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 107 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 108 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 109 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 110 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 111 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 112 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 113 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 114 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 115 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 116 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 117 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 118 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 119 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 120 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 121 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 122 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 123 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 124 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 125 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 126 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 127 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 128 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 129 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 130 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 131 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 132 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 133 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 134 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 135 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 136 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 137 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 138 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 139 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 140 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 141 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 142 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 143 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 144 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 145 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 146 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 147 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 148 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 149 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 150 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 151 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 152 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 153 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 154 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 155 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 156 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 157 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 158 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 159 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 160 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 161 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 162 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 163 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 164 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 165 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 166 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 167 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 168 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 169 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 172 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 173 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 177 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 178 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 179 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 181 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 182 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 183 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 185 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 186 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 189 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 193 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 194 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 195 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 196 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 198 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 199 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 201 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 202 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 203 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 206 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 208 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 209 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 210 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 211 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 212 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 213 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 214 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 215 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 216 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 217 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 218 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 219 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 220 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 221 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 222 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 223 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 224 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 225 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 226 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 227 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 229 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 230 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 231 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 233 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 234 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 235 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 239 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 242 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 243 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 244 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 245 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 246 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 247 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 248 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 249 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 250 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 252 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 253 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 254 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 255 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 256 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 257 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 258 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 259 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 260 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 261 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 262 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 263 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 264 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 265 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 266 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 267 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 268 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 269 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 270 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 271 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 274 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 276 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 277 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 326 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 327 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 328 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 329 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 333 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 334 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 335 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 336 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 337 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 338 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 339 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 340 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 341 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 342 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 343 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 344 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 345 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 346 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 347 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 348 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 349 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 350 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 351 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 352 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 353 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 354 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 355 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 356 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 357 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 358 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 359 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 360 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 361 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 362 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 363 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 364 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 365 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 366 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 367 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 368 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 369 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 370 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 371 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 372 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 373 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 374 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 375 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 376 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 377 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 378 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 379 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 380 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 381 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 382 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 383 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 384 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 385 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 386 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 387 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 388 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 389 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 390 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 391 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 392 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 393 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 394 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 395 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 396 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 397 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 398 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 399 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 400 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 401 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 402 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 403 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 404 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 405 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 406 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 407 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 408 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 409 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 410 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 411 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 412 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 413 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 468 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 469 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 470 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 471 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 472 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 473 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 474 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 475 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 476 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 477 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 478 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 479 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 480 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 481 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 482 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 483 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 484 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 485 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 486 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 487 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 488 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 489 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 490 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 491 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 493 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 495 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 496 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 498 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 499 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 500 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 501 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 502 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 503 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 504 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 505 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 506 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 507 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 508 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 509 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 510 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 511 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 512 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 514 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 515 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 516 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 517 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 518 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 519 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 520 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 521 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 522 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 523 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 524 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 525 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 526 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 527 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 528 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 529 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 530 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 531 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 532 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 533 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 534 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 535 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 536 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 537 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 538 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 539 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 540 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 541 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 542 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 543 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 544 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 545 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 546 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 547 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 548 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 549 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 550 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 551 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 552 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 553 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 554 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 555 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 556 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 557 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 558 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 559 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 560 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 561 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 562 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 563 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.22 |
