F486556

General Info

Members Datasets Scaffolds Average Seq Length
950 444 1900 56

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10508793|Ga0265314_105087931
Length 67
Sequence MIPQVIFGMNLGPHADFIVAAYAVAALVVVLLIGWIAIDHCVQRRRVAQLESQGVTRRSVQTSRQTA

Samples

Sample ID Description Type Environment
1 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
10 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
11 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
12 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
13 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
14 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
18 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
19 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
20 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
21 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
22 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
23 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
24 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
25 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
26 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
27 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
28 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
29 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
30 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
33 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
46 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
47 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
60 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
61 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
62 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
63 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
64 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
67 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
68 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
69 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
76 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
77 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
78 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
79 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
80 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
81 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
82 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
83 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
84 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
85 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
86 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
89 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
90 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
91 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
92 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
93 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
94 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
95 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
96 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
97 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
98 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
99 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
100 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
101 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
102 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
103 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
104 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
105 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
106 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
107 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
108 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
109 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
110 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
111 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
112 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
113 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
114 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
115 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
117 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
118 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
119 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
120 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
121 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
122 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
123 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
125 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
126 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
127 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
128 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
129 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
131 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
132 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
134 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
135 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
136 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
137 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
138 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
139 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
140 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
141 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
142 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
143 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
144 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
145 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
146 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
147 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
148 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
149 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
150 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
151 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
152 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
153 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
154 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
155 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
156 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
157 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
158 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
159 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
160 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
161 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
162 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
163 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
164 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
166 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
167 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
168 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
248 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
250 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
254 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
255 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
256 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
257 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
258 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
259 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
260 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
261 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
262 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
263 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
264 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
265 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
266 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
267 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
268 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
269 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
270 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
271 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
272 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
273 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
274 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
275 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
276 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
277 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
278 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
279 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
280 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
281 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
282 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
283 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
284 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
285 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
286 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
287 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
288 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
289 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
290 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
291 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
292 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
293 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
294 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
295 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
296 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
297 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
298 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
299 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
300 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
301 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
302 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
303 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
304 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
305 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
306 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
307 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
308 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
309 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
310 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
311 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
312 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
313 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
314 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
315 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