| Metatranscriptomes | 0 |
| Isolates | 18.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.81 |
| Nodule | 14.36 |
| Rhizoplane | 4.19 |
| Rhizosphere | 62.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1004541 | 3300001904 | Bacteria | 2367 |
| 2 | JGI24739J22299_10135061 | 3300001989 | Bacteria | 733 |
| 3 | JGI24737J22298_10001915 | 3300001990 | Bacteria | 7439 |
| 4 | JGI24737J22298_10086620 | 3300001990 | Bacteria | 930 |
| 5 | JGI24735J21928_10073188 | 3300002067 | Bacteria | 982 |
| 6 | JGI24738J21930_10011146 | 3300002075 | Bacteria | 1984 |
| 7 | JGI24034J26672_10016294 | 3300002239 | Bacteria | 1144 |
| 8 | JGI25165J46597_1015826 | 3300003214 | Bacteria | 1015 |
| 9 | JGI25153J46596_10015174 | 3300003215 | Bacteria | 3155 |
| 10 | rootH2_10047961 | 3300003320 | Bacteria | 3753 |
| 11 | JGI25160J50197_1004791 | 3300003354 | Bacteria | 5771 |
| 12 | JGI25160J50197_1011588 | 3300003354 | Bacteria | 3115 |
| 13 | Ga0055539_1009214 | 3300003752 | Bacteria | 1228 |
| 14 | Ga0055525_1006348 | 3300003759 | Bacteria | 1001 |
| 15 | Ga0055542_1015905 | 3300003762 | Bacteria | 1197 |
| 16 | Ga0055543_1009168 | 3300004625 | Bacteria | 2145 |
| 17 | Ga0065165_1001357 | 3300005262 | Bacteria | 27011 |
| 18 | Ga0065165_1004030 | 3300005262 | Bacteria | 9567 |
| 19 | Ga0065165_1032860 | 3300005262 | Bacteria | 1622 |
| 20 | Ga0065165_1118997 | 3300005262 | Bacteria | 643 |
| 21 | Ga0065704_10334546 | 3300005289 | Bacteria | 833 |
| 22 | Ga0070658_10000183 | 3300005327 | Bacteria | 54970 |
| 23 | Ga0070658_10022485 | 3300005327 | Bacteria | 5060 |
| 24 | Ga0070658_10404775 | 3300005327 | Bacteria | 1172 |
| 25 | Ga0070676_10900506 | 3300005328 | Bacteria | 659 |
| 26 | Ga0070683_100001584 | 3300005329 | Bacteria | 17600 |
| 27 | Ga0070683_100022475 | 3300005329 | Bacteria | 5636 |
| 28 | Ga0070683_100185701 | 3300005329 | Bacteria | 1974 |
| 29 | Ga0070683_101014406 | 3300005329 | Bacteria | 797 |
| 30 | Ga0070683_101811015 | 3300005329 | Bacteria | 587 |
| 31 | Ga0070690_100029491 | 3300005330 | Bacteria | 3404 |
| 32 | Ga0070670_100305865 | 3300005331 | Bacteria | 1391 |
| 33 | Ga0070670_101316187 | 3300005331 | Bacteria | 661 |
| 34 | Ga0070677_10085901 | 3300005333 | Bacteria | 1358 |
| 35 | Ga0070677_10091344 | 3300005333 | Bacteria | 1325 |
| 36 | Ga0070666_10353594 | 3300005335 | Bacteria | 1052 |
| 37 | Ga0070666_11107799 | 3300005335 | Bacteria | 589 |
| 38 | Ga0070666_11122019 | 3300005335 | Bacteria | 585 |
| 39 | Ga0070680_100281164 | 3300005336 | Bacteria | 1410 |
| 40 | Ga0070680_100559481 | 3300005336 | Bacteria | 980 |
| 41 | Ga0070680_101620926 | 3300005336 | Bacteria | 561 |
| 42 | Ga0070682_100020796 | 3300005337 | Bacteria | 3866 |
| 43 | Ga0068868_100055747 | 3300005338 | Bacteria | 3120 |
| 44 | Ga0070660_100000355 | 3300005339 | Bacteria | 30584 |
| 45 | Ga0070660_100095126 | 3300005339 | Bacteria | 2354 |
| 46 | Ga0070660_100659182 | 3300005339 | Bacteria | 877 |
| 47 | Ga0070689_100109545 | 3300005340 | Bacteria | 2195 |
| 48 | Ga0070689_101009126 | 3300005340 | Bacteria | 741 |
| 49 | Ga0070691_10098784 | 3300005341 | Bacteria | 1447 |
| 50 | Ga0070687_100827379 | 3300005343 | Bacteria | 658 |
| 51 | Ga0070661_100000485 | 3300005344 | Bacteria | 30409 |
| 52 | Ga0070661_100571415 | 3300005344 | Bacteria | 912 |
| 53 | Ga0070692_10066185 | 3300005345 | Bacteria | 1915 |
| 54 | Ga0070668_100020232 | 3300005347 | Bacteria | 5021 |
| 55 | Ga0070668_100048002 | 3300005347 | Bacteria | 3283 |
| 56 | Ga0070668_100210272 | 3300005347 | Bacteria | 1600 |
| 57 | Ga0070669_100012194 | 3300005353 | Bacteria | 6101 |
| 58 | Ga0070669_100580157 | 3300005353 | Bacteria | 938 |
| 59 | Ga0070675_100194941 | 3300005354 | Bacteria | 1757 |
| 60 | Ga0070671_100057964 | 3300005355 | Bacteria | 3224 |
| 61 | Ga0070671_100147617 | 3300005355 | Bacteria | 1985 |
| 62 | Ga0070671_100381490 | 3300005355 | Bacteria | 1205 |
| 63 | Ga0070659_100000643 | 3300005366 | Bacteria | 25509 |
| 64 | Ga0070667_100012808 | 3300005367 | Bacteria | 6931 |
| 65 | Ga0070667_100601515 | 3300005367 | Bacteria | 1013 |
| 66 | Ga0070714_100013505 | 3300005435 | Bacteria | 6546 |
| 67 | Ga0070714_100027645 | 3300005435 | Bacteria | 4699 |
| 68 | Ga0070714_100090791 | 3300005435 | Bacteria | 2676 |
| 69 | Ga0070713_100620875 | 3300005436 | Bacteria | 1028 |
| 70 | Ga0070700_100142070 | 3300005441 | Bacteria | 1633 |
| 71 | Ga0070663_100013584 | 3300005455 | Bacteria | 5197 |
| 72 | Ga0070663_100020640 | 3300005455 | Bacteria | 4364 |
| 73 | Ga0070663_100146941 | 3300005455 | Bacteria | 1804 |
| 74 | Ga0070663_100448900 | 3300005455 | Bacteria | 1062 |
| 75 | Ga0070678_100892300 | 3300005456 | Bacteria | 812 |
| 76 | Ga0070662_100000837 | 3300005457 | Bacteria | 18934 |
| 77 | Ga0070662_100022242 | 3300005457 | Bacteria | 4337 |
| 78 | Ga0070662_100220015 | 3300005457 | Bacteria | 1515 |
| 79 | Ga0070662_100258418 | 3300005457 | Bacteria | 1402 |
| 80 | Ga0070681_10070870 | 3300005458 | Bacteria | 3450 |
| 81 | Ga0070681_10512761 | 3300005458 | Bacteria | 1112 |
| 82 | Ga0070698_100007138 | 3300005471 | Bacteria | 12099 |
| 83 | Ga0070698_100276496 | 3300005471 | Bacteria | 1611 |
| 84 | Ga0070699_100606401 | 3300005518 | Bacteria | 998 |
| 85 | Ga0070679_100033899 | 3300005530 | Bacteria | 5057 |
| 86 | Ga0070679_100102543 | 3300005530 | Bacteria | 2847 |
| 87 | Ga0070679_100357835 | 3300005530 | Bacteria | 1407 |
| 88 | Ga0070684_100033048 | 3300005535 | Bacteria | 4414 |
| 89 | Ga0070684_100511943 | 3300005535 | Bacteria | 1112 |
| 90 | Ga0070684_101501222 | 3300005535 | Bacteria | 635 |
| 91 | Ga0068853_100001045 | 3300005539 | Bacteria | 19580 |
| 92 | Ga0068853_100602905 | 3300005539 | Bacteria | 1043 |
| 93 | Ga0068853_100708167 | 3300005539 | Bacteria | 961 |
| 94 | Ga0070693_100000320 | 3300005547 | Bacteria | 22053 |
| 95 | Ga0070693_100380447 | 3300005547 | Bacteria | 974 |
| 96 | Ga0070665_100014833 | 3300005548 | Bacteria | 7820 |
| 97 | Ga0070665_100118678 | 3300005548 | Bacteria | 2647 |
| 98 | Ga0070665_100161027 | 3300005548 | Bacteria | 2246 |
| 99 | Ga0068855_100001622 | 3300005563 | Bacteria | 28214 |
| 100 | Ga0068855_100175229 | 3300005563 | Bacteria | 2427 |
| 101 | Ga0068855_100194424 | 3300005563 | Bacteria | 2286 |
| 102 | Ga0068855_100263718 | 3300005563 | Bacteria | 1918 |
| 103 | Ga0068855_100672044 | 3300005563 | Bacteria | 1110 |
| 104 | Ga0070664_100000066 | 3300005564 | Bacteria | 65204 |
| 105 | Ga0070664_100222118 | 3300005564 | Bacteria | 1690 |
| 106 | Ga0070664_100833625 | 3300005564 | Bacteria | 863 |
| 107 | Ga0068857_100547766 | 3300005577 | Bacteria | 1090 |
| 108 | Ga0068857_100755357 | 3300005577 | Bacteria | 926 |
| 109 | Ga0068854_100028130 | 3300005578 | Bacteria | 3881 |
| 110 | Ga0068854_100818194 | 3300005578 | Bacteria | 813 |
| 111 | Ga0068856_100000213 | 3300005614 | Bacteria | 62582 |
| 112 | Ga0068856_100067312 | 3300005614 | Bacteria | 3539 |
| 113 | Ga0068856_100124240 | 3300005614 | Bacteria | 2583 |
| 114 | Ga0068856_100192467 | 3300005614 | Bacteria | 2053 |
| 115 | Ga0068856_100365959 | 3300005614 | Bacteria | 1461 |
| 116 | Ga0068856_100507150 | 3300005614 | Bacteria | 1227 |
| 117 | Ga0068852_100001507 | 3300005616 | Bacteria | 15764 |
| 118 | Ga0068852_100113240 | 3300005616 | Bacteria | 2470 |
| 119 | Ga0068852_100117200 | 3300005616 | Bacteria | 2431 |
| 120 | Ga0068852_100203957 | 3300005616 | Bacteria | 1872 |
| 121 | Ga0068852_100514613 | 3300005616 | Bacteria | 1193 |
| 122 | Ga0068859_100256143 | 3300005617 | Bacteria | 1841 |
| 123 | Ga0068864_100203722 | 3300005618 | Bacteria | 1819 |
| 124 | Ga0068864_100846111 | 3300005618 | Bacteria | 901 |
| 125 | Ga0068851_10037958 | 3300005834 | Bacteria | 2416 |
| 126 | Ga0068851_10598626 | 3300005834 | Bacteria | 671 |
| 127 | Ga0068863_100114135 | 3300005841 | Bacteria | 2573 |
| 128 | Ga0068863_100137145 | 3300005841 | Bacteria | 2338 |
| 129 | Ga0068858_100045278 | 3300005842 | Bacteria | 4077 |
| 130 | Ga0068858_100564543 | 3300005842 | Bacteria | 1102 |
| 131 | Ga0068858_101437046 | 3300005842 | Bacteria | 680 |
| 132 | Ga0068860_100152170 | 3300005843 | Bacteria | 2228 |
| 133 | Ga0068860_100836286 | 3300005843 | Bacteria | 935 |
| 134 | Ga0068862_101015754 | 3300005844 | Bacteria | 821 |
| 135 | Ga0081540_1055324 | 3300005983 | Bacteria | 1933 |
| 136 | Ga0081539_10014344 | 3300005985 | Bacteria | 5870 |
| 137 | Ga0075365_10078425 | 3300006038 | Bacteria | 2233 |
| 138 | Ga0075365_10105795 | 3300006038 | Bacteria | 1930 |
| 139 | Ga0075368_10006046 | 3300006042 | Bacteria | 4204 |
| 140 | Ga0075363_100037487 | 3300006048 | Bacteria | 2546 |
| 141 | Ga0075364_10103276 | 3300006051 | Bacteria | 1898 |
| 142 | Ga0075362_10283695 | 3300006177 | Bacteria | 819 |
| 143 | Ga0075367_10038912 | 3300006178 | Bacteria | 2771 |
| 144 | Ga0075367_10067056 | 3300006178 | Bacteria | 2151 |
| 145 | Ga0075367_10143533 | 3300006178 | Bacteria | 1480 |
| 146 | Ga0075366_10004819 | 3300006195 | Bacteria | 7278 |
| 147 | Ga0075366_10039337 | 3300006195 | Bacteria | 2796 |
| 148 | Ga0075366_10138911 | 3300006195 | Bacteria | 1468 |
| 149 | Ga0097621_100656091 | 3300006237 | Bacteria | 963 |
| 150 | Ga0075370_10108273 | 3300006353 | Bacteria | 1612 |
| 151 | Ga0068871_100136449 | 3300006358 | Bacteria | 2084 |
| 152 | Ga0068871_100209360 | 3300006358 | Bacteria | 1686 |
| 153 | Ga0075428_100025030 | 3300006844 | Bacteria | 6603 |
| 154 | Ga0097620_100256150 | 3300006931 | Bacteria | 1841 |
| 155 | Ga0099825_1024608 | 3300006941 | Bacteria | 3486 |
| 156 | Ga0099823_1028009 | 3300006944 | Bacteria | 4872 |
| 157 | Ga0099794_10285402 | 3300007265 | Bacteria | 854 |
| 158 | Ga0105250_10168572 | 3300009092 | Bacteria | 916 |
| 159 | Ga0105240_10001688 | 3300009093 | Bacteria | 37384 |
| 160 | Ga0105240_10002991 | 3300009093 | Bacteria | 26588 |
| 161 | Ga0105240_10018058 | 3300009093 | Bacteria | 9486 |
| 162 | Ga0105240_10062267 | 3300009093 | Bacteria | 4646 |
| 163 | Ga0105240_10064329 | 3300009093 | Bacteria | 4558 |
| 164 | Ga0105240_10180852 | 3300009093 | Bacteria | 2488 |
| 165 | Ga0111539_10113875 | 3300009094 | Bacteria | 3172 |
| 166 | Ga0105245_10037226 | 3300009098 | Bacteria | 4326 |
| 167 | Ga0105245_10140865 | 3300009098 | Bacteria | 2271 |
| 168 | Ga0105247_10075905 | 3300009101 | Bacteria | 2110 |
| 169 | Ga0114129_10191941 | 3300009147 | Bacteria | 2773 |
| 170 | Ga0114129_11433426 | 3300009147 | Bacteria | 851 |
| 171 | Ga0105243_10249558 | 3300009148 | Bacteria | 1584 |
| 172 | Ga0105241_10095345 | 3300009174 | Bacteria | 2355 |
| 173 | Ga0105241_10151116 | 3300009174 | Bacteria | 1900 |
| 174 | Ga0105241_10254547 | 3300009174 | Bacteria | 1490 |
| 175 | Ga0105241_10433901 | 3300009174 | Bacteria | 1159 |
| 176 | Ga0105241_11202462 | 3300009174 | Bacteria | 718 |
| 177 | Ga0105248_10001298 | 3300009177 | Bacteria | 27820 |
| 178 | Ga0105248_10037839 | 3300009177 | Bacteria | 5399 |
| 179 | Ga0105248_10135761 | 3300009177 | Bacteria | 2775 |
| 180 | Ga0105237_10180625 | 3300009545 | Bacteria | 2110 |
| 181 | Ga0105237_10943261 | 3300009545 | Bacteria | 870 |
| 182 | Ga0105238_10042157 | 3300009551 | Bacteria | 4622 |
| 183 | Ga0105238_10443089 | 3300009551 | Bacteria | 1295 |
| 184 | Ga0105238_10493878 | 3300009551 | Bacteria | 1224 |
| 185 | Ga0105238_10856888 | 3300009551 | Bacteria | 926 |
| 186 | Ga0105249_10179375 | 3300009553 | Bacteria | 2059 |
| 187 | Ga0105035_105232 | 3300009988 | Bacteria | 1047 |
| 188 | Ga0105239_10102315 | 3300010375 | Bacteria | 3170 |
| 189 | Ga0105239_10251449 | 3300010375 | Bacteria | 1985 |
| 190 | Ga0105239_10760939 | 3300010375 | Bacteria | 1109 |
| 191 | Ga0105239_11014354 | 3300010375 | Bacteria | 954 |
| 192 | Ga0105246_10291533 | 3300011119 | Bacteria | 1313 |
| 193 | Ga0157373_10062644 | 3300013100 | Bacteria | 2634 |
| 194 | Ga0157371_10038930 | 3300013102 | Bacteria | 3401 |
| 195 | Ga0157371_10110034 | 3300013102 | Bacteria | 1956 |
| 196 | Ga0157371_10347273 | 3300013102 | Bacteria | 1080 |
| 197 | Ga0157370_10566756 | 3300013104 | Bacteria | 1041 |
| 198 | Ga0157369_10008575 | 3300013105 | Bacteria | 11724 |
| 199 | Ga0157369_10186203 | 3300013105 | Bacteria | 2183 |
| 200 | Ga0157369_10310467 | 3300013105 | Bacteria | 1640 |
| 201 | Ga0157374_10171354 | 3300013296 | Bacteria | 2117 |
| 202 | Ga0157374_10265751 | 3300013296 | Bacteria | 1691 |
| 203 | Ga0157374_10332002 | 3300013296 | Bacteria | 1508 |
| 204 | Ga0157378_10365720 | 3300013297 | Bacteria | 1413 |
| 205 | Ga0157378_10590625 | 3300013297 | Bacteria | 1120 |
| 206 | Ga0163162_10310925 | 3300013306 | Bacteria | 1708 |
| 207 | Ga0157372_10619689 | 3300013307 | Bacteria | 1261 |
| 208 | Ga0157372_11528491 | 3300013307 | Bacteria | 769 |
| 209 | Ga0157372_11590858 | 3300013307 | Bacteria | 752 |
| 210 | Ga0163163_10000178 | 3300014325 | Bacteria | 65511 |
| 211 | Ga0163163_11709443 | 3300014325 | Bacteria | 690 |
| 212 | Ga0157380_12455849 | 3300014326 | Bacteria | 587 |
| 213 | Ga0157380_12781650 | 3300014326 | Bacteria | 556 |
| 214 | Ga0157379_10060043 | 3300014968 | Bacteria | 3399 |
| 215 | Ga0157379_10280107 | 3300014968 | Bacteria | 1517 |
| 216 | Ga0157379_10310164 | 3300014968 | Bacteria | 1439 |
| 217 | Ga0163161_10781217 | 3300017792 | Bacteria | 801 |
| 218 | Ga0163161_11183245 | 3300017792 | Bacteria | 660 |
| 219 | Ga0214544_1000003 | 3300021320 | Bacteria | 643752 |
| 220 | Ga0214542_1000022 | 3300021321 | Bacteria | 193578 |
| 221 | Ga0214545_1000010 | 3300021324 | Bacteria | 193578 |
| 222 | Ga0214543_1000035 | 3300021327 | Bacteria | 183100 |
| 223 | Ga0213872_10148620 | 3300021361 | Bacteria | 1025 |
| 224 | Ga0213876_10257779 | 3300021384 | Bacteria | 927 |
| 225 | Ga0213875_10165273 | 3300021388 | Bacteria | 1039 |
| 226 | Ga0209677_104648 | 3300025253 | Bacteria | 3878 |
| 227 | Ga0209148_1000300 | 3300025254 | Bacteria | 71458 |
| 228 | Ga0209233_1003105 | 3300025261 | Bacteria | 5910 |
| 229 | Ga0209455_1004466 | 3300025272 | Bacteria | 4570 |
| 230 | Ga0209564_1029846 | 3300025295 | Bacteria | 1704 |
| 231 | Ga0209758_1001432 | 3300025297 | Bacteria | 28196 |
| 232 | Ga0209758_1003439 | 3300025297 | Bacteria | 14405 |
| 233 | Ga0209758_1008335 | 3300025297 | Bacteria | 6752 |
| 234 | Ga0209758_1031443 | 3300025297 | Bacteria | 2176 |
| 235 | Ga0209758_1049226 | 3300025297 | Bacteria | 1490 |
| 236 | Ga0209256_1050558 | 3300025299 | Bacteria | 1007 |
| 237 | Ga0207426_1000271 | 3300025302 | Bacteria | 108392 |
| 238 | Ga0207426_1001014 | 3300025302 | Bacteria | 27217 |
| 239 | Ga0207426_1003388 | 3300025302 | Bacteria | 8739 |
| 240 | Ga0207697_10207181 | 3300025315 | Bacteria | 863 |
| 241 | Ga0207682_10013233 | 3300025893 | Bacteria | 3216 |
| 242 | Ga0207682_10050754 | 3300025893 | Bacteria | 1716 |
| 243 | Ga0207688_10110930 | 3300025901 | Bacteria | 1592 |
| 244 | Ga0207680_10000519 | 3300025903 | Bacteria | 18402 |
| 245 | Ga0207680_10366172 | 3300025903 | Bacteria | 1014 |
| 246 | Ga0207680_10480306 | 3300025903 | Bacteria | 884 |
| 247 | Ga0207680_11016604 | 3300025903 | Bacteria | 593 |
| 248 | Ga0207647_10032575 | 3300025904 | Bacteria | 3346 |
| 249 | Ga0207685_10289473 | 3300025905 | Bacteria | 807 |
| 250 | Ga0207705_10000101 | 3300025909 | Bacteria | 98231 |
| 251 | Ga0207705_10000234 | 3300025909 | Bacteria | 55024 |
| 252 | Ga0207654_10004047 | 3300025911 | Bacteria | 7381 |
| 253 | Ga0207654_10031377 | 3300025911 | Bacteria | 2925 |
| 254 | Ga0207654_10031955 | 3300025911 | Bacteria | 2903 |
| 255 | Ga0207654_10088027 | 3300025911 | Bacteria | 1886 |
| 256 | Ga0207654_10395276 | 3300025911 | Bacteria | 960 |
| 257 | Ga0207707_10054569 | 3300025912 | Bacteria | 3479 |
| 258 | Ga0207707_10449298 | 3300025912 | Bacteria | 1103 |
| 259 | Ga0207707_10656769 | 3300025912 | Bacteria | 883 |
| 260 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 261 | Ga0207695_10001211 | 3300025913 | Bacteria | 44223 |
| 262 | Ga0207695_10001322 | 3300025913 | Bacteria | 42020 |
| 263 | Ga0207695_10002104 | 3300025913 | Bacteria | 30252 |
| 264 | Ga0207695_10004934 | 3300025913 | Bacteria | 17978 |
| 265 | Ga0207695_10007864 | 3300025913 | Bacteria | 13466 |
| 266 | Ga0207695_10031813 | 3300025913 | Bacteria | 5781 |
| 267 | Ga0207695_10735192 | 3300025913 | Bacteria | 867 |
| 268 | Ga0207695_11352519 | 3300025913 | Bacteria | 592 |
| 269 | Ga0207671_10028139 | 3300025914 | Bacteria | 4202 |
| 270 | Ga0207671_10043531 | 3300025914 | Bacteria | 3320 |
| 271 | Ga0207660_10969376 | 3300025917 | Bacteria | 694 |
| 272 | Ga0207657_10000598 | 3300025919 | Bacteria | 38277 |
| 273 | Ga0207657_10429531 | 3300025919 | Bacteria | 1038 |
| 274 | Ga0207649_10000159 | 3300025920 | Bacteria | 54703 |
| 275 | Ga0207649_10000720 | 3300025920 | Bacteria | 21786 |
| 276 | Ga0207652_10047138 | 3300025921 | Bacteria | 3681 |
| 277 | Ga0207652_10075877 | 3300025921 | Bacteria | 2930 |
| 278 | Ga0207652_10491948 | 3300025921 | Bacteria | 1105 |
| 279 | Ga0207681_10635359 | 3300025923 | Bacteria | 884 |
| 280 | Ga0207694_10029327 | 3300025924 | Bacteria | 4199 |
| 281 | Ga0207694_10341424 | 3300025924 | Bacteria | 1238 |
| 282 | Ga0207694_10381028 | 3300025924 | Bacteria | 1171 |
| 283 | Ga0207694_11272716 | 3300025924 | Bacteria | 622 |
| 284 | Ga0207650_10073235 | 3300025925 | Bacteria | 2580 |
| 285 | Ga0207650_10411635 | 3300025925 | Bacteria | 1121 |
| 286 | Ga0207687_10386557 | 3300025927 | Bacteria | 1148 |
| 287 | Ga0207700_10070596 | 3300025928 | Bacteria | 2686 |
| 288 | Ga0207700_10194473 | 3300025928 | Bacteria | 1706 |
| 289 | Ga0207664_10111353 | 3300025929 | Bacteria | 2277 |
| 290 | Ga0207664_10236716 | 3300025929 | Bacteria | 1589 |
| 291 | Ga0207644_10011728 | 3300025931 | Bacteria | 5801 |
| 292 | Ga0207644_10070308 | 3300025931 | Bacteria | 2558 |
| 293 | Ga0207690_10000120 | 3300025932 | Bacteria | 65338 |
| 294 | Ga0207690_10005032 | 3300025932 | Bacteria | 7809 |
| 295 | Ga0207690_10609636 | 3300025932 | Bacteria | 892 |
| 296 | Ga0207690_10677336 | 3300025932 | Bacteria | 847 |
| 297 | Ga0207690_10930172 | 3300025932 | Bacteria | 722 |
| 298 | Ga0207706_10000143 | 3300025933 | Bacteria | 77680 |
| 299 | Ga0207706_10000200 | 3300025933 | Bacteria | 65947 |
| 300 | Ga0207706_10042793 | 3300025933 | Bacteria | 4014 |
| 301 | Ga0207706_10312484 | 3300025933 | Bacteria | 1368 |
| 302 | Ga0207686_10001391 | 3300025934 | Bacteria | 13750 |
| 303 | Ga0207709_10031989 | 3300025935 | Bacteria | 3078 |
| 304 | Ga0207709_10717838 | 3300025935 | Bacteria | 801 |
| 305 | Ga0207670_10624625 | 3300025936 | Bacteria | 886 |
| 306 | Ga0207665_10891855 | 3300025939 | Bacteria | 705 |
| 307 | Ga0207711_10001359 | 3300025941 | Bacteria | 23095 |
| 308 | Ga0207711_10026755 | 3300025941 | Bacteria | 4841 |
| 309 | Ga0207711_10141685 | 3300025941 | Bacteria | 2164 |
| 310 | Ga0207711_10240108 | 3300025941 | Bacteria | 1661 |
| 311 | Ga0207711_11081104 | 3300025941 | Bacteria | 743 |
| 312 | Ga0207689_10755469 | 3300025942 | Bacteria | 821 |
| 313 | Ga0207661_10033052 | 3300025944 | Bacteria | 4012 |
| 314 | Ga0207661_10050882 | 3300025944 | Bacteria | 3303 |
| 315 | Ga0207679_10000150 | 3300025945 | Bacteria | 57426 |
| 316 | Ga0207679_10185632 | 3300025945 | Bacteria | 1724 |
| 317 | Ga0207667_10000443 | 3300025949 | Bacteria | 55591 |
| 318 | Ga0207667_10022526 | 3300025949 | Bacteria | 6955 |
| 319 | Ga0207667_10088935 | 3300025949 | Bacteria | 3193 |
| 320 | Ga0207667_10097185 | 3300025949 | Bacteria | 3040 |
| 321 | Ga0207667_10199448 | 3300025949 | Bacteria | 2053 |
| 322 | Ga0207667_10370734 | 3300025949 | Bacteria | 1459 |
| 323 | Ga0207667_10458990 | 3300025949 | Bacteria | 1294 |
| 324 | Ga0207712_10733350 | 3300025961 | Bacteria | 864 |
| 325 | Ga0207668_10030734 | 3300025972 | Bacteria | 3532 |
| 326 | Ga0207668_10156908 | 3300025972 | Bacteria | 1769 |
| 327 | Ga0207640_10001958 | 3300025981 | Bacteria | 11089 |
| 328 | Ga0207640_10024896 | 3300025981 | Bacteria | 3617 |
| 329 | Ga0207640_11133151 | 3300025981 | Bacteria | 693 |
| 330 | Ga0207658_10010024 | 3300025986 | Bacteria | 6438 |
| 331 | Ga0207658_10264130 | 3300025986 | Bacteria | 1468 |
| 332 | Ga0207703_10259804 | 3300026035 | Bacteria | 1569 |
| 333 | Ga0207703_10325505 | 3300026035 | Bacteria | 1409 |
| 334 | Ga0207703_10526531 | 3300026035 | Bacteria | 1112 |
| 335 | Ga0207703_10908037 | 3300026035 | Bacteria | 843 |
| 336 | Ga0207703_11067623 | 3300026035 | Bacteria | 775 |
| 337 | Ga0207639_10004498 | 3300026041 | Bacteria | 9404 |
| 338 | Ga0207639_10176459 | 3300026041 | Bacteria | 1814 |
| 339 | Ga0207678_10001423 | 3300026067 | Bacteria | 21936 |
| 340 | Ga0207678_10003750 | 3300026067 | Bacteria | 13676 |
| 341 | Ga0207678_10188756 | 3300026067 | Bacteria | 1761 |
| 342 | Ga0207708_10180899 | 3300026075 | Bacteria | 1674 |
| 343 | Ga0207702_10001142 | 3300026078 | Bacteria | 27150 |
| 344 | Ga0207702_10115740 | 3300026078 | Bacteria | 2391 |
| 345 | Ga0207702_10115878 | 3300026078 | Bacteria | 2390 |
| 346 | Ga0207702_10207872 | 3300026078 | Bacteria | 1818 |
| 347 | Ga0207641_10134215 | 3300026088 | Bacteria | 2226 |
| 348 | Ga0207641_10184515 | 3300026088 | Bacteria | 1913 |
| 349 | Ga0207641_10611948 | 3300026088 | Bacteria | 1067 |
| 350 | Ga0207641_12429036 | 3300026088 | Bacteria | 523 |
| 351 | Ga0207676_10751265 | 3300026095 | Bacteria | 948 |
| 352 | Ga0207676_10769708 | 3300026095 | Bacteria | 937 |
| 353 | Ga0207674_10023598 | 3300026116 | Bacteria | 6586 |
| 354 | Ga0207674_10167492 | 3300026116 | Bacteria | 2151 |
| 355 | Ga0207675_101800732 | 3300026118 | Bacteria | 631 |
| 356 | Ga0207683_10841198 | 3300026121 | Bacteria | 852 |
| 357 | Ga0207698_10004252 | 3300026142 | Bacteria | 8710 |
| 358 | Ga0207698_10030363 | 3300026142 | Bacteria | 3885 |
| 359 | Ga0207698_10076081 | 3300026142 | Bacteria | 2685 |
| 360 | Ga0207698_10272416 | 3300026142 | Bacteria | 1561 |
| 361 | Ga0207698_10839487 | 3300026142 | Bacteria | 923 |
| 362 | Ga0207698_11873672 | 3300026142 | Bacteria | 615 |
| 363 | Ga0209389_1000198 | 3300027296 | Bacteria | 43300 |
| 364 | Ga0209489_101869 | 3300027361 | Bacteria | 43300 |
| 365 | Ga0209700_100029 | 3300027363 | Bacteria | 214607 |
| 366 | Ga0209813_10001368 | 3300027866 | Bacteria | 5480 |
| 367 | Ga0209813_10101094 | 3300027866 | Bacteria | 981 |
| 368 | Ga0268266_10002013 | 3300028379 | Bacteria | 22668 |
| 369 | Ga0268266_11135016 | 3300028379 | Bacteria | 756 |
| 370 | Ga0268265_10744595 | 3300028380 | Bacteria | 951 |
| 371 | Ga0268264_10153425 | 3300028381 | Bacteria | 2068 |
| 372 | Ga0307515_10002861 | 3300028794 | Bacteria | 36711 |
| 373 | Ga0265340_10015112 | 3300031247 | Bacteria | 4016 |
| 374 | Ga0265339_10154511 | 3300031249 | Bacteria | 1158 |
| 375 | Ga0265316_10636963 | 3300031344 | Bacteria | 754 |
| 376 | Ga0307513_10010831 | 3300031456 | Bacteria | 11389 |
| 377 | Ga0307513_10431514 | 3300031456 | Bacteria | 1046 |
| 378 | Ga0307408_100198915 | 3300031548 | Bacteria | 1620 |
| 379 | Ga0307408_100200300 | 3300031548 | Bacteria | 1615 |
| 380 | Ga0307408_101061234 | 3300031548 | Bacteria | 750 |
| 381 | Ga0307514_10000869 | 3300031649 | Bacteria | 47727 |
| 382 | Ga0316575_10062453 | 3300031665 | Bacteria | 1490 |
| 383 | Ga0316578_10169754 | 3300031728 | Bacteria | 1315 |
| 384 | Ga0307516_10058777 | 3300031730 | Bacteria | 3741 |
| 385 | Ga0307405_10019636 | 3300031731 | Bacteria | 3759 |
| 386 | Ga0307413_10028995 | 3300031824 | Bacteria | 3090 |
| 387 | Ga0307413_10076056 | 3300031824 | Bacteria | 2133 |
| 388 | Ga0307413_10611390 | 3300031824 | Bacteria | 893 |
| 389 | Ga0307410_10000614 | 3300031852 | Bacteria | 14673 |
| 390 | Ga0307410_10020666 | 3300031852 | Bacteria | 4033 |
| 391 | Ga0307410_10206070 | 3300031852 | Bacteria | 1504 |
| 392 | Ga0307410_11058462 | 3300031852 | Bacteria | 702 |
| 393 | Ga0307406_10015297 | 3300031901 | Bacteria | 4437 |
| 394 | Ga0307406_10028903 | 3300031901 | Bacteria | 3353 |
| 395 | Ga0307406_10128946 | 3300031901 | Bacteria | 1772 |
| 396 | Ga0307406_10416816 | 3300031901 | Bacteria | 1069 |
| 397 | Ga0307407_10104661 | 3300031903 | Bacteria | 1764 |
| 398 | Ga0307407_10286224 | 3300031903 | Bacteria | 1144 |
| 399 | Ga0307412_10099052 | 3300031911 | Bacteria | 2057 |
| 400 | Ga0307409_100002345 | 3300031995 | Bacteria | 9844 |
| 401 | Ga0307409_100038331 | 3300031995 | Bacteria | 3544 |
| 402 | Ga0307409_100185001 | 3300031995 | Bacteria | 1848 |
| 403 | Ga0307409_100744171 | 3300031995 | Bacteria | 983 |
| 404 | Ga0307416_100043233 | 3300032002 | Bacteria | 3526 |
| 405 | Ga0307416_100067803 | 3300032002 | Bacteria | 2945 |
| 406 | Ga0307416_100115023 | 3300032002 | Bacteria | 2381 |
| 407 | Ga0307416_100884032 | 3300032002 | Bacteria | 993 |
| 408 | Ga0307416_100979207 | 3300032002 | Bacteria | 948 |
| 409 | Ga0307414_10006519 | 3300032004 | Bacteria | 6510 |
| 410 | Ga0307414_10020667 | 3300032004 | Bacteria | 4109 |
| 411 | Ga0307414_10046840 | 3300032004 | Bacteria | 2971 |
| 412 | Ga0307414_10140922 | 3300032004 | Bacteria | 1887 |
| 413 | Ga0307414_10151685 | 3300032004 | Bacteria | 1829 |
| 414 | Ga0307411_10006176 | 3300032005 | Bacteria | 5963 |
| 415 | Ga0307411_10007844 | 3300032005 | Bacteria | 5480 |
| 416 | Ga0307411_10032157 | 3300032005 | Bacteria | 3239 |
| 417 | Ga0307411_10259166 | 3300032005 | Bacteria | 1372 |
| 418 | Ga0307411_10389564 | 3300032005 | Bacteria | 1148 |
| 419 | Ga0307411_10723682 | 3300032005 | Bacteria | 869 |
| 420 | Ga0307415_100066441 | 3300032126 | Bacteria | 2517 |
| 421 | Ga0307415_100800155 | 3300032126 | Bacteria | 860 |
| 422 | Ga0307507_10212954 | 3300033179 | Bacteria | 1314 |
| 423 | Ga0373950_0025159 | 3300034818 | Bacteria | 1074 |
| 424 | Ga0373938_0158013 | 3300034957 | Unclassified | 607 |
| 425 | Ga0373928_0041311 | 3300035084 | Bacteria | 1060 |
| 426 | Ga0373928_0061463 | 3300035084 | Bacteria | 909 |
| 427 | Ga0373940_0039268 | 3300035088 | Bacteria | 1295 |
| 428 | Ga0373949_0019819 | 3300035090 | Bacteria | 1535 |
| 429 | Ga0373951_0015606 | 3300035091 | Bacteria | 1712 |
| 430 | Ga0373932_0034080 | 3300035112 | Bacteria | 1433 |
| 431 | Ga0373939_0162671 | 3300035114 | Bacteria | 821 |
| 432 | Ga0373941_0040278 | 3300035115 | Bacteria | 1440 |
| 433 | Ga0373941_0054640 | 3300035115 | Bacteria | 1281 |
| 434 | Ga0373956_0570910 | 3300035119 | Bacteria | 540 |
| 435 | Ga0373961_0019832 | 3300035241 | Bacteria | 1771 |
| 436 | Ga0373961_0189150 | 3300035241 | Bacteria | 721 |
| 437 | Ga0316574_0190798 | 3300035398 | Bacteria | 1318 |
| 438 | Ga0316574_0618837 | 3300035398 | Bacteria | 668 |
| 439 | Ga0373931_0028511 | 3300035691 | Bacteria | 2859 |
| 440 | Ga0373931_0035758 | 3300035691 | Bacteria | 2584 |
| 441 | Ga0373931_0046073 | 3300035691 | Bacteria | 2304 |
| 442 | Ga0373935_0122257 | 3300035692 | Bacteria | 1741 |
| 443 | Ga0373935_0128209 | 3300035692 | Bacteria | 1702 |
| 444 | Ga0373935_0209241 | 3300035692 | Bacteria | 1351 |
| 445 | Ga0373927_0215017 | 3300035695 | Bacteria | 1263 |
| 446 | Ga0373947_0141561 | 3300035725 | Bacteria | 1543 |
| 447 | Ga0373947_0231506 | 3300035725 | Bacteria | 1217 |
| 448 | Ga0373937_1002568 | 3300036401 | Bacteria | 784 |
| 449 | Ga0395899_0017890 | 3300037312 | Bacteria | 5394 |
| 450 | Ga0395899_0042406 | 3300037312 | Bacteria | 3396 |
| 451 | Ga0395899_0052182 | 3300037312 | Bacteria | 3032 |
| 452 | Ga0395899_0052695 | 3300037312 | Bacteria | 3015 |
| 453 | Ga0395899_0134345 | 3300037312 | Bacteria | 1764 |
| 454 | Ga0395899_0145958 | 3300037312 | Bacteria | 1680 |
| 455 | Ga0395899_0158860 | 3300037312 | Bacteria | 1598 |
| 456 | Ga0395899_0254795 | 3300037312 | Bacteria | 1203 |
| 457 | Ga0395899_0289495 | 3300037312 | Bacteria | 1112 |
| 458 | Ga0395900_0000052 | 3300037418 | Bacteria | 223910 |
| 459 | Ga0395900_0008741 | 3300037418 | Bacteria | 10404 |
| 460 | Ga0395900_0025336 | 3300037418 | Bacteria | 6072 |
| 461 | Ga0395900_0039329 | 3300037418 | Bacteria | 4873 |
| 462 | Ga0395900_0053279 | 3300037418 | Bacteria | 4163 |
| 463 | Ga0395900_0083060 | 3300037418 | Bacteria | 3291 |
| 464 | Ga0395900_0083198 | 3300037418 | Bacteria | 3288 |
| 465 | Ga0395900_0094955 | 3300037418 | Bacteria | 3063 |
| 466 | Ga0395900_0117585 | 3300037418 | Bacteria | 2728 |
| 467 | Ga0395900_0190801 | 3300037418 | Bacteria | 2078 |
| 468 | Ga0395900_0371959 | 3300037418 | Bacteria | 1399 |
| 469 | Ga0395900_0426881 | 3300037418 | Bacteria | 1285 |
| 470 | Ga0395900_0522625 | 3300037418 | Bacteria | 1134 |
| 471 | Ga0395900_0884935 | 3300037418 | Bacteria | 817 |
| 472 | Ga0395900_1012887 | 3300037418 | Bacteria | 750 |
| 473 | Ga0395900_1851594 | 3300037418 | Bacteria | 514 |
| 474 | Ga0395898_0019459 | 3300037466 | Bacteria | 6907 |
| 475 | Ga0395898_0021508 | 3300037466 | Bacteria | 6541 |
| 476 | Ga0395898_0047996 | 3300037466 | Bacteria | 4188 |
| 477 | Ga0395898_0051087 | 3300037466 | Bacteria | 4044 |
| 478 | Ga0395898_0057465 | 3300037466 | Bacteria | 3791 |
| 479 | Ga0395898_0078609 | 3300037466 | Bacteria | 3183 |
| 480 | Ga0395898_0088051 | 3300037466 | Bacteria | 2990 |
| 481 | Ga0395898_0126977 | 3300037466 | Bacteria | 2443 |
| 482 | Ga0395898_0144462 | 3300037466 | Bacteria | 2277 |
| 483 | Ga0395898_0857885 | 3300037466 | Bacteria | 847 |
| 484 | Ga0395905_0002924 | 3300037471 | Bacteria | 18610 |
| 485 | Ga0395905_0003469 | 3300037471 | Bacteria | 16851 |
| 486 | Ga0395905_0078945 | 3300037471 | Bacteria | 3084 |
| 487 | Ga0395905_0091734 | 3300037471 | Bacteria | 2848 |
| 488 | Ga0395905_0118028 | 3300037471 | Bacteria | 2494 |
| 489 | Ga0395905_0122171 | 3300037471 | Bacteria | 2448 |
| 490 | Ga0395905_0125304 | 3300037471 | Bacteria | 2415 |
| 491 | Ga0395905_0126722 | 3300037471 | Bacteria | 2401 |
| 492 | Ga0395905_0134657 | 3300037471 | Bacteria | 2324 |
| 493 | Ga0395905_0181084 | 3300037471 | Bacteria | 1978 |
| 494 | Ga0395905_0240413 | 3300037471 | Bacteria | 1692 |
| 495 | Ga0395905_0355777 | 3300037471 | Bacteria | 1357 |
| 496 | Ga0395905_0533241 | 3300037471 | Bacteria | 1074 |
| 497 | Ga0395905_0545522 | 3300037471 | Bacteria | 1060 |
| 498 | Ga0395905_0630283 | 3300037471 | Bacteria | 974 |
| 499 | Ga0395905_0814824 | 3300037471 | Bacteria | 836 |
| 500 | Ga0395905_1416961 | 3300037471 | Bacteria | 599 |
| 501 | Ga0395905_1451650 | 3300037471 | Bacteria | 590 |
| 502 | Ga0395905_1759480 | 3300037471 | Bacteria | 525 |
| 503 | Ga0436364_1276852 | 3300037853 | Bacteria | 811 |
| 504 | Ga0395901_0000001 | 3300038443 | Bacteria | 800383 |
| 505 | Ga0395901_0008775 | 3300038443 | Bacteria | 10225 |
| 506 | Ga0395901_0029696 | 3300038443 | Bacteria | 5630 |
| 507 | Ga0395901_0048383 | 3300038443 | Bacteria | 4415 |
| 508 | Ga0395901_0064410 | 3300038443 | Bacteria | 3816 |
| 509 | Ga0395901_0070726 | 3300038443 | Bacteria | 3636 |
| 510 | Ga0395901_0242732 | 3300038443 | Bacteria | 1878 |
| 511 | Ga0395901_0243319 | 3300038443 | Bacteria | 1876 |
| 512 | Ga0395901_0314273 | 3300038443 | Bacteria | 1622 |
| 513 | Ga0395901_0367757 | 3300038443 | Bacteria | 1482 |
| 514 | Ga0395901_0627015 | 3300038443 | Bacteria | 1081 |
| 515 | Ga0395901_0688655 | 3300038443 | Bacteria | 1021 |
| 516 | Ga0395901_0834509 | 3300038443 | Bacteria | 908 |
| 517 | Ga0436365_0192116 | 3300039437 | Bacteria | 2068 |
| 518 | Ga0436365_0830248 | 3300039437 | Bacteria | 48518 |
| 519 | Ga0436365_0991055 | 3300039437 | Bacteria | 12481 |
| 520 | Ga0436365_1899237 | 3300039437 | Bacteria | 641 |
| 521 | Ga0436360_0436836 | 3300039438 | Bacteria | 1133 |
| 522 | Ga0436361_0062076 | 3300039447 | Bacteria | 713 |
| 523 | Ga0436361_0238763 | 3300039447 | Bacteria | 2092 |
| 524 | Ga0436363_0051271 | 3300039450 | Bacteria | 1786 |
| 525 | Ga0436363_0417278 | 3300039450 | Bacteria | 841 |
| 526 | Ga0436363_1034111 | 3300039450 | Bacteria | 1592 |