316 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
317 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
318 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
319 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
320 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
321 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
322 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
323 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
324 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
325 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
326 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
327 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
328 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
329 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
330 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
331 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
332 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
333 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
334 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
335 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
336 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
337 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
338 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
339 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
340 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
341 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
342 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
343 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
344 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
345 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
346 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
347 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
348 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
349 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
350 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
351 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
352 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
353 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
354 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
355 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
356 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
357 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
358 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
359 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
360 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
361 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
362 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
363 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
364 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
365 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
366 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
367 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
368 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
369 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
370 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
371 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
372 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
373 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
374 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
375 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
376 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
377 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
378 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
379 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
380 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
381 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
382 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
383 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
384 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
385 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
386 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
387 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
388 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
389 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
403 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
404 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
405 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
406 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
407 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
408 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
409 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
410 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
411 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
412 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
413 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
414 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
415 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
416 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
419 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
420 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
421 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
422 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
423 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
424 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
425 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
426 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
427 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
428 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
429 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
430 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
431 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
432 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
433 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
434 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
435 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
436 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
437 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
438 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
439 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
440 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
441 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
442 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
443 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
444 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.68
Nodule 0
Rhizoplane 6.63
Rhizosphere 89.68
Stem 0
Stem Tuber 0
Unclassified 1.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265314_10508793 3300031711 Bacteria 633
2 2214553303 2209111006 Bacteria 1226
3 ARcpr5oldR_c000008 3300000041 Bacteria 40651
4 ARSoilYngRDRAFT_c00021 3300000042 Bacteria 23635
5 ARcpr5yngRDRAFT_c000027 3300000043 Bacteria 23992
6 ARSoilOldRDRAFT_c000004 3300000044 Bacteria 62556
7 ARCol0oldRDRAFT_c00429 3300000045 Bacteria 4011
8 ARCol0yngRDRAFT_1000041 3300000652 Bacteria 21726
9 JGI24032J14994_100318 3300001430 Bacteria 2554
10 JGI24741J21665_1064785 3300001915 Bacteria 540
11 JGI24752J21851_1004684 3300001976 Bacteria 1792
12 JGI24746J21847_1000201 3300001977 Bacteria 7983
13 JGI24747J21853_1006578 3300001978 Bacteria 1101
14 JGI24740J21852_10050018 3300001979 Bacteria 1204
15 JGI24739J22299_10005396 3300001989 Bacteria 4862
16 JGI24737J22298_10001847 3300001990 Bacteria 7571
17 JGI24737J22298_10003088 3300001990 Bacteria 5899
18 JGI24737J22298_10005878 3300001990 Bacteria 4222
19 JGI24743J22301_10077858 3300001991 Bacteria 697
20 JGI24750J21931_1000142 3300002070 Bacteria 11648
21 JGI24750J21931_1001552 3300002070 Bacteria 2825
22 JGI24745J21846_1001327 3300002073 Bacteria 2386
23 JGI24748J21848_1006394 3300002074 Bacteria 1371
24 JGI24738J21930_10000653 3300002075 Bacteria 10027
25 JGI24749J21850_1000294 3300002076 Bacteria 7674
26 JGI24744J21845_10003018 3300002077 Bacteria 3453
27 JGI24035J26624_1000707 3300002126 Bacteria 3106
28 JGI24034J26672_10004566 3300002239 Bacteria 1967
29 JGI24742J22300_10000099 3300002244 Bacteria 12894
30 JGI24751J29686_10022656 3300002459 Bacteria 1303
31 JGI25153J46596_10001550 3300003215 Bacteria 13655
32 Ga0065717_1006099 3300005276 Bacteria 826
33 Ga0065716_1005930 3300005277 Bacteria 842
34 Ga0065704_10004119 3300005289 Bacteria 6170
35 Ga0065712_10284021 3300005290 Bacteria 872
36 Ga0065712_10428531 3300005290 Bacteria 703
37 Ga0065712_10641450 3300005290 Unclassified 571
38 Ga0065715_10001452 3300005293 Bacteria 7854
39 Ga0065715_10037175 3300005293 Bacteria 902
40 Ga0070676_10001608 3300005328 Bacteria 11482
41 Ga0070676_10299424 3300005328 Bacteria 1090
42 Ga0070676_10940415 3300005328 Bacteria 646
43 Ga0070683_100011295 3300005329 Bacteria 7711
44 Ga0070690_100083518 3300005330 Bacteria 2092
45 Ga0070690_100196986 3300005330 Bacteria 1400
46 Ga0070690_100272877 3300005330 Bacteria 1204
47 Ga0070690_100730998 3300005330 Bacteria 762
48 Ga0070670_100209031 3300005331 Bacteria 1697
49 Ga0070677_10000023 3300005333 Bacteria 44929
50 Ga0070677_10295422 3300005333 Bacteria 821
51 Ga0068869_100004994 3300005334 Bacteria 8305
52 Ga0068869_100901413 3300005334 Bacteria 765
53 Ga0070666_10018371 3300005335 Bacteria 4494
54 Ga0070666_10071095 3300005335 Bacteria 2368
55 Ga0070666_10729400 3300005335 Bacteria 728
56 Ga0070680_100006411 3300005336 Bacteria 8939
57 Ga0070680_100105143 3300005336 Bacteria 2347
58 Ga0070680_100253948 3300005336 Bacteria 1487
59 Ga0070680_100618396 3300005336 Bacteria 930
60 Ga0070680_100967789 3300005336 Bacteria 735
61 Ga0070682_100006324 3300005337 Bacteria 6647
62 Ga0070682_100259084 3300005337 Bacteria 1258
63 Ga0070682_100887404 3300005337 Bacteria 732
64 Ga0070682_101566212 3300005337 Bacteria 569
65 Ga0068868_100001933 3300005338 Bacteria 14224
66 Ga0068868_100254476 3300005338 Bacteria 1479
67 Ga0070660_100002712 3300005339 Bacteria 12162
68 Ga0070660_100083073 3300005339 Bacteria 2516
69 Ga0070660_100400006 3300005339 Bacteria 1136
70 Ga0070689_100007227 3300005340 Bacteria 7744
71 Ga0070689_100661275 3300005340 Bacteria 909
72 Ga0070689_100882032 3300005340 Bacteria 791
73 Ga0070691_10000519 3300005341 Bacteria 14524
74 Ga0070691_10182285 3300005341 Bacteria 1094
75 Ga0070691_10450454 3300005341 Bacteria 735
76 Ga0070687_100000762 3300005343 Bacteria 10689
77 Ga0070687_100046431 3300005343 Bacteria 2223
78 Ga0070687_100620084 3300005343 Bacteria 746
79 Ga0070661_100004148 3300005344 Bacteria 9994
80 Ga0070661_101637544 3300005344 Bacteria 545
81 Ga0070692_10004283 3300005345 Bacteria 5932
82 Ga0070668_100034630 3300005347 Bacteria 3849