| 527 | Ga0436363_1343732 | 3300039450 | Bacteria | 1374 |
| 528 | Ga0436362_1242088 | 3300039453 | Bacteria | 8896 |
| 529 | Ga0451795_1174563 | 3300041456 | Bacteria | 862 |
| 530 | Ga0451802_1751721 | 3300041460 | Bacteria | 604 |
| 531 | Ga0451804_0112483 | 3300041463 | Bacteria | 581 |
| 532 | Ga0451804_0787336 | 3300041463 | Bacteria | 836 |
| 533 | Ga0451804_0874594 | 3300041463 | Bacteria | 672 |
| 534 | Ga0451807_2537906 | 3300041486 | Bacteria | 679 |
| 535 | Ga0451851_0666669 | 3300041507 | Bacteria | 754 |
| 536 | Ga0451843_0205721 | 3300041509 | Bacteria | 720 |
| 537 | Ga0451843_0245082 | 3300041509 | Bacteria | 517 |
| 538 | Ga0451843_1595677 | 3300041509 | Bacteria | 635 |
| 539 | Ga0439445_0026585 | 3300042004 | Bacteria | 1482 |
| 540 | Ga0439445_0104735 | 3300042004 | Bacteria | 804 |
| 541 | Ga0439432_004532 | 3300042006 | Bacteria | 5070 |
| 542 | Ga0439432_041183 | 3300042006 | Bacteria | 1464 |
| 543 | Ga0439432_046703 | 3300042006 | Bacteria | 1360 |
| 544 | Ga0439432_181281 | 3300042006 | Bacteria | 613 |
| 545 | Ga0439432_185993 | 3300042006 | Bacteria | 604 |
| 546 | Ga0439452_055265 | 3300042010 | Bacteria | 900 |
| 547 | Ga0439462_0024348 | 3300042015 | Bacteria | 1590 |
| 548 | Ga0450911_001376 | 3300042115 | Bacteria | 5686 |
| 549 | Ga0450920_007363 | 3300042122 | Bacteria | 1994 |
| 550 | Ga0450889_018867 | 3300042144 | Bacteria | 756 |
| 551 | Ga0439446_0157633 | 3300042156 | Bacteria | 749 |
| 552 | Ga0450916_027540 | 3300042530 | Bacteria | 813 |
| 553 | Ga0451577_0007413 | 3300042876 | Bacteria | 10773 |
| 554 | Ga0466969_0006496 | 3300044656 | Bacteria | 6222 |
| 555 | Ga0466969_0024643 | 3300044656 | Bacteria | 3095 |
| 556 | Ga0466972_0016263 | 3300044658 | Bacteria | 3718 |
| 557 | Ga0466972_0119214 | 3300044658 | Bacteria | 1245 |
| 558 | Ga0466965_0094234 | 3300044683 | Bacteria | 1525 |
| 559 | Ga0466965_0133412 | 3300044683 | Bacteria | 1289 |
| 560 | Ga0466966_0000004 | 3300044684 | Bacteria | 223594 |
| 561 | Ga0466966_0008540 | 3300044684 | Bacteria | 6782 |
| 562 | Ga0466966_0008836 | 3300044684 | Bacteria | 6670 |
| 563 | Ga0466966_0140221 | 3300044684 | Bacteria | 1478 |
| 564 | Ga0466961_0000138 | 3300044693 | Bacteria | 48960 |
| 565 | Ga0466961_0001622 | 3300044693 | Bacteria | 13949 |
| 566 | Ga0466963_0028237 | 3300044694 | Bacteria | 3600 |
| 567 | Ga0466963_0036748 | 3300044694 | Bacteria | 3195 |
| 568 | Ga0466963_0131288 | 3300044694 | Bacteria | 1730 |
| 569 | Ga0466964_0029661 | 3300044706 | Bacteria | 2161 |
| 570 | Ga0466964_0179058 | 3300044706 | Bacteria | 1004 |
| 571 | Ga0466964_0385723 | 3300044706 | Bacteria | 728 |
| 572 | Ga0466971_0003803 | 3300044719 | Bacteria | 6460 |
| 573 | Ga0466968_0032411 | 3300044735 | Bacteria | 2173 |
| 574 | Ga0466970_0009047 | 3300044765 | Bacteria | 5026 |
| 575 | Ga0466957_0003105 | 3300044842 | Bacteria | 9038 |
| 576 | Ga0466957_0373373 | 3300044842 | Bacteria | 971 |
| 577 | Ga0466960_0162937 | 3300044901 | Bacteria | 1198 |
| 578 | Ga0466959_0006892 | 3300045049 | Bacteria | 7931 |
| 579 | Ga0466959_0051357 | 3300045049 | Bacteria | 3024 |
| 580 | Ga0466959_0355644 | 3300045049 | Bacteria | 998 |
| 581 | Ga0466958_0000180 | 3300045836 | Bacteria | 22832 |
| 582 | Ga0466958_0019378 | 3300045836 | Bacteria | 3960 |
| 583 | Ga0466958_0644809 | 3300045836 | Bacteria | 689 |
| 584 | Ga0466967_0001231 | 3300045976 | Bacteria | 14453 |
| 585 | Ga0466967_0023753 | 3300045976 | Bacteria | 5029 |
| 586 | Ga0466967_0104197 | 3300045976 | Bacteria | 2596 |
| 587 | Ga0466967_0229573 | 3300045976 | Bacteria | 1767 |
| 588 | Ga0466967_0418660 | 3300045976 | Bacteria | 1305 |
| 589 | Ga0495592_0087475 | 3300046454 | Bacteria | 2241 |
| 590 | Ga0495603_0069546 | 3300046455 | Bacteria | 2071 |
| 591 | Ga0495603_0091882 | 3300046455 | Bacteria | 1774 |
| 592 | Ga0495629_0019931 | 3300046459 | Bacteria | 4785 |
| 593 | Ga0495638_0024359 | 3300046460 | Bacteria | 3946 |
| 594 | Ga0495651_0006181 | 3300046462 | Bacteria | 9147 |
| 595 | Ga0495651_0047647 | 3300046462 | Bacteria | 3312 |
| 596 | Ga0495653_0119911 | 3300046463 | Bacteria | 1876 |
| 597 | Ga0495605_0117181 | 3300046474 | Bacteria | 1210 |
| 598 | Ga0495605_0426787 | 3300046474 | Bacteria | 548 |
| 599 | Ga0495662_0094060 | 3300046476 | Bacteria | 1463 |
| 600 | Ga0495584_0042923 | 3300046491 | Bacteria | 2283 |
| 601 | Ga0495606_0190585 | 3300046507 | Bacteria | 1175 |
| 602 | Ga0495608_0127776 | 3300046511 | Bacteria | 1628 |
| 603 | Ga0495608_0218195 | 3300046511 | Bacteria | 1197 |
| 604 | Ga0495610_0065210 | 3300046512 | Bacteria | 1719 |
| 605 | Ga0495616_0045788 | 3300046513 | Bacteria | 2212 |
| 606 | Ga0495620_0179206 | 3300046515 | Bacteria | 820 |
| 607 | Ga0495628_0082167 | 3300046516 | Bacteria | 2502 |
| 608 | Ga0495628_0618554 | 3300046516 | Bacteria | 772 |
| 609 | Ga0495631_0237102 | 3300046518 | Bacteria | 778 |
| 610 | Ga0495632_0097355 | 3300046519 | Bacteria | 1389 |
| 611 | Ga0495643_0018038 | 3300046522 | Bacteria | 4110 |
| 612 | Ga0495648_0095349 | 3300046524 | Bacteria | 1655 |
| 613 | Ga0495648_0106363 | 3300046524 | Bacteria | 1536 |
| 614 | Ga0495648_0210502 | 3300046524 | Bacteria | 966 |
| 615 | Ga0495663_0075922 | 3300046525 | Bacteria | 1076 |
| 616 | Ga0495652_0020427 | 3300046529 | Bacteria | 5887 |
| 617 | Ga0495665_0518137 | 3300046531 | Bacteria | 600 |
| 618 | Ga0495640_0025929 | 3300046533 | Bacteria | 4245 |
| 619 | Ga0495640_0028543 | 3300046533 | Bacteria | 4016 |
| 620 | Ga0495587_0012345 | 3300046536 | Bacteria | 5381 |
| 621 | Ga0495597_0031129 | 3300046542 | Bacteria | 2429 |
| 622 | Ga0495645_0156418 | 3300046543 | Bacteria | 1579 |
| 623 | Ga0495667_0007564 | 3300046559 | Bacteria | 7370 |
| 624 | Ga0495668_0198214 | 3300046616 | Bacteria | 1099 |
| 625 | Ga0495634_0183414 | 3300046642 | Bacteria | 1309 |
| 626 | Ga0495611_0247356 | 3300046648 | Bacteria | 827 |
| 627 | Ga0495635_0025058 | 3300046663 | Bacteria | 4156 |
| 628 | Ga0495635_0168772 | 3300046663 | Bacteria | 1488 |
| 629 | Ga0495588_0121894 | 3300046674 | Bacteria | 1374 |
| 630 | Ga0495657_0008617 | 3300046675 | Bacteria | 7782 |
| 631 | Ga0495657_0056380 | 3300046675 | Bacteria | 2616 |
| 632 | Ga0495599_0205800 | 3300046678 | Bacteria | 1208 |
| 633 | Ga0495599_0841143 | 3300046678 | Bacteria | 522 |
| 634 | Ga0495646_0025468 | 3300046680 | Bacteria | 3721 |
| 635 | Ga0495646_0089758 | 3300046680 | Bacteria | 1778 |
| 636 | Ga0495647_0085713 | 3300046681 | Bacteria | 1284 |
| 637 | Ga0495658_0245350 | 3300046683 | Bacteria | 1125 |
| 638 | Ga0495613_0002667 | 3300046689 | Bacteria | 13390 |
| 639 | Ga0495624_0040277 | 3300046690 | Bacteria | 2992 |
| 640 | Ga0495649_0170206 | 3300046694 | Bacteria | 1140 |
| 641 | Ga0495600_0005153 | 3300046809 | Bacteria | 7858 |
| 642 | Ga0495581_0123864 | 3300047315 | Bacteria | 1505 |
| 643 | Ga0495604_0001518 | 3300047317 | Bacteria | 19095 |
| 644 | Ga0495604_0034874 | 3300047317 | Bacteria | 3976 |
| 645 | Ga0495674_0041860 | 3300047319 | Bacteria | 4089 |
| 646 | Ga0495676_0036433 | 3300047321 | Bacteria | 4108 |
| 647 | Ga0495680_0002284 | 3300047322 | Bacteria | 19743 |
| 648 | Ga0495683_0198924 | 3300047323 | Bacteria | 905 |
| 649 | Ga0495683_0299956 | 3300047323 | Bacteria | 690 |
| 650 | Ga0495687_003327 | 3300047443 | Bacteria | 11777 |
| 651 | Ga0495675_0018949 | 3300047444 | Bacteria | 4371 |
| 652 | Ga0495675_0488881 | 3300047444 | Bacteria | 708 |
| 653 | Ga0495686_0066039 | 3300047472 | Bacteria | 2236 |
| 654 | Ga0495593_0038464 | 3300047673 | Bacteria | 2584 |
| 655 | Ga0495602_0017911 | 3300048088 | Bacteria | 7088 |
| 656 | Ga0495602_0123698 | 3300048088 | Bacteria | 2076 |
| 657 | Ga0495614_0256940 | 3300048089 | Bacteria | 800 |
| 658 | Ga0495626_0079678 | 3300048091 | Bacteria | 1457 |
| 659 | Ga0496100_0759575 | 3300048903 | Bacteria | 758 |
| 660 | Ga0496100_0953896 | 3300048903 | Bacteria | 674 |
| 661 | Ga0496101_0609763 | 3300048904 | Bacteria | 863 |
| 662 | Ga0496102_0018606 | 3300048905 | Bacteria | 6108 |
| 663 | Ga0496102_0129992 | 3300048905 | Bacteria | 2356 |
| 664 | Ga0496103_0010582 | 3300048906 | Bacteria | 5459 |
| 665 | Ga0496103_0192512 | 3300048906 | Bacteria | 1311 |
| 666 | Ga0496104_0001301 | 3300048907 | Bacteria | 21525 |
| 667 | Ga0496104_0187623 | 3300048907 | Bacteria | 1978 |
| 668 | Ga0496104_0196267 | 3300048907 | Bacteria | 1930 |
| 669 | Ga0496104_0365415 | 3300048907 | Bacteria | 1355 |
| 670 | Ga0496104_0983527 | 3300048907 | Bacteria | 748 |
| 671 | Ga0496105_0001938 | 3300048908 | Bacteria | 14867 |
| 672 | Ga0496105_0212489 | 3300048908 | Bacteria | 1576 |
| 673 | Ga0496106_0260546 | 3300048909 | Bacteria | 1387 |
| 674 | Ga0496108_0007947 | 3300048911 | Bacteria | 8600 |
| 675 | Ga0496108_0159593 | 3300048911 | Bacteria | 1948 |
| 676 | Ga0496108_1272429 | 3300048911 | Bacteria | 620 |
| 677 | Ga0496109_0013292 | 3300048912 | Bacteria | 7132 |
| 678 | Ga0496109_0573797 | 3300048912 | Bacteria | 1063 |
| 679 | Ga0496109_0838074 | 3300048912 | Bacteria | 857 |
| 680 | Ga0496110_0009456 | 3300048913 | Bacteria | 7892 |
| 681 | Ga0496110_0013347 | 3300048913 | Bacteria | 6788 |
| 682 | Ga0496110_1389731 | 3300048913 | Bacteria | 611 |
| 683 | Ga0496111_0002469 | 3300048914 | Bacteria | 11162 |
| 684 | Ga0496111_0042311 | 3300048914 | Bacteria | 3271 |
| 685 | Ga0496111_0116254 | 3300048914 | Bacteria | 1973 |
| 686 | Ga0496112_0041119 | 3300048915 | Bacteria | 4522 |
| 687 | Ga0496112_0202054 | 3300048915 | Bacteria | 1946 |
| 688 | Ga0496113_0069023 | 3300048916 | Bacteria | 2683 |
| 689 | Ga0496113_0143564 | 3300048916 | Bacteria | 1879 |
| 690 | Ga0496114_0059745 | 3300048917 | Bacteria | 3185 |
| 691 | Ga0496115_0000373 | 3300048918 | Bacteria | 36954 |
| 692 | Ga0496115_0327843 | 3300048918 | Bacteria | 1251 |
| 693 | Ga0496117_0030996 | 3300048920 | Bacteria | 4091 |
| 694 | Ga0496117_0111984 | 3300048920 | Bacteria | 1698 |
| 695 | Ga0496117_0125286 | 3300048920 | Bacteria | 1569 |
| 696 | Ga0496118_0197322 | 3300048921 | Bacteria | 1196 |
| 697 | Ga0496118_0224412 | 3300048921 | Bacteria | 1090 |
| 698 | Ga0496119_0035346 | 3300048922 | Bacteria | 3275 |
| 699 | Ga0496119_0063971 | 3300048922 | Bacteria | 2186 |
| 700 | Ga0496119_0073985 | 3300048922 | Bacteria | 1985 |
| 701 | Ga0496120_0012429 | 3300048923 | Bacteria | 5797 |
| 702 | Ga0496120_0120606 | 3300048923 | Bacteria | 1356 |
| 703 | Ga0496121_0004158 | 3300048924 | Bacteria | 19793 |
| 704 | Ga0496121_0008706 | 3300048924 | Bacteria | 11848 |
| 705 | Ga0496121_0418547 | 3300048924 | Bacteria | 872 |
| 706 | Ga0496122_0240507 | 3300048925 | Bacteria | 1021 |
| 707 | Ga0496123_0013694 | 3300048926 | Bacteria | 6783 |
| 708 | Ga0496124_0059478 | 3300048927 | Bacteria | 3210 |
| 709 | Ga0496124_0062431 | 3300048927 | Bacteria | 3118 |
| 710 | Ga0496125_0004735 | 3300048928 | Bacteria | 15510 |
| 711 | Ga0496125_0005730 | 3300048928 | Bacteria | 13672 |
| 712 | Ga0496125_0011397 | 3300048928 | Bacteria | 8896 |
| 713 | Ga0496125_0056157 | 3300048928 | Bacteria | 3200 |
| 714 | Ga0496125_0105608 | 3300048928 | Bacteria | 2058 |
| 715 | Ga0496125_0244883 | 3300048928 | Bacteria | 1135 |
| 716 | Ga0495682_0023983 | 3300049460 | Bacteria | 2277 |
| 717 | Ga0495682_0081852 | 3300049460 | Bacteria | 1161 |
| 718 | Ga0501037_0333584 | 3300049573 | Bacteria | 1048 |
| 719 | Ga0501047_0092875 | 3300049581 | Bacteria | 2897 |
| 720 | Ga0501047_0188539 | 3300049581 | Bacteria | 1927 |
| 721 | Ga0501068_0349003 | 3300049584 | Bacteria | 951 |
| 722 | Ga0501070_1385252 | 3300049586 | Bacteria | 535 |
| 723 | Ga0501071_1398619 | 3300049587 | Bacteria | 540 |
| 724 | Ga0501080_1068757 | 3300049742 | Bacteria | 698 |
| 725 | Ga0501035_0043797 | 3300049822 | Bacteria | 4033 |
| 726 | Ga0501044_0007508 | 3300049823 | Bacteria | 11994 |
| 727 | nmdc:mga03683_126074_c1 | 3300050489 | Bacteria | 1142 |
| 728 | nmdc:mga03683_59710_c1 | 3300050489 | Bacteria | 1032 |
| 729 | nmdc:mga03n38_125771_c1 | 3300050490 | Bacteria | 1265 |
| 730 | nmdc:mga00v17_396635_c1 | 3300050491 | Bacteria | 897 |
| 731 | nmdc:mga0yw44_21034_c1 | 3300050492 | Bacteria | 3633 |
| 732 | nmdc:mga0yw44_222257_c1 | 3300050492 | Bacteria | 1252 |
| 733 | nmdc:mga0yw44_357663_c1 | 3300050492 | Bacteria | 984 |
| 734 | nmdc:mga0yw44_511892_c1 | 3300050492 | Bacteria | 814 |
| 735 | nmdc:mga0k408_12833_c1 | 3300050493 | Bacteria | 4586 |
| 736 | nmdc:mga0k408_4643_c1 | 3300050493 | Bacteria | 7278 |
| 737 | nmdc:mga06z11_257103_c1 | 3300050494 | Bacteria | 1030 |
| 738 | nmdc:mga06z11_98233_c1 | 3300050494 | Bacteria | 1602 |
| 739 | nmdc:mga04h51_2392_c1 | 3300050495 | Bacteria | 4449 |
| 740 | nmdc:mga04h51_55597_c1 | 3300050495 | Bacteria | 1341 |
| 741 | nmdc:mga07m45_11800_c1 | 3300050496 | Bacteria | 4600 |
| 742 | nmdc:mga07m45_171882_c1 | 3300050496 | Bacteria | 1259 |
| 743 | nmdc:mga07m45_658517_c1 | 3300050496 | Bacteria | 603 |
| 744 | nmdc:mga05p37_198660_c1 | 3300050507 | Bacteria | 2430 |
| 745 | nmdc:mga0a205_3422_c1 | 3300050515 | Bacteria | 14147 |
| 746 | nmdc:mga0sz30_133229_c1 | 3300050516 | Bacteria | 1096 |
| 747 | nmdc:mga0sz30_36310_c1 | 3300050516 | Bacteria | 2059 |
| 748 | nmdc:mga0sz30_43159_c1 | 3300050516 | Bacteria | 1898 |
| 749 | Ga0500610_0435472 | 3300053079 | Bacteria | 519 |
| 750 | Ga0495595_0406314 | 3300053084 | Bacteria | 690 |
| 751 | Ga0500643_000068 | 3300053087 | Bacteria | 117369 |
| 752 | Ga0500647_0027416 | 3300053091 | Bacteria | 2692 |
| 753 | Ga0500641_0005471 | 3300053096 | Bacteria | 4500 |
| 754 | Ga0500555_007953 | 3300053103 | Bacteria | 3017 |
| 755 | Ga0500557_000141 | 3300053105 | Bacteria | 17116 |
| 756 | Ga0500562_080298 | 3300053108 | Bacteria | 882 |
| 757 | Ga0500569_015089 | 3300053109 | Bacteria | 1927 |
| 758 | Ga0500569_020803 | 3300053109 | Bacteria | 1727 |
| 759 | Ga0500582_147200 | 3300053114 | Bacteria | 816 |
| 760 | Ga0500594_0026329 | 3300053118 | Bacteria | 1498 |
| 761 | Ga0500642_0000088 | 3300053130 | Bacteria | 47518 |
| 762 | Ga0500559_0067336 | 3300053136 | Bacteria | 1607 |
| 763 | Ga0500590_020885 | 3300053148 | Bacteria | 3398 |
| 764 | Ga0500616_0019727 | 3300053153 | Bacteria | 3797 |
| 765 | Ga0500622_0024256 | 3300053156 | Bacteria | 3207 |
| 766 | Ga0500636_0250611 | 3300053177 | Bacteria | 903 |
| 767 | Ga0500625_055583 | 3300053729 | Bacteria | 1815 |
| 768 | Ga0500609_006945 | 3300053731 | Bacteria | 1533 |
| 769 | Ga0500552_002940 | 3300053733 | Bacteria | 1696 |
| 770 | Ga0500596_058157 | 3300053735 | Bacteria | 643 |
| 771 | Ga0500599_000688 | 3300053736 | Bacteria | 3649 |
| 772 | Ga0500601_000206 | 3300053737 | Bacteria | 11901 |
| 773 | Ga0501084_1692363 | 3300054114 | Bacteria | 529 |
| 774 | Ga0466962_0026992 | 3300061719 | Bacteria | 2756 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006178 | Ga0075367_10143533 | Ga0075367_101435332 | 137 |
| 2 | 3300027866 | Ga0209813_10101094 | Ga0209813_101010941 | 137 |
| 3 | 3300050494 | nmdc:mga06z11_257103_c1 | nmdc:mga06z11_257103_c1_61_513 | 137 |
| 4 | 3300050495 | nmdc:mga04h51_55597_c1 | nmdc:mga04h51_55597_c1_434_886 | 137 |
| 5 | 3300031548 | Ga0307408_101061234 | Ga0307408_1010612342 | 139 |
| 6 | 3300031824 | Ga0307413_10611390 | Ga0307413_106113902 | 140 |
| 7 | 3300032005 | Ga0307411_10032157 | Ga0307411_100321573 | 140 |
| 8 | 3300042876 | Ga0451577_0007413 | Ga0451577_0007413_5117_5539 | 140 |
| 9 | iso_pu_bacteria | 2899275550 | 2899278105 | 140 |
| 10 | 3300005435 | Ga0070714_100013505 | Ga0070714_1000135054 | 141 |
| 11 | 3300005436 | Ga0070713_100620875 | Ga0070713_1006208752 | 141 |
| 12 | 3300025928 | Ga0207700_10070596 | Ga0207700_100705962 | 141 |
| 13 | 3300025929 | Ga0207664_10236716 | Ga0207664_102367162 | 141 |
| 14 | 3300037471 | Ga0395905_0134657 | Ga0395905_0134657_514_939 | 141 |
| 15 | 3300041509 | Ga0451843_0205721 | Ga0451843_0205721_119_553 | 141 |
| 16 | 3300050493 | nmdc:mga0k408_4643_c1 | nmdc:mga0k408_4643_c1_5654_6079 | 141 |
| 17 | 3300006195 | Ga0075366_10004819 | Ga0075366_100048195 | 142 |
| 18 | 3300037312 | Ga0395899_0145958 | Ga0395899_0145958_372_800 | 142 |
| 19 | 3300037418 | Ga0395900_0884935 | Ga0395900_0884935_343_771 | 142 |
| 20 | 3300037466 | Ga0395898_0057465 | Ga0395898_0057465_3258_3686 | 142 |
| 21 | 3300038443 | Ga0395901_0070726 | Ga0395901_0070726_116_544 | 142 |
| 22 | 3300014326 | Ga0157380_12781650 | Ga0157380_127816502 | 143 |
| 23 | iso_pu_bacteria | 2643221598 | 2643998343 | 143 |
| 24 | iso_pu_bacteria | 2643221614 | 2644086796 | 143 |
| 25 | iso_pu_bacteria | 2643221661 | 2644341750 | 143 |
| 26 | iso_pu_bacteria | 2643221666 | 2644368037 | 143 |
| 27 | 3300005335 | Ga0070666_11107799 | Ga0070666_111077991 | 144 |
| 28 | 3300005355 | Ga0070671_100147617 | Ga0070671_1001476172 | 144 |
| 29 | 3300005435 | Ga0070714_100027645 | Ga0070714_1000276453 | 144 |
| 30 | 3300013307 | Ga0157372_11590858 | Ga0157372_115908581 | 144 |
| 31 | 3300025929 | Ga0207664_10111353 | Ga0207664_101113533 | 144 |
| 32 | 3300025941 | Ga0207711_10026755 | Ga0207711_100267553 | 144 |
| 33 | 3300031665 | Ga0316575_10062453 | Ga0316575_100624532 | 144 |
| 34 | 3300031728 | Ga0316578_10169754 | Ga0316578_101697542 | 144 |
| 35 | 3300035114 | Ga0373939_0162671 | Ga0373939_0162671_336_770 | 144 |
| 36 | 3300035398 | Ga0316574_0618837 | Ga0316574_0618837_145_588 | 144 |
| 37 | 3300037312 | Ga0395899_0254795 | Ga0395899_0254795_481_915 | 144 |
| 38 | 3300037418 | Ga0395900_0522625 | Ga0395900_0522625_125_559 | 144 |
| 39 | 3300037471 | Ga0395905_0122171 | Ga0395905_0122171_1429_1863 | 144 |
| 40 | 3300037471 | Ga0395905_0125304 | Ga0395905_0125304_791_1225 | 144 |
| 41 | 3300041463 | Ga0451804_0112483 | Ga0451804_0112483_26_463 | 144 |
| 42 | 3300044694 | Ga0466963_0131288 | Ga0466963_0131288_108_542 | 144 |
| 43 | 3300044842 | Ga0466957_0373373 | Ga0466957_0373373_86_520 | 144 |
| 44 | 3300045836 | Ga0466958_0019378 | Ga0466958_0019378_3469_3903 | 144 |
| 45 | 3300045976 | Ga0466967_0001231 | Ga0466967_0001231_13828_14262 | 144 |
| 46 | 3300045976 | Ga0466967_0023753 | Ga0466967_0023753_826_1260 | 144 |
| 47 | 3300045976 | Ga0466967_0418660 | Ga0466967_0418660_112_546 | 144 |
| 48 | 3300048913 | Ga0496110_0013347 | Ga0496110_0013347_5288_5722 | 144 |
| 49 | 3300048914 | Ga0496111_0116254 | Ga0496111_0116254_1172_1606 | 144 |
| 50 | 3300050515 | nmdc:mga0a205_3422_c1 | nmdc:mga0a205_3422_c1_11865_12299 | 144 |
| 51 | iso_pu_bacteria | 2894023352 | 2894025158 | 144 |
| 52 | 3300005289 | Ga0065704_10334546 | Ga0065704_103345461 | 145 |
| 53 | 3300006178 | Ga0075367_10067056 | Ga0075367_100670563 | 145 |
| 54 | 3300006195 | Ga0075366_10039337 | Ga0075366_100393372 | 145 |
| 55 | 3300028794 | Ga0307515_10002861 | Ga0307515_1000286122 | 145 |
| 56 | 3300031456 | Ga0307513_10010831 | Ga0307513_1001083110 | 145 |
| 57 | 3300031649 | Ga0307514_10000869 | Ga0307514_100008694 | 145 |
| 58 | 3300031824 | Ga0307413_10076056 | Ga0307413_100760562 | 145 |
| 59 | 3300031901 | Ga0307406_10416816 | Ga0307406_104168162 | 145 |
| 60 | 3300031903 | Ga0307407_10286224 | Ga0307407_102862242 | 145 |
| 61 | 3300031995 | Ga0307409_100744171 | Ga0307409_1007441712 | 145 |
| 62 | 3300032005 | Ga0307411_10723682 | Ga0307411_107236822 | 145 |
| 63 | 3300041509 | Ga0451843_0245082 | Ga0451843_0245082_25_474 | 145 |
| 64 | 3300042004 | Ga0439445_0026585 | Ga0439445_0026585_184_633 | 145 |
| 65 | 3300042115 | Ga0450911_001376 | Ga0450911_001376_3124_3573 | 145 |
| 66 | 3300042530 | Ga0450916_027540 | Ga0450916_027540_141_590 | 145 |
| 67 | 3300046525 | Ga0495663_0075922 | Ga0495663_0075922_262_705 | 145 |
| 68 | 3300046681 | Ga0495647_0085713 | Ga0495647_0085713_127_603 | 145 |
| 69 | 3300048924 | Ga0496121_0004158 | Ga0496121_0004158_11565_12014 | 145 |
| 70 | 3300048927 | Ga0496124_0062431 | Ga0496124_0062431_2110_2559 | 145 |
| 71 | 3300048928 | Ga0496125_0004735 | Ga0496125_0004735_8023_8472 | 145 |
| 72 | 3300048928 | Ga0496125_0005730 | Ga0496125_0005730_3180_3629 | 145 |
| 73 | 3300049581 | Ga0501047_0188539 | Ga0501047_0188539_101_544 | 145 |
| 74 | 3300050489 | nmdc:mga03683_59710_c1 | nmdc:mga03683_59710_c1_376_825 | 145 |
| 75 | 3300050492 | nmdc:mga0yw44_511892_c1 | nmdc:mga0yw44_511892_c1_119_568 | 145 |
| 76 | 3300050494 | nmdc:mga06z11_98233_c1 | nmdc:mga06z11_98233_c1_224_673 | 145 |
| 77 | 3300005328 | Ga0070676_10900506 | Ga0070676_109005062 | 146 |
| 78 | 3300005329 | Ga0070683_100022475 | Ga0070683_1000224754 | 146 |
| 79 | 3300005340 | Ga0070689_100109545 | Ga0070689_1001095451 | 146 |
| 80 | 3300005345 | Ga0070692_10066185 | Ga0070692_100661852 | 146 |
| 81 | 3300005455 | Ga0070663_100020640 | Ga0070663_1000206402 | 146 |
| 82 | 3300005535 | Ga0070684_101501222 | Ga0070684_1015012221 | 146 |
| 83 | 3300005564 | Ga0070664_100833625 | Ga0070664_1008336251 | 146 |
| 84 | 3300009147 | Ga0114129_11433426 | Ga0114129_114334261 | 146 |
| 85 | 3300014326 | Ga0157380_12455849 | Ga0157380_124558491 | 146 |
| 86 | 3300014968 | Ga0157379_10310164 | Ga0157379_103101642 | 146 |
| 87 | 3300025932 | Ga0207690_10677336 | Ga0207690_106773362 | 146 |
| 88 | 3300025936 | Ga0207670_10624625 | Ga0207670_106246252 | 146 |
| 89 | 3300025944 | Ga0207661_10050882 | Ga0207661_100508824 | 146 |
| 90 | 3300026067 | Ga0207678_10001423 | Ga0207678_100014235 | 146 |
| 91 | 3300031344 | Ga0265316_10636963 | Ga0265316_106369631 | 146 |
| 92 | 3300031456 | Ga0307513_10431514 | Ga0307513_104315141 | 146 |
| 93 | 3300031730 | Ga0307516_10058777 | Ga0307516_100587775 | 146 |
| 94 | 3300032002 | Ga0307416_100979207 | Ga0307416_1009792072 | 146 |
| 95 | 3300035084 | Ga0373928_0061463 | Ga0373928_0061463_444_890 | 146 |
| 96 | 3300035112 | Ga0373932_0034080 | Ga0373932_0034080_846_1292 | 146 |
| 97 | 3300035398 | Ga0316574_0190798 | Ga0316574_0190798_239_694 | 146 |
| 98 | 3300035691 | Ga0373931_0035758 | Ga0373931_0035758_1758_2204 | 146 |
| 99 | 3300035692 | Ga0373935_0122257 | Ga0373935_0122257_1082_1528 | 146 |
| 100 | 3300036401 | Ga0373937_1002568 | Ga0373937_1002568_225_671 | 146 |
| 101 | 3300037418 | Ga0395900_0094955 | Ga0395900_0094955_264_710 | 146 |
| 102 | 3300037466 | Ga0395898_0021508 | Ga0395898_0021508_5040_5486 | 146 |
| 103 | 3300037471 | Ga0395905_0545522 | Ga0395905_0545522_31_477 | 146 |
| 104 | 3300038443 | Ga0395901_0242732 | Ga0395901_0242732_265_711 | 146 |
| 105 | 3300039437 | Ga0436365_1899237 | Ga0436365_1899237_115_558 | 146 |
| 106 | 3300039447 | Ga0436361_0238763 | Ga0436361_0238763_1181_1627 | 146 |
| 107 | 3300041460 | Ga0451802_1751721 | Ga0451802_1751721_11_454 | 146 |
| 108 | 3300041463 | Ga0451804_0874594 | Ga0451804_0874594_183_629 | 146 |
| 109 | 3300042004 | Ga0439445_0104735 | Ga0439445_0104735_254_700 | 146 |
| 110 | 3300042006 | Ga0439432_004532 | Ga0439432_004532_4427_4873 | 146 |
| 111 | 3300049587 | Ga0501071_1398619 | Ga0501071_1398619_39_485 | 146 |
| 112 | 3300050496 | nmdc:mga07m45_171882_c1 | nmdc:mga07m45_171882_c1_187_636 | 146 |
| 113 | 3300053103 | Ga0500555_007953 | Ga0500555_007953_87_530 | 146 |
| 114 | 3300003320 | rootH2_10047961 | rootH2_100479614 | 147 |
| 115 | 3300005457 | Ga0070662_100220015 | Ga0070662_1002200152 | 147 |
| 116 | 3300009988 | Ga0105035_105232 | Ga0105035_1052322 | 147 |
| 117 | 3300025905 | Ga0207685_10289473 | Ga0207685_102894731 | 147 |
| 118 | 3300025932 | Ga0207690_10609636 | Ga0207690_106096362 | 147 |
| 119 | 3300025933 | Ga0207706_10312484 | Ga0207706_103124842 | 147 |
| 120 | 3300031548 | Ga0307408_100198915 | Ga0307408_1001989152 | 147 |
| 121 | 3300031901 | Ga0307406_10128946 | Ga0307406_101289462 | 147 |
| 122 | 3300031995 | Ga0307409_100185001 | Ga0307409_1001850013 | 147 |
| 123 | 3300032002 | Ga0307416_100067803 | Ga0307416_1000678033 | 147 |
| 124 | 3300032004 | Ga0307414_10140922 | Ga0307414_101409222 | 147 |
| 125 | 3300032004 | Ga0307414_10151685 | Ga0307414_101516853 | 147 |
| 126 | 3300032005 | Ga0307411_10259166 | Ga0307411_102591662 | 147 |
| 127 | 3300035115 | Ga0373941_0040278 | Ga0373941_0040278_877_1323 | 147 |
| 128 | 3300035241 | Ga0373961_0189150 | Ga0373961_0189150_116_571 | 147 |
| 129 | 3300042006 | Ga0439432_046703 | Ga0439432_046703_724_1173 | 147 |
| 130 | 3300042006 | Ga0439432_181281 | Ga0439432_181281_18_467 | 147 |
| 131 | 3300042144 | Ga0450889_018867 | Ga0450889_018867_143_592 | 147 |
| 132 | 3300046455 | Ga0495603_0091882 | Ga0495603_0091882_180_632 | 147 |
| 133 | 3300047444 | Ga0495675_0488881 | Ga0495675_0488881_13_483 | 147 |
| 134 | 3300048907 | Ga0496104_0001301 | Ga0496104_0001301_19706_20158 | 147 |
| 135 | 3300048908 | Ga0496105_0001938 | Ga0496105_0001938_2716_3168 | 147 |
| 136 | 3300048911 | Ga0496108_0007947 | Ga0496108_0007947_6821_7273 | 147 |
| 137 | 3300048912 | Ga0496109_0013292 | Ga0496109_0013292_6229_6681 | 147 |
| 138 | 3300048913 | Ga0496110_0009456 | Ga0496110_0009456_6534_6986 | 147 |
| 139 | 3300048914 | Ga0496111_0002469 | Ga0496111_0002469_7360_7812 | 147 |
| 140 | 3300048915 | Ga0496112_0041119 | Ga0496112_0041119_3513_3965 | 147 |
| 141 | 3300048916 | Ga0496113_0069023 | Ga0496113_0069023_2178_2630 | 147 |
| 142 | 3300048928 | Ga0496125_0105608 | Ga0496125_0105608_1138_1581 | 147 |
| 143 | 3300049584 | Ga0501068_0349003 | Ga0501068_0349003_19_471 | 147 |
| 144 | 3300050496 | nmdc:mga07m45_658517_c1 | nmdc:mga07m45_658517_c1_21_464 | 147 |
| 145 | 3300053737 | Ga0500601_000206 | Ga0500601_000206_11417_11866 | 147 |
| 146 | 3300054114 | Ga0501084_1692363 | Ga0501084_1692363_26_469 | 147 |
| 147 | 3300001989 | JGI24739J22299_10135061 | JGI24739J22299_101350612 | 148 |
| 148 | 3300003354 | JGI25160J50197_1004791 | JGI25160J50197_10047914 | 148 |
| 149 | 3300005262 | Ga0065165_1004030 | Ga0065165_10040303 | 148 |
| 150 | 3300005262 | Ga0065165_1032860 | Ga0065165_10328603 | 148 |
| 151 | 3300005329 | Ga0070683_101811015 | Ga0070683_1018110151 | 148 |
| 152 | 3300005331 | Ga0070670_101316187 | Ga0070670_1013161871 | 148 |
| 153 | 3300005333 | Ga0070677_10085901 | Ga0070677_100859012 | 148 |
| 154 | 3300005336 | Ga0070680_100281164 | Ga0070680_1002811642 | 148 |
| 155 | 3300005336 | Ga0070680_101620926 | Ga0070680_1016209261 | 148 |
| 156 | 3300005347 | Ga0070668_100020232 | Ga0070668_1000202327 | 148 |
| 157 | 3300005347 | Ga0070668_100210272 | Ga0070668_1002102722 | 148 |
| 158 | 3300005353 | Ga0070669_100012194 | Ga0070669_1000121945 | 148 |
| 159 | 3300005441 | Ga0070700_100142070 | Ga0070700_1001420701 | 148 |
| 160 | 3300005457 | Ga0070662_100022242 | Ga0070662_1000222423 | 148 |
| 161 | 3300005471 | Ga0070698_100276496 | Ga0070698_1002764962 | 148 |
| 162 | 3300005530 | Ga0070679_100033899 | Ga0070679_1000338994 | 148 |
| 163 | 3300005563 | Ga0068855_100175229 | Ga0068855_1001752294 | 148 |
| 164 | 3300005841 | Ga0068863_100137145 | Ga0068863_1001371452 | 148 |
| 165 | 3300005843 | Ga0068860_100152170 | Ga0068860_1001521703 | 148 |
| 166 | 3300005844 | Ga0068862_101015754 | Ga0068862_1010157542 | 148 |
| 167 | 3300009553 | Ga0105249_10179375 | Ga0105249_101793751 | 148 |
| 168 | 3300021361 | Ga0213872_10148620 | Ga0213872_101486201 | 148 |
| 169 | 3300025297 | Ga0209758_1049226 | Ga0209758_10492263 | 148 |
| 170 | 3300025302 | Ga0207426_1001014 | Ga0207426_10010143 | 148 |
| 171 | 3300025302 | Ga0207426_1003388 | Ga0207426_10033882 | 148 |
| 172 | 3300025893 | Ga0207682_10013233 | Ga0207682_100132332 | 148 |
| 173 | 3300025912 | Ga0207707_10054569 | Ga0207707_100545694 | 148 |
| 174 | 3300025917 | Ga0207660_10969376 | Ga0207660_109693762 | 148 |
| 175 | 3300025921 | Ga0207652_10047138 | Ga0207652_100471383 | 148 |
| 176 | 3300025933 | Ga0207706_10000143 | Ga0207706_1000014312 | 148 |
| 177 | 3300025949 | Ga0207667_10097185 | Ga0207667_100971852 | 148 |
| 178 | 3300025961 | Ga0207712_10733350 | Ga0207712_107333502 | 148 |
| 179 | 3300025972 | Ga0207668_10030734 | Ga0207668_100307343 | 148 |
| 180 | 3300025972 | Ga0207668_10156908 | Ga0207668_101569082 | 148 |
| 181 | 3300026035 | Ga0207703_10325505 | Ga0207703_103255052 | 148 |
| 182 | 3300026075 | Ga0207708_10180899 | Ga0207708_101808992 | 148 |
| 183 | 3300026088 | Ga0207641_10184515 | Ga0207641_101845152 | 148 |
| 184 | 3300026088 | Ga0207641_10611948 | Ga0207641_106119482 | 148 |
| 185 | 3300026088 | Ga0207641_12429036 | Ga0207641_124290361 | 148 |
| 186 | 3300028380 | Ga0268265_10744595 | Ga0268265_107445952 | 148 |
| 187 | 3300028381 | Ga0268264_10153425 | Ga0268264_101534253 | 148 |
| 188 | 3300031247 | Ga0265340_10015112 | Ga0265340_100151122 | 148 |
| 189 | 3300031249 | Ga0265339_10154511 | Ga0265339_101545112 | 148 |
| 190 | 3300035119 | Ga0373956_0570910 | Ga0373956_0570910_36_488 | 148 |
| 191 | 3300037312 | Ga0395899_0289495 | Ga0395899_0289495_420_866 | 148 |
| 192 | 3300037418 | Ga0395900_0083060 | Ga0395900_0083060_1525_1971 | 148 |
| 193 | 3300037418 | Ga0395900_0117585 | Ga0395900_0117585_1803_2249 | 148 |
| 194 | 3300037466 | Ga0395898_0144462 | Ga0395898_0144462_1387_1833 | 148 |
| 195 | 3300037471 | Ga0395905_0181084 | Ga0395905_0181084_588_1034 | 148 |
| 196 | 3300037471 | Ga0395905_0814824 | Ga0395905_0814824_161_607 | 148 |
| 197 | 3300037471 | Ga0395905_1759480 | Ga0395905_1759480_36_482 | 148 |
| 198 | 3300038443 | Ga0395901_0064410 | Ga0395901_0064410_207_653 | 148 |
| 199 | 3300039437 | Ga0436365_0830248 | Ga0436365_0830248_32850_33296 | 148 |
| 200 | 3300039450 | Ga0436363_1034111 | Ga0436363_1034111_623_1069 | 148 |
| 201 | 3300044683 | Ga0466965_0133412 | Ga0466965_0133412_832_1278 | 148 |
| 202 | 3300044684 | Ga0466966_0140221 | Ga0466966_0140221_67_513 | 148 |
| 203 | 3300045049 | Ga0466959_0051357 | Ga0466959_0051357_2311_2757 | 148 |
| 204 | 3300046454 | Ga0495592_0087475 | Ga0495592_0087475_1360_1812 | 148 |
| 205 | 3300046462 | Ga0495651_0006181 | Ga0495651_0006181_6717_7169 | 148 |
| 206 | 3300046463 | Ga0495653_0119911 | Ga0495653_0119911_764_1216 | 148 |
| 207 | 3300046507 | Ga0495606_0190585 | Ga0495606_0190585_700_1152 | 148 |
| 208 | 3300046511 | Ga0495608_0218195 | Ga0495608_0218195_239_691 | 148 |
| 209 | 3300046516 | Ga0495628_0082167 | Ga0495628_0082167_1253_1705 | 148 |
| 210 | 3300046524 | Ga0495648_0095349 | Ga0495648_0095349_76_528 | 148 |
| 211 | 3300046529 | Ga0495652_0020427 | Ga0495652_0020427_3363_3815 | 148 |
| 212 | 3300046533 | Ga0495640_0025929 | Ga0495640_0025929_1000_1452 | 148 |
| 213 | 3300046536 | Ga0495587_0012345 | Ga0495587_0012345_2632_3084 | 148 |
| 214 | 3300046543 | Ga0495645_0156418 | Ga0495645_0156418_1060_1512 | 148 |
| 215 | 3300046559 | Ga0495667_0007564 | Ga0495667_0007564_5236_5688 | 148 |
| 216 | 3300046642 | Ga0495634_0183414 | Ga0495634_0183414_139_591 | 148 |
| 217 | 3300046663 | Ga0495635_0168772 | Ga0495635_0168772_723_1175 | 148 |
| 218 | 3300046675 | Ga0495657_0008617 | Ga0495657_0008617_6716_7168 | 148 |
| 219 | 3300046678 | Ga0495599_0205800 | Ga0495599_0205800_254_706 | 148 |
| 220 | 3300046678 | Ga0495599_0841143 | Ga0495599_0841143_18_470 | 148 |
| 221 | 3300046680 | Ga0495646_0025468 | Ga0495646_0025468_1648_2100 | 148 |
| 222 | 3300046680 | Ga0495646_0089758 | Ga0495646_0089758_926_1378 | 148 |
| 223 | 3300046809 | Ga0495600_0005153 | Ga0495600_0005153_5312_5764 | 148 |
| 224 | 3300047317 | Ga0495604_0034874 | Ga0495604_0034874_930_1382 | 148 |
| 225 | 3300047319 | Ga0495674_0041860 | Ga0495674_0041860_2982_3434 | 148 |
| 226 | 3300047322 | Ga0495680_0002284 | Ga0495680_0002284_11286_11738 | 148 |
| 227 | 3300047323 | Ga0495683_0198924 | Ga0495683_0198924_88_540 | 148 |
| 228 | 3300047444 | Ga0495675_0018949 | Ga0495675_0018949_1160_1612 | 148 |
| 229 | 3300047472 | Ga0495686_0066039 | Ga0495686_0066039_100_552 | 148 |
| 230 | 3300048088 | Ga0495602_0017911 | Ga0495602_0017911_1161_1613 | 148 |
| 231 | 3300048920 | Ga0496117_0111984 | Ga0496117_0111984_679_1125 | 148 |
| 232 | 3300048924 | Ga0496121_0418547 | Ga0496121_0418547_128_580 | 148 |
| 233 | 3300048926 | Ga0496123_0013694 | Ga0496123_0013694_588_1034 | 148 |
| 234 | 3300049460 | Ga0495682_0081852 | Ga0495682_0081852_109_561 | 148 |
| 235 | 3300053079 | Ga0500610_0435472 | Ga0500610_0435472_39_491 | 148 |
| 236 | 3300053084 | Ga0495595_0406314 | Ga0495595_0406314_162_614 | 148 |
| 237 | 3300053109 | Ga0500569_015089 | Ga0500569_015089_907_1359 | 148 |
| 238 | 3300053731 | Ga0500609_006945 | Ga0500609_006945_450_902 | 148 |
| 239 | 3300053735 | Ga0500596_058157 | Ga0500596_058157_139_591 | 148 |
| 240 | iso_pu_bacteria | 2507262055 | 2507504521 | 148 |
| 241 | iso_pu_bacteria | 2508501009 | 2508545944 | 148 |
| 242 | iso_pu_bacteria | 2508501042 | 2508694797 | 148 |
| 243 | iso_pu_bacteria | 2508501128 | 2509146325 | 148 |
| 244 | iso_pu_bacteria | 2511231028 | 2511398246 | 148 |
| 245 | iso_pu_bacteria | 2513237092 | 2513626960 | 148 |
| 246 | iso_pu_bacteria | 2513237095 | 2513649281 | 148 |
| 247 | iso_pu_bacteria | 2513237104 | 2513714674 | 148 |
| 248 | iso_pu_bacteria | 2513237139 | 2513875502 | 148 |
| 249 | iso_pu_bacteria | 2513237161 | 2514011121 | 148 |
| 250 | iso_pu_bacteria | 2515154112 | 2515624261 | 148 |
| 251 | iso_pu_bacteria | 2517093001 | 2517102991 | 148 |
| 252 | iso_pu_bacteria | 2524023205 | 2524438817 | 148 |
| 253 | iso_pu_bacteria | 2528768022 | 2528849525 | 148 |
| 254 | iso_pu_bacteria | 2617270735 | 2617347662 | 148 |
| 255 | iso_pu_bacteria | 2617270741 | 2617374576 | 148 |
| 256 | iso_pu_bacteria | 2744054633 | 2745080404 | 148 |
| 257 | iso_pu_bacteria | 2791355196 | 2793063643 | 148 |
| 258 | iso_pu_bacteria | 2802429603 | 2805921143 | 148 |
| 259 | iso_pu_bacteria | 2816332527 | 2818240670 | 148 |
| 260 | iso_pu_bacteria | 2824600985 | 2824607231 | 148 |
| 261 | iso_pu_bacteria | 2824609381 | 2824616235 | 148 |
| 262 | iso_pu_bacteria | 2824617872 | 2824619470 | 148 |