83 Ga0070668_100322940 3300005347 Bacteria 1300
84 Ga0070668_100663353 3300005347 Bacteria 917
85 Ga0070669_100033503 3300005353 Bacteria 3716
86 Ga0070669_101680926 3300005353 Bacteria 553
87 Ga0070675_100004458 3300005354 Bacteria 10679
88 Ga0070675_100306969 3300005354 Bacteria 1399
89 Ga0070675_100732534 3300005354 Bacteria 901
90 Ga0070671_100002139 3300005355 Bacteria 15248
91 Ga0070671_100006841 3300005355 Bacteria 9126
92 Ga0070671_100372303 3300005355 Bacteria 1220
93 Ga0070674_100003695 3300005356 Bacteria 8622
94 Ga0070674_101148375 3300005356 Bacteria 688
95 Ga0070673_100000278 3300005364 Bacteria 26473
96 Ga0070688_100002472 3300005365 Bacteria 9344
97 Ga0070688_100120216 3300005365 Bacteria 1758
98 Ga0070688_100129624 3300005365 Bacteria 1700
99 Ga0070659_100021334 3300005366 Bacteria 4932
100 Ga0070659_100032681 3300005366 Bacteria 4037
101 Ga0070667_100099872 3300005367 Bacteria 2505
102 Ga0070667_100117492 3300005367 Bacteria 2310
103 Ga0070667_100191366 3300005367 Bacteria 1812
104 Ga0070667_100666877 3300005367 Bacteria 961
105 Ga0070703_10004071 3300005406 Bacteria 4126
106 Ga0070709_10707733 3300005434 Bacteria 784
107 Ga0070709_11092145 3300005434 Bacteria 638
108 Ga0070714_100096078 3300005435 Bacteria 2603
109 Ga0070713_100002202 3300005436 Bacteria 12626
110 Ga0070713_100054798 3300005436 Bacteria 3310
111 Ga0070710_10032227 3300005437 Bacteria 2837
112 Ga0070710_10075009 3300005437 Bacteria 1958
113 Ga0070710_11128175 3300005437 Bacteria 577
114 Ga0070701_10002237 3300005438 Bacteria 7402
115 Ga0070701_10029225 3300005438 Bacteria 2716
116 Ga0070711_100010296 3300005439 Bacteria 5784
117 Ga0070711_100032837 3300005439 Bacteria 3454
118 Ga0070711_100669550 3300005439 Bacteria 871
119 Ga0070711_100890525 3300005439 Bacteria 759
120 Ga0070705_100003982 3300005440 Bacteria 7219
121 Ga0070705_100110117 3300005440 Bacteria 1758
122 Ga0070705_101590232 3300005440 Bacteria 550
123 Ga0070700_100006419 3300005441 Bacteria 6288
124 Ga0070694_100030249 3300005444 Bacteria 3540
125 Ga0070694_100091319 3300005444 Bacteria 2137
126 Ga0070708_100798902 3300005445 Bacteria 887
127 Ga0070663_100066816 3300005455 Bacteria 2606
128 Ga0070663_100359059 3300005455 Bacteria 1181
129 Ga0070663_100780255 3300005455 Bacteria 818
130 Ga0070678_100010332 3300005456 Bacteria 5697
131 Ga0070678_100023420 3300005456 Bacteria 4114
132 Ga0070678_100790187 3300005456 Bacteria 861
133 Ga0070678_100896118 3300005456 Bacteria 811
134 Ga0070662_100009569 3300005457 Bacteria 6341
135 Ga0070662_100148013 3300005457 Bacteria 1825
136 Ga0070662_100166352 3300005457 Bacteria 1728
137 Ga0070662_101077569 3300005457 Bacteria 689
138 Ga0070681_10014480 3300005458 Bacteria 7848
139 Ga0070681_10216769 3300005458 Bacteria 1830
140 Ga0070681_10758724 3300005458 Bacteria 887
141 Ga0068867_100003764 3300005459 Bacteria 10677
142 Ga0068867_101445492 3300005459 Bacteria 639
143 Ga0070685_10003496 3300005466 Bacteria 7992
144 Ga0070685_10057273 3300005466 Bacteria 2268
145 Ga0070698_101904286 3300005471 Bacteria 548
146 Ga0074259_11914260 3300005507 Bacteria 828
147 Ga0070679_100013963 3300005530 Bacteria 7697
148 Ga0070679_100923212 3300005530 Bacteria 816
149 Ga0070679_101114161 3300005530 Bacteria 734
150 Ga0070684_100002161 3300005535 Bacteria 14516
151 Ga0070697_100099725 3300005536 Bacteria 2411
152 Ga0070697_101385194 3300005536 Bacteria 628
153 Ga0068853_100107619 3300005539 Bacteria 2472
154 Ga0068853_100169178 3300005539 Bacteria 1976
155 Ga0068853_100507384 3300005539 Bacteria 1139
156 Ga0070672_100006797 3300005543 Bacteria 7724
157 Ga0070672_100091006 3300005543 Bacteria 2461
158 Ga0070672_102035043 3300005543 Bacteria 517
159 Ga0070686_100002376 3300005544 Bacteria 10368
160 Ga0070686_100215484 3300005544 Bacteria 1385
161 Ga0070686_100816795 3300005544 Bacteria 753
162 Ga0070695_100012396 3300005545 Bacteria 5114
163 Ga0070695_100084616 3300005545 Bacteria 2104
164 Ga0070696_100050690 3300005546 Bacteria 2885
165 Ga0070696_100147055 3300005546 Bacteria 1727
166 Ga0070696_100225558 3300005546 Bacteria 1408
167 Ga0070696_100614228 3300005546 Bacteria 878
168 Ga0070696_100741333 3300005546 Bacteria 804
169 Ga0070693_100004321 3300005547 Bacteria 6708
170 Ga0070665_100015460 3300005548 Bacteria 7667
171 Ga0070665_100800342 3300005548 Bacteria 956
172 Ga0070704_100588550 3300005549 Bacteria 976
173 Ga0068855_100108999 3300005563 Bacteria 3180
174 Ga0070664_100006568 3300005564 Bacteria 9381
175 Ga0070664_100139268 3300005564 Bacteria 2136
176 Ga0068857_100009381 3300005577 Bacteria 8494
177 Ga0068857_101349621 3300005577 Bacteria 693
178 Ga0068854_100004762 3300005578 Bacteria 8555
179 Ga0068854_102260262 3300005578 Bacteria 504
180 Ga0068856_100011377 3300005614 Bacteria 8632
181 Ga0068856_101164615 3300005614 Bacteria 788
182 Ga0068856_101789160 3300005614 Bacteria 626
183 Ga0068856_102447424 3300005614 Bacteria 529
184 Ga0070702_100016353 3300005615 Bacteria 3805
185 Ga0070702_100157048 3300005615 Bacteria 1466
186 Ga0068852_100004590 3300005616 Bacteria 9779
187 Ga0068859_100005699 3300005617 Bacteria 12674
188 Ga0068859_100090933 3300005617 Bacteria 3103
189 Ga0068859_100155049 3300005617 Bacteria 2367
190 Ga0068864_100053957 3300005618 Bacteria 3468
191 Ga0068864_102321095 3300005618 Bacteria 543
192 Ga0068864_102713670 3300005618 Bacteria 501
193 Ga0068866_10000992 3300005718 Bacteria 12484
194 Ga0068866_10722857 3300005718 Bacteria 685
195 Ga0068866_10909239 3300005718 Bacteria 620
196 Ga0068861_100042258 3300005719 Bacteria 3415
197 Ga0068861_100059764 3300005719 Bacteria 2919
198 Ga0068861_100612122 3300005719 Bacteria 1001
199 Ga0068861_101417892 3300005719 Bacteria 679
200 Ga0068851_10311124 3300005834 Bacteria 908
201 Ga0068870_10001034 3300005840 Bacteria 11000
202 Ga0068863_100772622 3300005841 Bacteria 957
203 Ga0068858_100012900 3300005842 Bacteria 7881
204 Ga0068858_100973767 3300005842 Bacteria 831
205 Ga0068860_100051814 3300005843 Bacteria 3904
206 Ga0068860_100109251 3300005843 Bacteria 2643
207 Ga0068860_100235745 3300005843 Bacteria 1779
208 Ga0068860_101027301 3300005843 Bacteria 843
209 Ga0068862_100011106 3300005844 Bacteria 7437
210 Ga0068862_100088088 3300005844 Bacteria 2700
211 Ga0068862_102647642 3300005844 Bacteria 513
212 Ga0070717_10173803 3300006028 Bacteria 1875
213 Ga0070717_10435591 3300006028 Bacteria 1180
214 Ga0070717_10904151 3300006028 Bacteria 804
215 Ga0075368_10232396 3300006042 Bacteria 785
216 Ga0075363_100501534 3300006048 Bacteria 721
217 Ga0075363_100688814 3300006048 Bacteria 617
218 Ga0070715_10088080 3300006163 Bacteria 1423
219 Ga0070715_10825924 3300006163 Bacteria 565
220 Ga0070716_100019760 3300006173 Bacteria 3526
221 Ga0070716_101670851 3300006173 Bacteria 525
222 Ga0070712_100168338 3300006175 Bacteria 1698
223 Ga0070712_100816125 3300006175 Bacteria 801
224 Ga0070712_100891576 3300006175 Bacteria 766
225 Ga0075362_10222860 3300006177 Bacteria 922
226 Ga0075367_10049634 3300006178 Bacteria 2474
227 Ga0075367_10213883 3300006178 Bacteria 1206
228 Ga0075367_10241563 3300006178 Bacteria 1132
229 Ga0075367_10275710 3300006178 Bacteria 1057
230 Ga0075366_10013534 3300006195 Bacteria 4648
231 Ga0075366_10756690 3300006195 Bacteria 604
232 Ga0075366_10828416 3300006195 Bacteria 576
233 Ga0075366_10998778 3300006195 Bacteria 522
234 Ga0097621_100001689 3300006237 Bacteria 15113
235 Ga0097621_100048767 3300006237 Bacteria 3437
236 Ga0068871_100000012 3300006358 Bacteria 105267
237 Ga0068871_100028219 3300006358 Bacteria 4398
238 Ga0075428_101030274 3300006844 Bacteria 871
239 Ga0075431_102088187 3300006847 Bacteria 521
240 Ga0075433_10073897 3300006852 Bacteria 2999
241 Ga0075433_10529252 3300006852 Bacteria 1037
242 Ga0075434_100008227 3300006871 Bacteria 9681
243 Ga0075434_100057072 3300006871 Bacteria 3880
244 Ga0075434_100208872 3300006871 Bacteria 1973
245 Ga0068865_100001680 3300006881 Bacteria 12959
246 Ga0068865_100002705 3300006881 Bacteria 10514
247 Ga0068865_100080956 3300006881 Bacteria 2331
248 Ga0075436_100790006 3300006914 Bacteria 706
249 Ga0097620_100005699 3300006931 Bacteria 12674
250 Ga0097620_100090933 3300006931 Bacteria 3103
251 Ga0097620_100155048 3300006931 Bacteria 2367
252 Ga0075435_100010179 3300007076 Bacteria 6869
253 Ga0075435_100046408 3300007076 Bacteria 3484
254 Ga0075435_100250706 3300007076 Bacteria 1507
255 Ga0075435_100347599 3300007076 Bacteria 1271
256 Ga0105251_10063306 3300009011 Bacteria 1736
257 Ga0105251_10574867 3300009011 Unclassified 533
258 Ga0105244_10263517 3300009036 Bacteria 802
259 Ga0105250_10019692 3300009092 Bacteria 2728
260 Ga0105240_10024512 3300009093 Bacteria 7950
261 Ga0105240_10311123 3300009093 Bacteria 1799
262 Ga0111539_10022491 3300009094 Bacteria 7745
263 Ga0111539_10073134 3300009094 Bacteria 4041
264 Ga0111539_10135442 3300009094 Bacteria 2884
265 Ga0111539_12457945 3300009094 Bacteria 604
266 Ga0105245_10000460 3300009098 Bacteria 37264
267 Ga0105245_10040059 3300009098 Bacteria 4172
268 Ga0105245_10349843 3300009098 Bacteria 1464
269 Ga0105247_10009860 3300009101 Bacteria 5787
270 Ga0105247_10023574 3300009101 Bacteria 3708
271 Ga0105247_10227571 3300009101 Bacteria 1265
272 Ga0105247_10392668 3300009101 Bacteria 986
273 Ga0114129_10001035 3300009147 Bacteria 36374
274 Ga0114129_13064008 3300009147 Bacteria 547
275 Ga0105243_10004739 3300009148 Bacteria 10698
276 Ga0105243_10462228 3300009148 Bacteria 1193
277 Ga0105243_11137087 3300009148 Bacteria 791
278 Ga0105243_11278577 3300009148 Bacteria 750
279 Ga0105243_13063417 3300009148 Bacteria 506
280 Ga0105241_10004650 3300009174 Bacteria 10147
281 Ga0105241_10042115 3300009174 Bacteria 3453
282 Ga0105241_10288222 3300009174 Bacteria 1405
283 Ga0105242_10012445 3300009176 Bacteria 6550
284 Ga0105242_10109507 3300009176 Bacteria 2352
285 Ga0105248_10009565 3300009177 Bacteria 10670
286 Ga0105248_10018941 3300009177 Bacteria 7611
287 Ga0105248_10798337 3300009177 Bacteria 1065
288 Ga0105248_11315493 3300009177 Bacteria 817
289 Ga0105237_10036875 3300009545 Bacteria 4945
290 Ga0105237_10398499 3300009545 Bacteria 1381
291 Ga0105237_11155634 3300009545 Bacteria 781
292 Ga0105238_10949783 3300009551 Bacteria 879
293 Ga0105249_10011836 3300009553 Bacteria 7669
294 Ga0105249_10080495 3300009553 Bacteria 3026
295 Ga0105249_10589509 3300009553 Bacteria 1165
296 Ga0105239_10083127 3300010375 Bacteria 3526
297 Ga0105239_10132781 3300010375 Bacteria 2770
298 Ga0105239_12028467 3300010375 Bacteria 668
299 Ga0105246_10003054 3300011119 Bacteria 10161
300 Ga0105246_10020775 3300011119 Bacteria 4216
301 Ga0105246_11400109 3300011119 Bacteria 652
302 Ga0157325_1010159 3300012485 Bacteria 686
303 Ga0157339_1002028 3300012505 Bacteria 1325
304 Ga0157342_1036583 3300012507 Bacteria 641