| 263 | iso_pu_bacteria | 2824626560 | 2824627925 | 148 |
| 264 | iso_pu_bacteria | 2824635225 | 2824636031 | 148 |
| 265 | iso_pu_bacteria | 2824644064 | 2824647901 | 148 |
| 266 | iso_pu_bacteria | 2824653114 | 2824659130 | 148 |
| 267 | iso_pu_bacteria | 2824661429 | 2824667719 | 148 |
| 268 | iso_pu_bacteria | 2824671348 | 2824679070 | 148 |
| 269 | iso_pu_bacteria | 2824679649 | 2824686697 | 148 |
| 270 | iso_pu_bacteria | 2824687955 | 2824695673 | 148 |
| 271 | iso_pu_bacteria | 2824696289 | 2824701860 | 148 |
| 272 | iso_pu_bacteria | 2824704595 | 2824712202 | 148 |
| 273 | iso_pu_bacteria | 2824714736 | 2824720459 | 148 |
| 274 | iso_pu_bacteria | 2824723954 | 2824730729 | 148 |
| 275 | iso_pu_bacteria | 2824732956 | 2824736021 | 148 |
| 276 | iso_pu_bacteria | 2824746037 | 2824750648 | 148 |
| 277 | iso_pu_bacteria | 2824753945 | 2824761744 | 148 |
| 278 | iso_pu_bacteria | 2824763712 | 2824772243 | 148 |
| 279 | iso_pu_bacteria | 2824773399 | 2824775865 | 148 |
| 280 | iso_pu_bacteria | 2838122688 | 2838129254 | 148 |
| 281 | iso_pu_bacteria | 2841941048 | 2841945979 | 148 |
| 282 | iso_pu_bacteria | 2841949485 | 2841957610 | 148 |
| 283 | iso_pu_bacteria | 2841957949 | 2841963129 | 148 |
| 284 | iso_pu_bacteria | 2841966195 | 2841968900 | 148 |
| 285 | iso_pu_bacteria | 2841974524 | 2841979624 | 148 |
| 286 | iso_pu_bacteria | 2841983080 | 2841989730 | 148 |
| 287 | iso_pu_bacteria | 2842038055 | 2842044245 | 148 |
| 288 | iso_pu_bacteria | 2842045827 | 2842051766 | 148 |
| 289 | iso_pu_bacteria | 2847930680 | 2847931893 | 148 |
| 290 | iso_pu_bacteria | 2847939898 | 2847941401 | 148 |
| 291 | iso_pu_bacteria | 2849076700 | 2849082328 | 148 |
| 292 | iso_pu_bacteria | 2857509624 | 2857514889 | 148 |
| 293 | iso_pu_bacteria | 2874590934 | 2874595453 | 148 |
| 294 | iso_pu_bacteria | 2874612657 | 2874620107 | 148 |
| 295 | iso_pu_bacteria | 2874620515 | 2874621580 | 148 |
| 296 | iso_pu_bacteria | 2874628541 | 2874629530 | 148 |
| 297 | iso_pu_bacteria | 2874645413 | 2874651881 | 148 |
| 298 | iso_pu_bacteria | 2876761206 | 2876770515 | 148 |
| 299 | iso_pu_bacteria | 2876771140 | 2876775647 | 148 |
| 300 | iso_pu_bacteria | 2876818435 | 2876823639 | 148 |
| 301 | iso_pu_bacteria | 2879074833 | 2879079738 | 148 |
| 302 | iso_pu_bacteria | 2879083081 | 2879091197 | 148 |
| 303 | iso_pu_bacteria | 2879099564 | 2879103139 | 148 |
| 304 | iso_pu_bacteria | 2879127579 | 2879133858 | 148 |
| 305 | iso_pu_bacteria | 2879142872 | 2879144498 | 148 |
| 306 | iso_pu_bacteria | 2881364244 | 2881369736 | 148 |
| 307 | iso_pu_bacteria | 2885366525 | 2885368334 | 148 |
| 308 | iso_pu_bacteria | 2885409591 | 2885418061 | 148 |
| 309 | iso_pu_bacteria | 2888378607 | 2888380363 | 148 |
| 310 | iso_pu_bacteria | 2888388044 | 2888391351 | 148 |
| 311 | iso_pu_bacteria | 2888419890 | 2888427091 | 148 |
| 312 | iso_pu_bacteria | 2903727486 | 2903729400 | 148 |
| 313 | iso_pu_bacteria | 2904666416 | 2904668249 | 148 |
| 314 | iso_pu_bacteria | 2904711408 | 2904720036 | 148 |
| 315 | iso_pu_bacteria | 2906602504 | 2906606612 | 148 |
| 316 | iso_pu_bacteria | 2906626472 | 2906629619 | 148 |
| 317 | iso_pu_bacteria | 2906643746 | 2906645931 | 148 |
| 318 | iso_pu_bacteria | 2908775508 | 2908777055 | 148 |
| 319 | iso_pu_bacteria | 2922368715 | 2922369943 | 148 |
| 320 | iso_pu_bacteria | 2922393267 | 2922398699 | 148 |
| 321 | iso_pu_bacteria | 2929615660 | 2929622762 | 148 |
| 322 | iso_pu_bacteria | 2929624759 | 2929632134 | 148 |
| 323 | iso_pu_bacteria | 2932784394 | 2932789933 | 148 |
| 324 | iso_pu_bacteria | 2932794094 | 2932796109 | 148 |
| 325 | iso_pu_bacteria | 2932801729 | 2932807685 | 148 |
| 326 | iso_pu_bacteria | 2932809354 | 2932815475 | 148 |
| 327 | iso_pu_bacteria | 2932818245 | 2932825086 | 148 |
| 328 | iso_pu_bacteria | 2932828146 | 2932829211 | 148 |
| 329 | iso_pu_bacteria | 2933577622 | 2933584606 | 148 |
| 330 | iso_pu_bacteria | 2935608549 | 2935613075 | 148 |
| 331 | iso_pu_bacteria | 2935616580 | 2935617686 | 148 |
| 332 | iso_pu_bacteria | 2935638405 | 2935643731 | 148 |
| 333 | iso_pu_bacteria | 2935648319 | 2935654013 | 148 |
| 334 | iso_pu_bacteria | 2935656913 | 2935662885 | 148 |
| 335 | iso_pu_bacteria | 2935665750 | 2935670959 | 148 |
| 336 | iso_pu_bacteria | 2935675223 | 2935681602 | 148 |
| 337 | iso_pu_bacteria | 2935684952 | 2935692578 | 148 |
| 338 | iso_pu_bacteria | 2935694250 | 2935699167 | 148 |
| 339 | iso_pu_bacteria | 2935703347 | 2935709981 | 148 |
| 340 | iso_pu_bacteria | 2935713505 | 2935721196 | 148 |
| 341 | iso_pu_bacteria | 2935722832 | 2935730810 | 148 |
| 342 | iso_pu_bacteria | 2935732158 | 2935739886 | 148 |
| 343 | iso_pu_bacteria | 2935741537 | 2935748924 | 148 |
| 344 | iso_pu_bacteria | 2935750917 | 2935758794 | 148 |
| 345 | iso_pu_bacteria | 2935760218 | 2935767856 | 148 |
| 346 | iso_pu_bacteria | 2935769743 | 2935774904 | 148 |
| 347 | iso_pu_bacteria | 2935777560 | 2935779908 | 148 |
| 348 | iso_pu_bacteria | 2935785616 | 2935792178 | 148 |
| 349 | iso_pu_bacteria | 2935793552 | 2935798653 | 148 |
| 350 | iso_pu_bacteria | 2935801545 | 2935806824 | 148 |
| 351 | iso_pu_bacteria | 2935810662 | 2935817988 | 148 |
| 352 | iso_pu_bacteria | 2935819856 | 2935825073 | 148 |
| 353 | iso_pu_bacteria | 2935827899 | 2935834416 | 148 |
| 354 | iso_pu_bacteria | 2935837841 | 2935843859 | 148 |
| 355 | iso_pu_bacteria | 2935847175 | 2935852292 | 148 |
| 356 | iso_pu_bacteria | 2935855204 | 2935856815 | 148 |
| 357 | iso_pu_bacteria | 2935864058 | 2935868342 | 148 |
| 358 | iso_pu_bacteria | 2935873716 | 2935879652 | 148 |
| 359 | iso_pu_bacteria | 2935883170 | 2935887390 | 148 |
| 360 | iso_pu_bacteria | 2935908558 | 2935910726 | 148 |
| 361 | iso_pu_bacteria | 2935916978 | 2935921906 | 148 |
| 362 | iso_pu_bacteria | 2935926038 | 2935929955 | 148 |
| 363 | iso_pu_bacteria | 2935934488 | 2935937623 | 148 |
| 364 | iso_pu_bacteria | 2935942939 | 2935947978 | 148 |
| 365 | iso_pu_bacteria | 2935951376 | 2935956823 | 148 |
| 366 | iso_pu_bacteria | 2935959822 | 2935964921 | 148 |
| 367 | iso_pu_bacteria | 2935967501 | 2935970920 | 148 |
| 368 | iso_pu_bacteria | 2935975950 | 2935982594 | 148 |
| 369 | iso_pu_bacteria | 2935984226 | 2935984426 | 148 |
| 370 | iso_pu_bacteria | 2935992306 | 2935997158 | 148 |
| 371 | iso_pu_bacteria | 2936002035 | 2936009905 | 148 |
| 372 | iso_pu_bacteria | 2936011229 | 2936016918 | 148 |
| 373 | iso_pu_bacteria | 2936019824 | 2936025674 | 148 |
| 374 | iso_pu_bacteria | 2936028420 | 2936034516 | 148 |
| 375 | iso_pu_bacteria | 2936037263 | 2936044614 | 148 |
| 376 | iso_pu_bacteria | 2936046547 | 2936052450 | 148 |
| 377 | iso_pu_bacteria | 2936055302 | 2936055506 | 148 |
| 378 | iso_pu_bacteria | 2940556831 | 2940564616 | 148 |
| 379 | iso_pu_bacteria | 2941538514 | 2941545107 | 148 |
| 380 | iso_pu_bacteria | 3005483717 | 3005485912 | 148 |
| 381 | iso_pu_bacteria | 3005506211 | 3005510771 | 148 |
| 382 | iso_pu_bacteria | 3005587118 | 3005591735 | 148 |
| 383 | iso_pu_bacteria | 3005594810 | 3005595804 | 148 |
| 384 | iso_pu_bacteria | 3005710791 | 3005711769 | 148 |
| 385 | iso_pu_bacteria | 3005718088 | 3005719012 | 148 |
| 386 | iso_pu_bacteria | 8006926726 | 8006929689 | 148 |
| 387 | iso_pu_bacteria | 8016511872 | 8016518999 | 148 |
| 388 | iso_pu_bacteria | 8016522445 | 8016525421 | 148 |
| 389 | iso_pu_bacteria | 8016530956 | 8016539011 | 148 |
| 390 | iso_pu_bacteria | 8016548790 | 8016549999 | 148 |
| 391 | iso_pu_bacteria | 8016557553 | 8016558412 | 148 |
| 392 | iso_pu_bacteria | 8016566248 | 8016568703 | 148 |
| 393 | iso_pu_bacteria | 8016575299 | 8016581350 | 148 |
| 394 | iso_pu_bacteria | 8016583857 | 8016587278 | 148 |
| 395 | iso_pu_bacteria | 8016595262 | 8016596401 | 148 |
| 396 | iso_pu_bacteria | 8016603502 | 8016607270 | 148 |
| 397 | iso_pu_bacteria | 8016613128 | 8016619174 | 148 |
| 398 | iso_pu_bacteria | 8016622563 | 8016630418 | 148 |
| 399 | iso_pu_bacteria | 8016630954 | 8016636700 | 148 |
| 400 | iso_pu_bacteria | 8017057580 | 8017057695 | 148 |
| 401 | iso_pu_bacteria | 8019538911 | 8019541266 | 148 |
| 402 | iso_pu_bacteria | 8019547302 | 8019549363 | 148 |
| 403 | iso_pu_bacteria | 8019576017 | 8019578117 | 148 |
| 404 | iso_pu_bacteria | 8019586578 | 8019596152 | 148 |
| 405 | iso_pu_bacteria | 8019597564 | 8019605542 | 148 |
| 406 | iso_pu_bacteria | 8019608314 | 8019612996 | 148 |
| 407 | iso_pu_bacteria | 8019629233 | 8019638402 | 148 |
| 408 | iso_pu_bacteria | 8019648815 | 8019651527 | 148 |
| 409 | iso_pu_bacteria | 8019659431 | 8019666322 | 148 |
| 410 | iso_pu_bacteria | 8019668869 | 8019675818 | 148 |
| 411 | iso_pu_bacteria | 8019678201 | 8019680275 | 148 |
| 412 | iso_pu_bacteria | 8019687851 | 8019695493 | 148 |
| 413 | iso_pu_bacteria | 8055742211 | 8055750646 | 148 |
| 414 | 3300005338 | Ga0068868_100055747 | Ga0068868_1000557472 | 149 |
| 415 | 3300005340 | Ga0070689_101009126 | Ga0070689_1010091262 | 149 |
| 416 | 3300005341 | Ga0070691_10098784 | Ga0070691_100987841 | 149 |
| 417 | 3300005343 | Ga0070687_100827379 | Ga0070687_1008273791 | 149 |
| 418 | 3300005367 | Ga0070667_100601515 | Ga0070667_1006015152 | 149 |
| 419 | 3300005456 | Ga0070678_100892300 | Ga0070678_1008923002 | 149 |
| 420 | 3300005458 | Ga0070681_10070870 | Ga0070681_100708702 | 149 |
| 421 | 3300005471 | Ga0070698_100007138 | Ga0070698_1000071382 | 149 |
| 422 | 3300005518 | Ga0070699_100606401 | Ga0070699_1006064012 | 149 |
| 423 | 3300005530 | Ga0070679_100102543 | Ga0070679_1001025431 | 149 |
| 424 | 3300005539 | Ga0068853_100602905 | Ga0068853_1006029052 | 149 |
| 425 | 3300005578 | Ga0068854_100818194 | Ga0068854_1008181942 | 149 |
| 426 | 3300005614 | Ga0068856_100365959 | Ga0068856_1003659592 | 149 |
| 427 | 3300005618 | Ga0068864_100203722 | Ga0068864_1002037223 | 149 |
| 428 | 3300005834 | Ga0068851_10598626 | Ga0068851_105986262 | 149 |
| 429 | 3300005842 | Ga0068858_100045278 | Ga0068858_1000452782 | 149 |
| 430 | 3300005843 | Ga0068860_100836286 | Ga0068860_1008362862 | 149 |
| 431 | 3300006358 | Ga0068871_100136449 | Ga0068871_1001364493 | 149 |
| 432 | 3300007265 | Ga0099794_10285402 | Ga0099794_102854021 | 149 |
| 433 | 3300009092 | Ga0105250_10168572 | Ga0105250_101685722 | 149 |
| 434 | 3300009093 | Ga0105240_10062267 | Ga0105240_100622673 | 149 |
| 435 | 3300009094 | Ga0111539_10113875 | Ga0111539_101138756 | 149 |
| 436 | 3300009098 | Ga0105245_10037226 | Ga0105245_100372265 | 149 |
| 437 | 3300009174 | Ga0105241_11202462 | Ga0105241_112024621 | 149 |
| 438 | 3300009177 | Ga0105248_10037839 | Ga0105248_100378393 | 149 |
| 439 | 3300009551 | Ga0105238_10042157 | Ga0105238_100421575 | 149 |
| 440 | 3300009551 | Ga0105238_10856888 | Ga0105238_108568881 | 149 |
| 441 | 3300011119 | Ga0105246_10291533 | Ga0105246_102915332 | 149 |
| 442 | 3300013296 | Ga0157374_10332002 | Ga0157374_103320023 | 149 |
| 443 | 3300013297 | Ga0157378_10590625 | Ga0157378_105906252 | 149 |
| 444 | 3300013306 | Ga0163162_10310925 | Ga0163162_103109252 | 149 |
| 445 | 3300025903 | Ga0207680_10480306 | Ga0207680_104803062 | 149 |
| 446 | 3300025912 | Ga0207707_10656769 | Ga0207707_106567692 | 149 |
| 447 | 3300025913 | Ga0207695_10001322 | Ga0207695_1000132237 | 149 |
| 448 | 3300025913 | Ga0207695_10007864 | Ga0207695_100078646 | 149 |
| 449 | 3300025921 | Ga0207652_10075877 | Ga0207652_100758774 | 149 |
| 450 | 3300025924 | Ga0207694_10029327 | Ga0207694_100293275 | 149 |
| 451 | 3300025924 | Ga0207694_11272716 | Ga0207694_112727161 | 149 |
| 452 | 3300025934 | Ga0207686_10001391 | Ga0207686_100013914 | 149 |
| 453 | 3300025935 | Ga0207709_10717838 | Ga0207709_107178381 | 149 |
| 454 | 3300025939 | Ga0207665_10891855 | Ga0207665_108918552 | 149 |
| 455 | 3300025941 | Ga0207711_10141685 | Ga0207711_101416852 | 149 |
| 456 | 3300026035 | Ga0207703_10259804 | Ga0207703_102598041 | 149 |
| 457 | 3300042006 | Ga0439432_185993 | Ga0439432_185993_102_557 | 149 |
| 458 | 3300042010 | Ga0439452_055265 | Ga0439452_055265_65_520 | 149 |
| 459 | 3300046683 | Ga0495658_0245350 | Ga0495658_0245350_255_710 | 149 |
| 460 | 3300048918 | Ga0496115_0000373 | Ga0496115_0000373_8350_8802 | 149 |
| 461 | 3300053114 | Ga0500582_147200 | Ga0500582_147200_111_572 | 149 |
| 462 | 3300001990 | JGI24737J22298_10001915 | JGI24737J22298_100019153 | 150 |
| 463 | 3300002067 | JGI24735J21928_10073188 | JGI24735J21928_100731882 | 150 |
| 464 | 3300002075 | JGI24738J21930_10011146 | JGI24738J21930_100111462 | 150 |
| 465 | 3300002239 | JGI24034J26672_10016294 | JGI24034J26672_100162941 | 150 |
| 466 | 3300003214 | JGI25165J46597_1015826 | JGI25165J46597_10158262 | 150 |
| 467 | 3300003215 | JGI25153J46596_10015174 | JGI25153J46596_100151743 | 150 |
| 468 | 3300003354 | JGI25160J50197_1011588 | JGI25160J50197_10115883 | 150 |
| 469 | 3300003752 | Ga0055539_1009214 | Ga0055539_10092143 | 150 |
| 470 | 3300003759 | Ga0055525_1006348 | Ga0055525_10063482 | 150 |
| 471 | 3300003762 | Ga0055542_1015905 | Ga0055542_10159052 | 150 |
| 472 | 3300004625 | Ga0055543_1009168 | Ga0055543_10091682 | 150 |
| 473 | 3300005262 | Ga0065165_1001357 | Ga0065165_100135730 | 150 |
| 474 | 3300005262 | Ga0065165_1118997 | Ga0065165_11189971 | 150 |
| 475 | 3300005327 | Ga0070658_10000183 | Ga0070658_1000018328 | 150 |
| 476 | 3300005327 | Ga0070658_10022485 | Ga0070658_100224855 | 150 |
| 477 | 3300005327 | Ga0070658_10404775 | Ga0070658_104047752 | 150 |
| 478 | 3300005329 | Ga0070683_100001584 | Ga0070683_1000015844 | 150 |
| 479 | 3300005329 | Ga0070683_101014406 | Ga0070683_1010144062 | 150 |
| 480 | 3300005330 | Ga0070690_100029491 | Ga0070690_1000294912 | 150 |
| 481 | 3300005331 | Ga0070670_100305865 | Ga0070670_1003058652 | 150 |
| 482 | 3300005333 | Ga0070677_10091344 | Ga0070677_100913442 | 150 |
| 483 | 3300005335 | Ga0070666_10353594 | Ga0070666_103535942 | 150 |
| 484 | 3300005335 | Ga0070666_11122019 | Ga0070666_111220191 | 150 |
| 485 | 3300005336 | Ga0070680_100559481 | Ga0070680_1005594812 | 150 |
| 486 | 3300005337 | Ga0070682_100020796 | Ga0070682_1000207961 | 150 |
| 487 | 3300005339 | Ga0070660_100000355 | Ga0070660_10000035528 | 150 |
| 488 | 3300005339 | Ga0070660_100659182 | Ga0070660_1006591821 | 150 |
| 489 | 3300005344 | Ga0070661_100000485 | Ga0070661_1000004857 | 150 |
| 490 | 3300005347 | Ga0070668_100048002 | Ga0070668_1000480023 | 150 |
| 491 | 3300005353 | Ga0070669_100580157 | Ga0070669_1005801571 | 150 |
| 492 | 3300005354 | Ga0070675_100194941 | Ga0070675_1001949412 | 150 |
| 493 | 3300005355 | Ga0070671_100057964 | Ga0070671_1000579644 | 150 |
| 494 | 3300005355 | Ga0070671_100381490 | Ga0070671_1003814901 | 150 |
| 495 | 3300005366 | Ga0070659_100000643 | Ga0070659_10000064314 | 150 |
| 496 | 3300005367 | Ga0070667_100012808 | Ga0070667_1000128082 | 150 |
| 497 | 3300005455 | Ga0070663_100013584 | Ga0070663_1000135846 | 150 |
| 498 | 3300005455 | Ga0070663_100448900 | Ga0070663_1004489002 | 150 |
| 499 | 3300005457 | Ga0070662_100000837 | Ga0070662_1000008377 | 150 |
| 500 | 3300005457 | Ga0070662_100258418 | Ga0070662_1002584182 | 150 |
| 501 | 3300005458 | Ga0070681_10512761 | Ga0070681_105127612 | 150 |
| 502 | 3300005530 | Ga0070679_100357835 | Ga0070679_1003578352 | 150 |
| 503 | 3300005535 | Ga0070684_100033048 | Ga0070684_1000330482 | 150 |
| 504 | 3300005539 | Ga0068853_100001045 | Ga0068853_10000104514 | 150 |
| 505 | 3300005539 | Ga0068853_100708167 | Ga0068853_1007081672 | 150 |
| 506 | 3300005547 | Ga0070693_100000320 | Ga0070693_10000032013 | 150 |
| 507 | 3300005547 | Ga0070693_100380447 | Ga0070693_1003804471 | 150 |
| 508 | 3300005548 | Ga0070665_100014833 | Ga0070665_1000148337 | 150 |
| 509 | 3300005548 | Ga0070665_100118678 | Ga0070665_1001186782 | 150 |
| 510 | 3300005548 | Ga0070665_100161027 | Ga0070665_1001610272 | 150 |
| 511 | 3300005563 | Ga0068855_100001622 | Ga0068855_1000016228 | 150 |
| 512 | 3300005563 | Ga0068855_100194424 | Ga0068855_1001944242 | 150 |
| 513 | 3300005563 | Ga0068855_100672044 | Ga0068855_1006720442 | 150 |
| 514 | 3300005564 | Ga0070664_100000066 | Ga0070664_1000000667 | 150 |
| 515 | 3300005564 | Ga0070664_100222118 | Ga0070664_1002221183 | 150 |
| 516 | 3300005577 | Ga0068857_100547766 | Ga0068857_1005477662 | 150 |
| 517 | 3300005578 | Ga0068854_100028130 | Ga0068854_1000281302 | 150 |
| 518 | 3300005614 | Ga0068856_100000213 | Ga0068856_10000021328 | 150 |
| 519 | 3300005614 | Ga0068856_100192467 | Ga0068856_1001924673 | 150 |
| 520 | 3300005616 | Ga0068852_100001507 | Ga0068852_10000150713 | 150 |
| 521 | 3300005616 | Ga0068852_100117200 | Ga0068852_1001172002 | 150 |
| 522 | 3300005616 | Ga0068852_100203957 | Ga0068852_1002039573 | 150 |
| 523 | 3300005616 | Ga0068852_100514613 | Ga0068852_1005146132 | 150 |
| 524 | 3300005617 | Ga0068859_100256143 | Ga0068859_1002561432 | 150 |
| 525 | 3300005618 | Ga0068864_100846111 | Ga0068864_1008461112 | 150 |
| 526 | 3300005834 | Ga0068851_10037958 | Ga0068851_100379582 | 150 |
| 527 | 3300005841 | Ga0068863_100114135 | Ga0068863_1001141353 | 150 |
| 528 | 3300005842 | Ga0068858_100564543 | Ga0068858_1005645432 | 150 |
| 529 | 3300005842 | Ga0068858_101437046 | Ga0068858_1014370462 | 150 |
| 530 | 3300005983 | Ga0081540_1055324 | Ga0081540_10553241 | 150 |
| 531 | 3300005985 | Ga0081539_10014344 | Ga0081539_100143445 | 150 |
| 532 | 3300006038 | Ga0075365_10078425 | Ga0075365_100784252 | 150 |
| 533 | 3300006038 | Ga0075365_10105795 | Ga0075365_101057952 | 150 |
| 534 | 3300006042 | Ga0075368_10006046 | Ga0075368_100060464 | 150 |
| 535 | 3300006048 | Ga0075363_100037487 | Ga0075363_1000374873 | 150 |
| 536 | 3300006051 | Ga0075364_10103276 | Ga0075364_101032763 | 150 |
| 537 | 3300006177 | Ga0075362_10283695 | Ga0075362_102836952 | 150 |
| 538 | 3300006178 | Ga0075367_10038912 | Ga0075367_100389122 | 150 |
| 539 | 3300006195 | Ga0075366_10138911 | Ga0075366_101389112 | 150 |
| 540 | 3300006237 | Ga0097621_100656091 | Ga0097621_1006560912 | 150 |
| 541 | 3300006353 | Ga0075370_10108273 | Ga0075370_101082732 | 150 |
| 542 | 3300006358 | Ga0068871_100209360 | Ga0068871_1002093603 | 150 |
| 543 | 3300006844 | Ga0075428_100025030 | Ga0075428_1000250307 | 150 |
| 544 | 3300006931 | Ga0097620_100256150 | Ga0097620_1002561502 | 150 |
| 545 | 3300006941 | Ga0099825_1024608 | Ga0099825_10246083 | 150 |
| 546 | 3300006944 | Ga0099823_1028009 | Ga0099823_10280095 | 150 |
| 547 | 3300009093 | Ga0105240_10001688 | Ga0105240_1000168815 | 150 |
| 548 | 3300009093 | Ga0105240_10002991 | Ga0105240_1000299114 | 150 |
| 549 | 3300009093 | Ga0105240_10018058 | Ga0105240_100180583 | 150 |
| 550 | 3300009093 | Ga0105240_10180852 | Ga0105240_101808523 | 150 |
| 551 | 3300009098 | Ga0105245_10140865 | Ga0105245_101408652 | 150 |
| 552 | 3300009101 | Ga0105247_10075905 | Ga0105247_100759053 | 150 |
| 553 | 3300009147 | Ga0114129_10191941 | Ga0114129_101919416 | 150 |
| 554 | 3300009148 | Ga0105243_10249558 | Ga0105243_102495582 | 150 |
| 555 | 3300009174 | Ga0105241_10095345 | Ga0105241_100953452 | 150 |
| 556 | 3300009174 | Ga0105241_10151116 | Ga0105241_101511162 | 150 |
| 557 | 3300009174 | Ga0105241_10254547 | Ga0105241_102545472 | 150 |
| 558 | 3300009177 | Ga0105248_10001298 | Ga0105248_1000129815 | 150 |
| 559 | 3300009177 | Ga0105248_10135761 | Ga0105248_101357613 | 150 |
| 560 | 3300009545 | Ga0105237_10180625 | Ga0105237_101806253 | 150 |
| 561 | 3300009545 | Ga0105237_10943261 | Ga0105237_109432612 | 150 |
| 562 | 3300009551 | Ga0105238_10443089 | Ga0105238_104430892 | 150 |
| 563 | 3300009551 | Ga0105238_10493878 | Ga0105238_104938782 | 150 |
| 564 | 3300010375 | Ga0105239_10102315 | Ga0105239_101023152 | 150 |
| 565 | 3300010375 | Ga0105239_10251449 | Ga0105239_102514492 | 150 |
| 566 | 3300010375 | Ga0105239_11014354 | Ga0105239_110143542 | 150 |
| 567 | 3300013100 | Ga0157373_10062644 | Ga0157373_100626443 | 150 |
| 568 | 3300013102 | Ga0157371_10038930 | Ga0157371_100389303 | 150 |
| 569 | 3300013105 | Ga0157369_10310467 | Ga0157369_103104672 | 150 |
| 570 | 3300013296 | Ga0157374_10171354 | Ga0157374_101713542 | 150 |
| 571 | 3300013297 | Ga0157378_10365720 | Ga0157378_103657202 | 150 |
| 572 | 3300013307 | Ga0157372_10619689 | Ga0157372_106196892 | 150 |
| 573 | 3300014325 | Ga0163163_10000178 | Ga0163163_1000017848 | 150 |
| 574 | 3300014325 | Ga0163163_11709443 | Ga0163163_117094432 | 150 |
| 575 | 3300014968 | Ga0157379_10060043 | Ga0157379_100600433 | 150 |
| 576 | 3300014968 | Ga0157379_10280107 | Ga0157379_102801072 | 150 |
| 577 | 3300017792 | Ga0163161_10781217 | Ga0163161_107812172 | 150 |
| 578 | 3300017792 | Ga0163161_11183245 | Ga0163161_111832451 | 150 |
| 579 | 3300021320 | Ga0214544_1000003 | Ga0214544_1000003576 | 150 |
| 580 | 3300021321 | Ga0214542_1000022 | Ga0214542_1000022146 | 150 |
| 581 | 3300021324 | Ga0214545_1000010 | Ga0214545_100001037 | 150 |
| 582 | 3300021327 | Ga0214543_1000035 | Ga0214543_1000035146 | 150 |
| 583 | 3300021384 | Ga0213876_10257779 | Ga0213876_102577791 | 150 |
| 584 | 3300021388 | Ga0213875_10165273 | Ga0213875_101652731 | 150 |
| 585 | 3300025253 | Ga0209677_104648 | Ga0209677_1046485 | 150 |
| 586 | 3300025254 | Ga0209148_1000300 | Ga0209148_100030018 | 150 |
| 587 | 3300025261 | Ga0209233_1003105 | Ga0209233_10031057 | 150 |
| 588 | 3300025272 | Ga0209455_1004466 | Ga0209455_10044663 | 150 |
| 589 | 3300025295 | Ga0209564_1029846 | Ga0209564_10298462 | 150 |
| 590 | 3300025297 | Ga0209758_1001432 | Ga0209758_100143226 | 150 |
| 591 | 3300025297 | Ga0209758_1003439 | Ga0209758_100343912 | 150 |
| 592 | 3300025297 | Ga0209758_1008335 | Ga0209758_10083354 | 150 |
| 593 | 3300025297 | Ga0209758_1031443 | Ga0209758_10314432 | 150 |
| 594 | 3300025299 | Ga0209256_1050558 | Ga0209256_10505582 | 150 |
| 595 | 3300025302 | Ga0207426_1000271 | Ga0207426_1000271112 | 150 |
| 596 | 3300025315 | Ga0207697_10207181 | Ga0207697_102071812 | 150 |
| 597 | 3300025893 | Ga0207682_10050754 | Ga0207682_100507542 | 150 |
| 598 | 3300025901 | Ga0207688_10110930 | Ga0207688_101109303 | 150 |
| 599 | 3300025903 | Ga0207680_10000519 | Ga0207680_100005194 | 150 |
| 600 | 3300025903 | Ga0207680_10366172 | Ga0207680_103661722 | 150 |
| 601 | 3300025903 | Ga0207680_11016604 | Ga0207680_110166041 | 150 |
| 602 | 3300025909 | Ga0207705_10000234 | Ga0207705_1000023428 | 150 |
| 603 | 3300025911 | Ga0207654_10004047 | Ga0207654_100040477 | 150 |
| 604 | 3300025911 | Ga0207654_10031377 | Ga0207654_100313773 | 150 |
| 605 | 3300025911 | Ga0207654_10088027 | Ga0207654_100880272 | 150 |
| 606 | 3300025911 | Ga0207654_10395276 | Ga0207654_103952761 | 150 |
| 607 | 3300025912 | Ga0207707_10449298 | Ga0207707_104492982 | 150 |
| 608 | 3300025913 | Ga0207695_10000006 | Ga0207695_10000006319 | 150 |
| 609 | 3300025913 | Ga0207695_10001211 | Ga0207695_1000121120 | 150 |
| 610 | 3300025913 | Ga0207695_10004934 | Ga0207695_100049344 | 150 |
| 611 | 3300025913 | Ga0207695_10735192 | Ga0207695_107351922 | 150 |
| 612 | 3300025913 | Ga0207695_11352519 | Ga0207695_113525191 | 150 |
| 613 | 3300025914 | Ga0207671_10028139 | Ga0207671_100281394 | 150 |
| 614 | 3300025914 | Ga0207671_10043531 | Ga0207671_100435313 | 150 |
| 615 | 3300025919 | Ga0207657_10000598 | Ga0207657_1000059828 | 150 |
| 616 | 3300025920 | Ga0207649_10000159 | Ga0207649_1000015931 | 150 |
| 617 | 3300025921 | Ga0207652_10491948 | Ga0207652_104919482 | 150 |
| 618 | 3300025923 | Ga0207681_10635359 | Ga0207681_106353592 | 150 |
| 619 | 3300025924 | Ga0207694_10341424 | Ga0207694_103414242 | 150 |
| 620 | 3300025924 | Ga0207694_10381028 | Ga0207694_103810282 | 150 |
| 621 | 3300025925 | Ga0207650_10073235 | Ga0207650_100732352 | 150 |
| 622 | 3300025925 | Ga0207650_10411635 | Ga0207650_104116352 | 150 |
| 623 | 3300025927 | Ga0207687_10386557 | Ga0207687_103865572 | 150 |
| 624 | 3300025928 | Ga0207700_10194473 | Ga0207700_101944732 | 150 |
| 625 | 3300025931 | Ga0207644_10011728 | Ga0207644_100117286 | 150 |
| 626 | 3300025931 | Ga0207644_10070308 | Ga0207644_100703082 | 150 |
| 627 | 3300025932 | Ga0207690_10000120 | Ga0207690_1000012030 | 150 |
| 628 | 3300025932 | Ga0207690_10930172 | Ga0207690_109301721 | 150 |
| 629 | 3300025933 | Ga0207706_10000200 | Ga0207706_1000020028 | 150 |
| 630 | 3300025933 | Ga0207706_10042793 | Ga0207706_100427933 | 150 |
| 631 | 3300025935 | Ga0207709_10031989 | Ga0207709_100319892 | 150 |
| 632 | 3300025941 | Ga0207711_10001359 | Ga0207711_1000135920 | 150 |
| 633 | 3300025941 | Ga0207711_10240108 | Ga0207711_102401082 | 150 |
| 634 | 3300025941 | Ga0207711_11081104 | Ga0207711_110811042 | 150 |
| 635 | 3300025942 | Ga0207689_10755469 | Ga0207689_107554692 | 150 |
| 636 | 3300025944 | Ga0207661_10033052 | Ga0207661_100330523 | 150 |
| 637 | 3300025945 | Ga0207679_10000150 | Ga0207679_1000015046 | 150 |
| 638 | 3300025945 | Ga0207679_10185632 | Ga0207679_101856322 | 150 |
| 639 | 3300025949 | Ga0207667_10000443 | Ga0207667_1000044342 | 150 |
| 640 | 3300025949 | Ga0207667_10370734 | Ga0207667_103707342 | 150 |
| 641 | 3300025949 | Ga0207667_10458990 | Ga0207667_104589902 | 150 |
| 642 | 3300025981 | Ga0207640_10024896 | Ga0207640_100248964 | 150 |
| 643 | 3300025986 | Ga0207658_10010024 | Ga0207658_100100247 | 150 |
| 644 | 3300025986 | Ga0207658_10264130 | Ga0207658_102641302 | 150 |
| 645 | 3300026035 | Ga0207703_10526531 | Ga0207703_105265312 | 150 |
| 646 | 3300026035 | Ga0207703_10908037 | Ga0207703_109080372 | 150 |
| 647 | 3300026035 | Ga0207703_11067623 | Ga0207703_110676232 | 150 |
| 648 | 3300026041 | Ga0207639_10004498 | Ga0207639_100044982 | 150 |
| 649 | 3300026041 | Ga0207639_10176459 | Ga0207639_101764592 | 150 |
| 650 | 3300026067 | Ga0207678_10003750 | Ga0207678_100037509 | 150 |
| 651 | 3300026067 | Ga0207678_10188756 | Ga0207678_101887562 | 150 |
| 652 | 3300026078 | Ga0207702_10001142 | Ga0207702_1000114221 | 150 |
| 653 | 3300026088 | Ga0207641_10134215 | Ga0207641_101342153 | 150 |
| 654 | 3300026095 | Ga0207676_10751265 | Ga0207676_107512652 | 150 |
| 655 | 3300026095 | Ga0207676_10769708 | Ga0207676_107697082 | 150 |
| 656 | 3300026116 | Ga0207674_10023598 | Ga0207674_100235983 | 150 |
| 657 | 3300026118 | Ga0207675_101800732 | Ga0207675_1018007322 | 150 |
| 658 | 3300026121 | Ga0207683_10841198 | Ga0207683_108411982 | 150 |
| 659 | 3300026142 | Ga0207698_10004252 | Ga0207698_100042528 | 150 |
| 660 | 3300026142 | Ga0207698_10030363 | Ga0207698_100303632 | 150 |
| 661 | 3300026142 | Ga0207698_10839487 | Ga0207698_108394871 | 150 |
| 662 | 3300026142 | Ga0207698_11873672 | Ga0207698_118736721 | 150 |
| 663 | 3300027296 | Ga0209389_1000198 | Ga0209389_100019827 | 150 |
| 664 | 3300027361 | Ga0209489_101869 | Ga0209489_10186927 | 150 |
| 665 | 3300027363 | Ga0209700_100029 | Ga0209700_10002918 | 150 |
| 666 | 3300027866 | Ga0209813_10001368 | Ga0209813_100013686 | 150 |
| 667 | 3300028379 | Ga0268266_10002013 | Ga0268266_1000201313 | 150 |
| 668 | 3300028379 | Ga0268266_11135016 | Ga0268266_111350161 | 150 |
| 669 | 3300031548 | Ga0307408_100200300 | Ga0307408_1002003002 | 150 |
| 670 | 3300031731 | Ga0307405_10019636 | Ga0307405_100196363 | 150 |
| 671 | 3300031824 | Ga0307413_10028995 | Ga0307413_100289952 | 150 |
| 672 | 3300031852 | Ga0307410_10000614 | Ga0307410_100006145 | 150 |
| 673 | 3300031852 | Ga0307410_10020666 | Ga0307410_100206664 | 150 |
| 674 | 3300031852 | Ga0307410_10206070 | Ga0307410_102060702 | 150 |
| 675 | 3300031852 | Ga0307410_11058462 | Ga0307410_110584622 | 150 |
| 676 | 3300031901 | Ga0307406_10015297 | Ga0307406_100152972 | 150 |
| 677 | 3300031901 | Ga0307406_10028903 | Ga0307406_100289032 | 150 |
| 678 | 3300031903 | Ga0307407_10104661 | Ga0307407_101046612 | 150 |
| 679 | 3300031911 | Ga0307412_10099052 | Ga0307412_100990522 | 150 |
| 680 | 3300031995 | Ga0307409_100002345 | Ga0307409_1000023452 | 150 |
| 681 | 3300031995 | Ga0307409_100038331 | Ga0307409_1000383313 | 150 |
| 682 | 3300032002 | Ga0307416_100043233 | Ga0307416_1000432334 | 150 |
| 683 | 3300032002 | Ga0307416_100115023 | Ga0307416_1001150233 | 150 |
| 684 | 3300032002 | Ga0307416_100884032 | Ga0307416_1008840322 | 150 |
| 685 | 3300032004 | Ga0307414_10006519 | Ga0307414_100065196 | 150 |
| 686 | 3300032004 | Ga0307414_10020667 | Ga0307414_100206673 | 150 |
| 687 | 3300032004 | Ga0307414_10046840 | Ga0307414_100468403 | 150 |
| 688 | 3300032005 | Ga0307411_10006176 | Ga0307411_100061764 | 150 |
| 689 | 3300032005 | Ga0307411_10007844 | Ga0307411_100078445 | 150 |
| 690 | 3300032005 | Ga0307411_10389564 | Ga0307411_103895641 | 150 |
| 691 | 3300032126 | Ga0307415_100066441 | Ga0307415_1000664413 | 150 |
| 692 | 3300032126 | Ga0307415_100800155 | Ga0307415_1008001552 | 150 |
| 693 | 3300033179 | Ga0307507_10212954 | Ga0307507_102129542 | 150 |
| 694 | 3300034818 | Ga0373950_0025159 | Ga0373950_0025159_291_749 | 150 |
| 695 | 3300034957 | Ga0373938_0158013 | Ga0373938_0158013_116_574 | 150 |
| 696 | 3300035084 | Ga0373928_0041311 | Ga0373928_0041311_584_1042 | 150 |
| 697 | 3300035088 | Ga0373940_0039268 | Ga0373940_0039268_189_674 | 150 |
| 698 | 3300035090 | Ga0373949_0019819 | Ga0373949_0019819_1019_1504 | 150 |
| 699 | 3300035091 | Ga0373951_0015606 | Ga0373951_0015606_330_815 | 150 |
| 700 | 3300035115 | Ga0373941_0054640 | Ga0373941_0054640_190_648 | 150 |
| 701 | 3300035241 | Ga0373961_0019832 | Ga0373961_0019832_20_478 | 150 |
| 702 | 3300035691 | Ga0373931_0028511 | Ga0373931_0028511_816_1301 | 150 |
| 703 | 3300035691 | Ga0373931_0046073 | Ga0373931_0046073_683_1141 | 150 |
| 704 | 3300035692 | Ga0373935_0128209 | Ga0373935_0128209_1019_1483 | 150 |
| 705 | 3300035692 | Ga0373935_0209241 | Ga0373935_0209241_242_703 | 150 |
| 706 | 3300035695 | Ga0373927_0215017 | Ga0373927_0215017_122_583 | 150 |
| 707 | 3300035725 | Ga0373947_0141561 | Ga0373947_0141561_630_1094 | 150 |
| 708 | 3300035725 | Ga0373947_0231506 | Ga0373947_0231506_91_552 | 150 |
| 709 | 3300037312 | Ga0395899_0017890 | Ga0395899_0017890_1371_1826 | 150 |
| 710 | 3300037312 | Ga0395899_0042406 | Ga0395899_0042406_2416_2874 | 150 |
| 711 | 3300037312 | Ga0395899_0052695 | Ga0395899_0052695_1829_2287 | 150 |
| 712 | 3300037418 | Ga0395900_0000052 | Ga0395900_0000052_50256_50711 | 150 |
| 713 | 3300037418 | Ga0395900_0008741 | Ga0395900_0008741_9065_9523 | 150 |
| 714 | 3300037418 | Ga0395900_0190801 | Ga0395900_0190801_776_1234 | 150 |
| 715 | 3300037418 | Ga0395900_1012887 | Ga0395900_1012887_174_638 | 150 |
| 716 | 3300037418 | Ga0395900_1851594 | Ga0395900_1851594_40_498 | 150 |
| 717 | 3300037466 | Ga0395898_0019459 | Ga0395898_0019459_4130_4585 | 150 |
| 718 | 3300037466 | Ga0395898_0051087 | Ga0395898_0051087_3337_3801 | 150 |
| 719 | 3300037466 | Ga0395898_0126977 | Ga0395898_0126977_1512_2006 | 150 |
| 720 | 3300037471 | Ga0395905_0003469 | Ga0395905_0003469_4091_4549 | 150 |
| 721 | 3300037471 | Ga0395905_0078945 | Ga0395905_0078945_579_1034 | 150 |
| 722 | 3300037471 | Ga0395905_0091734 | Ga0395905_0091734_363_827 | 150 |
| 723 | 3300037471 | Ga0395905_0118028 | Ga0395905_0118028_629_1087 | 150 |
| 724 | 3300037471 | Ga0395905_0126722 | Ga0395905_0126722_1556_2014 | 150 |
| 725 | 3300037471 | Ga0395905_0240413 | Ga0395905_0240413_617_1075 | 150 |
| 726 | 3300037471 | Ga0395905_0355777 | Ga0395905_0355777_395_856 | 150 |
| 727 | 3300037471 | Ga0395905_0533241 | Ga0395905_0533241_93_551 | 150 |
| 728 | 3300037471 | Ga0395905_1451650 | Ga0395905_1451650_114_566 | 150 |
| 729 | 3300037853 | Ga0436364_1276852 | Ga0436364_1276852_270_734 | 150 |
| 730 | 3300038443 | Ga0395901_0000001 | Ga0395901_0000001_737289_737744 | 150 |
| 731 | 3300038443 | Ga0395901_0029696 | Ga0395901_0029696_2158_2616 | 150 |
| 732 | 3300038443 | Ga0395901_0048383 | Ga0395901_0048383_515_973 | 150 |
| 733 | 3300038443 | Ga0395901_0314273 | Ga0395901_0314273_1095_1550 | 150 |
| 734 | 3300038443 | Ga0395901_0367757 | Ga0395901_0367757_395_853 | 150 |
| 735 | 3300039437 | Ga0436365_0192116 | Ga0436365_0192116_1287_1751 | 150 |
| 736 | 3300039438 | Ga0436360_0436836 | Ga0436360_0436836_501_971 | 150 |
| 737 | 3300039447 | Ga0436361_0062076 | Ga0436361_0062076_197_652 | 150 |
| 738 | 3300039450 | Ga0436363_0417278 | Ga0436363_0417278_269_733 | 150 |
| 739 | 3300039450 | Ga0436363_1343732 | Ga0436363_1343732_180_644 | 150 |
| 740 | 3300041456 | Ga0451795_1174563 | Ga0451795_1174563_271_735 | 150 |
| 741 | 3300041463 | Ga0451804_0787336 | Ga0451804_0787336_266_730 | 150 |
| 742 | 3300041486 | Ga0451807_2537906 | Ga0451807_2537906_139_660 | 150 |
| 743 | 3300041507 | Ga0451851_0666669 | Ga0451851_0666669_12_476 | 150 |
| 744 | 3300041509 | Ga0451843_1595677 | Ga0451843_1595677_23_487 | 150 |
| 745 | 3300042006 | Ga0439432_041183 | Ga0439432_041183_404_862 | 150 |
| 746 | 3300042015 | Ga0439462_0024348 | Ga0439462_0024348_476_934 | 150 |
| 747 | 3300042122 | Ga0450920_007363 | Ga0450920_007363_1110_1568 | 150 |
| 748 | 3300042156 | Ga0439446_0157633 | Ga0439446_0157633_215_667 | 150 |
| 749 | 3300044656 | Ga0466969_0024643 | Ga0466969_0024643_2246_2710 | 150 |
| 750 | 3300044658 | Ga0466972_0016263 | Ga0466972_0016263_2469_2933 | 150 |
| 751 | 3300044658 | Ga0466972_0119214 | Ga0466972_0119214_345_809 | 150 |
| 752 | 3300044683 | Ga0466965_0094234 | Ga0466965_0094234_211_675 | 150 |
| 753 | 3300044684 | Ga0466966_0008540 | Ga0466966_0008540_5914_6378 | 150 |
| 754 | 3300044693 | Ga0466961_0000138 | Ga0466961_0000138_46781_47245 | 150 |
| 755 | 3300044694 | Ga0466963_0028237 | Ga0466963_0028237_25_489 | 150 |
| 756 | 3300044706 | Ga0466964_0029661 | Ga0466964_0029661_1655_2119 | 150 |
| 757 | 3300044706 | Ga0466964_0179058 | Ga0466964_0179058_152_616 | 150 |
| 758 | 3300044706 | Ga0466964_0385723 | Ga0466964_0385723_176_640 | 150 |