305 Ga0157315_1001406 3300012508 Bacteria 1331
306 Ga0157327_1007424 3300012512 Bacteria 955
307 Ga0157326_1007335 3300012513 Bacteria 1190
308 Ga0157373_10040037 3300013100 Bacteria 3354
309 Ga0157373_10167598 3300013100 Bacteria 1546
310 Ga0157373_10588411 3300013100 Bacteria 809
311 Ga0157371_10056079 3300013102 Bacteria 2795
312 Ga0157371_10127768 3300013102 Bacteria 1808
313 Ga0157371_10686683 3300013102 Bacteria 766
314 Ga0157371_11067755 3300013102 Bacteria 618
315 Ga0157371_11432476 3300013102 Bacteria 537
316 Ga0157370_10060606 3300013104 Bacteria 3592
317 Ga0157369_10589122 3300013105 Bacteria 1148
318 Ga0157374_10038684 3300013296 Bacteria 4385
319 Ga0157374_10083737 3300013296 Bacteria 3030
320 Ga0157374_11363534 3300013296 Bacteria 732
321 Ga0157374_11377520 3300013296 Bacteria 728
322 Ga0157378_10014743 3300013297 Bacteria 6848
323 Ga0157378_10506297 3300013297 Bacteria 1207
324 Ga0163162_10015058 3300013306 Bacteria 7555
325 Ga0163162_10056975 3300013306 Bacteria 3935
326 Ga0157372_10019471 3300013307 Bacteria 7316
327 Ga0157372_10363331 3300013307 Bacteria 1687
328 Ga0157372_11128583 3300013307 Bacteria 907
329 Ga0157372_12472989 3300013307 Unclassified 596
330 Ga0157375_10006955 3300013308 Bacteria 9875
331 Ga0157375_10011212 3300013308 Bacteria 7908
332 Ga0157375_10057985 3300013308 Bacteria 3829
333 Ga0163163_10000824 3300014325 Bacteria 26424
334 Ga0163163_10010204 3300014325 Bacteria 8432
335 Ga0163163_10879352 3300014325 Bacteria 959
336 Ga0163163_11929153 3300014325 Bacteria 650
337 Ga0157380_10011939 3300014326 Bacteria 6285
338 Ga0157380_12382093 3300014326 Bacteria 594
339 Ga0182008_10490518 3300014497 Bacteria 674
340 Ga0157377_10000747 3300014745 Bacteria 13471
341 Ga0157379_10007473 3300014968 Bacteria 9462
342 Ga0157379_10013180 3300014968 Bacteria 7238
343 Ga0157379_10623376 3300014968 Bacteria 1008
344 Ga0157379_11171661 3300014968 Bacteria 738
345 Ga0157376_10002255 3300014969 Bacteria 13007
346 Ga0157376_10021752 3300014969 Bacteria 4984
347 Ga0163161_10016061 3300017792 Bacteria 5227
348 Ga0163161_10093417 3300017792 Bacteria 2229
349 Ga0207666_1000023 3300025271 Bacteria 37093
350 Ga0207673_1000424 3300025290 Bacteria 4347
351 Ga0209758_1000469 3300025297 Bacteria 66568
352 Ga0207426_1021230 3300025302 Bacteria 2246
353 Ga0207697_10012454 3300025315 Bacteria 3565
354 Ga0207697_10016013 3300025315 Bacteria 3093
355 Ga0207697_10330491 3300025315 Bacteria 677
356 Ga0207697_10429440 3300025315 Unclassified 586
357 Ga0207656_10446361 3300025321 Bacteria 653
358 Ga0207655_1197181 3300025728 Bacteria 603
359 Ga0207713_1133154 3300025735 Bacteria 820
360 Ga0207653_10036526 3300025885 Bacteria 1601
361 Ga0207682_10000011 3300025893 Bacteria 85533
362 Ga0207692_10023879 3300025898 Bacteria 2834
363 Ga0207692_10066492 3300025898 Bacteria 1884
364 Ga0207692_10988268 3300025898 Bacteria 555
365 Ga0207642_10011537 3300025899 Bacteria 3157
366 Ga0207642_10103106 3300025899 Bacteria 1437
367 Ga0207710_10004009 3300025900 Bacteria 6489
368 Ga0207710_10014708 3300025900 Bacteria 3303
369 Ga0207710_10371065 3300025900 Bacteria 731
370 Ga0207688_10004178 3300025901 Bacteria 7867
371 Ga0207680_10064689 3300025903 Bacteria 2243
372 Ga0207680_10070896 3300025903 Bacteria 2158
373 Ga0207680_10240693 3300025903 Bacteria 1247
374 Ga0207647_10010277 3300025904 Bacteria 6612
375 Ga0207647_10065675 3300025904 Bacteria 2202
376 Ga0207685_10086430 3300025905 Bacteria 1310
377 Ga0207699_10044072 3300025906 Bacteria 2595
378 Ga0207699_10147525 3300025906 Bacteria 1553
379 Ga0207645_10000788 3300025907 Bacteria 26477
380 Ga0207645_10050754 3300025907 Bacteria 2649
381 Ga0207645_10248540 3300025907 Bacteria 1176
382 Ga0207643_10000284 3300025908 Bacteria 35172
383 Ga0207654_10048360 3300025911 Bacteria 2434
384 Ga0207654_10093881 3300025911 Bacteria 1835
385 Ga0207707_10070632 3300025912 Bacteria 3043
386 Ga0207707_10117155 3300025912 Bacteria 2328
387 Ga0207707_10189218 3300025912 Bacteria 1796
388 Ga0207707_10594912 3300025912 Bacteria 937
389 Ga0207695_10063284 3300025913 Bacteria 3815
390 Ga0207671_11476342 3300025914 Bacteria 525
391 Ga0207693_10022746 3300025915 Bacteria 4978
392 Ga0207693_10214684 3300025915 Bacteria 1512
393 Ga0207693_10976798 3300025915 Bacteria 647
394 Ga0207693_11061198 3300025915 Bacteria 617
395 Ga0207663_10075770 3300025916 Bacteria 2184
396 Ga0207663_10202970 3300025916 Bacteria 1431
397 Ga0207663_10686151 3300025916 Bacteria 810
398 Ga0207663_10903506 3300025916 Bacteria 706
399 Ga0207660_10002700 3300025917 Bacteria 11629
400 Ga0207660_10175555 3300025917 Bacteria 1661
401 Ga0207660_10311925 3300025917 Bacteria 1254
402 Ga0207660_10556703 3300025917 Bacteria 933
403 Ga0207662_10004076 3300025918 Bacteria 7630
404 Ga0207662_10083618 3300025918 Bacteria 1951
405 Ga0207662_10493550 3300025918 Bacteria 842
406 Ga0207662_10962644 3300025918 Bacteria 605
407 Ga0207657_10011928 3300025919 Bacteria 8600
408 Ga0207657_10014635 3300025919 Bacteria 7643
409 Ga0207649_10000057 3300025920 Bacteria 102314
410 Ga0207652_10010898 3300025921 Bacteria 7327
411 Ga0207652_10079351 3300025921 Bacteria 2867
412 Ga0207652_10179186 3300025921 Bacteria 1904
413 Ga0207681_10000181 3300025923 Bacteria 51755
414 Ga0207681_10063212 3300025923 Bacteria 2552
415 Ga0207694_10826098 3300025924 Bacteria 783
416 Ga0207650_10009809 3300025925 Bacteria 6548
417 Ga0207659_10000028 3300025926 Bacteria 130804
418 Ga0207659_10370962 3300025926 Bacteria 1192
419 Ga0207687_10000061 3300025927 Bacteria 84113
420 Ga0207687_10034404 3300025927 Bacteria 3440
421 Ga0207687_10404325 3300025927 Bacteria 1124
422 Ga0207700_10002284 3300025928 Bacteria 10999
423 Ga0207700_10194862 3300025928 Bacteria 1704
424 Ga0207664_10090245 3300025929 Bacteria 2511
425 Ga0207664_10978438 3300025929 Bacteria 759
426 Ga0207644_10030053 3300025931 Bacteria 3773
427 Ga0207644_10035293 3300025931 Bacteria 3503
428 Ga0207644_10269484 3300025931 Bacteria 1364
429 Ga0207690_10003360 3300025932 Bacteria 9568
430 Ga0207690_10059910 3300025932 Bacteria 2581
431 Ga0207690_10529243 3300025932 Bacteria 956
432 Ga0207706_10008724 3300025933 Bacteria 9338
433 Ga0207706_10011033 3300025933 Bacteria 8236
434 Ga0207706_10048754 3300025933 Bacteria 3745
435 Ga0207686_10001777 3300025934 Bacteria 11991
436 Ga0207709_10000539 3300025935 Bacteria 32486
437 Ga0207709_10339825 3300025935 Bacteria 1130
438 Ga0207709_11037883 3300025935 Bacteria 671
439 Ga0207670_10000217 3300025936 Bacteria 37598
440 Ga0207670_10032848 3300025936 Bacteria 3340
441 Ga0207670_10062967 3300025936 Bacteria 2536
442 Ga0207669_10000147 3300025937 Bacteria 34031
443 Ga0207704_10000767 3300025938 Bacteria 14133
444 Ga0207704_10025964 3300025938 Bacteria 3206
445 Ga0207704_10102972 3300025938 Bacteria 1908
446 Ga0207704_11156049 3300025938 Bacteria 659
447 Ga0207665_10306222 3300025939 Bacteria 1189
448 Ga0207665_10593667 3300025939 Bacteria 864
449 Ga0207691_10015068 3300025940 Bacteria 7357
450 Ga0207711_10001580 3300025941 Bacteria 21028
451 Ga0207711_10490849 3300025941 Bacteria 1144
452 Ga0207711_10694397 3300025941 Bacteria 949
453 Ga0207689_10016286 3300025942 Bacteria 6298
454 Ga0207689_10170310 3300025942 Bacteria 1795
455 Ga0207689_10822593 3300025942 Bacteria 784
456 Ga0207661_10000215 3300025944 Bacteria 37435
457 Ga0207679_10000026 3300025945 Bacteria 200073
458 Ga0207679_10376732 3300025945 Bacteria 1243
459 Ga0207679_10539312 3300025945 Bacteria 1045
460 Ga0207667_10162304 3300025949 Bacteria 2298
461 Ga0207667_11425039 3300025949 Bacteria 666
462 Ga0207651_10000173 3300025960 Bacteria 27970
463 Ga0207651_10066509 3300025960 Bacteria 2533
464 Ga0207712_10002375 3300025961 Bacteria 12203
465 Ga0207668_10000242 3300025972 Bacteria 36700
466 Ga0207668_10011222 3300025972 Bacteria 5438
467 Ga0207640_10004395 3300025981 Bacteria 7642
468 Ga0207640_10244208 3300025981 Bacteria 1389
469 Ga0207640_11712646 3300025981 Bacteria 567
470 Ga0207658_10001541 3300025986 Bacteria 17874
471 Ga0207658_10086624 3300025986 Bacteria 2416
472 Ga0207658_11114146 3300025986 Bacteria 721
473 Ga0207658_11758288 3300025986 Bacteria 566
474 Ga0207677_10001215 3300026023 Bacteria 13903
475 Ga0207677_10419379 3300026023 Bacteria 1140
476 Ga0207703_10011441 3300026035 Bacteria 6900
477 Ga0207639_10030363 3300026041 Bacteria 3963
478 Ga0207639_10114687 3300026041 Bacteria 2202
479 Ga0207639_11378924 3300026041 Bacteria 662
480 Ga0207678_10003797 3300026067 Bacteria 13581
481 Ga0207678_10231024 3300026067 Bacteria 1584
482 Ga0207678_10254022 3300026067 Bacteria 1506
483 Ga0207678_10313066 3300026067 Bacteria 1350
484 Ga0207708_10040194 3300026075 Bacteria 3565
485 Ga0207708_10040692 3300026075 Bacteria 3543
486 Ga0207702_10013194 3300026078 Bacteria 6871
487 Ga0207702_10563077 3300026078 Bacteria 1116
488 Ga0207702_10588022 3300026078 Bacteria 1091
489 Ga0207702_10667875 3300026078 Bacteria 1023
490 Ga0207641_10004378 3300026088 Bacteria 12242
491 Ga0207641_10651980 3300026088 Bacteria 1034
492 Ga0207648_10013596 3300026089 Bacteria 7561
493 Ga0207648_10426462 3300026089 Bacteria 1205
494 Ga0207676_10011705 3300026095 Bacteria 6276
495 Ga0207676_11914568 3300026095 Bacteria 592
496 Ga0207674_10019430 3300026116 Bacteria 7357
497 Ga0207674_10978913 3300026116 Bacteria 815
498 Ga0207675_100005898 3300026118 Bacteria 11692
499 Ga0207675_101016757 3300026118 Bacteria 847
500 Ga0207675_101209746 3300026118 Bacteria 776
501 Ga0207675_101496453 3300026118 Bacteria 696
502 Ga0207683_10000034 3300026121 Bacteria 101817
503 Ga0207683_10985380 3300026121 Bacteria 783
504 Ga0207683_11212473 3300026121 Bacteria 699
505 Ga0207698_10062501 3300026142 Bacteria 2908
506 Ga0207698_10545720 3300026142 Bacteria 1135
507 Ga0207698_12612366 3300026142 Bacteria 514
508 Ga0209967_1029015 3300027364 Bacteria 825
509 Ga0209984_1000604 3300027424 Bacteria 3912
510 Ga0210000_1058352 3300027462 Bacteria 623
511 Ga0209995_1037488 3300027471 Bacteria 816
512 Ga0209968_1017972 3300027526 Bacteria 1131
513 Ga0209999_1052856 3300027543 Bacteria 769
514 Ga0209970_1054687 3300027614 Bacteria 726
515 Ga0210002_1001523 3300027617 Bacteria 3292
516 Ga0209983_1005386 3300027665 Bacteria 2653
517 Ga0209971_1011075 3300027682 Bacteria 2135
518 Ga0209971_1106343 3300027682 Bacteria 688
519 Ga0209966_1002078 3300027695 Bacteria 3346
520 Ga0209966_1009657 3300027695 Bacteria 1727
521 Ga0209998_10001526 3300027717 Bacteria 5566
522 Ga0209998_10004442 3300027717 Bacteria 2981
523 Ga0209998_10008809 3300027717 Bacteria 2090
524 Ga0209813_10312894 3300027866 Bacteria 613
525 Ga0209974_10001907 3300027876 Bacteria 7607
526 Ga0209974_10031486 3300027876 Bacteria 1756
527 Ga0209974_10231815 3300027876 Bacteria 690
528 Ga0209974_10250310 3300027876 Unclassified 666
529 Ga0207428_10000352 3300027907 Bacteria 59444
530 Ga0207428_10015741 3300027907 Bacteria 6531
531 Ga0207428_10962384 3300027907 Bacteria 601
532 Ga0268266_10208151 3300028379 Bacteria 1793
533 Ga0268266_10368337 3300028379 Bacteria 1353
534 Ga0268265_10034295 3300028380 Bacteria 3697
535 Ga0268265_10083616 3300028380 Bacteria 2528
536 Ga0268265_11704707 3300028380 Bacteria 636
537 Ga0268265_12465802 3300028380 Bacteria 526
538 Ga0268264_10029609 3300028381 Bacteria 4486
539 Ga0268264_10051655 3300028381 Bacteria 3426
540 Ga0268264_10211228 3300028381 Bacteria 1782
541 Ga0268264_10268654 3300028381 Bacteria 1592
542 Ga0265336_10203605 3300028666 Bacteria 588
543 Ga0265338_10091258 3300028800 Bacteria 2517
544 Ga0265338_10252547 3300028800 Bacteria 1300
545 Ga0265325_10000141 3300031241 Bacteria 50291
546 Ga0265325_10042206 3300031241 Bacteria 2386
547 Ga0265325_10049091 3300031241 Bacteria 2180
548 Ga0265325_10066720 3300031241 Bacteria 1814
549 Ga0265325_10076774 3300031241 Bacteria 1666
550 Ga0265329_10030428 3300031242 Bacteria 1759
551 Ga0265339_10358857 3300031249 Bacteria 686
552 Ga0265339_10394246 3300031249 Bacteria 647
553 Ga0265339_10450511 3300031249 Bacteria 597
554 Ga0265331_10045173 3300031250 Bacteria 2127
555 Ga0265331_10543949 3300031250 Bacteria 523
556 Ga0265316_10352122 3300031344 Bacteria 1066
557 Ga0265313_10018807 3300031595 Bacteria 3867
558 Ga0265313_10021482 3300031595 Bacteria 3529
559 Ga0265313_10187746 3300031595 Bacteria 866
560 Ga0265313_10293104 3300031595 Bacteria 655
561 Ga0316579_10145834 3300031691 Bacteria 1141
562 Ga0265314_10001306 3300031711 Bacteria 28247
563 Ga0265342_10535242 3300031712 Bacteria 595
564 Ga0373930_0027386 3300034816 Bacteria 1155
565 Ga0373930_0090380 3300034816 Bacteria 718
566 Ga0373930_0093586 3300034816 Bacteria 707
567 Ga0373930_0114737 3300034816 Bacteria 651
568 Ga0373930_0184612 3300034816 Bacteria 537
569 Ga0373948_0000052 3300034817 Bacteria 12263
570 Ga0373948_0029637 3300034817 Bacteria 1096
571 Ga0373950_0000290 3300034818 Bacteria 6308
572 Ga0373950_0013884 3300034818 Bacteria 1349
573 Ga0373958_0000208 3300034819 Bacteria 6915
574 Ga0373958_0003436 3300034819 Bacteria 2283
575 Ga0373958_0070583 3300034819 Bacteria 774
576 Ga0373959_0000448 3300034820 Bacteria 7722
577 Ga0373938_0000271 3300034957 Bacteria 8214
578 Ga0373938_0001918 3300034957 Bacteria 3326
579 Ga0373928_0000292 3300035084 Bacteria 9905
580 Ga0373928_0003672 3300035084 Bacteria 2924
581 Ga0373929_0000220 3300035085 Bacteria 10415
582 Ga0373929_0008491 3300035085 Bacteria 1893
583 Ga0373934_0033265 3300035086 Bacteria 2024
584 Ga0373934_0044157 3300035086 Bacteria 1761
585 Ga0373934_0219436 3300035086 Bacteria 784
586 Ga0373934_0392987 3300035086 Bacteria 579
587 Ga0373940_0000726 3300035088 Bacteria 5364
588 Ga0373940_0020259 3300035088 Bacteria 1688
589 Ga0373944_0023906 3300035089 Bacteria 1786
590 Ga0373949_0001073 3300035090 Bacteria 8354
591 Ga0373949_0092515 3300035090 Bacteria 819
592 Ga0373951_0000417 3300035091 Bacteria 12488
593 Ga0373951_0007575 3300035091 Bacteria 2464
594 Ga0373951_0037635 3300035091 Bacteria 1158
595 Ga0373952_0000812 3300035092 Bacteria 5626
596 Ga0373952_0000918 3300035092 Bacteria 5348
597 Ga0373923_0069799 3300035111 Bacteria 1507
598 Ga0373923_0598101 3300035111 Bacteria 543
599 Ga0373932_0000481 3300035112 Bacteria 12269
600 Ga0373932_0008894 3300035112 Bacteria 2405
601 Ga0373932_0099415 3300035112 Bacteria 945
602 Ga0373936_0015595 3300035113 Bacteria 2912
603 Ga0373936_0060497 3300035113 Bacteria 1545
604 Ga0373939_0000928 3300035114 Bacteria 7276
605 Ga0373939_0004973 3300035114 Bacteria 3159
606 Ga0373939_0007805 3300035114 Bacteria 2607
607 Ga0373939_0114468 3300035114 Bacteria 944
608 Ga0373939_0265839 3300035114 Unclassified 672
609 Ga0373939_0510788 3300035114 Bacteria 514
610 Ga0373941_0017395 3300035115 Bacteria 1969
611 Ga0373941_0122757 3300035115 Bacteria 927
612 Ga0373941_0252867 3300035115 Bacteria 688
613 Ga0373945_0002769 3300035116 Bacteria 5506
614 Ga0373945_0483094 3300035116 Bacteria 550
615 Ga0373953_0040024 3300035117 Bacteria 1860
616 Ga0373953_0182806 3300035117 Bacteria 905
617 Ga0373954_0000946 3300035118 Bacteria 11331
618 Ga0373954_0124282 3300035118 Bacteria 1254
619 Ga0373954_0430257 3300035118 Bacteria 653
620 Ga0373956_0031688 3300035119 Bacteria 2318
621 Ga0373957_0000582 3300035120 Bacteria 9224
622 Ga0373957_0073298 3300035120 Bacteria 1342
623 Ga0373960_0000785 3300035121 Bacteria 6661
624 Ga0373960_0077202 3300035121 Bacteria 1041
625 Ga0373960_0366756 3300035121 Bacteria 549
626 Ga0373943_0043036 3300035170 Bacteria 2191
627 Ga0373946_0313959 3300035171 Bacteria 777
628 Ga0373955_0012502 3300035172 Bacteria 4079
629 Ga0373955_0015058 3300035172 Bacteria 3777
630 Ga0373942_0001252 3300035207 Bacteria 6666
631 Ga0373942_0008719 3300035207 Bacteria 2368
632 Ga0373942_0210047 3300035207 Bacteria 649
633 Ga0373961_0000729 3300035241 Bacteria 11431
634 Ga0373961_0010994 3300035241 Bacteria 2239
635 Ga0373961_0119197 3300035241 Bacteria 873
636 Ga0373962_0000934 3300035242 Bacteria 6725
637 Ga0373962_0003274 3300035242 Bacteria 3897
638 Ga0373962_0203513 3300035242 Bacteria 671
639 Ga0373924_0013971 3300035410 Bacteria 3026
640 Ga0373924_0236135 3300035410 Bacteria 808
641 Ga0373931_0033895 3300035691 Bacteria 2647
642 Ga0373931_0085607 3300035691 Bacteria 1747
643 Ga0373931_0167775 3300035691 Bacteria 1291
644 Ga0373931_0199553 3300035691 Bacteria 1194
645 Ga0373931_0823106 3300035691 Bacteria 620
646 Ga0373935_0315777 3300035692 Bacteria 1107
647 Ga0373927_0054855 3300035695 Bacteria 2578
648 Ga0373927_0198607 3300035695 Bacteria 1316
649 Ga0373933_0001593 3300035724 Bacteria 13290
650 Ga0373933_0057937 3300035724 Bacteria 2329
651 Ga0373933_0275356 3300035724 Bacteria 1087
652 Ga0373933_0564927 3300035724 Bacteria 747
653 Ga0373947_0030588 3300035725 Bacteria 3164
654 Ga0373937_0020270 3300036401 Bacteria 5960
655 Ga0373937_0364010 3300036401 Bacteria 1371
656 Ga0373937_1440193 3300036401 Bacteria 636
657 Ga0316582_0987900 3300036647 Bacteria 575
658 Ga0373925_0025042 3300037068 Bacteria 4358
659 Ga0242420_101194 3300038996 Bacteria 613
660 Ga0439438_136614 3300041405 Bacteria 587
661 Ga0439453_0003376 3300041408 Bacteria 2293
662 Ga0439461_0150486 3300041410 Bacteria 601
663 Ga0439437_041097 3300042000 Bacteria 600
664 Ga0439441_102238 3300042001 Bacteria 644
665 Ga0439448_0022010 3300042005 Bacteria 1978
666 Ga0439450_004715 3300042008 Bacteria 2349
667 Ga0439455_0050676 3300042012 Bacteria 1084
668 Ga0439455_0224038 3300042012 Bacteria 547
669 Ga0439463_057346 3300042016 Bacteria 995
670 Ga0450912_022373 3300042116 Bacteria 619
671 Ga0450923_005742 3300042125 Bacteria 2022
672 Ga0439434_0050056 3300042435 Bacteria 1294
673 Ga0439460_0084837 3300042461 Bacteria 999
674 Ga0439460_0113937 3300042461 Bacteria 879
675 Ga0451577_0284134 3300042876 Bacteria 1499
676 Ga0453684_0130071 3300044712 Bacteria 3022
677 Ga0451576_0054445 3300045051 Bacteria 4189
678 Ga0495592_0001184 3300046454 Bacteria 18095
679 Ga0495592_0001796 3300046454 Bacteria 15099
680 Ga0495603_0039204 3300046455 Bacteria 2839
681 Ga0495629_0022097 3300046459 Bacteria 4536
682 Ga0495629_0105177 3300046459 Bacteria 1968
683 Ga0495641_0021810 3300046461 Bacteria 3216
684 Ga0495651_0000895 3300046462 Bacteria 23161
685 Ga0495651_0121907 3300046462 Bacteria 1914
686 Ga0495653_0012511 3300046463 Bacteria 6929
687 Ga0495653_0061825 3300046463 Bacteria 2832
688 Ga0495653_0112665 3300046463 Bacteria 1952
689 Ga0495580_0022216 3300046472 Bacteria 4671
690 Ga0495582_0033772 3300046473 Bacteria 2813
691 Ga0495605_0186899 3300046474 Bacteria 909
692 Ga0495605_0432582 3300046474 Unclassified 544
693 Ga0495639_0056207 3300046475 Bacteria 1796
694 Ga0495662_0089456 3300046476 Bacteria 1500
695 Ga0495664_0104577 3300046477 Bacteria 1706
696 Ga0495584_0019904 3300046491 Bacteria 3410
697 Ga0495584_0320445 3300046491 Bacteria 787
698 Ga0495594_0100434 3300046499 Bacteria 1627
699 Ga0495608_0000129 3300046511 Bacteria 53862
700 Ga0495608_0064010 3300046511 Bacteria 2412
701 Ga0495608_0741337 3300046511 Bacteria 582
702 Ga0495618_0001726 3300046514 Bacteria 14506
703 Ga0495628_0001570 3300046516 Bacteria 20927
704 Ga0495628_0003849 3300046516 Bacteria 13361
705 Ga0495630_0152347 3300046517 Bacteria 1759
706 Ga0495630_0222963 3300046517 Bacteria 1439
707 Ga0495630_0522976 3300046517 Bacteria 910
708 Ga0495666_0037234 3300046526 Bacteria 2367
709 Ga0495652_0004520 3300046529 Bacteria 13265
710 Ga0495652_0005753 3300046529 Bacteria 11605
711 Ga0495640_0015297 3300046533 Bacteria 5776
712 Ga0495640_0506676 3300046533 Bacteria 734
713 Ga0495586_0075384 3300046535 Bacteria 1846
714 Ga0495587_0000354 3300046536 Bacteria 32868
715 Ga0495609_0389822 3300046538 Bacteria 558
716 Ga0495621_0410885 3300046539 Bacteria 575
717 Ga0495645_0000800 3300046543 Bacteria 21568
718 Ga0495645_0001074 3300046543 Bacteria 18551
719 Ga0495622_0026504 3300046557 Bacteria 2706
720 Ga0495667_0002315 3300046559 Bacteria 12757
721 Ga0495667_0005226 3300046559 Bacteria 8774
722 Ga0495667_0626731 3300046559 Unclassified 669
723 Ga0495634_0029694 3300046642 Bacteria 3784
724 Ga0495634_0284418 3300046642 Bacteria 1003
725 Ga0495635_0001388 3300046663 Bacteria 16150
726 Ga0495635_0008767 3300046663 Bacteria 7061
727 Ga0495635_0315488 3300046663 Bacteria 1047
728 Ga0495588_0009363 3300046674 Bacteria 4525
729 Ga0495657_0001374 3300046675 Bacteria 21110
730 Ga0495599_0000294 3300046678 Bacteria 30376
731 Ga0495623_0000055 3300046679 Bacteria 69548
732 Ga0495623_0034568 3300046679 Bacteria 3241
733 Ga0495646_0000749 3300046680 Bacteria 18095
734 Ga0495646_0096760 3300046680 Bacteria 1697
735 Ga0495647_0003946 3300046681 Bacteria 4784
736 Ga0495658_0055246 3300046683 Bacteria 2261
737 Ga0495658_0771160 3300046683 Bacteria 616
738 Ga0495669_0416858 3300046684 Bacteria 651
739 Ga0495669_0514129 3300046684 Bacteria 582
740 Ga0495669_0652107 3300046684 Bacteria 512
741 Ga0495613_0086929 3300046689 Bacteria 2266
742 Ga0495613_0099715 3300046689 Bacteria 2098
743 Ga0495624_0083266 3300046690 Bacteria 1978
744 Ga0495600_0015473 3300046809 Bacteria 4822
745 Ga0495581_0120100 3300047315 Bacteria 1529
746 Ga0495604_0001560 3300047317 Bacteria 18862
747 Ga0495604_0840185 3300047317 Bacteria 577
748 Ga0495674_0005151 3300047319 Bacteria 12554
749 Ga0495676_0020056 3300047321 Bacteria 5873
750 Ga0495680_0023201 3300047322 Bacteria 5161
751 Ga0495680_0028926 3300047322 Bacteria 4541
752 Ga0495683_0399392 3300047323 Bacteria 572
753 Ga0495675_0000190 3300047444 Bacteria 44968
754 Ga0495675_0761318 3300047444 Bacteria 538
755 Ga0495677_0026799 3300047445 Bacteria 2090
756 Ga0495684_0079574 3300047471 Bacteria 2488
757 Ga0495684_0110226 3300047471 Bacteria 2078
758 Ga0495684_0125158 3300047471 Bacteria 1934
759 Ga0495593_0019249 3300047673 Bacteria 3828
760 Ga0495593_0101596 3300047673 Bacteria 1474
761 Ga0495602_0000445 3300048088 Bacteria 38896
762 Ga0495602_0051765 3300048088 Bacteria 3654
763 Ga0495614_0055739 3300048089 Bacteria 1695
764 Ga0496100_0008642 3300048903 Bacteria 5687
765 Ga0496100_0026951 3300048903 Bacteria 3528
766 Ga0496100_0718454 3300048903 Bacteria 780
767 Ga0496100_1169733 3300048903 Unclassified 606
768 Ga0496101_0000756 3300048904 Bacteria 19156
769 Ga0496101_0061211 3300048904 Bacteria 2733
770 Ga0496101_0558541 3300048904 Bacteria 905
771 Ga0496101_1409394 3300048904 Bacteria 543
772 Ga0496102_0004000 3300048905 Bacteria 12481
773 Ga0496102_0015432 3300048905 Bacteria 6654
774 Ga0496102_0034406 3300048905 Bacteria 4556
775 Ga0496102_0118800 3300048905 Bacteria 2468
776 Ga0496102_0674401 3300048905 Bacteria 957
777 Ga0496102_1505913 3300048905 Bacteria 591
778 Ga0496103_0005706 3300048906 Bacteria 7439
779 Ga0496103_0035045 3300048906 Bacteria 3071
780 Ga0496103_0626835 3300048906 Bacteria 684
781 Ga0496104_0000685 3300048907 Bacteria 29134
782 Ga0496104_0015809 3300048907 Bacteria 6846
783 Ga0496104_0038642 3300048907 Bacteria 4466
784 Ga0496104_0068546 3300048907 Bacteria 3371
785 Ga0496105_0004285 3300048908 Bacteria 10738
786 Ga0496105_0004757 3300048908 Bacteria 10249
787 Ga0496105_0066300 3300048908 Bacteria 2980
788 Ga0496106_0015376 3300048909 Bacteria 5664
789 Ga0496106_0018745 3300048909 Bacteria 5124
790 Ga0496106_0157291 3300048909 Bacteria 1795
791 Ga0496107_0034190 3300048910 Bacteria 3640
792 Ga0496107_0071295 3300048910 Bacteria 2524
793 Ga0496107_0113287 3300048910 Bacteria 1994
794 Ga0496107_0214485 3300048910 Bacteria 1431
795 Ga0496108_0060683 3300048911 Bacteria 3182
796 Ga0496108_0064652 3300048911 Bacteria 3082
797 Ga0496108_0120541 3300048911 Bacteria 2249
798 Ga0496108_0678493 3300048911 Bacteria 894
799 Ga0496109_0000736 3300048912 Bacteria 27218
800 Ga0496109_0002526 3300048912 Bacteria 15338
801 Ga0496109_0836602 3300048912 Bacteria 858
802 Ga0496109_0869542 3300048912 Bacteria 839
803 Ga0496110_0040570 3300048913 Bacteria 4057
804 Ga0496110_0073214 3300048913 Bacteria 3041
805 Ga0496110_0115516 3300048913 Bacteria 2416
806 Ga0496110_0116265 3300048913 Bacteria 2408
807 Ga0496110_0601642 3300048913 Bacteria 997
808 Ga0496111_0004209 3300048914 Bacteria 9061
809 Ga0496111_0028217 3300048914 Bacteria 3977
810 Ga0496111_0046988 3300048914 Bacteria 3109
811 Ga0496111_0446740 3300048914 Bacteria 954
812 Ga0496111_0500311 3300048914 Bacteria 895
813 Ga0496112_0006875 3300048915 Bacteria 10029
814 Ga0496112_0520368 3300048915 Bacteria 1124
815 Ga0496112_1096512 3300048915 Bacteria 714
816 Ga0496113_0000137 3300048916 Bacteria 31613
817 Ga0496113_0089487 3300048916 Bacteria 2370
818 Ga0496113_0722695 3300048916 Bacteria 794
819 Ga0496113_1451753 3300048916 Bacteria 530
820 Ga0496114_0019287 3300048917 Bacteria 5524
821 Ga0496114_1018750 3300048917 Bacteria 711
822 Ga0496115_0001071 3300048918 Bacteria 19818
823 Ga0496115_0052463 3300048918 Bacteria 3271
824 Ga0496115_0212618 3300048918 Bacteria 1597
825 Ga0496115_0215768 3300048918 Bacteria 1584
826 Ga0496115_0368980 3300048918 Bacteria 1168
827 Ga0501031_0200545 3300049568 Bacteria 1302
828 Ga0501032_0006386 3300049569 Bacteria 8683
829 Ga0501032_0674492 3300049569 Bacteria 656
830 Ga0501033_0015402 3300049570 Bacteria 5801
831 Ga0501033_0873285 3300049570 Bacteria 605
832 Ga0501034_0003727 3300049571 Bacteria 17214
833 Ga0501034_0088704 3300049571 Bacteria 3091
834 Ga0501034_0827729 3300049571 Bacteria 817
835 Ga0501036_0001268 3300049572 Bacteria 19351
836 Ga0501036_0913683 3300049572 Bacteria 720
837 Ga0501037_0002956 3300049573 Bacteria 12324
838 Ga0501038_0006827 3300049574 Bacteria 10543
839 Ga0501038_1261459 3300049574 Bacteria 535
840 Ga0501039_0001032 3300049575 Bacteria 20355
841 Ga0501042_0022883 3300049578 Bacteria 4366
842 Ga0501043_0016441 3300049579 Bacteria 5801
843 Ga0501043_0547671 3300049579 Bacteria 860
844 Ga0501046_0003718 3300049580 Bacteria 13966
845 Ga0501046_0809632 3300049580 Bacteria 656
846 Ga0501047_0003496 3300049581 Bacteria 14841
847 Ga0501047_0456182 3300049581 Bacteria 1107
848 Ga0501047_0624279 3300049581 Bacteria 898
849 Ga0501047_1293631 3300049581 Bacteria 543
850 Ga0501048_0021902 3300049582 Bacteria 4677
851 Ga0501067_0020492 3300049583 Bacteria 3659
852 Ga0501067_0169709 3300049583 Bacteria 1215
853 Ga0501067_0181781 3300049583 Bacteria 1171
854 Ga0501068_0001483 3300049584 Bacteria 12485
855 Ga0501068_0402075 3300049584 Bacteria 883
856 Ga0501068_0798678 3300049584 Bacteria 619
857 Ga0501069_0010836 3300049585 Bacteria 4831
858 Ga0501069_0479032 3300049585 Bacteria 741
859 Ga0501070_0006615 3300049586 Bacteria 9864
860 Ga0501070_0013417 3300049586 Bacteria 6907
861 Ga0501070_0094844 3300049586 Bacteria 2469
862 Ga0501070_0451718 3300049586 Bacteria 1036
863 Ga0501070_1270496 3300049586 Bacteria 563
864 Ga0501071_0030772 3300049587 Bacteria 3798
865 Ga0501071_0121667 3300049587 Bacteria 1935
866 Ga0501072_0090931 3300049588 Bacteria 2423
867 Ga0501072_0184387 3300049588 Bacteria 1665
868 Ga0501072_0608886 3300049588 Bacteria 861
869 Ga0501073_0022730 3300049589 Bacteria 4511
870 Ga0501073_0054051 3300049589 Bacteria 2812
871 Ga0501073_0067793 3300049589 Bacteria 2487
872 Ga0501074_0004173 3300049590 Bacteria 10321
873 Ga0501074_0069598 3300049590 Bacteria 2530
874 Ga0501074_0481657 3300049590 Bacteria 879
875 Ga0501076_0119375 3300049592 Bacteria 2135
876 Ga0501076_1053318 3300049592 Bacteria 670
877 Ga0501077_0013445 3300049593 Bacteria 5134
878 Ga0501077_0915746 3300049593 Bacteria 564
879 Ga0501079_0042008 3300049741 Bacteria 3531
880 Ga0501079_0199651 3300049741 Bacteria 1562
881 Ga0501079_0447865 3300049741 Bacteria 1014
882 Ga0501080_0004990 3300049742 Bacteria 11818
883 Ga0501080_0595808 3300049742 Bacteria 981
884 Ga0501080_0878274 3300049742 Bacteria 783
885 Ga0501080_0909845 3300049742 Bacteria 766
886 Ga0501080_1248272 3300049742 Bacteria 637
887 Ga0501081_0069649 3300049743 Bacteria 2451
888 Ga0501083_0011859 3300049744 Bacteria 6109
889 Ga0501083_0157471 3300049744 Bacteria 1486
890 Ga0501083_0227065 3300049744 Bacteria 1216
891 Ga0501083_0547854 3300049744 Bacteria 753
892 Ga0501083_0640081 3300049744 Bacteria 692
893 Ga0501035_0005159 3300049822 Bacteria 12356
894 Ga0501044_0000815 3300049823 Bacteria 37466
895 Ga0501044_0047956 3300049823 Bacteria 4416
896 Ga0501044_0091369 3300049823 Bacteria 3071
897 Ga0501044_0228946 3300049823 Bacteria 1807
898 Ga0501044_0265469 3300049823 Bacteria 1654
899 Ga0501044_0366313 3300049823 Bacteria 1358
900 Ga0501045_0028538 3300049824 Bacteria 4026
901 nmdc:mga03683_285151_c1 3300050489 Bacteria 772
902 nmdc:mga03683_55536_c1 3300050489 Bacteria 1663
903 nmdc:mga03n38_204888_c1 3300050490 Bacteria 1022
904 nmdc:mga00v17_1027838_c1 3300050491 Bacteria 518
905 nmdc:mga0yw44_1210491_c1 3300050492 Bacteria 509
906 nmdc:mga0k408_5369_c1 3300050493 Bacteria 6813
907 nmdc:mga0k408_681019_c1 3300050493 Bacteria 603
908 nmdc:mga06z11_34084_c1 3300050494 Bacteria 2496
909 nmdc:mga06z11_398671_c1 3300050494 Bacteria 828
910 nmdc:mga06z11_87978_c1 3300050494 Bacteria 1681
911 nmdc:mga04h51_172790_c1 3300050495 Bacteria 837
912 nmdc:mga05p37_12681_c1 3300050507 Bacteria 10070
913 nmdc:mga0qj67_1145800_c1 3300050509 Bacteria 606
914 nmdc:mga08y16_10015_c1 3300050511 Bacteria 9948
915 nmdc:mga08y16_148566_c1 3300050511 Bacteria 2436
916 nmdc:mga0n895_1708930_c1 3300050512 Unclassified 592
917 nmdc:mga0n895_180745_c1 3300050512 Bacteria 2141
918 nmdc:mga0n895_342978_c1 3300050512 Bacteria 1513
919 nmdc:mga0n895_5683_c1 3300050512 Bacteria 10456
920 nmdc:mga0n895_656907_c1 3300050512 Bacteria 1047
921 nmdc:mga0rr50_128689_c1 3300050513 Bacteria 2024
922 nmdc:mga0rr50_244106_c1 3300050513 Bacteria 1489
923 nmdc:mga0rr50_26270_c1 3300050513 Bacteria 4060
924 nmdc:mga0rr50_587162_c1 3300050513 Bacteria 949
925 nmdc:mga0a205_20550_c1 3300050515 Bacteria 6232
926 nmdc:mga0a205_34581_c1 3300050515 Bacteria 4848
927 Ga0495601_0000677 3300053077 Bacteria 18186
928 Ga0495601_0000798 3300053077 Bacteria 17006
929 Ga0495612_0000089 3300053078 Bacteria 40250
930 Ga0495612_0004307 3300053078 Bacteria 5905
931 Ga0495595_0000369 3300053084 Bacteria 17095
932 Ga0495595_0009383 3300053084 Bacteria 4047
933 Ga0495619_0002831 3300053085 Bacteria 11298
934 Ga0495619_0004203 3300053085 Bacteria 9187
935 Ga0495619_0212680 3300053085 Bacteria 1339
936 Ga0500556_0251699 3300053104 Bacteria 695
937 Ga0500595_065803 3300053119 Bacteria 1084
938 Ga0500595_153555 3300053119 Bacteria 643
939 Ga0500618_053097 3300053125 Bacteria 916
940 Ga0500642_0041131 3300053130 Bacteria 1998
941 Ga0500652_057838 3300053131 Bacteria 1592
942 Ga0500568_0195641 3300053139 Bacteria 741
943 Ga0500573_0352082 3300053140 Bacteria 715
944 Ga0501084_0024607 3300054114 Bacteria 5024
945 Ga0501084_0089613 3300054114 Bacteria 2582
946 Ga0501082_0025085 3300060353 Bacteria 5136
947 Ga0501082_0120448 3300060353 Bacteria 2275
948 Ga0501082_0347494 3300060353 Bacteria 1293
949 Ga0501082_0598370 3300060353 Bacteria 965
950 Ga0501082_1447803 3300060353 Bacteria 600
951 Ga0265314_10508793
952 2214553303
953 ARcpr5oldR_c000008
954 ARSoilYngRDRAFT_c00021
955 ARcpr5yngRDRAFT_c000027
956 ARSoilOldRDRAFT_c000004
957 ARCol0oldRDRAFT_c00429
958 ARCol0yngRDRAFT_1000041
959 JGI24032J14994_100318
960 JGI24741J21665_1064785
961 JGI24752J21851_1004684
962 JGI24746J21847_1000201
963 JGI24747J21853_1006578
964 JGI24740J21852_10050018
965 JGI24739J22299_10005396
966 JGI24737J22298_10001847
967 JGI24737J22298_10003088
968 JGI24737J22298_10005878
969 JGI24743J22301_10077858
970 JGI24750J21931_1000142
971 JGI24750J21931_1001552
972 JGI24745J21846_1001327
973 JGI24748J21848_1006394
974 JGI24738J21930_10000653
975 JGI24749J21850_1000294
976 JGI24744J21845_10003018
977 JGI24035J26624_1000707
978 JGI24034J26672_10004566
979 JGI24742J22300_10000099
980 JGI24751J29686_10022656
981 JGI25153J46596_10001550
982 Ga0065717_1006099
983 Ga0065716_1005930
984 Ga0065704_10004119
985 Ga0065712_10284021
986 Ga0065712_10428531
987 Ga0065712_10641450
988 Ga0065715_10001452
989 Ga0065715_10037175
990 Ga0070676_10001608
991 Ga0070676_10299424
992 Ga0070676_10940415
993 Ga0070683_100011295
994 Ga0070690_100083518
995 Ga0070690_100196986
996 Ga0070690_100272877
997 Ga0070690_100730998
998 Ga0070670_100209031
999 Ga0070677_10000023
1000 Ga0070677_10295422
1001 Ga0068869_100004994
1002 Ga0068869_100901413
1003 Ga0070666_10018371
1004 Ga0070666_10071095
1005 Ga0070666_10729400
1006 Ga0070680_100006411
1007 Ga0070680_100105143
1008 Ga0070680_100253948
1009 Ga0070680_100618396
1010 Ga0070680_100967789
1011 Ga0070682_100006324
1012 Ga0070682_100259084
1013 Ga0070682_100887404
1014 Ga0070682_101566212
1015 Ga0068868_100001933
1016 Ga0068868_100254476
1017 Ga0070660_100002712
1018 Ga0070660_100083073
1019 Ga0070660_100400006
1020 Ga0070689_100007227
1021 Ga0070689_100661275
1022 Ga0070689_100882032
1023 Ga0070691_10000519
1024 Ga0070691_10182285
1025 Ga0070691_10450454
1026 Ga0070687_100000762
1027 Ga0070687_100046431
1028 Ga0070687_100620084
1029 Ga0070661_100004148
1030 Ga0070661_101637544
1031 Ga0070692_10004283
1032 Ga0070668_100034630
1033 Ga0070668_100322940
1034 Ga0070668_100663353
1035 Ga0070669_100033503
1036 Ga0070669_101680926
1037 Ga0070675_100004458
1038 Ga0070675_100306969
1039 Ga0070675_100732534
1040 Ga0070671_100002139
1041 Ga0070671_100006841
1042 Ga0070671_100372303
1043 Ga0070674_100003695
1044 Ga0070674_101148375
1045 Ga0070673_100000278
1046 Ga0070688_100002472
1047 Ga0070688_100120216
1048 Ga0070688_100129624
1049 Ga0070659_100021334
1050 Ga0070659_100032681
1051 Ga0070667_100099872
1052 Ga0070667_100117492
1053 Ga0070667_100191366
1054 Ga0070667_100666877
1055 Ga0070703_10004071
1056 Ga0070709_10707733
1057 Ga0070709_11092145
1058 Ga0070714_100096078
1059 Ga0070713_100002202
1060 Ga0070713_100054798
1061 Ga0070710_10032227
1062 Ga0070710_10075009
1063 Ga0070710_11128175
1064 Ga0070701_10002237
1065 Ga0070701_10029225
1066 Ga0070711_100010296
1067 Ga0070711_100032837
1068 Ga0070711_100669550
1069 Ga0070711_100890525
1070 Ga0070705_100003982
1071 Ga0070705_100110117
1072 Ga0070705_101590232
1073 Ga0070700_100006419
1074 Ga0070694_100030249
1075 Ga0070694_100091319
1076 Ga0070708_100798902
1077 Ga0070663_100066816
1078 Ga0070663_100359059
1079 Ga0070663_100780255
1080 Ga0070678_100010332
1081 Ga0070678_100023420
1082 Ga0070678_100790187
1083 Ga0070678_100896118
1084 Ga0070662_100009569
1085 Ga0070662_100148013
1086 Ga0070662_100166352
1087 Ga0070662_101077569
1088 Ga0070681_10014480
1089 Ga0070681_10216769
1090 Ga0070681_10758724
1091 Ga0068867_100003764
1092 Ga0068867_101445492
1093 Ga0070685_10003496
1094 Ga0070685_10057273
1095 Ga0070698_101904286
1096 Ga0074259_11914260
1097 Ga0070679_100013963
1098 Ga0070679_100923212
1099 Ga0070679_101114161
1100 Ga0070684_100002161
1101 Ga0070697_100099725
1102 Ga0070697_101385194
1103 Ga0068853_100107619
1104 Ga0068853_100169178
1105 Ga0068853_100507384
1106 Ga0070672_100006797
1107 Ga0070672_100091006
1108 Ga0070672_102035043
1109 Ga0070686_100002376
1110 Ga0070686_100215484
1111 Ga0070686_100816795
1112 Ga0070695_100012396
1113 Ga0070695_100084616
1114 Ga0070696_100050690
1115 Ga0070696_100147055
1116 Ga0070696_100225558
1117 Ga0070696_100614228
1118 Ga0070696_100741333
1119 Ga0070693_100004321
1120 Ga0070665_100015460
1121 Ga0070665_100800342
1122 Ga0070704_100588550
1123 Ga0068855_100108999
1124 Ga0070664_100006568
1125 Ga0070664_100139268
1126 Ga0068857_100009381
1127 Ga0068857_101349621
1128 Ga0068854_100004762
1129 Ga0068854_102260262
1130 Ga0068856_100011377
1131 Ga0068856_101164615
1132 Ga0068856_101789160
1133 Ga0068856_102447424
1134 Ga0070702_100016353
1135 Ga0070702_100157048
1136 Ga0068852_100004590
1137 Ga0068859_100005699
1138 Ga0068859_100090933
1139 Ga0068859_100155049
1140 Ga0068864_100053957
1141 Ga0068864_102321095
1142 Ga0068864_102713670
1143 Ga0068866_10000992
1144 Ga0068866_10722857
1145 Ga0068866_10909239
1146 Ga0068861_100042258
1147 Ga0068861_100059764
1148 Ga0068861_100612122
1149 Ga0068861_101417892
1150 Ga0068851_10311124
1151 Ga0068870_10001034
1152 Ga0068863_100772622
1153 Ga0068858_100012900
1154 Ga0068858_100973767
1155 Ga0068860_100051814
1156 Ga0068860_100109251
1157 Ga0068860_100235745
1158 Ga0068860_101027301
1159 Ga0068862_100011106
1160 Ga0068862_100088088
1161 Ga0068862_102647642
1162 Ga0070717_10173803
1163 Ga0070717_10435591
1164 Ga0070717_10904151
1165 Ga0075368_10232396
1166 Ga0075363_100501534
1167 Ga0075363_100688814
1168 Ga0070715_10088080
1169 Ga0070715_10825924
1170 Ga0070716_100019760
1171 Ga0070716_101670851
1172 Ga0070712_100168338
1173 Ga0070712_100816125
1174 Ga0070712_100891576
1175 Ga0075362_10222860
1176 Ga0075367_10049634
1177 Ga0075367_10213883
1178 Ga0075367_10241563
1179 Ga0075367_10275710
1180 Ga0075366_10013534
1181 Ga0075366_10756690
1182 Ga0075366_10828416
1183 Ga0075366_10998778
1184 Ga0097621_100001689
1185 Ga0097621_100048767
1186 Ga0068871_100000012
1187 Ga0068871_100028219
1188 Ga0075428_101030274
1189 Ga0075431_102088187
1190 Ga0075433_10073897
1191 Ga0075433_10529252
1192 Ga0075434_100008227
1193 Ga0075434_100057072
1194 Ga0075434_100208872
1195 Ga0068865_100001680
1196 Ga0068865_100002705
1197 Ga0068865_100080956
1198 Ga0075436_100790006
1199 Ga0097620_100005699
1200 Ga0097620_100090933
1201 Ga0097620_100155048
1202 Ga0075435_100010179
1203 Ga0075435_100046408
1204 Ga0075435_100250706
1205 Ga0075435_100347599
1206 Ga0105251_10063306
1207 Ga0105251_10574867
1208 Ga0105244_10263517
1209 Ga0105250_10019692
1210 Ga0105240_10024512
1211 Ga0105240_10311123
1212 Ga0111539_10022491
1213 Ga0111539_10073134
1214 Ga0111539_10135442
1215 Ga0111539_12457945
1216 Ga0105245_10000460
1217 Ga0105245_10040059
1218 Ga0105245_10349843
1219 Ga0105247_10009860
1220 Ga0105247_10023574
1221 Ga0105247_10227571
1222 Ga0105247_10392668
1223 Ga0114129_10001035
1224 Ga0114129_13064008
1225 Ga0105243_10004739
1226 Ga0105243_10462228
1227 Ga0105243_11137087
1228 Ga0105243_11278577
1229 Ga0105243_13063417
1230 Ga0105241_10004650
1231 Ga0105241_10042115
1232 Ga0105241_10288222
1233 Ga0105242_10012445
1234 Ga0105242_10109507
1235 Ga0105248_10009565
1236 Ga0105248_10018941
1237 Ga0105248_10798337
1238 Ga0105248_11315493
1239 Ga0105237_10036875
1240 Ga0105237_10398499
1241 Ga0105237_11155634
1242 Ga0105238_10949783
1243 Ga0105249_10011836
1244 Ga0105249_10080495
1245 Ga0105249_10589509
1246 Ga0105239_10083127
1247 Ga0105239_10132781
1248 Ga0105239_12028467
1249 Ga0105246_10003054
1250 Ga0105246_10020775
1251 Ga0105246_11400109
1252 Ga0157325_1010159
1253 Ga0157339_1002028
1254 Ga0157342_1036583
1255 Ga0157315_1001406
1256 Ga0157327_1007424
1257 Ga0157326_1007335
1258 Ga0157373_10040037
1259 Ga0157373_10167598
1260 Ga0157373_10588411
1261 Ga0157371_10056079
1262 Ga0157371_10127768
1263 Ga0157371_10686683
1264 Ga0157371_11067755
1265 Ga0157371_11432476
1266 Ga0157370_10060606
1267 Ga0157369_10589122
1268 Ga0157374_10038684
1269 Ga0157374_10083737
1270 Ga0157374_11363534
1271 Ga0157374_11377520
1272 Ga0157378_10014743
1273 Ga0157378_10506297
1274 Ga0163162_10015058
1275 Ga0163162_10056975
1276 Ga0157372_10019471
1277 Ga0157372_10363331
1278 Ga0157372_11128583
1279 Ga0157372_12472989
1280 Ga0157375_10006955
1281 Ga0157375_10011212
1282 Ga0157375_10057985
1283 Ga0163163_10000824
1284 Ga0163163_10010204
1285 Ga0163163_10879352
1286 Ga0163163_11929153
1287 Ga0157380_10011939
1288 Ga0157380_12382093
1289 Ga0182008_10490518
1290 Ga0157377_10000747
1291 Ga0157379_10007473
1292 Ga0157379_10013180
1293 Ga0157379_10623376
1294 Ga0157379_11171661
1295 Ga0157376_10002255
1296 Ga0157376_10021752
1297 Ga0163161_10016061
1298 Ga0163161_10093417
1299 Ga0207666_1000023
1300 Ga0207673_1000424
1301 Ga0209758_1000469
1302 Ga0207426_1021230
1303 Ga0207697_10012454
1304 Ga0207697_10016013
1305 Ga0207697_10330491
1306 Ga0207697_10429440
1307 Ga0207656_10446361
1308 Ga0207655_1197181
1309 Ga0207713_1133154
1310 Ga0207653_10036526
1311 Ga0207682_10000011
1312 Ga0207692_10023879
1313 Ga0207692_10066492
1314 Ga0207692_10988268
1315 Ga0207642_10011537
1316 Ga0207642_10103106
1317 Ga0207710_10004009
1318 Ga0207710_10014708
1319 Ga0207710_10371065
1320 Ga0207688_10004178
1321 Ga0207680_10064689
1322 Ga0207680_10070896
1323 Ga0207680_10240693
1324 Ga0207647_10010277
1325 Ga0207647_10065675
1326 Ga0207685_10086430
1327 Ga0207699_10044072
1328 Ga0207699_10147525
1329 Ga0207645_10000788
1330 Ga0207645_10050754
1331 Ga0207645_10248540
1332 Ga0207643_10000284
1333 Ga0207654_10048360
1334 Ga0207654_10093881
1335 Ga0207707_10070632
1336 Ga0207707_10117155
1337 Ga0207707_10189218
1338 Ga0207707_10594912
1339 Ga0207695_10063284
1340 Ga0207671_11476342
1341 Ga0207693_10022746
1342 Ga0207693_10214684
1343 Ga0207693_10976798
1344 Ga0207693_11061198
1345 Ga0207663_10075770
1346 Ga0207663_10202970
1347 Ga0207663_10686151
1348 Ga0207663_10903506
1349 Ga0207660_10002700
1350 Ga0207660_10175555
1351 Ga0207660_10311925
1352 Ga0207660_10556703
1353 Ga0207662_10004076
1354 Ga0207662_10083618
1355 Ga0207662_10493550
1356 Ga0207662_10962644
1357 Ga0207657_10011928
1358 Ga0207657_10014635
1359 Ga0207649_10000057
1360 Ga0207652_10010898
1361 Ga0207652_10079351
1362 Ga0207652_10179186
1363 Ga0207681_10000181
1364 Ga0207681_10063212
1365 Ga0207694_10826098
1366 Ga0207650_10009809
1367 Ga0207659_10000028
1368 Ga0207659_10370962
1369 Ga0207687_10000061
1370 Ga0207687_10034404
1371 Ga0207687_10404325
1372 Ga0207700_10002284
1373 Ga0207700_10194862
1374 Ga0207664_10090245
1375 Ga0207664_10978438
1376 Ga0207644_10030053
1377 Ga0207644_10035293
1378 Ga0207644_10269484
1379 Ga0207690_10003360
1380 Ga0207690_10059910
1381 Ga0207690_10529243
1382 Ga0207706_10008724
1383 Ga0207706_10011033
1384 Ga0207706_10048754
1385 Ga0207686_10001777
1386 Ga0207709_10000539
1387 Ga0207709_10339825
1388 Ga0207709_11037883
1389 Ga0207670_10000217
1390 Ga0207670_10032848
1391 Ga0207670_10062967
1392 Ga0207669_10000147
1393 Ga0207704_10000767
1394 Ga0207704_10025964
1395 Ga0207704_10102972
1396 Ga0207704_11156049
1397 Ga0207665_10306222
1398 Ga0207665_10593667
1399 Ga0207691_10015068
1400 Ga0207711_10001580
1401 Ga0207711_10490849
1402 Ga0207711_10694397
1403 Ga0207689_10016286
1404 Ga0207689_10170310
1405 Ga0207689_10822593
1406 Ga0207661_10000215
1407 Ga0207679_10000026
1408 Ga0207679_10376732
1409 Ga0207679_10539312
1410 Ga0207667_10162304
1411 Ga0207667_11425039
1412 Ga0207651_10000173
1413 Ga0207651_10066509
1414 Ga0207712_10002375
1415 Ga0207668_10000242
1416 Ga0207668_10011222
1417 Ga0207640_10004395
1418 Ga0207640_10244208
1419 Ga0207640_11712646
1420 Ga0207658_10001541
1421 Ga0207658_10086624
1422 Ga0207658_11114146
1423 Ga0207658_11758288
1424 Ga0207677_10001215
1425 Ga0207677_10419379
1426 Ga0207703_10011441
1427 Ga0207639_10030363
1428 Ga0207639_10114687
1429 Ga0207639_11378924
1430 Ga0207678_10003797
1431 Ga0207678_10231024
1432 Ga0207678_10254022
1433 Ga0207678_10313066
1434 Ga0207708_10040194
1435 Ga0207708_10040692
1436 Ga0207702_10013194
1437 Ga0207702_10563077
1438 Ga0207702_10588022
1439 Ga0207702_10667875
1440 Ga0207641_10004378
1441 Ga0207641_10651980
1442 Ga0207648_10013596
1443 Ga0207648_10426462
1444 Ga0207676_10011705
1445 Ga0207676_11914568
1446 Ga0207674_10019430
1447 Ga0207674_10978913
1448 Ga0207675_100005898
1449 Ga0207675_101016757
1450 Ga0207675_101209746
1451 Ga0207675_101496453
1452 Ga0207683_10000034
1453 Ga0207683_10985380
1454 Ga0207683_11212473
1455 Ga0207698_10062501
1456 Ga0207698_10545720
1457 Ga0207698_12612366
1458 Ga0209967_1029015
1459 Ga0209984_1000604
1460 Ga0210000_1058352
1461 Ga0209995_1037488
1462 Ga0209968_1017972
1463 Ga0209999_1052856
1464 Ga0209970_1054687
1465 Ga0210002_1001523
1466 Ga0209983_1005386
1467 Ga0209971_1011075
1468 Ga0209971_1106343
1469 Ga0209966_1002078
1470 Ga0209966_1009657
1471 Ga0209998_10001526
1472 Ga0209998_10004442
1473 Ga0209998_10008809
1474 Ga0209813_10312894
1475 Ga0209974_10001907
1476 Ga0209974_10031486
1477 Ga0209974_10231815
1478 Ga0209974_10250310
1479 Ga0207428_10000352
1480 Ga0207428_10015741
1481 Ga0207428_10962384
1482 Ga0268266_10208151
1483 Ga0268266_10368337
1484 Ga0268265_10034295
1485 Ga0268265_10083616
1486 Ga0268265_11704707
1487 Ga0268265_12465802
1488 Ga0268264_10029609
1489 Ga0268264_10051655
1490 Ga0268264_10211228
1491 Ga0268264_10268654
1492 Ga0265336_10203605
1493 Ga0265338_10091258
1494 Ga0265338_10252547
1495 Ga0265325_10000141
1496 Ga0265325_10042206
1497 Ga0265325_10049091
1498 Ga0265325_10066720
1499 Ga0265325_10076774
1500 Ga0265329_10030428
1501 Ga0265339_10358857
1502 Ga0265339_10394246
1503 Ga0265339_10450511
1504 Ga0265331_10045173
1505 Ga0265331_10543949
1506 Ga0265316_10352122
1507 Ga0265313_10018807
1508 Ga0265313_10021482
1509 Ga0265313_10187746
1510 Ga0265313_10293104
1511 Ga0316579_10145834
1512 Ga0265314_10001306
1513 Ga0265342_10535242
1514 Ga0373930_0027386
1515 Ga0373930_0090380
1516 Ga0373930_0093586
1517 Ga0373930_0114737
1518 Ga0373930_0184612
1519 Ga0373948_0000052
1520 Ga0373948_0029637
1521 Ga0373950_0000290
1522 Ga0373950_0013884
1523 Ga0373958_0000208
1524 Ga0373958_0003436
1525 Ga0373958_0070583
1526 Ga0373959_0000448
1527 Ga0373938_0000271
1528 Ga0373938_0001918
1529 Ga0373928_0000292
1530 Ga0373928_0003672
1531 Ga0373929_0000220
1532 Ga0373929_0008491
1533 Ga0373934_0033265
1534 Ga0373934_0044157
1535 Ga0373934_0219436
1536 Ga0373934_0392987
1537 Ga0373940_0000726
1538 Ga0373940_0020259
1539 Ga0373944_0023906
1540 Ga0373949_0001073
1541 Ga0373949_0092515
1542 Ga0373951_0000417
1543 Ga0373951_0007575
1544 Ga0373951_0037635
1545 Ga0373952_0000812
1546 Ga0373952_0000918
1547 Ga0373923_0069799
1548 Ga0373923_0598101
1549 Ga0373932_0000481
1550 Ga0373932_0008894
1551 Ga0373932_0099415
1552 Ga0373936_0015595
1553 Ga0373936_0060497
1554 Ga0373939_0000928
1555 Ga0373939_0004973
1556 Ga0373939_0007805
1557 Ga0373939_0114468
1558 Ga0373939_0265839
1559 Ga0373939_0510788
1560 Ga0373941_0017395
1561 Ga0373941_0122757
1562 Ga0373941_0252867
1563 Ga0373945_0002769
1564 Ga0373945_0483094
1565 Ga0373953_0040024
1566 Ga0373953_0182806
1567 Ga0373954_0000946
1568 Ga0373954_0124282
1569 Ga0373954_0430257
1570 Ga0373956_0031688
1571 Ga0373957_0000582
1572 Ga0373957_0073298
1573 Ga0373960_0000785
1574 Ga0373960_0077202
1575 Ga0373960_0366756
1576 Ga0373943_0043036
1577 Ga0373946_0313959
1578 Ga0373955_0012502
1579 Ga0373955_0015058
1580 Ga0373942_0001252
1581 Ga0373942_0008719
1582 Ga0373942_0210047
1583 Ga0373961_0000729
1584 Ga0373961_0010994
1585 Ga0373961_0119197
1586 Ga0373962_0000934
1587 Ga0373962_0003274
1588 Ga0373962_0203513
1589 Ga0373924_0013971
1590 Ga0373924_0236135
1591 Ga0373931_0033895
1592 Ga0373931_0085607
1593 Ga0373931_0167775
1594 Ga0373931_0199553
1595 Ga0373931_0823106
1596 Ga0373935_0315777
1597 Ga0373927_0054855
1598 Ga0373927_0198607
1599 Ga0373933_0001593
1600 Ga0373933_0057937
1601 Ga0373933_0275356
1602 Ga0373933_0564927
1603 Ga0373947_0030588
1604 Ga0373937_0020270
1605 Ga0373937_0364010
1606 Ga0373937_1440193
1607 Ga0316582_0987900
1608 Ga0373925_0025042
1609 Ga0242420_101194
1610 Ga0439438_136614
1611 Ga0439453_0003376
1612 Ga0439461_0150486
1613 Ga0439437_041097
1614 Ga0439441_102238
1615 Ga0439448_0022010
1616 Ga0439450_004715
1617 Ga0439455_0050676
1618 Ga0439455_0224038
1619 Ga0439463_057346
1620 Ga0450912_022373
1621 Ga0450923_005742
1622 Ga0439434_0050056
1623 Ga0439460_0084837
1624 Ga0439460_0113937
1625 Ga0451577_0284134
1626 Ga0453684_0130071
1627 Ga0451576_0054445
1628 Ga0495592_0001184
1629 Ga0495592_0001796
1630 Ga0495603_0039204
1631 Ga0495629_0022097
1632 Ga0495629_0105177
1633 Ga0495641_0021810
1634 Ga0495651_0000895
1635 Ga0495651_0121907
1636 Ga0495653_0012511
1637 Ga0495653_0061825
1638 Ga0495653_0112665
1639 Ga0495580_0022216
1640 Ga0495582_0033772
1641 Ga0495605_0186899
1642 Ga0495605_0432582
1643 Ga0495639_0056207
1644 Ga0495662_0089456
1645 Ga0495664_0104577
1646 Ga0495584_0019904
1647 Ga0495584_0320445
1648 Ga0495594_0100434
1649 Ga0495608_0000129
1650 Ga0495608_0064010
1651 Ga0495608_0741337
1652 Ga0495618_0001726
1653 Ga0495628_0001570
1654 Ga0495628_0003849
1655 Ga0495630_0152347
1656 Ga0495630_0222963
1657 Ga0495630_0522976
1658 Ga0495666_0037234
1659 Ga0495652_0004520
1660 Ga0495652_0005753
1661 Ga0495640_0015297
1662 Ga0495640_0506676
1663 Ga0495586_0075384
1664 Ga0495587_0000354
1665 Ga0495609_0389822
1666 Ga0495621_0410885
1667 Ga0495645_0000800
1668 Ga0495645_0001074
1669 Ga0495622_0026504
1670 Ga0495667_0002315
1671 Ga0495667_0005226
1672 Ga0495667_0626731
1673 Ga0495634_0029694
1674 Ga0495634_0284418
1675 Ga0495635_0001388
1676 Ga0495635_0008767
1677 Ga0495635_0315488
1678 Ga0495588_0009363
1679 Ga0495657_0001374
1680 Ga0495599_0000294
1681 Ga0495623_0000055
1682 Ga0495623_0034568
1683 Ga0495646_0000749
1684 Ga0495646_0096760
1685 Ga0495647_0003946
1686 Ga0495658_0055246
1687 Ga0495658_0771160
1688 Ga0495669_0416858
1689 Ga0495669_0514129
1690 Ga0495669_0652107
1691 Ga0495613_0086929
1692 Ga0495613_0099715
1693 Ga0495624_0083266
1694 Ga0495600_0015473
1695 Ga0495581_0120100
1696 Ga0495604_0001560
1697 Ga0495604_0840185
1698 Ga0495674_0005151
1699 Ga0495676_0020056
1700 Ga0495680_0023201
1701 Ga0495680_0028926
1702 Ga0495683_0399392
1703 Ga0495675_0000190
1704 Ga0495675_0761318
1705 Ga0495677_0026799
1706 Ga0495684_0079574
1707 Ga0495684_0110226
1708 Ga0495684_0125158
1709 Ga0495593_0019249
1710 Ga0495593_0101596
1711 Ga0495602_0000445
1712 Ga0495602_0051765
1713 Ga0495614_0055739
1714 Ga0496100_0008642
1715 Ga0496100_0026951
1716 Ga0496100_0718454
1717 Ga0496100_1169733
1718 Ga0496101_0000756
1719 Ga0496101_0061211
1720 Ga0496101_0558541
1721 Ga0496101_1409394
1722 Ga0496102_0004000
1723 Ga0496102_0015432
1724 Ga0496102_0034406
1725 Ga0496102_0118800
1726 Ga0496102_0674401
1727 Ga0496102_1505913
1728 Ga0496103_0005706
1729 Ga0496103_0035045
1730 Ga0496103_0626835
1731 Ga0496104_0000685
1732 Ga0496104_0015809
1733 Ga0496104_0038642
1734 Ga0496104_0068546
1735 Ga0496105_0004285
1736 Ga0496105_0004757
1737 Ga0496105_0066300
1738 Ga0496106_0015376
1739 Ga0496106_0018745
1740 Ga0496106_0157291
1741 Ga0496107_0034190
1742 Ga0496107_0071295
1743 Ga0496107_0113287
1744 Ga0496107_0214485
1745 Ga0496108_0060683
1746 Ga0496108_0064652
1747 Ga0496108_0120541
1748 Ga0496108_0678493
1749 Ga0496109_0000736
1750 Ga0496109_0002526
1751 Ga0496109_0836602
1752 Ga0496109_0869542
1753 Ga0496110_0040570
1754 Ga0496110_0073214
1755 Ga0496110_0115516
1756 Ga0496110_0116265
1757 Ga0496110_0601642
1758 Ga0496111_0004209
1759 Ga0496111_0028217
1760 Ga0496111_0046988
1761 Ga0496111_0446740
1762 Ga0496111_0500311
1763 Ga0496112_0006875
1764 Ga0496112_0520368
1765 Ga0496112_1096512
1766 Ga0496113_0000137
1767 Ga0496113_0089487
1768 Ga0496113_0722695
1769 Ga0496113_1451753
1770 Ga0496114_0019287
1771 Ga0496114_1018750
1772 Ga0496115_0001071
1773 Ga0496115_0052463
1774 Ga0496115_0212618
1775 Ga0496115_0215768
1776 Ga0496115_0368980
1777 Ga0501031_0200545
1778 Ga0501032_0006386
1779 Ga0501032_0674492
1780 Ga0501033_0015402
1781 Ga0501033_0873285
1782 Ga0501034_0003727
1783 Ga0501034_0088704
1784 Ga0501034_0827729
1785 Ga0501036_0001268
1786 Ga0501036_0913683
1787 Ga0501037_0002956
1788 Ga0501038_0006827
1789 Ga0501038_1261459
1790 Ga0501039_0001032
1791 Ga0501042_0022883
1792 Ga0501043_0016441
1793 Ga0501043_0547671
1794 Ga0501046_0003718
1795 Ga0501046_0809632
1796 Ga0501047_0003496
1797 Ga0501047_0456182
1798 Ga0501047_0624279
1799 Ga0501047_1293631
1800 Ga0501048_0021902
1801 Ga0501067_0020492
1802 Ga0501067_0169709
1803 Ga0501067_0181781
1804 Ga0501068_0001483
1805 Ga0501068_0402075
1806 Ga0501068_0798678
1807 Ga0501069_0010836
1808 Ga0501069_0479032
1809 Ga0501070_0006615
1810 Ga0501070_0013417
1811 Ga0501070_0094844
1812 Ga0501070_0451718
1813 Ga0501070_1270496
1814 Ga0501071_0030772
1815 Ga0501071_0121667
1816 Ga0501072_0090931
1817 Ga0501072_0184387
1818 Ga0501072_0608886
1819 Ga0501073_0022730
1820 Ga0501073_0054051
1821 Ga0501073_0067793
1822 Ga0501074_0004173
1823 Ga0501074_0069598
1824 Ga0501074_0481657
1825 Ga0501076_0119375
1826 Ga0501076_1053318
1827 Ga0501077_0013445
1828 Ga0501077_0915746
1829 Ga0501079_0042008
1830 Ga0501079_0199651
1831 Ga0501079_0447865
1832 Ga0501080_0004990
1833 Ga0501080_0595808
1834 Ga0501080_0878274
1835 Ga0501080_0909845
1836 Ga0501080_1248272
1837 Ga0501081_0069649
1838 Ga0501083_0011859
1839 Ga0501083_0157471
1840 Ga0501083_0227065
1841 Ga0501083_0547854
1842 Ga0501083_0640081
1843 Ga0501035_0005159
1844 Ga0501044_0000815
1845 Ga0501044_0047956
1846 Ga0501044_0091369
1847 Ga0501044_0228946
1848 Ga0501044_0265469
1849 Ga0501044_0366313
1850 Ga0501045_0028538
1851 nmdc:mga03683_285151_c1
1852 nmdc:mga03683_55536_c1
1853 nmdc:mga03n38_204888_c1
1854 nmdc:mga00v17_1027838_c1
1855 nmdc:mga0yw44_1210491_c1
1856 nmdc:mga0k408_5369_c1
1857 nmdc:mga0k408_681019_c1
1858 nmdc:mga06z11_34084_c1
1859 nmdc:mga06z11_398671_c1
1860 nmdc:mga06z11_87978_c1
1861 nmdc:mga04h51_172790_c1
1862 nmdc:mga05p37_12681_c1
1863 nmdc:mga0qj67_1145800_c1
1864 nmdc:mga08y16_10015_c1
1865 nmdc:mga08y16_148566_c1
1866 nmdc:mga0n895_1708930_c1
1867 nmdc:mga0n895_180745_c1
1868 nmdc:mga0n895_342978_c1
1869 nmdc:mga0n895_5683_c1
1870 nmdc:mga0n895_656907_c1
1871 nmdc:mga0rr50_128689_c1
1872 nmdc:mga0rr50_244106_c1
1873 nmdc:mga0rr50_26270_c1
1874 nmdc:mga0rr50_587162_c1
1875 nmdc:mga0a205_20550_c1
1876 nmdc:mga0a205_34581_c1
1877 Ga0495601_0000677
1878 Ga0495601_0000798
1879 Ga0495612_0000089
1880 Ga0495612_0004307
1881 Ga0495595_0000369
1882 Ga0495595_0009383
1883 Ga0495619_0002831
1884 Ga0495619_0004203
1885 Ga0495619_0212680
1886 Ga0500556_0251699
1887 Ga0500595_065803
1888 Ga0500595_153555
1889 Ga0500618_053097
1890 Ga0500642_0041131
1891 Ga0500652_057838
1892 Ga0500568_0195641
1893 Ga0500573_0352082
1894 Ga0501084_0024607
1895 Ga0501084_0089613
1896 Ga0501082_0025085
1897 Ga0501082_0120448
1898 Ga0501082_0347494
1899 Ga0501082_0598370
1900 Ga0501082_1447803

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04995

CcmD

Heme exporter protein D (CcmD)

12

55

0.97

Map