| 759 | 3300044735 | Ga0466968_0032411 | Ga0466968_0032411_287_751 | 150 |
| 760 | 3300044901 | Ga0466960_0162937 | Ga0466960_0162937_232_696 | 150 |
| 761 | 3300045049 | Ga0466959_0355644 | Ga0466959_0355644_215_679 | 150 |
| 762 | 3300045976 | Ga0466967_0104197 | Ga0466967_0104197_2011_2475 | 150 |
| 763 | 3300046455 | Ga0495603_0069546 | Ga0495603_0069546_70_534 | 150 |
| 764 | 3300046459 | Ga0495629_0019931 | Ga0495629_0019931_3100_3564 | 150 |
| 765 | 3300046460 | Ga0495638_0024359 | Ga0495638_0024359_1157_1621 | 150 |
| 766 | 3300046462 | Ga0495651_0047647 | Ga0495651_0047647_2781_3245 | 150 |
| 767 | 3300046474 | Ga0495605_0117181 | Ga0495605_0117181_680_1144 | 150 |
| 768 | 3300046474 | Ga0495605_0426787 | Ga0495605_0426787_19_483 | 150 |
| 769 | 3300046476 | Ga0495662_0094060 | Ga0495662_0094060_977_1441 | 150 |
| 770 | 3300046491 | Ga0495584_0042923 | Ga0495584_0042923_533_1018 | 150 |
| 771 | 3300046511 | Ga0495608_0127776 | Ga0495608_0127776_915_1379 | 150 |
| 772 | 3300046512 | Ga0495610_0065210 | Ga0495610_0065210_1111_1575 | 150 |
| 773 | 3300046513 | Ga0495616_0045788 | Ga0495616_0045788_1374_1838 | 150 |
| 774 | 3300046515 | Ga0495620_0179206 | Ga0495620_0179206_180_638 | 150 |
| 775 | 3300046516 | Ga0495628_0618554 | Ga0495628_0618554_289_753 | 150 |
| 776 | 3300046518 | Ga0495631_0237102 | Ga0495631_0237102_23_487 | 150 |
| 777 | 3300046519 | Ga0495632_0097355 | Ga0495632_0097355_143_607 | 150 |
| 778 | 3300046522 | Ga0495643_0018038 | Ga0495643_0018038_3026_3490 | 150 |
| 779 | 3300046524 | Ga0495648_0106363 | Ga0495648_0106363_113_577 | 150 |
| 780 | 3300046524 | Ga0495648_0210502 | Ga0495648_0210502_330_794 | 150 |
| 781 | 3300046531 | Ga0495665_0518137 | Ga0495665_0518137_58_522 | 150 |
| 782 | 3300046533 | Ga0495640_0028543 | Ga0495640_0028543_273_737 | 150 |
| 783 | 3300046542 | Ga0495597_0031129 | Ga0495597_0031129_835_1299 | 150 |
| 784 | 3300046616 | Ga0495668_0198214 | Ga0495668_0198214_380_844 | 150 |
| 785 | 3300046648 | Ga0495611_0247356 | Ga0495611_0247356_351_815 | 150 |
| 786 | 3300046663 | Ga0495635_0025058 | Ga0495635_0025058_3176_3640 | 150 |
| 787 | 3300046674 | Ga0495588_0121894 | Ga0495588_0121894_351_815 | 150 |
| 788 | 3300046675 | Ga0495657_0056380 | Ga0495657_0056380_88_552 | 150 |
| 789 | 3300046689 | Ga0495613_0002667 | Ga0495613_0002667_9769_10233 | 150 |
| 790 | 3300046690 | Ga0495624_0040277 | Ga0495624_0040277_1608_2072 | 150 |
| 791 | 3300046694 | Ga0495649_0170206 | Ga0495649_0170206_207_671 | 150 |
| 792 | 3300047315 | Ga0495581_0123864 | Ga0495581_0123864_82_546 | 150 |
| 793 | 3300047317 | Ga0495604_0001518 | Ga0495604_0001518_1401_1865 | 150 |
| 794 | 3300047321 | Ga0495676_0036433 | Ga0495676_0036433_420_884 | 150 |
| 795 | 3300047323 | Ga0495683_0299956 | Ga0495683_0299956_96_560 | 150 |
| 796 | 3300047443 | Ga0495687_003327 | Ga0495687_003327_3471_3935 | 150 |
| 797 | 3300047673 | Ga0495593_0038464 | Ga0495593_0038464_730_1194 | 150 |
| 798 | 3300048088 | Ga0495602_0123698 | Ga0495602_0123698_200_664 | 150 |
| 799 | 3300048089 | Ga0495614_0256940 | Ga0495614_0256940_283_747 | 150 |
| 800 | 3300048091 | Ga0495626_0079678 | Ga0495626_0079678_54_518 | 150 |
| 801 | 3300048903 | Ga0496100_0759575 | Ga0496100_0759575_112_576 | 150 |
| 802 | 3300048903 | Ga0496100_0953896 | Ga0496100_0953896_140_604 | 150 |
| 803 | 3300048904 | Ga0496101_0609763 | Ga0496101_0609763_95_559 | 150 |
| 804 | 3300048905 | Ga0496102_0018606 | Ga0496102_0018606_4424_4888 | 150 |
| 805 | 3300048905 | Ga0496102_0129992 | Ga0496102_0129992_122_586 | 150 |
| 806 | 3300048906 | Ga0496103_0010582 | Ga0496103_0010582_1801_2265 | 150 |
| 807 | 3300048906 | Ga0496103_0192512 | Ga0496103_0192512_638_1102 | 150 |
| 808 | 3300048907 | Ga0496104_0187623 | Ga0496104_0187623_592_1056 | 150 |
| 809 | 3300048907 | Ga0496104_0196267 | Ga0496104_0196267_42_506 | 150 |
| 810 | 3300048907 | Ga0496104_0365415 | Ga0496104_0365415_538_1002 | 150 |
| 811 | 3300048907 | Ga0496104_0983527 | Ga0496104_0983527_117_569 | 150 |
| 812 | 3300048908 | Ga0496105_0212489 | Ga0496105_0212489_706_1170 | 150 |
| 813 | 3300048909 | Ga0496106_0260546 | Ga0496106_0260546_533_997 | 150 |
| 814 | 3300048911 | Ga0496108_0159593 | Ga0496108_0159593_372_836 | 150 |
| 815 | 3300048911 | Ga0496108_1272429 | Ga0496108_1272429_136_594 | 150 |
| 816 | 3300048912 | Ga0496109_0573797 | Ga0496109_0573797_538_1002 | 150 |
| 817 | 3300048912 | Ga0496109_0838074 | Ga0496109_0838074_46_510 | 150 |
| 818 | 3300048913 | Ga0496110_1389731 | Ga0496110_1389731_108_572 | 150 |
| 819 | 3300048914 | Ga0496111_0042311 | Ga0496111_0042311_1538_1996 | 150 |
| 820 | 3300048915 | Ga0496112_0202054 | Ga0496112_0202054_926_1390 | 150 |
| 821 | 3300048916 | Ga0496113_0143564 | Ga0496113_0143564_1057_1521 | 150 |
| 822 | 3300048917 | Ga0496114_0059745 | Ga0496114_0059745_329_793 | 150 |
| 823 | 3300048918 | Ga0496115_0327843 | Ga0496115_0327843_617_1081 | 150 |
| 824 | 3300048920 | Ga0496117_0030996 | Ga0496117_0030996_2027_2491 | 150 |
| 825 | 3300048920 | Ga0496117_0125286 | Ga0496117_0125286_779_1243 | 150 |
| 826 | 3300048921 | Ga0496118_0197322 | Ga0496118_0197322_363_827 | 150 |
| 827 | 3300048921 | Ga0496118_0224412 | Ga0496118_0224412_307_771 | 150 |
| 828 | 3300048922 | Ga0496119_0035346 | Ga0496119_0035346_509_973 | 150 |
| 829 | 3300048922 | Ga0496119_0063971 | Ga0496119_0063971_772_1236 | 150 |
| 830 | 3300048922 | Ga0496119_0073985 | Ga0496119_0073985_1397_1861 | 150 |
| 831 | 3300048923 | Ga0496120_0012429 | Ga0496120_0012429_23_487 | 150 |
| 832 | 3300048923 | Ga0496120_0120606 | Ga0496120_0120606_716_1180 | 150 |
| 833 | 3300048924 | Ga0496121_0008706 | Ga0496121_0008706_504_968 | 150 |
| 834 | 3300048925 | Ga0496122_0240507 | Ga0496122_0240507_422_886 | 150 |
| 835 | 3300048927 | Ga0496124_0059478 | Ga0496124_0059478_867_1331 | 150 |
| 836 | 3300048928 | Ga0496125_0011397 | Ga0496125_0011397_6431_6925 | 150 |
| 837 | 3300048928 | Ga0496125_0056157 | Ga0496125_0056157_2678_3142 | 150 |
| 838 | 3300048928 | Ga0496125_0244883 | Ga0496125_0244883_271_735 | 150 |
| 839 | 3300049460 | Ga0495682_0023983 | Ga0495682_0023983_118_582 | 150 |
| 840 | 3300049573 | Ga0501037_0333584 | Ga0501037_0333584_161_616 | 150 |
| 841 | 3300049581 | Ga0501047_0092875 | Ga0501047_0092875_1888_2343 | 150 |
| 842 | 3300049586 | Ga0501070_1385252 | Ga0501070_1385252_45_500 | 150 |
| 843 | 3300049742 | Ga0501080_1068757 | Ga0501080_1068757_123_578 | 150 |
| 844 | 3300049822 | Ga0501035_0043797 | Ga0501035_0043797_3010_3465 | 150 |
| 845 | 3300049823 | Ga0501044_0007508 | Ga0501044_0007508_9659_10114 | 150 |
| 846 | 3300050489 | nmdc:mga03683_126074_c1 | nmdc:mga03683_126074_c1_361_825 | 150 |
| 847 | 3300050490 | nmdc:mga03n38_125771_c1 | nmdc:mga03n38_125771_c1_519_983 | 150 |
| 848 | 3300050491 | nmdc:mga00v17_396635_c1 | nmdc:mga00v17_396635_c1_238_702 | 150 |
| 849 | 3300050492 | nmdc:mga0yw44_21034_c1 | nmdc:mga0yw44_21034_c1_2489_2953 | 150 |
| 850 | 3300050492 | nmdc:mga0yw44_222257_c1 | nmdc:mga0yw44_222257_c1_94_558 | 150 |
| 851 | 3300050492 | nmdc:mga0yw44_357663_c1 | nmdc:mga0yw44_357663_c1_111_575 | 150 |
| 852 | 3300050493 | nmdc:mga0k408_12833_c1 | nmdc:mga0k408_12833_c1_2281_2745 | 150 |
| 853 | 3300050495 | nmdc:mga04h51_2392_c1 | nmdc:mga04h51_2392_c1_397_861 | 150 |
| 854 | 3300050496 | nmdc:mga07m45_11800_c1 | nmdc:mga07m45_11800_c1_818_1282 | 150 |
| 855 | 3300050507 | nmdc:mga05p37_198660_c1 | nmdc:mga05p37_198660_c1_1349_1834 | 150 |
| 856 | 3300050516 | nmdc:mga0sz30_133229_c1 | nmdc:mga0sz30_133229_c1_399_863 | 150 |
| 857 | 3300050516 | nmdc:mga0sz30_36310_c1 | nmdc:mga0sz30_36310_c1_744_1208 | 150 |
| 858 | 3300050516 | nmdc:mga0sz30_43159_c1 | nmdc:mga0sz30_43159_c1_356_820 | 150 |
| 859 | 3300053087 | Ga0500643_000068 | Ga0500643_000068_113761_114225 | 150 |
| 860 | 3300053091 | Ga0500647_0027416 | Ga0500647_0027416_351_815 | 150 |
| 861 | 3300053096 | Ga0500641_0005471 | Ga0500641_0005471_1225_1689 | 150 |
| 862 | 3300053105 | Ga0500557_000141 | Ga0500557_000141_1174_1638 | 150 |
| 863 | 3300053108 | Ga0500562_080298 | Ga0500562_080298_324_788 | 150 |
| 864 | 3300053109 | Ga0500569_020803 | Ga0500569_020803_136_600 | 150 |
| 865 | 3300053118 | Ga0500594_0026329 | Ga0500594_0026329_679_1143 | 150 |
| 866 | 3300053130 | Ga0500642_0000088 | Ga0500642_0000088_4390_4854 | 150 |
| 867 | 3300053136 | Ga0500559_0067336 | Ga0500559_0067336_239_703 | 150 |
| 868 | 3300053148 | Ga0500590_020885 | Ga0500590_020885_92_556 | 150 |
| 869 | 3300053153 | Ga0500616_0019727 | Ga0500616_0019727_2655_3119 | 150 |
| 870 | 3300053156 | Ga0500622_0024256 | Ga0500622_0024256_2708_3172 | 150 |
| 871 | 3300053177 | Ga0500636_0250611 | Ga0500636_0250611_301_765 | 150 |
| 872 | 3300053729 | Ga0500625_055583 | Ga0500625_055583_301_765 | 150 |
| 873 | 3300053733 | Ga0500552_002940 | Ga0500552_002940_993_1457 | 150 |
| 874 | 3300053736 | Ga0500599_000688 | Ga0500599_000688_161_625 | 150 |
| 875 | 3300005435 | Ga0070714_100090791 | Ga0070714_1000907913 | 151 |
| 876 | 3300037418 | Ga0395900_0025336 | Ga0395900_0025336_1161_1628 | 151 |
| 877 | 3300037418 | Ga0395900_0039329 | Ga0395900_0039329_254_721 | 151 |
| 878 | 3300037466 | Ga0395898_0078609 | Ga0395898_0078609_995_1462 | 151 |
| 879 | 3300037471 | Ga0395905_0002924 | Ga0395905_0002924_13088_13555 | 151 |
| 880 | 3300037471 | Ga0395905_1416961 | Ga0395905_1416961_43_510 | 151 |
| 881 | 3300038443 | Ga0395901_0243319 | Ga0395901_0243319_453_920 | 151 |
| 882 | 3300038443 | Ga0395901_0688655 | Ga0395901_0688655_47_514 | 151 |
| 883 | 3300039437 | Ga0436365_0991055 | Ga0436365_0991055_596_1066 | 151 |
| 884 | 3300039450 | Ga0436363_0051271 | Ga0436363_0051271_1122_1592 | 151 |
| 885 | 3300039453 | Ga0436362_1242088 | Ga0436362_1242088_1435_1905 | 151 |
| 886 | 3300001904 | JGI24736J21556_1004541 | JGI24736J21556_10045412 | 152 |
| 887 | 3300001990 | JGI24737J22298_10086620 | JGI24737J22298_100866202 | 152 |
| 888 | 3300005329 | Ga0070683_100185701 | Ga0070683_1001857012 | 152 |
| 889 | 3300005339 | Ga0070660_100095126 | Ga0070660_1000951263 | 152 |
| 890 | 3300005344 | Ga0070661_100571415 | Ga0070661_1005714151 | 152 |
| 891 | 3300005455 | Ga0070663_100146941 | Ga0070663_1001469412 | 152 |
| 892 | 3300005535 | Ga0070684_100511943 | Ga0070684_1005119431 | 152 |
| 893 | 3300005563 | Ga0068855_100263718 | Ga0068855_1002637182 | 152 |
| 894 | 3300005577 | Ga0068857_100755357 | Ga0068857_1007553572 | 152 |
| 895 | 3300005614 | Ga0068856_100067312 | Ga0068856_1000673124 | 152 |
| 896 | 3300005614 | Ga0068856_100124240 | Ga0068856_1001242404 | 152 |
| 897 | 3300005614 | Ga0068856_100507150 | Ga0068856_1005071502 | 152 |
| 898 | 3300005616 | Ga0068852_100113240 | Ga0068852_1001132402 | 152 |
| 899 | 3300009093 | Ga0105240_10064329 | Ga0105240_100643292 | 152 |
| 900 | 3300009174 | Ga0105241_10433901 | Ga0105241_104339012 | 152 |
| 901 | 3300010375 | Ga0105239_10760939 | Ga0105239_107609392 | 152 |
| 902 | 3300013102 | Ga0157371_10110034 | Ga0157371_101100342 | 152 |
| 903 | 3300013102 | Ga0157371_10347273 | Ga0157371_103472732 | 152 |
| 904 | 3300013104 | Ga0157370_10566756 | Ga0157370_105667562 | 152 |
| 905 | 3300013105 | Ga0157369_10008575 | Ga0157369_1000857511 | 152 |
| 906 | 3300013105 | Ga0157369_10186203 | Ga0157369_101862032 | 152 |
| 907 | 3300013296 | Ga0157374_10265751 | Ga0157374_102657512 | 152 |
| 908 | 3300013307 | Ga0157372_11528491 | Ga0157372_115284912 | 152 |
| 909 | 3300025904 | Ga0207647_10032575 | Ga0207647_100325752 | 152 |
| 910 | 3300025909 | Ga0207705_10000101 | Ga0207705_1000010175 | 152 |
| 911 | 3300025911 | Ga0207654_10031955 | Ga0207654_100319553 | 152 |
| 912 | 3300025913 | Ga0207695_10002104 | Ga0207695_100021046 | 152 |
| 913 | 3300025913 | Ga0207695_10031813 | Ga0207695_100318135 | 152 |
| 914 | 3300025919 | Ga0207657_10429531 | Ga0207657_104295312 | 152 |
| 915 | 3300025920 | Ga0207649_10000720 | Ga0207649_1000072019 | 152 |
| 916 | 3300025932 | Ga0207690_10005032 | Ga0207690_100050323 | 152 |
| 917 | 3300025949 | Ga0207667_10022526 | Ga0207667_100225266 | 152 |
| 918 | 3300025949 | Ga0207667_10088935 | Ga0207667_100889352 | 152 |
| 919 | 3300025949 | Ga0207667_10199448 | Ga0207667_101994482 | 152 |
| 920 | 3300025981 | Ga0207640_10001958 | Ga0207640_1000195811 | 152 |
| 921 | 3300025981 | Ga0207640_11133151 | Ga0207640_111331512 | 152 |
| 922 | 3300026078 | Ga0207702_10115740 | Ga0207702_101157402 | 152 |
| 923 | 3300026078 | Ga0207702_10115878 | Ga0207702_101158783 | 152 |
| 924 | 3300026078 | Ga0207702_10207872 | Ga0207702_102078722 | 152 |
| 925 | 3300026116 | Ga0207674_10167492 | Ga0207674_101674922 | 152 |
| 926 | 3300026142 | Ga0207698_10076081 | Ga0207698_100760814 | 152 |
| 927 | 3300026142 | Ga0207698_10272416 | Ga0207698_102724161 | 152 |
| 928 | 3300037312 | Ga0395899_0052182 | Ga0395899_0052182_1391_1849 | 152 |
| 929 | 3300037312 | Ga0395899_0134345 | Ga0395899_0134345_731_1222 | 152 |
| 930 | 3300037312 | Ga0395899_0158860 | Ga0395899_0158860_387_845 | 152 |
| 931 | 3300037418 | Ga0395900_0053279 | Ga0395900_0053279_2647_3105 | 152 |
| 932 | 3300037418 | Ga0395900_0083198 | Ga0395900_0083198_2284_2775 | 152 |
| 933 | 3300037418 | Ga0395900_0371959 | Ga0395900_0371959_72_530 | 152 |
| 934 | 3300037418 | Ga0395900_0426881 | Ga0395900_0426881_142_600 | 152 |
| 935 | 3300037466 | Ga0395898_0047996 | Ga0395898_0047996_2340_2798 | 152 |
| 936 | 3300037466 | Ga0395898_0088051 | Ga0395898_0088051_1662_2120 | 152 |
| 937 | 3300037466 | Ga0395898_0857885 | Ga0395898_0857885_156_614 | 152 |
| 938 | 3300037471 | Ga0395905_0630283 | Ga0395905_0630283_451_921 | 152 |
| 939 | 3300038443 | Ga0395901_0008775 | Ga0395901_0008775_6227_6718 | 152 |
| 940 | 3300038443 | Ga0395901_0627015 | Ga0395901_0627015_76_534 | 152 |
| 941 | 3300038443 | Ga0395901_0834509 | Ga0395901_0834509_318_776 | 152 |
| 942 | 3300044656 | Ga0466969_0006496 | Ga0466969_0006496_5089_5547 | 152 |
| 943 | 3300044684 | Ga0466966_0000004 | Ga0466966_0000004_185025_185483 | 152 |
| 944 | 3300044684 | Ga0466966_0008836 | Ga0466966_0008836_2698_3156 | 152 |
| 945 | 3300044693 | Ga0466961_0001622 | Ga0466961_0001622_12314_12772 | 152 |
| 946 | 3300044694 | Ga0466963_0036748 | Ga0466963_0036748_2194_2652 | 152 |
| 947 | 3300044719 | Ga0466971_0003803 | Ga0466971_0003803_3596_4054 | 152 |
| 948 | 3300044765 | Ga0466970_0009047 | Ga0466970_0009047_2054_2512 | 152 |
| 949 | 3300044842 | Ga0466957_0003105 | Ga0466957_0003105_7792_8250 | 152 |
| 950 | 3300045049 | Ga0466959_0006892 | Ga0466959_0006892_1178_1636 | 152 |
| 951 | 3300045836 | Ga0466958_0000180 | Ga0466958_0000180_19145_19603 | 152 |
| 952 | 3300045836 | Ga0466958_0644809 | Ga0466958_0644809_138_608 | 152 |
| 953 | 3300045976 | Ga0466967_0229573 | Ga0466967_0229573_1011_1481 | 152 |
| 954 | 3300061719 | Ga0466962_0026992 | Ga0466962_0026992_1178_1636 | 152 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2z1j-assembly1.cif.gz_A | crystal structure of e.coli rnase hi surface charged mutant(q4r/t40e/q72h/q76k/q80e/t92k/q105k/q113r/q115k/n143k/t145k) | 0.9753 | 4 | 144 |
| 1wsj-assembly3.cif.gz_C | crystal structure of e.coli rnase hi active site mutant (k87a/h124a) | 0.9746 | 4 | 144 |
| 1wsj-assembly5.cif.gz_E | crystal structure of e.coli rnase hi active site mutant (k87a/h124a) | 0.9727 | 4 | 144 |
| 1jl2-assembly1.cif.gz_C | crystal structure of tceo rnase h-a chimera combining the folding core from t. thermophilus rnase h and the remaining region of e. coli rnase h | 0.9712 | 6 | 144 |
| 1wsj-assembly7.cif.gz_G | crystal structure of e.coli rnase hi active site mutant (k87a/h124a) | 0.9702 | 4 | 144 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1jl2C00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9712 | 6 | 144 | 3.30.420.10 |
| af_A0A0R0EHL2_85_153_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9709 | 7 | 60 | 3.30.420.10 |
| 2zqbB00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9487 | 4 | 146 | 3.30.420.10 |
| 4ibnA01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9128 | 1 | 146 | 3.30.420.10 |
| 2zqbB00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.8926 | 4 | 146 | 3.30.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D0XTL9-F1-model_v4 | Ribonuclease HI | 1.003 | 4 | 67 |
GO:0003676
GO:0004523 |
| AF-A0A527HH28-F1-model_v4 | deleted | 1.002 | 4 | 75 |
|
| AF-A0A258X9Y1-F1-model_v4 | Ribonuclease H (RNase H) (EC 3.1.26.4) | 0.9991 | 4 | 145 |
GO:0000287
GO:0003676 GO:0004523 GO:0005737 GO:0043137 |
| AF-A0A0G9MSR0-F1-model_v4 | Ribonuclease H (RNase H) (EC 3.1.26.4) | 0.9991 | 4 | 146 |
GO:0000287
GO:0003676 GO:0004523 GO:0005737 GO:0043137 |
| AF-A0A1G1D884-F1-model_v4 | ribonuclease H (EC 3.1.26.4) | 0.9988 | 4 | 121 |
GO:0003676
GO:0004523 GO:0043137 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar