F486551
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 950 | 478 | 887 | 193 |
Family's Representative Sequence
| Representative Sequence | 3300007265|Ga0099794_10223694|Ga0099794_102236942 |
| Length | 209 |
| Sequence | MKKKKMSTAMSQPLLIAFVMFAAVMFFTPGPNNIMLLSSGLTYGFRPTLPHIAGITFGFAFMIGVVGLGLGTIFITYPVLQTILKYAGVAYLIYLAAAIAMSGPVKPDHDNRRGPMTFWGAAMFQWINAKGWVMVIGTITAYAGIASFPWNITIQVMLSLVLGAVSCSAWALFGTALRPLLTSPRLVRTFNIVMAVLLLASLYPVFMDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 3 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 4 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 5 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 6 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 7 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 8 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 9 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 10 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 11 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 12 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 13 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 14 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 15 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 16 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 17 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 18 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 19 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 20 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 21 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 22 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 23 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 24 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 25 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 26 | 2904699407 | |||
| 27 | 2906610324 | |||
| 28 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 29 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 30 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 31 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 32 | 2922425934 | |||
| 33 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 34 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 35 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 36 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 37 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 38 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 39 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 40 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 41 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 42 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 44 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 45 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 46 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 47 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 48 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 49 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 54 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 56 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 66 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 80 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 85 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 92 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 97 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 98 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 99 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 100 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 101 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 102 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 103 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 104 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 105 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 106 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 107 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 108 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 109 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 111 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 112 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 113 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 114 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 115 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 116 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 117 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 119 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 120 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 121 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 122 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 124 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 125 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 126 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 127 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 128 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 130 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 131 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 132 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 133 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 134 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 135 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 147 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 161 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 162 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 163 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 164 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 230 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 231 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 232 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 233 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 234 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 238 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 239 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 240 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 242 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 243 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 244 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 245 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 246 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 247 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 248 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 249 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 250 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 251 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 252 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 253 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 254 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 255 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 256 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 257 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 258 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 259 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 260 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 261 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 262 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 263 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 264 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 265 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 266 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 267 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 268 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 269 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 270 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 271 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 272 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 273 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 274 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 276 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 277 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 278 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 279 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 280 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 281 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 282 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 283 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 284 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 285 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 286 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 287 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 288 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 289 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 290 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 291 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 292 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 293 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 294 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 295 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 296 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 297 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 298 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 299 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 300 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 301 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 302 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 380 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 381 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 382 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 383 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 384 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 385 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 386 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 387 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 388 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 389 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 390 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 391 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 392 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 393 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 394 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 395 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 396 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 397 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 398 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 399 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 400 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 401 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 402 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 403 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 404 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 419 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 420 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 421 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 422 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 423 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 424 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 425 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 426 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 433 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 435 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 439 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 440 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 441 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 442 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 443 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 444 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 445 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 446 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 447 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 448 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 449 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 450 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 451 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 452 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 453 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 454 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 455 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 456 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 457 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 458 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 459 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 460 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 461 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 462 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 463 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 464 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 465 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 466 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 467 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 468 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 469 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 470 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 471 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 472 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 473 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 474 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 475 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 476 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 477 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 478 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.46 |
| Metatranscriptomes | 0.11 |
| Isolates | 4.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.26 |
| Nodule | 3.68 |
| Rhizoplane | 5.26 |
| Rhizosphere | 69.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10012951 | 3300001989 | Bacteria | 3052 |
| 2 | JGI24737J22298_10016177 | 3300001990 | Bacteria | 2409 |
| 3 | JGI24735J21928_10016953 | 3300002067 | Bacteria | 2255 |
| 4 | JGI24742J22300_10012308 | 3300002244 | Bacteria | 1425 |
| 5 | JGI25406J46586_10000721 | 3300003203 | Bacteria | 15439 |
| 6 | JGI25406J46586_10008215 | 3300003203 | Bacteria | 4737 |
| 7 | JGI25406J46586_10017054 | 3300003203 | Bacteria | 3009 |
| 8 | JGI25153J46596_10000738 | 3300003215 | Bacteria | 20026 |
| 9 | rootH2_10077708 | 3300003320 | Bacteria | 1427 |
| 10 | JGI25160J50197_1029660 | 3300003354 | Bacteria | 1441 |
| 11 | JGI25404J52841_10015813 | 3300003659 | Bacteria | 1637 |
| 12 | JGI25404J52841_10047108 | 3300003659 | Bacteria | 909 |
| 13 | JGI25405J52794_10061750 | 3300003911 | Bacteria | 811 |
| 14 | Ga0065165_1009382 | 3300005262 | Bacteria | 4396 |
| 15 | Ga0070658_10562246 | 3300005327 | Bacteria | 987 |
| 16 | Ga0070676_10212565 | 3300005328 | Bacteria | 1274 |
| 17 | Ga0070683_100017126 | 3300005329 | Bacteria | 6399 |
| 18 | Ga0070683_100521531 | 3300005329 | Bacteria | 1135 |
| 19 | Ga0070690_100647479 | 3300005330 | Bacteria | 807 |
| 20 | Ga0068869_100064859 | 3300005334 | Bacteria | 2687 |
| 21 | Ga0068869_100381851 | 3300005334 | Bacteria | 1155 |
| 22 | Ga0070680_100061117 | 3300005336 | Bacteria | 3084 |
| 23 | Ga0068868_100130295 | 3300005338 | Bacteria | 2057 |
| 24 | Ga0068868_100137064 | 3300005338 | Bacteria | 2006 |
| 25 | Ga0068868_100747279 | 3300005338 | Bacteria | 879 |
| 26 | Ga0070660_100884856 | 3300005339 | Bacteria | 753 |
| 27 | Ga0070689_100504881 | 3300005340 | Bacteria | 1036 |
| 28 | Ga0070691_10055133 | 3300005341 | Bacteria | 1903 |
| 29 | Ga0070687_100189376 | 3300005343 | Bacteria | 1238 |
| 30 | Ga0070661_100205620 | 3300005344 | Bacteria | 1506 |
| 31 | Ga0070668_100050535 | 3300005347 | Bacteria | 3201 |
| 32 | Ga0070668_100152569 | 3300005347 | Bacteria | 1869 |
| 33 | Ga0070669_100236187 | 3300005353 | Bacteria | 1451 |
| 34 | Ga0070671_100160005 | 3300005355 | Bacteria | 1903 |
| 35 | Ga0070671_100501845 | 3300005355 | Bacteria | 1044 |
| 36 | Ga0070674_100062001 | 3300005356 | Bacteria | 2612 |
| 37 | Ga0070688_100109774 | 3300005365 | Bacteria | 1833 |
| 38 | Ga0070688_100172809 | 3300005365 | Bacteria | 1493 |
| 39 | Ga0070659_100251243 | 3300005366 | Bacteria | 1465 |
| 40 | Ga0070659_100383741 | 3300005366 | Bacteria | 1184 |
| 41 | Ga0070659_100668052 | 3300005366 | Bacteria | 897 |
| 42 | Ga0070667_101255141 | 3300005367 | Bacteria | 694 |
| 43 | Ga0070703_10198342 | 3300005406 | Bacteria | 786 |
| 44 | Ga0070709_10001764 | 3300005434 | Bacteria | 11754 |
| 45 | Ga0070709_10153975 | 3300005434 | Bacteria | 1591 |
| 46 | Ga0070714_100051653 | 3300005435 | Bacteria | 3506 |
| 47 | Ga0070714_100547529 | 3300005435 | Bacteria | 1107 |
| 48 | Ga0070713_100061144 | 3300005436 | Bacteria | 3151 |
| 49 | Ga0070713_100211833 | 3300005436 | Bacteria | 1754 |
| 50 | Ga0070713_100228238 | 3300005436 | Bacteria | 1691 |
| 51 | Ga0070713_100378511 | 3300005436 | Bacteria | 1318 |
| 52 | Ga0070713_100835486 | 3300005436 | Bacteria | 884 |
| 53 | Ga0070710_10001695 | 3300005437 | Bacteria | 10382 |
| 54 | Ga0070710_10527186 | 3300005437 | Bacteria | 812 |
| 55 | Ga0070711_100020703 | 3300005439 | Bacteria | 4243 |
| 56 | Ga0070711_100044852 | 3300005439 | Bacteria | 3003 |
| 57 | Ga0070711_100712389 | 3300005439 | Bacteria | 846 |
| 58 | Ga0070711_100773988 | 3300005439 | Bacteria | 812 |
| 59 | Ga0070708_101169909 | 3300005445 | Bacteria | 720 |
| 60 | Ga0070663_100018549 | 3300005455 | Bacteria | 4566 |
| 61 | Ga0070663_100053867 | 3300005455 | Bacteria | 2873 |
| 62 | Ga0070663_100685201 | 3300005455 | Bacteria | 870 |
| 63 | Ga0070678_100198168 | 3300005456 | Bacteria | 1655 |
| 64 | Ga0070678_100371820 | 3300005456 | Bacteria | 1234 |
| 65 | Ga0070678_100383583 | 3300005456 | Bacteria | 1216 |
| 66 | Ga0070662_100050768 | 3300005457 | Bacteria | 2992 |
| 67 | Ga0070662_100190683 | 3300005457 | Bacteria | 1621 |
| 68 | Ga0070662_100483100 | 3300005457 | Bacteria | 1031 |
| 69 | Ga0070681_10463553 | 3300005458 | Bacteria | 1179 |
| 70 | Ga0068867_100111788 | 3300005459 | Bacteria | 2099 |
| 71 | Ga0068867_100349335 | 3300005459 | Bacteria | 1234 |
| 72 | Ga0070706_100129052 | 3300005467 | Bacteria | 2359 |
| 73 | Ga0070706_100260542 | 3300005467 | Bacteria | 1619 |
| 74 | Ga0070707_100119818 | 3300005468 | Bacteria | 2555 |
| 75 | Ga0070698_100197239 | 3300005471 | Bacteria | 1949 |
| 76 | Ga0070698_100617451 | 3300005471 | Bacteria | 1025 |
| 77 | Ga0070697_100238054 | 3300005536 | Bacteria | 1554 |
| 78 | Ga0068853_100097793 | 3300005539 | Bacteria | 2592 |
| 79 | Ga0068853_100262428 | 3300005539 | Bacteria | 1588 |
| 80 | Ga0068853_101018183 | 3300005539 | Bacteria | 798 |
| 81 | Ga0070672_100109452 | 3300005543 | Bacteria | 2250 |
| 82 | Ga0070672_100154769 | 3300005543 | Bacteria | 1898 |
| 83 | Ga0070686_100356428 | 3300005544 | Bacteria | 1100 |
| 84 | Ga0070695_100094980 | 3300005545 | Bacteria | 1997 |
| 85 | Ga0070695_100542236 | 3300005545 | Bacteria | 906 |
| 86 | Ga0070696_100473956 | 3300005546 | Bacteria | 992 |
| 87 | Ga0070665_100088043 | 3300005548 | Bacteria | 3111 |
| 88 | Ga0070665_100174517 | 3300005548 | Bacteria | 2150 |
| 89 | Ga0070665_100701082 | 3300005548 | Bacteria | 1025 |
| 90 | Ga0070704_100583576 | 3300005549 | Bacteria | 980 |
| 91 | Ga0070704_100666847 | 3300005549 | Bacteria | 919 |
| 92 | Ga0068855_100050191 | 3300005563 | Bacteria | 4918 |
| 93 | Ga0068855_100053959 | 3300005563 | Bacteria | 4727 |
| 94 | Ga0068855_100508206 | 3300005563 | Bacteria | 1309 |
| 95 | Ga0068855_100531771 | 3300005563 | Bacteria | 1274 |
| 96 | Ga0070664_100432562 | 3300005564 | Bacteria | 1206 |
| 97 | Ga0068857_100014952 | 3300005577 | Bacteria | 6770 |
| 98 | Ga0068857_100165432 | 3300005577 | Bacteria | 2008 |
| 99 | Ga0068857_100548812 | 3300005577 | Bacteria | 1089 |
| 100 | Ga0068854_100021501 | 3300005578 | Bacteria | 4379 |
| 101 | Ga0068854_100364401 | 3300005578 | Bacteria | 1186 |
| 102 | Ga0068854_101195812 | 3300005578 | Bacteria | 681 |
| 103 | Ga0068856_100002538 | 3300005614 | Bacteria | 18824 |
| 104 | Ga0068856_100100529 | 3300005614 | Bacteria | 2884 |
| 105 | Ga0068856_100289594 | 3300005614 | Bacteria | 1654 |
| 106 | Ga0068856_100444122 | 3300005614 | Bacteria | 1318 |
| 107 | Ga0068852_100008462 | 3300005616 | Bacteria | 7583 |
| 108 | Ga0068852_100660284 | 3300005616 | Bacteria | 1054 |
| 109 | Ga0068852_100757318 | 3300005616 | Bacteria | 983 |
| 110 | Ga0068852_100782486 | 3300005616 | Bacteria | 968 |
| 111 | Ga0068859_100668110 | 3300005617 | Bacteria | 1130 |
| 112 | Ga0068859_101197883 | 3300005617 | Bacteria | 836 |
| 113 | Ga0068864_100128028 | 3300005618 | Bacteria | 2277 |
| 114 | Ga0068864_100556159 | 3300005618 | Bacteria | 1110 |
| 115 | Ga0068864_100748175 | 3300005618 | Bacteria | 958 |
| 116 | Ga0068866_10046902 | 3300005718 | Bacteria | 2175 |
| 117 | Ga0068861_100030335 | 3300005719 | Bacteria | 3961 |
| 118 | Ga0068861_100046881 | 3300005719 | Bacteria | 3260 |
| 119 | Ga0068861_100572507 | 3300005719 | Bacteria | 1032 |
| 120 | Ga0068870_10242840 | 3300005840 | Bacteria | 1113 |
| 121 | Ga0068863_100243895 | 3300005841 | Bacteria | 1734 |
| 122 | Ga0068863_100394052 | 3300005841 | Bacteria | 1353 |
| 123 | Ga0068858_100239469 | 3300005842 | Bacteria | 1721 |
| 124 | Ga0068858_100420222 | 3300005842 | Bacteria | 1286 |
| 125 | Ga0068858_100766265 | 3300005842 | Bacteria | 941 |
| 126 | Ga0068860_100000533 | 3300005843 | Bacteria | 46479 |
| 127 | Ga0068860_100134467 | 3300005843 | Bacteria | 2374 |
| 128 | Ga0068862_100265752 | 3300005844 | Bacteria | 1567 |
| 129 | Ga0068862_100569862 | 3300005844 | Bacteria | 1083 |
| 130 | Ga0081455_10070768 | 3300005937 | Bacteria | 2895 |
| 131 | Ga0081455_10380199 | 3300005937 | Bacteria | 987 |
| 132 | Ga0081540_1002213 | 3300005983 | Bacteria | 16044 |
| 133 | Ga0081540_1005827 | 3300005983 | Bacteria | 9115 |
| 134 | Ga0081540_1012712 | 3300005983 | Bacteria | 5519 |
| 135 | Ga0081540_1017590 | 3300005983 | Bacteria | 4418 |
| 136 | Ga0081540_1024174 | 3300005983 | Bacteria | 3532 |
| 137 | Ga0081540_1025572 | 3300005983 | Bacteria | 3392 |
| 138 | Ga0081540_1052500 | 3300005983 | Bacteria | 2006 |
| 139 | Ga0081539_10000748 | 3300005985 | Bacteria | 64594 |
| 140 | Ga0081539_10001829 | 3300005985 | Bacteria | 33573 |
| 141 | Ga0070717_10133966 | 3300006028 | Bacteria | 2132 |
| 142 | Ga0070717_10257705 | 3300006028 | Bacteria | 1543 |
| 143 | Ga0075365_10027753 | 3300006038 | Bacteria | 3605 |
| 144 | Ga0075365_10039617 | 3300006038 | Bacteria | 3069 |
| 145 | Ga0075365_10126465 | 3300006038 | Bacteria | 1766 |
| 146 | Ga0075365_10296614 | 3300006038 | Bacteria | 1137 |
| 147 | Ga0075365_10358222 | 3300006038 | Bacteria | 1028 |
| 148 | Ga0075365_10479718 | 3300006038 | Bacteria | 878 |
| 149 | Ga0075368_10020977 | 3300006042 | Bacteria | 2478 |
| 150 | Ga0075368_10030204 | 3300006042 | Bacteria | 2098 |
| 151 | Ga0075363_100023427 | 3300006048 | Bacteria | 3129 |
| 152 | Ga0075363_100052487 | 3300006048 | Bacteria | 2176 |
| 153 | Ga0075363_100448932 | 3300006048 | Bacteria | 761 |
| 154 | Ga0075364_10281885 | 3300006051 | Bacteria | 1130 |
| 155 | Ga0075432_10127059 | 3300006058 | Bacteria | 962 |
| 156 | Ga0070715_10001014 | 3300006163 | Bacteria | 7909 |
| 157 | Ga0070716_100019284 | 3300006173 | Bacteria | 3563 |
| 158 | Ga0070716_100399010 | 3300006173 | Bacteria | 988 |
| 159 | Ga0070716_100442075 | 3300006173 | Bacteria | 946 |
| 160 | Ga0070712_100029479 | 3300006175 | Bacteria | 3678 |
| 161 | Ga0070712_100573429 | 3300006175 | Bacteria | 953 |
| 162 | Ga0070712_100755187 | 3300006175 | Bacteria | 832 |
| 163 | Ga0075362_10094934 | 3300006177 | Bacteria | 1388 |
| 164 | Ga0075367_10089243 | 3300006178 | Bacteria | 1874 |
| 165 | Ga0075367_10119054 | 3300006178 | Bacteria | 1626 |
| 166 | Ga0075367_10151217 | 3300006178 | Bacteria | 1440 |
| 167 | Ga0075367_10176008 | 3300006178 | Bacteria | 1333 |
| 168 | Ga0075367_10384087 | 3300006178 | Bacteria | 887 |
| 169 | Ga0075369_10065856 | 3300006186 | Bacteria | 1588 |
| 170 | Ga0075369_10293403 | 3300006186 | Bacteria | 759 |
| 171 | Ga0075369_10340714 | 3300006186 | Bacteria | 703 |
| 172 | Ga0075366_10409780 | 3300006195 | Bacteria | 834 |
| 173 | Ga0075366_10465306 | 3300006195 | Bacteria | 781 |
| 174 | Ga0097621_100156156 | 3300006237 | Bacteria | 1958 |
| 175 | Ga0097621_100273661 | 3300006237 | Bacteria | 1484 |
| 176 | Ga0075370_10055472 | 3300006353 | Bacteria | 2251 |
| 177 | Ga0075370_10105899 | 3300006353 | Bacteria | 1630 |
| 178 | Ga0075370_10152099 | 3300006353 | Bacteria | 1356 |
| 179 | Ga0075370_10477048 | 3300006353 | Bacteria | 752 |
| 180 | Ga0068871_100235438 | 3300006358 | Bacteria | 1590 |
| 181 | Ga0068871_100267565 | 3300006358 | Bacteria | 1493 |
| 182 | Ga0068871_100349535 | 3300006358 | Bacteria | 1307 |
| 183 | Ga0075428_100084451 | 3300006844 | Bacteria | 3464 |
| 184 | Ga0075434_100395193 | 3300006871 | Bacteria | 1403 |
| 185 | Ga0068865_100059062 | 3300006881 | Bacteria | 2681 |
| 186 | Ga0068865_100122589 | 3300006881 | Bacteria | 1935 |
| 187 | Ga0068865_100678081 | 3300006881 | Bacteria | 878 |
| 188 | Ga0097620_100668134 | 3300006931 | Bacteria | 1130 |
| 189 | Ga0097620_101197797 | 3300006931 | Bacteria | 836 |
| 190 | Ga0099825_1032872 | 3300006941 | Bacteria | 2064 |
| 191 | Ga0099824_1014525 | 3300006942 | Bacteria | 7787 |
| 192 | Ga0099822_1005034 | 3300006943 | Bacteria | 17247 |
| 193 | Ga0075435_100401054 | 3300007076 | Bacteria | 1179 |
| 194 | Ga0099794_10029066 | 3300007265 | Bacteria | 2574 |
| 195 | Ga0099794_10141477 | 3300007265 | Bacteria | 1218 |
| 196 | Ga0099794_10148055 | 3300007265 | Bacteria | 1191 |
| 197 | Ga0099794_10223694 | 3300007265 | Bacteria | 967 |
| 198 | Ga0099795_10032744 | 3300007788 | Bacteria | 1800 |
| 199 | Ga0105240_10030327 | 3300009093 | Bacteria | 7028 |
| 200 | Ga0105240_10036581 | 3300009093 | Bacteria | 6313 |
| 201 | Ga0105240_10141354 | 3300009093 | Bacteria | 2878 |
| 202 | Ga0105240_11578733 | 3300009093 | Bacteria | 687 |
| 203 | Ga0111539_10163191 | 3300009094 | Bacteria | 2606 |
| 204 | Ga0111539_10255594 | 3300009094 | Bacteria | 2040 |
| 205 | Ga0105245_10046675 | 3300009098 | Bacteria | 3871 |
| 206 | Ga0105245_10801445 | 3300009098 | Bacteria | 980 |
| 207 | Ga0105247_10036617 | 3300009101 | Bacteria | 2991 |
| 208 | Ga0105247_10159250 | 3300009101 | Bacteria | 1493 |
| 209 | Ga0105247_10206883 | 3300009101 | Bacteria | 1322 |
| 210 | Ga0105247_10420080 | 3300009101 | Bacteria | 957 |
| 211 | Ga0105243_10275580 | 3300009148 | Bacteria | 1513 |
| 212 | Ga0105243_10420205 | 3300009148 | Bacteria | 1247 |
| 213 | Ga0105243_10742634 | 3300009148 | Bacteria | 961 |
| 214 | Ga0105241_10117846 | 3300009174 | Bacteria | 2134 |
| 215 | Ga0105241_11096257 | 3300009174 | Bacteria | 749 |
| 216 | Ga0105242_10195163 | 3300009176 | Bacteria | 1795 |
| 217 | Ga0105242_10707278 | 3300009176 | Bacteria | 987 |
| 218 | Ga0105242_10894335 | 3300009176 | Bacteria | 887 |
| 219 | Ga0105248_10498772 | 3300009177 | Bacteria | 1372 |
| 220 | Ga0105248_11061362 | 3300009177 | Bacteria | 915 |
| 221 | Ga0105248_11700760 | 3300009177 | Bacteria | 715 |
| 222 | Ga0105237_10066154 | 3300009545 | Bacteria | 3610 |
| 223 | Ga0105237_10124394 | 3300009545 | Bacteria | 2574 |
| 224 | Ga0105237_10770205 | 3300009545 | Bacteria | 969 |
| 225 | Ga0105237_10885744 | 3300009545 | Bacteria | 899 |
| 226 | Ga0105238_10008344 | 3300009551 | Bacteria | 10365 |
| 227 | Ga0105249_10821648 | 3300009553 | Bacteria | 994 |
| 228 | Ga0105249_11153238 | 3300009553 | Bacteria | 846 |
| 229 | Ga0105249_11378852 | 3300009553 | Bacteria | 777 |
| 230 | Ga0105249_12059108 | 3300009553 | Bacteria | 643 |
| 231 | Ga0099796_10082966 | 3300010159 | Bacteria | 1178 |
| 232 | Ga0099796_10091940 | 3300010159 | Bacteria | 1129 |
| 233 | Ga0099796_10198341 | 3300010159 | Bacteria | 813 |
| 234 | Ga0105239_10007487 | 3300010375 | Bacteria | 12527 |
| 235 | Ga0105239_10165019 | 3300010375 | Bacteria | 2476 |
| 236 | Ga0105246_10180621 | 3300011119 | Bacteria | 1624 |
| 237 | Ga0157370_10081244 | 3300013104 | Bacteria | 3050 |
| 238 | Ga0157370_10519025 | 3300013104 | Bacteria | 1093 |
| 239 | Ga0157374_10131890 | 3300013296 | Bacteria | 2418 |
| 240 | Ga0157378_10133193 | 3300013297 | Bacteria | 2303 |
| 241 | Ga0157378_10140689 | 3300013297 | Bacteria | 2241 |
| 242 | Ga0157378_10496294 | 3300013297 | Bacteria | 1219 |
| 243 | Ga0157378_10697539 | 3300013297 | Bacteria | 1034 |
| 244 | Ga0157378_10740440 | 3300013297 | Bacteria | 1005 |
| 245 | Ga0157378_10798558 | 3300013297 | Bacteria | 969 |
| 246 | Ga0163162_10561879 | 3300013306 | Bacteria | 1269 |
| 247 | Ga0157372_10719819 | 3300013307 | Bacteria | 1161 |
| 248 | Ga0157375_10281247 | 3300013308 | Bacteria | 1827 |
| 249 | Ga0157375_10564644 | 3300013308 | Bacteria | 1299 |
| 250 | Ga0157375_10595944 | 3300013308 | Bacteria | 1265 |
| 251 | Ga0157375_10750967 | 3300013308 | Bacteria | 1127 |
| 252 | Ga0163163_10069119 | 3300014325 | Bacteria | 3516 |
| 253 | Ga0163163_10126403 | 3300014325 | Bacteria | 2595 |
| 254 | Ga0157380_10586871 | 3300014326 | Bacteria | 1100 |
| 255 | Ga0157380_10857288 | 3300014326 | Bacteria | 931 |
| 256 | Ga0157377_10176996 | 3300014745 | Bacteria | 1338 |
| 257 | Ga0157379_10018767 | 3300014968 | Bacteria | 6098 |
| 258 | Ga0157379_10387674 | 3300014968 | Bacteria | 1283 |
| 259 | Ga0157379_10562057 | 3300014968 | Bacteria | 1062 |
| 260 | Ga0163161_10822778 | 3300017792 | Bacteria | 782 |
| 261 | Ga0213873_10035460 | 3300021358 | Bacteria | 1262 |
| 262 | Ga0213872_10194607 | 3300021361 | Bacteria | 871 |
| 263 | Ga0213876_10096501 | 3300021384 | Bacteria | 1566 |
| 264 | Ga0213876_10367531 | 3300021384 | Bacteria | 765 |
| 265 | Ga0213871_10005944 | 3300021441 | Bacteria | 2552 |
| 266 | Ga0209677_100642 | 3300025253 | Bacteria | 18518 |
| 267 | Ga0209148_1015784 | 3300025254 | Bacteria | 1311 |
| 268 | Ga0209233_1004646 | 3300025261 | Bacteria | 4640 |
| 269 | Ga0209233_1009366 | 3300025261 | Bacteria | 2984 |
| 270 | Ga0209455_1007059 | 3300025272 | Bacteria | 3224 |
| 271 | Ga0209758_1036446 | 3300025297 | Bacteria | 1919 |
| 272 | Ga0207426_1015827 | 3300025302 | Bacteria | 2727 |
| 273 | Ga0207697_10261027 | 3300025315 | Bacteria | 767 |
| 274 | Ga0207696_1022802 | 3300025711 | Bacteria | 1983 |
| 275 | Ga0207713_1148801 | 3300025735 | Bacteria | 758 |
| 276 | Ga0207653_10180814 | 3300025885 | Bacteria | 789 |
| 277 | Ga0207692_10008094 | 3300025898 | Bacteria | 4339 |
| 278 | Ga0207692_10123298 | 3300025898 | Bacteria | 1454 |
| 279 | Ga0207710_10073815 | 3300025900 | Bacteria | 1569 |
| 280 | Ga0207710_10135880 | 3300025900 | Bacteria | 1184 |
| 281 | Ga0207710_10274996 | 3300025900 | Bacteria | 846 |
| 282 | Ga0207688_10067411 | 3300025901 | Bacteria | 2025 |
| 283 | Ga0207688_10260136 | 3300025901 | Bacteria | 1053 |
| 284 | Ga0207688_10278162 | 3300025901 | Bacteria | 1019 |
| 285 | Ga0207688_10314184 | 3300025901 | Bacteria | 960 |
| 286 | Ga0207680_10377489 | 3300025903 | Bacteria | 999 |
| 287 | Ga0207647_10001257 | 3300025904 | Bacteria | 19505 |
| 288 | Ga0207647_10162990 | 3300025904 | Bacteria | 1300 |
| 289 | Ga0207685_10019456 | 3300025905 | Bacteria | 2239 |
| 290 | Ga0207685_10103387 | 3300025905 | Bacteria | 1222 |
| 291 | Ga0207699_10014446 | 3300025906 | Bacteria | 4071 |
| 292 | Ga0207645_10753394 | 3300025907 | Bacteria | 662 |
| 293 | Ga0207643_10101886 | 3300025908 | Bacteria | 1684 |
| 294 | Ga0207643_10113831 | 3300025908 | Bacteria | 1596 |
| 295 | Ga0207684_10236553 | 3300025910 | Bacteria | 1576 |
| 296 | Ga0207695_10054115 | 3300025913 | Bacteria | 4194 |
| 297 | Ga0207695_10322828 | 3300025913 | Bacteria | 1433 |
| 298 | Ga0207671_10034203 | 3300025914 | Bacteria | 3778 |
| 299 | Ga0207671_10166650 | 3300025914 | Bacteria | 1709 |
| 300 | Ga0207671_10466978 | 3300025914 | Bacteria | 1006 |
| 301 | Ga0207693_10017003 | 3300025915 | Bacteria | 5807 |
| 302 | Ga0207693_10097945 | 3300025915 | Bacteria | 2300 |
| 303 | Ga0207693_10142022 | 3300025915 | Bacteria | 1888 |
| 304 | Ga0207693_10162362 | 3300025915 | Bacteria | 1758 |
| 305 | Ga0207693_10691375 | 3300025915 | Bacteria | 790 |
| 306 | Ga0207663_10012346 | 3300025916 | Bacteria | 4617 |
| 307 | Ga0207663_10124585 | 3300025916 | Bacteria | 1770 |
| 308 | Ga0207663_10414156 | 3300025916 | Bacteria | 1033 |
| 309 | Ga0207660_10465140 | 3300025917 | Bacteria | 1024 |
| 310 | Ga0207662_10092971 | 3300025918 | Bacteria | 1858 |
| 311 | Ga0207657_10167355 | 3300025919 | Bacteria | 1782 |
| 312 | Ga0207649_10355527 | 3300025920 | Bacteria | 1085 |
| 313 | Ga0207646_10141882 | 3300025922 | Bacteria | 2164 |
| 314 | Ga0207681_10595647 | 3300025923 | Bacteria | 913 |
| 315 | Ga0207694_10103075 | 3300025924 | Bacteria | 2262 |
| 316 | Ga0207694_10219612 | 3300025924 | Bacteria | 1550 |
| 317 | Ga0207694_10586258 | 3300025924 | Bacteria | 937 |
| 318 | Ga0207650_10614695 | 3300025925 | Bacteria | 914 |
| 319 | Ga0207687_10749336 | 3300025927 | Bacteria | 831 |
| 320 | Ga0207700_10005365 | 3300025928 | Bacteria | 7655 |
| 321 | Ga0207700_10109507 | 3300025928 | Bacteria | 2220 |
| 322 | Ga0207700_10138887 | 3300025928 | Bacteria | 1994 |
| 323 | Ga0207700_10324013 | 3300025928 | Bacteria | 1336 |
| 324 | Ga0207664_10039186 | 3300025929 | Bacteria | 3678 |
| 325 | Ga0207664_10048347 | 3300025929 | Bacteria | 3344 |
| 326 | Ga0207664_10903405 | 3300025929 | Bacteria | 793 |
| 327 | Ga0207644_10157199 | 3300025931 | Bacteria | 1764 |
| 328 | Ga0207690_10647708 | 3300025932 | Bacteria | 865 |
| 329 | Ga0207706_10119813 | 3300025933 | Bacteria | 2314 |
| 330 | Ga0207706_10403780 | 3300025933 | Bacteria | 1184 |
| 331 | Ga0207706_10470132 | 3300025933 | Bacteria | 1087 |
| 332 | Ga0207706_10582197 | 3300025933 | Bacteria | 962 |
| 333 | Ga0207686_10691379 | 3300025934 | Bacteria | 810 |
| 334 | Ga0207686_10905074 | 3300025934 | Bacteria | 712 |
| 335 | Ga0207709_10031008 | 3300025935 | Bacteria | 3117 |
| 336 | Ga0207709_10632096 | 3300025935 | Bacteria | 851 |
| 337 | Ga0207669_10060589 | 3300025937 | Bacteria | 2321 |
| 338 | Ga0207669_10098745 | 3300025937 | Bacteria | 1923 |
| 339 | Ga0207669_10129629 | 3300025937 | Bacteria | 1730 |
| 340 | Ga0207669_10360764 | 3300025937 | Bacteria | 1126 |
| 341 | Ga0207669_10859103 | 3300025937 | Bacteria | 756 |
| 342 | Ga0207704_10598304 | 3300025938 | Bacteria | 902 |
| 343 | Ga0207665_10226175 | 3300025939 | Bacteria | 1373 |
| 344 | Ga0207691_10162587 | 3300025940 | Bacteria | 1958 |
| 345 | Ga0207691_10344192 | 3300025940 | Bacteria | 1276 |
| 346 | Ga0207711_10028488 | 3300025941 | Bacteria | 4699 |
| 347 | Ga0207689_10120260 | 3300025942 | Bacteria | 2161 |
| 348 | Ga0207689_10136439 | 3300025942 | Bacteria | 2020 |
| 349 | Ga0207689_10362997 | 3300025942 | Bacteria | 1204 |
| 350 | Ga0207679_10253509 | 3300025945 | Bacteria | 1497 |
| 351 | Ga0207679_10348912 | 3300025945 | Bacteria | 1289 |
| 352 | Ga0207667_10082489 | 3300025949 | Bacteria | 3330 |
| 353 | Ga0207667_10396432 | 3300025949 | Bacteria | 1405 |
| 354 | Ga0207667_10903591 | 3300025949 | Bacteria | 875 |
| 355 | Ga0207712_10037317 | 3300025961 | Bacteria | 3315 |
| 356 | Ga0207712_10080536 | 3300025961 | Bacteria | 2369 |
| 357 | Ga0207712_10972498 | 3300025961 | Bacteria | 752 |
| 358 | Ga0207668_10035131 | 3300025972 | Bacteria | 3334 |
| 359 | Ga0207668_10142225 | 3300025972 | Bacteria | 1846 |
| 360 | Ga0207668_10145956 | 3300025972 | Bacteria | 1825 |
| 361 | Ga0207668_10453057 | 3300025972 | Bacteria | 1095 |
| 362 | Ga0207640_10041115 | 3300025981 | Bacteria | 2938 |
| 363 | Ga0207658_10191212 | 3300025986 | Bacteria | 1701 |
| 364 | Ga0207658_10511636 | 3300025986 | Bacteria | 1071 |
| 365 | Ga0207658_11009216 | 3300025986 | Bacteria | 759 |
| 366 | Ga0207677_10124631 | 3300026023 | Bacteria | 1944 |
| 367 | Ga0207677_10431955 | 3300026023 | Bacteria | 1124 |
| 368 | Ga0207703_10240546 | 3300026035 | Bacteria | 1627 |
| 369 | Ga0207703_11286334 | 3300026035 | Bacteria | 703 |
| 370 | Ga0207639_10091983 | 3300026041 | Bacteria | 2430 |
| 371 | Ga0207639_10345083 | 3300026041 | Bacteria | 1328 |
| 372 | Ga0207639_10418683 | 3300026041 | Bacteria | 1211 |
| 373 | Ga0207678_10032160 | 3300026067 | Bacteria | 4572 |
| 374 | Ga0207678_10053178 | 3300026067 | Bacteria | 3491 |
| 375 | Ga0207678_10253016 | 3300026067 | Bacteria | 1509 |
| 376 | Ga0207708_10409201 | 3300026075 | Bacteria | 1123 |
| 377 | Ga0207708_10727809 | 3300026075 | Bacteria | 850 |
| 378 | Ga0207702_10005495 | 3300026078 | Bacteria | 11083 |
| 379 | Ga0207702_10092121 | 3300026078 | Bacteria | 2656 |
| 380 | Ga0207702_10174308 | 3300026078 | Bacteria | 1975 |
| 381 | Ga0207702_10633658 | 3300026078 | Bacteria | 1051 |
| 382 | Ga0207641_10025466 | 3300026088 | Bacteria | 4879 |
| 383 | Ga0207648_10059634 | 3300026089 | Bacteria | 3328 |
| 384 | Ga0207676_10196235 | 3300026095 | Bacteria | 1780 |
| 385 | Ga0207676_10284766 | 3300026095 | Bacteria | 1502 |
| 386 | Ga0207674_10091312 | 3300026116 | Bacteria | 3035 |
| 387 | Ga0207675_100110100 | 3300026118 | Bacteria | 2599 |
| 388 | Ga0207675_100147251 | 3300026118 | Bacteria | 2240 |
| 389 | Ga0207675_100263571 | 3300026118 | Bacteria | 1671 |
| 390 | Ga0207675_101345103 | 3300026118 | Bacteria | 735 |
| 391 | Ga0207675_101692571 | 3300026118 | Bacteria | 652 |
| 392 | Ga0207683_10055231 | 3300026121 | Bacteria | 3483 |
| 393 | Ga0207683_10138242 | 3300026121 | Bacteria | 2194 |
| 394 | Ga0207683_10506705 | 3300026121 | Bacteria | 1115 |
| 395 | Ga0207683_11096467 | 3300026121 | Bacteria | 739 |
| 396 | Ga0207698_10120875 | 3300026142 | Bacteria | 2216 |
| 397 | Ga0207698_10211220 | 3300026142 | Bacteria | 1746 |
| 398 | Ga0207698_10298222 | 3300026142 | Bacteria | 1499 |
| 399 | Ga0209589_1000006 | 3300027357 | Bacteria | 436292 |
| 400 | Ga0209489_100007 | 3300027361 | Bacteria | 436292 |
| 401 | Ga0209700_100008 | 3300027363 | Bacteria | 436292 |
| 402 | Ga0209813_10042489 | 3300027866 | Bacteria | 1389 |
| 403 | Ga0207428_10291146 | 3300027907 | Bacteria | 1210 |
| 404 | Ga0268266_10020468 | 3300028379 | Bacteria | 5638 |
| 405 | Ga0268266_10080867 | 3300028379 | Bacteria | 2831 |
| 406 | Ga0268266_10300834 | 3300028379 | Bacteria | 1496 |
| 407 | Ga0268266_10316897 | 3300028379 | Bacteria | 1458 |
| 408 | Ga0268266_10449676 | 3300028379 | Bacteria | 1224 |
| 409 | Ga0268266_10667140 | 3300028379 | Bacteria | 1001 |
| 410 | Ga0268265_10131809 | 3300028380 | Bacteria | 2078 |
| 411 | Ga0268264_10000038 | 3300028381 | Bacteria | 383623 |
| 412 | Ga0268264_10441281 | 3300028381 | Bacteria | 1259 |
| 413 | Ga0268264_10554606 | 3300028381 | Bacteria | 1127 |
| 414 | Ga0268264_11287691 | 3300028381 | Bacteria | 741 |
| 415 | Ga0307517_10000085 | 3300028786 | Bacteria | 131200 |
| 416 | Ga0307517_10261092 | 3300028786 | Bacteria | 1006 |
| 417 | Ga0307515_10011214 | 3300028794 | Bacteria | 17023 |
| 418 | Ga0307511_10213126 | 3300030521 | Bacteria | 982 |
| 419 | Ga0265330_10037533 | 3300031235 | Bacteria | 2156 |
| 420 | Ga0265332_10011292 | 3300031238 | Bacteria | 3971 |
| 421 | Ga0307513_10238049 | 3300031456 | Bacteria | 1628 |
| 422 | Ga0307513_10314383 | 3300031456 | Bacteria | 1327 |
| 423 | Ga0307509_10097844 | 3300031507 | Bacteria | 2981 |
| 424 | Ga0307509_10345403 | 3300031507 | Bacteria | 1214 |
| 425 | Ga0307509_10523554 | 3300031507 | Bacteria | 866 |
| 426 | Ga0307408_101032590 | 3300031548 | Bacteria | 759 |
| 427 | Ga0307508_10000034 | 3300031616 | Bacteria | 160115 |
| 428 | Ga0307508_10210415 | 3300031616 | Bacteria | 1545 |
| 429 | Ga0307508_10452355 | 3300031616 | Bacteria | 877 |
| 430 | Ga0265314_10004394 | 3300031711 | Bacteria | 13098 |
| 431 | Ga0307516_10012741 | 3300031730 | Bacteria | 9038 |
| 432 | Ga0307516_10032981 | 3300031730 | Bacteria | 5214 |
| 433 | Ga0307516_10065038 | 3300031730 | Bacteria | 3524 |
| 434 | Ga0307516_10252513 | 3300031730 | Bacteria | 1457 |
| 435 | Ga0307405_10698883 | 3300031731 | Bacteria | 839 |
| 436 | Ga0307410_10233930 | 3300031852 | Bacteria | 1420 |
| 437 | Ga0307406_10101760 | 3300031901 | Bacteria | 1959 |
| 438 | Ga0307406_10444783 | 3300031901 | Bacteria | 1038 |
| 439 | Ga0307412_10213504 | 3300031911 | Bacteria | 1474 |
| 440 | Ga0307409_100054772 | 3300031995 | Bacteria | 3074 |
| 441 | Ga0307414_10374532 | 3300032004 | Bacteria | 1229 |
| 442 | Ga0307411_10144349 | 3300032005 | Bacteria | 1759 |
| 443 | Ga0307415_100150032 | 3300032126 | Bacteria | 1793 |
| 444 | Ga0307415_100854509 | 3300032126 | Bacteria | 835 |
| 445 | Ga0307507_10154469 | 3300033179 | Bacteria | 1715 |
| 446 | Ga0307510_10003336 | 3300033180 | Bacteria | 18711 |
| 447 | Ga0307510_10066449 | 3300033180 | Bacteria | 3641 |
| 448 | Ga0307510_10084996 | 3300033180 | Bacteria | 3044 |
| 449 | Ga0315911_1000010 | 3300033442 | Bacteria | 322197 |
| 450 | Ga0373926_0117731 | 3300035083 | Bacteria | 1000 |
| 451 | Ga0373934_0018370 | 3300035086 | Bacteria | 2674 |
| 452 | Ga0373934_0023403 | 3300035086 | Bacteria | 2387 |
| 453 | Ga0373934_0116398 | 3300035086 | Bacteria | 1086 |
| 454 | Ga0373923_0002503 | 3300035111 | Bacteria | 5676 |
| 455 | Ga0373936_0005856 | 3300035113 | Bacteria | 4630 |
| 456 | Ga0373936_0012112 | 3300035113 | Bacteria | 3275 |
| 457 | Ga0373936_0072403 | 3300035113 | Bacteria | 1423 |
| 458 | Ga0373936_0097159 | 3300035113 | Bacteria | 1240 |
| 459 | Ga0373936_0168920 | 3300035113 | Bacteria | 956 |
| 460 | Ga0373936_0172971 | 3300035113 | Bacteria | 945 |
| 461 | Ga0373945_0162233 | 3300035116 | Bacteria | 912 |
| 462 | Ga0373953_0001969 | 3300035117 | Bacteria | 6108 |
| 463 | Ga0373954_0005665 | 3300035118 | Bacteria | 5414 |
| 464 | Ga0373954_0084697 | 3300035118 | Bacteria | 1517 |
| 465 | Ga0373956_0095529 | 3300035119 | Bacteria | 1374 |
| 466 | Ga0373957_0000736 | 3300035120 | Bacteria | 8502 |
| 467 | Ga0373943_0003952 | 3300035170 | Bacteria | 6748 |
| 468 | Ga0373943_0059547 | 3300035170 | Bacteria | 1904 |
| 469 | Ga0373943_0140225 | 3300035170 | Bacteria | 1302 |
| 470 | Ga0373946_0028442 | 3300035171 | Bacteria | 2218 |
| 471 | Ga0373955_0005145 | 3300035172 | Bacteria | 5849 |
| 472 | Ga0373955_0054932 | 3300035172 | Bacteria | 2179 |
| 473 | Ga0373955_0122066 | 3300035172 | Bacteria | 1515 |
| 474 | Ga0373961_0233487 | 3300035241 | Bacteria | 660 |
| 475 | Ga0373924_0049264 | 3300035410 | Bacteria | 1743 |
| 476 | Ga0373924_0095738 | 3300035410 | Bacteria | 1273 |
| 477 | Ga0373931_0045962 | 3300035691 | Bacteria | 2307 |
| 478 | Ga0373931_0388267 | 3300035691 | Bacteria | 881 |
| 479 | Ga0373935_0000757 | 3300035692 | Bacteria | 17195 |
| 480 | Ga0373935_0252555 | 3300035692 | Bacteria | 1234 |
| 481 | Ga0373935_1033344 | 3300035692 | Bacteria | 611 |
| 482 | Ga0373927_0001989 | 3300035695 | Bacteria | 15069 |
| 483 | Ga0373927_0005694 | 3300035695 | Bacteria | 8555 |
| 484 | Ga0373927_0110911 | 3300035695 | Bacteria | 1787 |
| 485 | Ga0373927_0366000 | 3300035695 | Bacteria | 950 |
| 486 | Ga0373933_0001305 | 3300035724 | Bacteria | 14682 |
| 487 | Ga0373933_0024456 | 3300035724 | Bacteria | 3458 |
| 488 | Ga0373933_0069371 | 3300035724 | Bacteria | 2142 |
| 489 | Ga0373933_0359702 | 3300035724 | Bacteria | 946 |
| 490 | Ga0373947_0008292 | 3300035725 | Bacteria | 5987 |
| 491 | Ga0373947_0010080 | 3300035725 | Bacteria | 5424 |
| 492 | Ga0373947_0137760 | 3300035725 | Bacteria | 1563 |
| 493 | Ga0373947_0323315 | 3300035725 | Bacteria | 1032 |
| 494 | Ga0373937_0036098 | 3300036401 | Bacteria | 4503 |
| 495 | Ga0373937_0047886 | 3300036401 | Bacteria | 3911 |
| 496 | Ga0373937_0460668 | 3300036401 | Bacteria | 1208 |
| 497 | Ga0310109_024739 | 3300036534 | Bacteria | 805 |
| 498 | Ga0373925_0002155 | 3300037068 | Bacteria | 16079 |
| 499 | Ga0373925_0112186 | 3300037068 | Bacteria | 2108 |
| 500 | Ga0373925_0245252 | 3300037068 | Bacteria | 1436 |
| 501 | Ga0395900_0277762 | 3300037418 | Bacteria | 1668 |
| 502 | Ga0395905_0417554 | 3300037471 | Bacteria | 1237 |
| 503 | Ga0436364_0160837 | 3300037853 | Bacteria | 2904 |
| 504 | Ga0395901_0264121 | 3300038443 | Bacteria | 1791 |
| 505 | Ga0436365_0207937 | 3300039437 | Bacteria | 18457 |
| 506 | Ga0436365_0526074 | 3300039437 | Bacteria | 1963 |
| 507 | Ga0436365_0797860 | 3300039437 | Bacteria | 2322 |
| 508 | Ga0436365_1353163 | 3300039437 | Bacteria | 1631 |
| 509 | Ga0436360_0124501 | 3300039438 | Bacteria | 2440 |
| 510 | Ga0436360_0223651 | 3300039438 | Bacteria | 1228 |
| 511 | Ga0436360_0668865 | 3300039438 | Bacteria | 2351 |
| 512 | Ga0436361_0550718 | 3300039447 | Bacteria | 2128 |
| 513 | Ga0436361_0619086 | 3300039447 | Bacteria | 1844 |
| 514 | Ga0436361_0737425 | 3300039447 | Bacteria | 3002 |
| 515 | Ga0436363_0989765 | 3300039450 | Bacteria | 714 |
| 516 | Ga0436362_0051863 | 3300039453 | Bacteria | 1655 |
| 517 | Ga0436362_0128483 | 3300039453 | Bacteria | 4975 |
| 518 | Ga0451791_0424928 | 3300041451 | Bacteria | 1289 |
| 519 | Ga0451797_1273054 | 3300041453 | Bacteria | 886 |
| 520 | Ga0451802_1317356 | 3300041460 | Bacteria | 826 |
| 521 | Ga0451855_1672864 | 3300041511 | Bacteria | 736 |
| 522 | Ga0466969_0460354 | 3300044656 | Bacteria | 579 |
| 523 | Ga0466966_0326218 | 3300044684 | Bacteria | 922 |
| 524 | Ga0466966_0405775 | 3300044684 | Bacteria | 819 |
| 525 | Ga0466963_0310919 | 3300044694 | Bacteria | 1109 |
| 526 | Ga0466963_0632677 | 3300044694 | Bacteria | 755 |
| 527 | Ga0466964_0295022 | 3300044706 | Bacteria | 815 |
| 528 | Ga0466968_0101836 | 3300044735 | Bacteria | 1283 |
| 529 | Ga0466970_0188141 | 3300044765 | Bacteria | 1147 |
| 530 | Ga0466959_0216038 | 3300045049 | Bacteria | 1331 |
| 531 | Ga0466967_0274971 | 3300045976 | Bacteria | 1615 |
| 532 | Ga0495617_034968 | 3300046452 | Bacteria | 1687 |
| 533 | Ga0495627_098624 | 3300046453 | Bacteria | 836 |
| 534 | Ga0495592_0027847 | 3300046454 | Bacteria | 4280 |
| 535 | Ga0495592_0395414 | 3300046454 | Bacteria | 876 |
| 536 | Ga0495592_0464859 | 3300046454 | Bacteria | 790 |
| 537 | Ga0495603_0000064 | 3300046455 | Bacteria | 46716 |
| 538 | Ga0495603_0019088 | 3300046455 | Bacteria | 4150 |
| 539 | Ga0495603_0033019 | 3300046455 | Bacteria | 3114 |
| 540 | Ga0495603_0034710 | 3300046455 | Bacteria | 3031 |
| 541 | Ga0495603_0038842 | 3300046455 | Bacteria | 2853 |
| 542 | Ga0495629_0004224 | 3300046459 | Bacteria | 10777 |
| 543 | Ga0495629_0043875 | 3300046459 | Bacteria | 3139 |
| 544 | Ga0495629_0090717 | 3300046459 | Bacteria | 2132 |
| 545 | Ga0495629_0245663 | 3300046459 | Bacteria | 1232 |
| 546 | Ga0495638_0072979 | 3300046460 | Bacteria | 2095 |
| 547 | Ga0495638_0220774 | 3300046460 | Bacteria | 1059 |
| 548 | Ga0495641_0020444 | 3300046461 | Bacteria | 3356 |
| 549 | Ga0495641_0063503 | 3300046461 | Bacteria | 1664 |
| 550 | Ga0495651_0021786 | 3300046462 | Bacteria | 4982 |
| 551 | Ga0495651_0109822 | 3300046462 | Bacteria | 2041 |
| 552 | Ga0495653_0003792 | 3300046463 | Bacteria | 12222 |
| 553 | Ga0495653_0152036 | 3300046463 | Bacteria | 1616 |
| 554 | Ga0495650_0146722 | 3300046471 | Bacteria | 850 |
| 555 | Ga0495580_0002461 | 3300046472 | Bacteria | 16173 |
| 556 | Ga0495580_0276473 | 3300046472 | Bacteria | 1146 |
| 557 | Ga0495582_0000197 | 3300046473 | Bacteria | 33437 |
| 558 | Ga0495582_0060111 | 3300046473 | Bacteria | 2097 |
| 559 | Ga0495605_0156289 | 3300046474 | Bacteria | 1014 |
| 560 | Ga0495605_0203257 | 3300046474 | Bacteria | 862 |
| 561 | Ga0495639_0000218 | 3300046475 | Bacteria | 29492 |
| 562 | Ga0495639_0131118 | 3300046475 | Bacteria | 1200 |
| 563 | Ga0495639_0435893 | 3300046475 | Bacteria | 665 |
| 564 | Ga0495639_0495160 | 3300046475 | Bacteria | 624 |
| 565 | Ga0495662_0000732 | 3300046476 | Bacteria | 15694 |
| 566 | Ga0495662_0122431 | 3300046476 | Bacteria | 1277 |
| 567 | Ga0495664_0009846 | 3300046477 | Bacteria | 5359 |
| 568 | Ga0495664_0045608 | 3300046477 | Bacteria | 2600 |
| 569 | Ga0495664_0209359 | 3300046477 | Bacteria | 1181 |
| 570 | Ga0495664_0331204 | 3300046477 | Bacteria | 918 |
| 571 | Ga0495584_0201231 | 3300046491 | Bacteria | 1012 |
| 572 | Ga0495584_0220792 | 3300046491 | Bacteria | 963 |
| 573 | Ga0495584_0227339 | 3300046491 | Bacteria | 948 |
| 574 | Ga0495594_0002513 | 3300046499 | Bacteria | 9558 |
| 575 | Ga0495594_0051126 | 3300046499 | Bacteria | 2274 |
| 576 | Ga0495583_0121704 | 3300046506 | Bacteria | 1098 |
| 577 | Ga0495606_0000976 | 3300046507 | Bacteria | 41812 |
| 578 | Ga0495606_0103261 | 3300046507 | Bacteria | 1732 |
| 579 | Ga0495608_0006251 | 3300046511 | Bacteria | 8454 |
| 580 | Ga0495608_0151565 | 3300046511 | Bacteria | 1477 |
| 581 | Ga0495610_0106976 | 3300046512 | Bacteria | 1244 |
| 582 | Ga0495616_0160909 | 3300046513 | Bacteria | 1010 |
| 583 | Ga0495618_0085231 | 3300046514 | Bacteria | 2019 |
| 584 | Ga0495620_0183965 | 3300046515 | Bacteria | 807 |
| 585 | Ga0495628_0020250 | 3300046516 | Bacteria | 5491 |
| 586 | Ga0495628_0036805 | 3300046516 | Bacteria | 3925 |
| 587 | Ga0495628_0086580 | 3300046516 | Bacteria | 2429 |
| 588 | Ga0495628_0319043 | 3300046516 | Bacteria | 1147 |
| 589 | Ga0495630_0004218 | 3300046517 | Bacteria | 10069 |
| 590 | Ga0495630_0139522 | 3300046517 | Bacteria | 1843 |
| 591 | Ga0495631_0064932 | 3300046518 | Bacteria | 1580 |
| 592 | Ga0495632_0120324 | 3300046519 | Bacteria | 1227 |
| 593 | Ga0495632_0147885 | 3300046519 | Bacteria | 1087 |
| 594 | Ga0495648_0001038 | 3300046524 | Bacteria | 28176 |
| 595 | Ga0495666_0066999 | 3300046526 | Bacteria | 1711 |
| 596 | Ga0495666_0267223 | 3300046526 | Bacteria | 777 |
| 597 | Ga0495652_0111215 | 3300046529 | Bacteria | 2203 |
| 598 | Ga0495652_0122095 | 3300046529 | Bacteria | 2075 |
| 599 | Ga0495652_0129640 | 3300046529 | Bacteria | 1998 |
| 600 | Ga0495652_0688806 | 3300046529 | Bacteria | 689 |
| 601 | Ga0495665_0000531 | 3300046531 | Bacteria | 19287 |
| 602 | Ga0495665_0125401 | 3300046531 | Bacteria | 1345 |
| 603 | Ga0495640_0001572 | 3300046533 | Bacteria | 17991 |
| 604 | Ga0495640_0055146 | 3300046533 | Bacteria | 2719 |
| 605 | Ga0495640_0059939 | 3300046533 | Bacteria | 2590 |
| 606 | Ga0495640_0264149 | 3300046533 | Bacteria | 1075 |
| 607 | Ga0495640_0439086 | 3300046533 | Bacteria | 798 |
| 608 | Ga0495586_0341001 | 3300046535 | Bacteria | 860 |
| 609 | Ga0495587_0073220 | 3300046536 | Bacteria | 1990 |
| 610 | Ga0495587_0142881 | 3300046536 | Bacteria | 1365 |
| 611 | Ga0495587_0357461 | 3300046536 | Bacteria | 813 |
| 612 | Ga0495598_0030150 | 3300046537 | Bacteria | 1517 |
| 613 | Ga0495609_0055347 | 3300046538 | Bacteria | 1760 |
| 614 | Ga0495645_0066733 | 3300046543 | Bacteria | 2599 |
| 615 | Ga0495645_0189922 | 3300046543 | Bacteria | 1401 |
| 616 | Ga0495622_0014503 | 3300046557 | Bacteria | 3659 |
| 617 | Ga0495622_0067417 | 3300046557 | Bacteria | 1653 |
| 618 | Ga0495622_0137244 | 3300046557 | Bacteria | 1111 |
| 619 | Ga0495667_0036833 | 3300046559 | Bacteria | 3262 |
| 620 | Ga0495667_0037334 | 3300046559 | Bacteria | 3238 |
| 621 | Ga0495656_0025190 | 3300046615 | Bacteria | 2356 |
| 622 | Ga0495656_0047390 | 3300046615 | Bacteria | 1822 |
| 623 | Ga0495656_0141490 | 3300046615 | Bacteria | 1154 |
| 624 | Ga0495668_0082544 | 3300046616 | Bacteria | 1763 |
| 625 | Ga0495668_0111202 | 3300046616 | Bacteria | 1498 |
| 626 | Ga0495668_0216782 | 3300046616 | Bacteria | 1048 |
| 627 | Ga0495668_0360483 | 3300046616 | Bacteria | 798 |
| 628 | Ga0495668_0492791 | 3300046616 | Bacteria | 675 |
| 629 | Ga0495634_0032723 | 3300046642 | Bacteria | 3574 |
| 630 | Ga0495634_0045928 | 3300046642 | Bacteria | 2950 |
| 631 | Ga0495634_0382784 | 3300046642 | Bacteria | 838 |
| 632 | Ga0495611_0163675 | 3300046648 | Bacteria | 1040 |
| 633 | Ga0495611_0290356 | 3300046648 | Bacteria | 754 |
| 634 | Ga0495625_0185670 | 3300046660 | Bacteria | 1380 |
| 635 | Ga0495625_0214035 | 3300046660 | Bacteria | 1265 |
| 636 | Ga0495625_0358749 | 3300046660 | Bacteria | 919 |
| 637 | Ga0495625_0368236 | 3300046660 | Bacteria | 904 |
| 638 | Ga0495635_0000356 | 3300046663 | Bacteria | 29094 |
| 639 | Ga0495635_0009382 | 3300046663 | Bacteria | 6840 |
| 640 | Ga0495635_0308362 | 3300046663 | Bacteria | 1061 |
| 641 | Ga0495635_0522968 | 3300046663 | Bacteria | 779 |
| 642 | Ga0495659_0074733 | 3300046664 | Bacteria | 1275 |
| 643 | Ga0495588_0005017 | 3300046674 | Bacteria | 5877 |
| 644 | Ga0495588_0129229 | 3300046674 | Bacteria | 1332 |
| 645 | Ga0495657_0042456 | 3300046675 | Bacteria | 3104 |
| 646 | Ga0495599_0008747 | 3300046678 | Bacteria | 6165 |
| 647 | Ga0495599_0142463 | 3300046678 | Bacteria | 1487 |
| 648 | Ga0495623_0102188 | 3300046679 | Bacteria | 1745 |
| 649 | Ga0495646_0019745 | 3300046680 | Bacteria | 4261 |
| 650 | Ga0495647_0038637 | 3300046681 | Bacteria | 1805 |
| 651 | Ga0495647_0231668 | 3300046681 | Bacteria | 818 |
| 652 | Ga0495658_0001357 | 3300046683 | Bacteria | 12840 |
| 653 | Ga0495658_0171387 | 3300046683 | Bacteria | 1343 |
| 654 | Ga0495658_0309361 | 3300046683 | Bacteria | 1000 |
| 655 | Ga0495658_0616318 | 3300046683 | Bacteria | 695 |
| 656 | Ga0495669_0141445 | 3300046684 | Bacteria | 1136 |
| 657 | Ga0495669_0322155 | 3300046684 | Bacteria | 746 |
| 658 | Ga0495613_0001784 | 3300046689 | Bacteria | 16356 |
| 659 | Ga0495613_0027914 | 3300046689 | Bacteria | 4202 |
| 660 | Ga0495624_0003608 | 3300046690 | Bacteria | 11462 |
| 661 | Ga0495624_0402922 | 3300046690 | Bacteria | 821 |
| 662 | Ga0495670_0238679 | 3300046691 | Bacteria | 967 |
| 663 | Ga0495671_0031809 | 3300046692 | Bacteria | 2696 |
| 664 | Ga0495671_0204737 | 3300046692 | Bacteria | 957 |
| 665 | Ga0495589_0093356 | 3300046794 | Bacteria | 1461 |
| 666 | Ga0495600_0028015 | 3300046809 | Bacteria | 3643 |
| 667 | Ga0495581_0001121 | 3300047315 | Bacteria | 14654 |
| 668 | Ga0495604_0024387 | 3300047317 | Bacteria | 4825 |
| 669 | Ga0495604_0365405 | 3300047317 | Bacteria | 956 |
| 670 | Ga0495636_0060684 | 3300047318 | Bacteria | 1598 |
| 671 | Ga0495636_0394425 | 3300047318 | Bacteria | 658 |
| 672 | Ga0495674_0000910 | 3300047319 | Bacteria | 28292 |
| 673 | Ga0495674_0023623 | 3300047319 | Bacteria | 5662 |
| 674 | Ga0495674_0312652 | 3300047319 | Bacteria | 1281 |
| 675 | Ga0495672_0033942 | 3300047320 | Bacteria | 3157 |
| 676 | Ga0495672_0194269 | 3300047320 | Bacteria | 1018 |
| 677 | Ga0495680_0054687 | 3300047322 | Bacteria | 3098 |
| 678 | Ga0495680_0058904 | 3300047322 | Bacteria | 2966 |
| 679 | Ga0495680_0144985 | 3300047322 | Bacteria | 1735 |
| 680 | Ga0495675_0009561 | 3300047444 | Bacteria | 6038 |
| 681 | Ga0495675_0060330 | 3300047444 | Bacteria | 2404 |
| 682 | Ga0495677_0034533 | 3300047445 | Bacteria | 1845 |
| 683 | Ga0495677_0080280 | 3300047445 | Bacteria | 1222 |
| 684 | Ga0495677_0145479 | 3300047445 | Bacteria | 911 |
| 685 | Ga0495685_059848 | 3300047447 | Bacteria | 1285 |
| 686 | Ga0495685_149195 | 3300047447 | Bacteria | 760 |
| 687 | Ga0495673_0038103 | 3300047469 | Bacteria | 2190 |
| 688 | Ga0495673_0094597 | 3300047469 | Bacteria | 1216 |
| 689 | Ga0495681_0103225 | 3300047470 | Bacteria | 1244 |
| 690 | Ga0495684_0001020 | 3300047471 | Bacteria | 22754 |
| 691 | Ga0495684_0383689 | 3300047471 | Bacteria | 990 |
| 692 | Ga0495593_0000053 | 3300047673 | Bacteria | 47697 |
| 693 | Ga0495593_0007888 | 3300047673 | Bacteria | 6199 |
| 694 | Ga0495593_0242344 | 3300047673 | Bacteria | 903 |
| 695 | Ga0495602_0077062 | 3300048088 | Bacteria | 2822 |
| 696 | Ga0495614_0180337 | 3300048089 | Bacteria | 950 |
| 697 | Ga0495614_0203854 | 3300048089 | Bacteria | 896 |
| 698 | Ga0496100_0060633 | 3300048903 | Bacteria | 2490 |
| 699 | Ga0496100_0148326 | 3300048903 | Bacteria | 1670 |
| 700 | Ga0496101_0090913 | 3300048904 | Bacteria | 2271 |
| 701 | Ga0496102_0625952 | 3300048905 | Bacteria | 999 |
| 702 | Ga0496102_0626103 | 3300048905 | Bacteria | 999 |
| 703 | Ga0496102_0702912 | 3300048905 | Bacteria | 934 |
| 704 | Ga0496102_0925518 | 3300048905 | Bacteria | 793 |
| 705 | Ga0496102_0940500 | 3300048905 | Bacteria | 785 |
| 706 | Ga0496103_0220729 | 3300048906 | Bacteria | 1219 |
| 707 | Ga0496103_0255405 | 3300048906 | Bacteria | 1128 |
| 708 | Ga0496103_0306827 | 3300048906 | Bacteria | 1021 |
| 709 | Ga0496104_0368281 | 3300048907 | Bacteria | 1349 |
| 710 | Ga0496104_0424482 | 3300048907 | Bacteria | 1241 |
| 711 | Ga0496104_0677574 | 3300048907 | Bacteria | 939 |
| 712 | Ga0496105_0057058 | 3300048908 | Bacteria | 3224 |
| 713 | Ga0496105_0415518 | 3300048908 | Bacteria | 1066 |
| 714 | Ga0496105_0495984 | 3300048908 | Bacteria | 959 |
| 715 | Ga0496106_0050763 | 3300048909 | Bacteria | 3126 |
| 716 | Ga0496106_0054025 | 3300048909 | Bacteria | 3034 |
| 717 | Ga0496106_0280571 | 3300048909 | Bacteria | 1335 |
| 718 | Ga0496106_0349821 | 3300048909 | Bacteria | 1187 |
| 719 | Ga0496106_0801556 | 3300048909 | Bacteria | 747 |
| 720 | Ga0496107_0108637 | 3300048910 | Bacteria | 2037 |
| 721 | Ga0496107_0369921 | 3300048910 | Bacteria | 1066 |
| 722 | Ga0496107_0966489 | 3300048910 | Bacteria | 619 |
| 723 | Ga0496108_0043253 | 3300048911 | Bacteria | 3763 |
| 724 | Ga0496108_0634035 | 3300048911 | Bacteria | 930 |
| 725 | Ga0496108_0786655 | 3300048911 | Bacteria | 821 |
| 726 | Ga0496109_0052114 | 3300048912 | Bacteria | 3729 |
| 727 | Ga0496109_0368697 | 3300048912 | Bacteria | 1356 |
| 728 | Ga0496109_1271712 | 3300048912 | Bacteria | 672 |
| 729 | Ga0496110_0425738 | 3300048913 | Bacteria | 1210 |
| 730 | Ga0496110_0439236 | 3300048913 | Bacteria | 1189 |
| 731 | Ga0496110_0563044 | 3300048913 | Bacteria | 1035 |
| 732 | Ga0496111_0254025 | 3300048914 | Bacteria | 1304 |
| 733 | Ga0496111_0672150 | 3300048914 | Bacteria | 755 |
| 734 | Ga0496112_0000008 | 3300048915 | Bacteria | 310323 |
| 735 | Ga0496112_0017278 | 3300048915 | Bacteria | 6774 |
| 736 | Ga0496112_0552225 | 3300048915 | Bacteria | 1085 |
| 737 | Ga0496112_0921247 | 3300048915 | Bacteria | 795 |
| 738 | Ga0496113_0108920 | 3300048916 | Bacteria | 2154 |
| 739 | Ga0496113_0118535 | 3300048916 | Bacteria | 2067 |
| 740 | Ga0496113_0346479 | 3300048916 | Bacteria | 1191 |
| 741 | Ga0496114_0036626 | 3300048917 | Bacteria | 4055 |
| 742 | Ga0496115_0047118 | 3300048918 | Bacteria | 3446 |
| 743 | Ga0496115_0054879 | 3300048918 | Bacteria | 3200 |
| 744 | Ga0496117_0025346 | 3300048920 | Bacteria | 4665 |
| 745 | Ga0496117_0224367 | 3300048920 | Bacteria | 1043 |
| 746 | Ga0496118_0018656 | 3300048921 | Bacteria | 6238 |
| 747 | Ga0496118_0137994 | 3300048921 | Bacteria | 1552 |
| 748 | Ga0496118_0179292 | 3300048921 | Bacteria | 1282 |
| 749 | Ga0496118_0220837 | 3300048921 | Bacteria | 1103 |
| 750 | Ga0496118_0383114 | 3300048921 | Bacteria | 737 |
| 751 | Ga0496119_0052904 | 3300048922 | Bacteria | 2484 |
| 752 | Ga0496119_0088159 | 3300048922 | Bacteria | 1770 |
| 753 | Ga0496120_0163118 | 3300048923 | Bacteria | 1109 |
| 754 | Ga0496121_0000178 | 3300048924 | Bacteria | 141429 |
| 755 | Ga0496121_0000381 | 3300048924 | Bacteria | 90593 |
| 756 | Ga0496121_0001606 | 3300048924 | Bacteria | 37522 |
| 757 | Ga0496121_0065155 | 3300048924 | Bacteria | 2966 |
| 758 | Ga0496121_0074199 | 3300048924 | Bacteria | 2723 |
| 759 | Ga0496121_0094181 | 3300048924 | Bacteria | 2331 |
| 760 | Ga0496121_0122575 | 3300048924 | Bacteria | 1960 |
| 761 | Ga0496121_0144549 | 3300048924 | Bacteria | 1759 |
| 762 | Ga0496121_0251455 | 3300048924 | Bacteria | 1225 |
| 763 | Ga0496121_0438888 | 3300048924 | Bacteria | 844 |
| 764 | Ga0496121_0448240 | 3300048924 | Bacteria | 832 |
| 765 | Ga0496121_0455858 | 3300048924 | Bacteria | 823 |
| 766 | Ga0496123_0311933 | 3300048926 | Bacteria | 746 |
| 767 | Ga0496124_0057960 | 3300048927 | Bacteria | 3260 |
| 768 | Ga0496124_0227694 | 3300048927 | Bacteria | 1396 |
| 769 | Ga0496125_0172081 | 3300048928 | Bacteria | 1454 |
| 770 | Ga0496126_0072513 | 3300048929 | Bacteria | 3063 |
| 771 | Ga0496126_0135415 | 3300048929 | Bacteria | 2125 |
| 772 | Ga0496126_0145644 | 3300048929 | Bacteria | 2034 |
| 773 | Ga0496126_0169885 | 3300048929 | Bacteria | 1858 |
| 774 | Ga0496126_0180012 | 3300048929 | Bacteria | 1796 |
| 775 | Ga0496126_0218646 | 3300048929 | Bacteria | 1601 |
| 776 | Ga0496126_0507847 | 3300048929 | Bacteria | 962 |
| 777 | Ga0496126_0512153 | 3300048929 | Bacteria | 957 |
| 778 | Ga0495678_169183 | 3300049459 | Bacteria | 693 |
| 779 | Ga0495682_0207520 | 3300049460 | Bacteria | 694 |
| 780 | Ga0501033_0058655 | 3300049570 | Bacteria | 2843 |
| 781 | Ga0501034_0907848 | 3300049571 | Bacteria | 768 |
| 782 | Ga0501036_0658356 | 3300049572 | Bacteria | 867 |
| 783 | Ga0501039_0800798 | 3300049575 | Bacteria | 735 |
| 784 | Ga0501043_0062269 | 3300049579 | Bacteria | 2929 |
| 785 | Ga0501046_0116454 | 3300049580 | Bacteria | 2037 |
| 786 | Ga0501070_0071621 | 3300049586 | Bacteria | 2870 |
| 787 | Ga0501073_0282758 | 3300049589 | Bacteria | 1145 |
| 788 | Ga0501075_0940531 | 3300049591 | Bacteria | 657 |
| 789 | Ga0501076_0942825 | 3300049592 | Bacteria | 711 |
| 790 | Ga0501035_0205489 | 3300049822 | Bacteria | 1687 |
| 791 | Ga0501044_0056597 | 3300049823 | Bacteria | 4026 |
| 792 | Ga0501044_0433402 | 3300049823 | Bacteria | 1223 |
| 793 | nmdc:mga03683_190444_c1 | 3300050489 | Bacteria | 938 |
| 794 | nmdc:mga03683_26098_c1 | 3300050489 | Bacteria | 2302 |
| 795 | nmdc:mga03n38_77539_c1 | 3300050490 | Bacteria | 1553 |
| 796 | nmdc:mga00v17_150838_c1 | 3300050491 | Bacteria | 1494 |
| 797 | nmdc:mga00v17_464079_c1 | 3300050491 | Bacteria | 822 |
| 798 | nmdc:mga00v17_651583_c1 | 3300050491 | Bacteria | 677 |
| 799 | nmdc:mga0yw44_28665_c1 | 3300050492 | Bacteria | 3206 |
| 800 | nmdc:mga0yw44_95359_c1 | 3300050492 | Bacteria | 1887 |
| 801 | nmdc:mga0k408_192270_c1 | 3300050493 | Bacteria | 1218 |
| 802 | nmdc:mga0k408_199632_c1 | 3300050493 | Bacteria | 1194 |
| 803 | nmdc:mga0k408_302495_c1 | 3300050493 | Bacteria | 955 |
| 804 | nmdc:mga0k408_562543_c1 | 3300050493 | Bacteria | 674 |
| 805 | nmdc:mga06z11_180894_c1 | 3300050494 | Bacteria | 1216 |
| 806 | nmdc:mga06z11_26727_c1 | 3300050494 | Bacteria | 2750 |
| 807 | nmdc:mga04h51_50942_c1 | 3300050495 | Bacteria | 1389 |
| 808 | nmdc:mga07m45_134023_c1 | 3300050496 | Bacteria | 1434 |
| 809 | nmdc:mga07m45_40462_c1 | 3300050496 | Bacteria | 2608 |
| 810 | nmdc:mga07m45_40483_c1 | 3300050496 | Bacteria | 2607 |
| 811 | nmdc:mga07m45_496790_c1 | 3300050496 | Bacteria | 706 |
| 812 | nmdc:mga07m45_536427_c1 | 3300050496 | Bacteria | 677 |
| 813 | nmdc:mga05p37_284592_c1 | 3300050507 | Bacteria | 1970 |
| 814 | nmdc:mga09592_1025960_c1 | 3300050508 | Bacteria | 688 |
| 815 | nmdc:mga0qj67_179462_c1 | 3300050509 | Bacteria | 1719 |
| 816 | nmdc:mga08y16_82751_c1 | 3300050511 | Bacteria | 3346 |
| 817 | nmdc:mga0n895_730985_c1 | 3300050512 | Bacteria | 984 |
| 818 | nmdc:mga0rr50_219099_c1 | 3300050513 | Bacteria | 1571 |
| 819 | nmdc:mga0sz30_65860_c1 | 3300050516 | Bacteria | 1554 |
| 820 | Ga0495601_0085617 | 3300053077 | Bacteria | 2025 |
| 821 | Ga0495601_0231351 | 3300053077 | Bacteria | 1207 |
| 822 | Ga0500635_0016572 | 3300053080 | Bacteria | 2194 |
| 823 | Ga0500635_0049093 | 3300053080 | Bacteria | 1439 |
| 824 | Ga0500635_0268516 | 3300053080 | Bacteria | 671 |
| 825 | Ga0495655_0027175 | 3300053083 | Bacteria | 1355 |
| 826 | Ga0495655_0066725 | 3300053083 | Bacteria | 996 |
| 827 | Ga0495655_0116550 | 3300053083 | Bacteria | 809 |
| 828 | Ga0495595_0006351 | 3300053084 | Bacteria | 4815 |
| 829 | Ga0495595_0120918 | 3300053084 | Bacteria | 1275 |
| 830 | Ga0495619_0004452 | 3300053085 | Bacteria | 8941 |
| 831 | Ga0495619_0024318 | 3300053085 | Bacteria | 3884 |
| 832 | Ga0500643_079256 | 3300053087 | Bacteria | 904 |
| 833 | Ga0500651_0030081 | 3300053093 | Bacteria | 3415 |
| 834 | Ga0500651_0226076 | 3300053093 | Bacteria | 1096 |
| 835 | Ga0500651_0424996 | 3300053093 | Bacteria | 743 |
| 836 | Ga0500566_0000008 | 3300053094 | Bacteria | 143641 |
| 837 | Ga0500566_0042489 | 3300053094 | Bacteria | 2622 |
| 838 | Ga0500566_0151274 | 3300053094 | Bacteria | 1220 |
| 839 | Ga0500640_005945 | 3300053095 | Bacteria | 4612 |
| 840 | Ga0500641_0017543 | 3300053096 | Bacteria | 2679 |
| 841 | Ga0500641_0019512 | 3300053096 | Bacteria | 2564 |
| 842 | Ga0500641_0055829 | 3300053096 | Bacteria | 1635 |
| 843 | Ga0500650_0363481 | 3300053098 | Bacteria | 631 |
| 844 | Ga0500554_016759 | 3300053102 | Bacteria | 1944 |
| 845 | Ga0500556_0035598 | 3300053104 | Bacteria | 1721 |
| 846 | Ga0500572_001569 | 3300053111 | Bacteria | 6087 |
| 847 | Ga0500572_002289 | 3300053111 | Bacteria | 4637 |
| 848 | Ga0500591_110620 | 3300053115 | Bacteria | 1152 |
| 849 | Ga0500594_0042046 | 3300053118 | Bacteria | 1254 |
| 850 | Ga0500595_001022 | 3300053119 | Bacteria | 15703 |
| 851 | Ga0500595_001796 | 3300053119 | Bacteria | 11140 |
| 852 | Ga0500595_022869 | 3300053119 | Bacteria | 2204 |
| 853 | Ga0500595_129974 | 3300053119 | Bacteria | 709 |
| 854 | Ga0500597_217313 | 3300053120 | Bacteria | 796 |
| 855 | Ga0500608_013208 | 3300053122 | Bacteria | 3653 |
| 856 | Ga0500642_0009310 | 3300053130 | Bacteria | 3404 |
| 857 | Ga0500655_034038 | 3300053133 | Bacteria | 987 |
| 858 | Ga0500559_0001443 | 3300053136 | Bacteria | 13494 |
| 859 | Ga0500559_0002991 | 3300053136 | Bacteria | 8472 |
| 860 | Ga0500559_0170543 | 3300053136 | Bacteria | 1023 |
| 861 | Ga0500561_0088660 | 3300053137 | Bacteria | 912 |
| 862 | Ga0500577_0045825 | 3300053142 | Bacteria | 1618 |
| 863 | Ga0500588_0076954 | 3300053146 | Bacteria | 1108 |
| 864 | Ga0500588_0283379 | 3300053146 | Bacteria | 626 |
| 865 | Ga0500589_052332 | 3300053147 | Bacteria | 1891 |
| 866 | Ga0500589_136364 | 3300053147 | Bacteria | 1018 |
| 867 | Ga0500590_062564 | 3300053148 | Bacteria | 1867 |
| 868 | Ga0500603_001477 | 3300053150 | Bacteria | 5364 |
| 869 | Ga0500603_001591 | 3300053150 | Bacteria | 5129 |
| 870 | Ga0500603_126041 | 3300053150 | Bacteria | 779 |
| 871 | Ga0500616_0227389 | 3300053153 | Bacteria | 810 |
| 872 | Ga0500627_0197623 | 3300053158 | Bacteria | 902 |
| 873 | Ga0500630_032400 | 3300053159 | Bacteria | 2566 |
| 874 | Ga0500638_000896 | 3300053162 | Bacteria | 8428 |
| 875 | Ga0500638_127630 | 3300053162 | Bacteria | 1157 |
| 876 | Ga0500639_000010 | 3300053163 | Bacteria | 136747 |
| 877 | Ga0500639_011164 | 3300053163 | Bacteria | 4712 |
| 878 | Ga0500639_096015 | 3300053163 | Bacteria | 1468 |
| 879 | Ga0500636_0194460 | 3300053177 | Bacteria | 1078 |
| 880 | Ga0500636_0328676 | 3300053177 | Bacteria | 739 |
| 881 | Ga0500637_0041226 | 3300053178 | Bacteria | 2609 |
| 882 | Ga0500637_0068610 | 3300053178 | Bacteria | 2037 |
| 883 | Ga0500637_0306450 | 3300053178 | Bacteria | 863 |
| 884 | Ga0500576_038374 | 3300053725 | Bacteria | 2162 |
| 885 | Ga0500596_001566 | 3300053735 | Bacteria | 4640 |
| 886 | Ga0500596_001917 | 3300053735 | Bacteria | 4173 |
| 887 | Ga0500661_001842 | 3300055283 | Bacteria | 4003 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8019687851 | 8019693989 | 141 |
| 2 | 3300005330 | Ga0070690_100647479 | Ga0070690_1006474791 | 147 |
| 3 | 3300009553 | Ga0105249_11378852 | Ga0105249_113788521 | 147 |
| 4 | 3300053083 | Ga0495655_0116550 | Ga0495655_0116550_272_799 | 153 |
| 5 | 3300035116 | Ga0373945_0162233 | Ga0373945_0162233_22_549 | 155 |
| 6 | 3300035695 | Ga0373927_0110911 | Ga0373927_0110911_27_554 | 155 |
| 7 | 3300044656 | Ga0466969_0460354 | Ga0466969_0460354_14_544 | 155 |
| 8 | 3300044706 | Ga0466964_0295022 | Ga0466964_0295022_17_547 | 155 |
| 9 | 3300046536 | Ga0495587_0142881 | Ga0495587_0142881_821_1348 | 155 |
| 10 | 3300046663 | Ga0495635_0308362 | Ga0495635_0308362_512_1039 | 155 |
| 11 | 3300047447 | Ga0495685_149195 | Ga0495685_149195_17_544 | 155 |
| 12 | 3300048910 | Ga0496107_0966489 | Ga0496107_0966489_14_541 | 155 |
| 13 | 3300048913 | Ga0496110_0425738 | Ga0496110_0425738_11_538 | 155 |
| 14 | 3300048929 | Ga0496126_0512153 | Ga0496126_0512153_17_544 | 155 |
| 15 | 3300049592 | Ga0501076_0942825 | Ga0501076_0942825_166_693 | 155 |
| 16 | 3300053120 | Ga0500597_217313 | Ga0500597_217313_15_542 | 155 |
| 17 | 3300053136 | Ga0500559_0170543 | Ga0500559_0170543_468_995 | 155 |
| 18 | 3300053162 | Ga0500638_127630 | Ga0500638_127630_10_537 | 155 |
| 19 | 3300005365 | Ga0070688_100172809 | Ga0070688_1001728091 | 162 |
| 20 | 3300005367 | Ga0070667_101255141 | Ga0070667_1012551411 | 162 |
| 21 | 3300005436 | Ga0070713_100835486 | Ga0070713_1008354861 | 162 |
| 22 | 3300005544 | Ga0070686_100356428 | Ga0070686_1003564282 | 162 |
| 23 | 3300005578 | Ga0068854_101195812 | Ga0068854_1011958121 | 162 |
| 24 | 3300005616 | Ga0068852_100757318 | Ga0068852_1007573182 | 162 |
| 25 | 3300006237 | Ga0097621_100273661 | Ga0097621_1002736612 | 162 |
| 26 | 3300006358 | Ga0068871_100267565 | Ga0068871_1002675652 | 162 |
| 27 | 3300009098 | Ga0105245_10801445 | Ga0105245_108014452 | 162 |
| 28 | 3300009101 | Ga0105247_10206883 | Ga0105247_102068831 | 162 |
| 29 | 3300009176 | Ga0105242_10707278 | Ga0105242_107072782 | 162 |
| 30 | 3300009177 | Ga0105248_10498772 | Ga0105248_104987722 | 162 |
| 31 | 3300009545 | Ga0105237_10770205 | Ga0105237_107702051 | 162 |
| 32 | 3300010375 | Ga0105239_10165019 | Ga0105239_101650192 | 162 |
| 33 | 3300025315 | Ga0207697_10261027 | Ga0207697_102610271 | 162 |
| 34 | 3300025900 | Ga0207710_10135880 | Ga0207710_101358802 | 162 |
| 35 | 3300025927 | Ga0207687_10749336 | Ga0207687_107493361 | 162 |
| 36 | 3300025934 | Ga0207686_10905074 | Ga0207686_109050742 | 162 |
| 37 | 3300025986 | Ga0207658_10511636 | Ga0207658_105116361 | 162 |
| 38 | 3300026041 | Ga0207639_10418683 | Ga0207639_104186832 | 162 |
| 39 | 3300026142 | Ga0207698_10120875 | Ga0207698_101208753 | 162 |
| 40 | 3300035691 | Ga0373931_0388267 | Ga0373931_0388267_209_811 | 162 |
| 41 | 3300048903 | Ga0496100_0060633 | Ga0496100_0060633_18_620 | 162 |
| 42 | 3300048905 | Ga0496102_0940500 | Ga0496102_0940500_134_736 | 162 |
| 43 | 3300048906 | Ga0496103_0220729 | Ga0496103_0220729_94_696 | 162 |
| 44 | 3300048908 | Ga0496105_0057058 | Ga0496105_0057058_635_1237 | 162 |
| 45 | 3300048909 | Ga0496106_0050763 | Ga0496106_0050763_1812_2414 | 162 |
| 46 | 3300048910 | Ga0496107_0108637 | Ga0496107_0108637_1184_1786 | 162 |
| 47 | 3300048911 | Ga0496108_0786655 | Ga0496108_0786655_94_696 | 162 |
| 48 | 3300048912 | Ga0496109_0052114 | Ga0496109_0052114_2282_2884 | 162 |
| 49 | 3300048913 | Ga0496110_0439236 | Ga0496110_0439236_320_922 | 162 |
| 50 | 3300048915 | Ga0496112_0921247 | Ga0496112_0921247_104_706 | 162 |
| 51 | 3300048917 | Ga0496114_0036626 | Ga0496114_0036626_632_1234 | 162 |
| 52 | 3300048918 | Ga0496115_0047118 | Ga0496115_0047118_668_1270 | 162 |
| 53 | 3300006038 | Ga0075365_10479718 | Ga0075365_104797181 | 164 |
| 54 | 3300053094 | Ga0500566_0042489 | Ga0500566_0042489_1233_1850 | 164 |
| 55 | 3300053119 | Ga0500595_001796 | Ga0500595_001796_6787_7434 | 164 |
| 56 | 3300053162 | Ga0500638_000896 | Ga0500638_000896_5895_6542 | 164 |
| 57 | 3300053178 | Ga0500637_0041226 | Ga0500637_0041226_1044_1661 | 164 |
| 58 | 3300055283 | Ga0500661_001842 | Ga0500661_001842_2523_3140 | 164 |
| 59 | 3300007788 | Ga0099795_10032744 | Ga0099795_100327442 | 165 |
| 60 | 3300013306 | Ga0163162_10561879 | Ga0163162_105618792 | 165 |
| 61 | 3300035692 | Ga0373935_1033344 | Ga0373935_1033344_44_601 | 165 |
| 62 | 3300041511 | Ga0451855_1672864 | Ga0451855_1672864_165_722 | 165 |
| 63 | 3300046475 | Ga0495639_0495160 | Ga0495639_0495160_55_612 | 165 |
| 64 | 3300046529 | Ga0495652_0122095 | Ga0495652_0122095_1504_2061 | 165 |
| 65 | 3300046531 | Ga0495665_0125401 | Ga0495665_0125401_10_567 | 165 |
| 66 | 3300046533 | Ga0495640_0264149 | Ga0495640_0264149_271_873 | 165 |
| 67 | 3300046616 | Ga0495668_0216782 | Ga0495668_0216782_26_583 | 165 |
| 68 | 3300046678 | Ga0495599_0008747 | Ga0495599_0008747_5594_6151 | 165 |
| 69 | 3300048089 | Ga0495614_0203854 | Ga0495614_0203854_263_865 | 165 |
| 70 | 3300053084 | Ga0495595_0120918 | Ga0495595_0120918_695_1252 | 165 |
| 71 | 3300003203 | JGI25406J46586_10008215 | JGI25406J46586_100082153 | 167 |
| 72 | 3300003203 | JGI25406J46586_10017054 | JGI25406J46586_100170544 | 167 |
| 73 | 3300005985 | Ga0081539_10001829 | Ga0081539_100018294 | 167 |
| 74 | 3300005614 | Ga0068856_100002538 | Ga0068856_1000025384 | 170 |
| 75 | 3300026078 | Ga0207702_10005495 | Ga0207702_100054955 | 170 |
| 76 | 3300046471 | Ga0495650_0146722 | Ga0495650_0146722_263_835 | 170 |
| 77 | 3300046474 | Ga0495605_0156289 | Ga0495605_0156289_428_1000 | 170 |
| 78 | 3300046474 | Ga0495605_0203257 | Ga0495605_0203257_273_845 | 170 |
| 79 | 3300046681 | Ga0495647_0231668 | Ga0495647_0231668_230_802 | 170 |
| 80 | 3300048905 | Ga0496102_0925518 | Ga0496102_0925518_15_587 | 170 |
| 81 | 3300053080 | Ga0500635_0268516 | Ga0500635_0268516_19_621 | 170 |
| 82 | 3300053146 | Ga0500588_0283379 | Ga0500588_0283379_14_586 | 170 |
| 83 | 3300025735 | Ga0207713_1148801 | Ga0207713_11488011 | 171 |
| 84 | 3300035113 | Ga0373936_0097159 | Ga0373936_0097159_530_1132 | 171 |
| 85 | 3300048909 | Ga0496106_0280571 | Ga0496106_0280571_577_1179 | 171 |
| 86 | 3300003354 | JGI25160J50197_1029660 | JGI25160J50197_10296602 | 172 |
| 87 | 3300005262 | Ga0065165_1009382 | Ga0065165_10093822 | 172 |
| 88 | 3300025302 | Ga0207426_1015827 | Ga0207426_10158272 | 172 |
| 89 | 3300033180 | Ga0307510_10084996 | Ga0307510_100849962 | 172 |
| 90 | 3300046455 | Ga0495603_0033019 | Ga0495603_0033019_297_899 | 172 |
| 91 | 3300053080 | Ga0500635_0049093 | Ga0500635_0049093_685_1287 | 172 |
| 92 | 3300053102 | Ga0500554_016759 | Ga0500554_016759_574_1176 | 172 |
| 93 | 3300053150 | Ga0500603_001591 | Ga0500603_001591_3909_4511 | 172 |
| 94 | 3300053178 | Ga0500637_0068610 | Ga0500637_0068610_909_1511 | 172 |
| 95 | 3300035724 | Ga0373933_0001305 | Ga0373933_0001305_9197_9799 | 173 |
| 96 | 3300025254 | Ga0209148_1015784 | Ga0209148_10157842 | 175 |
| 97 | 3300025261 | Ga0209233_1009366 | Ga0209233_10093665 | 175 |
| 98 | 3300025272 | Ga0209455_1007059 | Ga0209455_10070594 | 175 |
| 99 | 3300037853 | Ga0436364_0160837 | Ga0436364_0160837_1396_1998 | 175 |
| 100 | 3300039437 | Ga0436365_0797860 | Ga0436365_0797860_253_855 | 175 |
| 101 | 3300048922 | Ga0496119_0052904 | Ga0496119_0052904_988_1590 | 175 |
| 102 | iso_pu_bacteria | 2513237098 | 2513671135 | 175 |
| 103 | iso_pu_bacteria | 2513237101 | 2513697349 | 175 |
| 104 | iso_pu_bacteria | 2524023210 | 2524464004 | 175 |
| 105 | iso_pu_bacteria | 2721755755 | 2723843155 | 175 |
| 106 | iso_pu_bacteria | 2874604998 | 2874612513 | 175 |
| 107 | iso_pu_bacteria | 2885383462 | 2885389047 | 175 |
| 108 | iso_pu_bacteria | 2903768456 | 2903773578 | 175 |
| 109 | iso_pu_bacteria | 8006984368 | 8006989279 | 175 |
| 110 | iso_pu_bacteria | 8006994254 | 8006997756 | 175 |
| 111 | iso_pu_bacteria | 2508501128 | 2509147153 | 176 |
| 112 | iso_pu_bacteria | 2513237096 | 2513654945 | 176 |
| 113 | iso_pu_bacteria | 2513237137 | 2513861259 | 176 |
| 114 | iso_pu_bacteria | 2513237145 | 2513916032 | 176 |
| 115 | iso_pu_bacteria | 2517572143 | 2517894664 | 176 |
| 116 | iso_pu_bacteria | 2524023228 | 2524534404 | 176 |
| 117 | iso_pu_bacteria | 2667528175 | 2671119086 | 176 |
| 118 | iso_pu_bacteria | 2728368998 | 2728747677 | 176 |
| 119 | iso_pu_bacteria | 2791355197 | 2793071134 | 176 |
| 120 | iso_pu_bacteria | 2824617872 | 2824618957 | 176 |
| 121 | iso_pu_bacteria | 2824626560 | 2824627523 | 176 |
| 122 | iso_pu_bacteria | 2824635225 | 2824638848 | 176 |
| 123 | iso_pu_bacteria | 2824644064 | 2824647650 | 176 |
| 124 | iso_pu_bacteria | 2824714736 | 2824716461 | 176 |
| 125 | iso_pu_bacteria | 2824723954 | 2824726407 | 176 |
| 126 | iso_pu_bacteria | 2885374607 | 2885382418 | 176 |
| 127 | iso_pu_bacteria | 2903748898 | 2903757852 | 176 |
| 128 | iso_pu_bacteria | 2904690495 | 2904697002 | 176 |
| 129 | iso_pu_bacteria | 2904699407 | 2904705697 | 176 |
| 130 | iso_pu_bacteria | 2906610324 | 2906611391 | 176 |
| 131 | iso_pu_bacteria | 2906635258 | 2906641571 | 176 |
| 132 | iso_pu_bacteria | 2906660503 | 2906661275 | 176 |
| 133 | iso_pu_bacteria | 2908739725 | 2908744977 | 176 |
| 134 | iso_pu_bacteria | 2908756301 | 2908762730 | 176 |
| 135 | iso_pu_bacteria | 2922425934 | 2922427977 | 176 |
| 136 | iso_pu_bacteria | 2935630451 | 2935632105 | 176 |
| 137 | iso_pu_bacteria | 2941507105 | 2941508053 | 176 |
| 138 | iso_pu_bacteria | 2941515067 | 2941515442 | 176 |
| 139 | iso_pu_bacteria | 2941523033 | 2941523983 | 176 |
| 140 | iso_pu_bacteria | 3005474847 | 3005477684 | 176 |
| 141 | iso_pu_bacteria | 8006933436 | 8006933534 | 176 |
| 142 | iso_pu_bacteria | 8006973647 | 8006983207 | 176 |
| 143 | iso_pu_bacteria | 8019555841 | 8019559458 | 176 |
| 144 | iso_pu_bacteria | 8019565922 | 8019569560 | 176 |
| 145 | iso_pu_bacteria | 8056689827 | 8056695092 | 176 |
| 146 | 3300037471 | Ga0395905_0417554 | Ga0395905_0417554_473_1087 | 177 |
| 147 | 3300005434 | Ga0070709_10001764 | Ga0070709_1000176411 | 178 |
| 148 | 3300005435 | Ga0070714_100051653 | Ga0070714_1000516532 | 178 |
| 149 | 3300005436 | Ga0070713_100211833 | Ga0070713_1002118332 | 178 |
| 150 | 3300005437 | Ga0070710_10001695 | Ga0070710_1000169512 | 178 |
| 151 | 3300005439 | Ga0070711_100020703 | Ga0070711_1000207036 | 178 |
| 152 | 3300005458 | Ga0070681_10463553 | Ga0070681_104635532 | 178 |
| 153 | 3300006173 | Ga0070716_100019284 | Ga0070716_1000192845 | 178 |
| 154 | 3300006175 | Ga0070712_100573429 | Ga0070712_1005734291 | 178 |
| 155 | 3300009093 | Ga0105240_10036581 | Ga0105240_100365816 | 178 |
| 156 | 3300009101 | Ga0105247_10420080 | Ga0105247_104200801 | 178 |
| 157 | 3300009177 | Ga0105248_11700760 | Ga0105248_117007602 | 178 |
| 158 | 3300009545 | Ga0105237_10885744 | Ga0105237_108857441 | 178 |
| 159 | 3300025898 | Ga0207692_10008094 | Ga0207692_100080942 | 178 |
| 160 | 3300025900 | Ga0207710_10274996 | Ga0207710_102749961 | 178 |
| 161 | 3300025906 | Ga0207699_10014446 | Ga0207699_100144461 | 178 |
| 162 | 3300025915 | Ga0207693_10097945 | Ga0207693_100979451 | 178 |
| 163 | 3300025915 | Ga0207693_10162362 | Ga0207693_101623622 | 178 |
| 164 | 3300025916 | Ga0207663_10414156 | Ga0207663_104141561 | 178 |
| 165 | 3300025924 | Ga0207694_10586258 | Ga0207694_105862582 | 178 |
| 166 | 3300025928 | Ga0207700_10005365 | Ga0207700_100053654 | 178 |
| 167 | 3300025929 | Ga0207664_10048347 | Ga0207664_100483472 | 178 |
| 168 | 3300039437 | Ga0436365_0207937 | Ga0436365_0207937_362_961 | 178 |
| 169 | 3300039453 | Ga0436362_0128483 | Ga0436362_0128483_75_674 | 178 |
| 170 | 3300005339 | Ga0070660_100884856 | Ga0070660_1008848561 | 179 |
| 171 | 3300005434 | Ga0070709_10153975 | Ga0070709_101539752 | 179 |
| 172 | 3300005435 | Ga0070714_100547529 | Ga0070714_1005475292 | 179 |
| 173 | 3300005436 | Ga0070713_100378511 | Ga0070713_1003785112 | 179 |
| 174 | 3300005445 | Ga0070708_101169909 | Ga0070708_1011699091 | 179 |
| 175 | 3300005455 | Ga0070663_100685201 | Ga0070663_1006852011 | 179 |
| 176 | 3300005614 | Ga0068856_100289594 | Ga0068856_1002895942 | 179 |
| 177 | 3300021358 | Ga0213873_10035460 | Ga0213873_100354601 | 179 |
| 178 | 3300021361 | Ga0213872_10194607 | Ga0213872_101946072 | 179 |
| 179 | 3300021384 | Ga0213876_10096501 | Ga0213876_100965011 | 179 |
| 180 | 3300021384 | Ga0213876_10367531 | Ga0213876_103675312 | 179 |
| 181 | 3300021441 | Ga0213871_10005944 | Ga0213871_100059442 | 179 |
| 182 | 3300025928 | Ga0207700_10324013 | Ga0207700_103240132 | 179 |
| 183 | 3300025929 | Ga0207664_10039186 | Ga0207664_100391863 | 179 |
| 184 | 3300026078 | Ga0207702_10174308 | Ga0207702_101743083 | 179 |
| 185 | 3300031507 | Ga0307509_10097844 | Ga0307509_100978442 | 179 |
| 186 | 3300031548 | Ga0307408_101032590 | Ga0307408_1010325902 | 179 |
| 187 | 3300031616 | Ga0307508_10452355 | Ga0307508_104523551 | 179 |
| 188 | 3300035695 | Ga0373927_0001989 | Ga0373927_0001989_11092_11691 | 179 |
| 189 | 3300035725 | Ga0373947_0010080 | Ga0373947_0010080_1688_2287 | 179 |
| 190 | 3300037418 | Ga0395900_0277762 | Ga0395900_0277762_454_1053 | 179 |
| 191 | 3300038443 | Ga0395901_0264121 | Ga0395901_0264121_508_1107 | 179 |
| 192 | 3300039437 | Ga0436365_0526074 | Ga0436365_0526074_342_941 | 179 |
| 193 | 3300039437 | Ga0436365_1353163 | Ga0436365_1353163_25_624 | 179 |
| 194 | 3300039438 | Ga0436360_0124501 | Ga0436360_0124501_539_1138 | 179 |
| 195 | 3300039438 | Ga0436360_0223651 | Ga0436360_0223651_586_1185 | 179 |
| 196 | 3300039447 | Ga0436361_0550718 | Ga0436361_0550718_453_1052 | 179 |
| 197 | 3300039447 | Ga0436361_0619086 | Ga0436361_0619086_464_1063 | 179 |
| 198 | 3300039447 | Ga0436361_0737425 | Ga0436361_0737425_28_627 | 179 |
| 199 | 3300039450 | Ga0436363_0989765 | Ga0436363_0989765_42_641 | 179 |
| 200 | 3300039453 | Ga0436362_0051863 | Ga0436362_0051863_276_875 | 179 |
| 201 | 3300044735 | Ga0466968_0101836 | Ga0466968_0101836_72_671 | 179 |
| 202 | 3300046455 | Ga0495603_0019088 | Ga0495603_0019088_180_779 | 179 |
| 203 | 3300046475 | Ga0495639_0131118 | Ga0495639_0131118_294_896 | 179 |
| 204 | 3300046524 | Ga0495648_0001038 | Ga0495648_0001038_24605_25210 | 179 |
| 205 | 3300046526 | Ga0495666_0267223 | Ga0495666_0267223_154_753 | 179 |
| 206 | 3300046683 | Ga0495658_0309361 | Ga0495658_0309361_104_703 | 179 |
| 207 | 3300048921 | Ga0496118_0179292 | Ga0496118_0179292_12_626 | 179 |
| 208 | 3300048923 | Ga0496120_0163118 | Ga0496120_0163118_301_921 | 179 |
| 209 | 3300048924 | Ga0496121_0001606 | Ga0496121_0001606_32312_32932 | 179 |
| 210 | 3300048926 | Ga0496123_0311933 | Ga0496123_0311933_16_633 | 179 |
| 211 | 3300048929 | Ga0496126_0135415 | Ga0496126_0135415_696_1310 | 179 |
| 212 | 3300048929 | Ga0496126_0169885 | Ga0496126_0169885_54_671 | 179 |
| 213 | 3300053093 | Ga0500651_0030081 | Ga0500651_0030081_2008_2610 | 179 |
| 214 | 3300053118 | Ga0500594_0042046 | Ga0500594_0042046_594_1196 | 179 |
| 215 | 3300053119 | Ga0500595_001022 | Ga0500595_001022_6409_7029 | 179 |
| 216 | 3300053119 | Ga0500595_022869 | Ga0500595_022869_952_1566 | 179 |
| 217 | 3300053130 | Ga0500642_0009310 | Ga0500642_0009310_811_1413 | 179 |
| 218 | 3300053146 | Ga0500588_0076954 | Ga0500588_0076954_496_1098 | 179 |
| 219 | 3300053158 | Ga0500627_0197623 | Ga0500627_0197623_13_627 | 179 |
| 220 | 3300001989 | JGI24739J22299_10012951 | JGI24739J22299_100129514 | 180 |
| 221 | 3300001990 | JGI24737J22298_10016177 | JGI24737J22298_100161772 | 180 |
| 222 | 3300002067 | JGI24735J21928_10016953 | JGI24735J21928_100169532 | 180 |
| 223 | 3300002244 | JGI24742J22300_10012308 | JGI24742J22300_100123082 | 180 |
| 224 | 3300003203 | JGI25406J46586_10000721 | JGI25406J46586_1000072112 | 180 |
| 225 | 3300003215 | JGI25153J46596_10000738 | JGI25153J46596_1000073820 | 180 |
| 226 | 3300003320 | rootH2_10077708 | rootH2_100777081 | 180 |
| 227 | 3300003659 | JGI25404J52841_10015813 | JGI25404J52841_100158132 | 180 |
| 228 | 3300003659 | JGI25404J52841_10047108 | JGI25404J52841_100471081 | 180 |
| 229 | 3300003911 | JGI25405J52794_10061750 | JGI25405J52794_100617502 | 180 |
| 230 | 3300005327 | Ga0070658_10562246 | Ga0070658_105622461 | 180 |
| 231 | 3300005328 | Ga0070676_10212565 | Ga0070676_102125651 | 180 |
| 232 | 3300005328 | Ga0070676_10212565 | Ga0070676_102125652 | 180 |
| 233 | 3300005329 | Ga0070683_100017126 | Ga0070683_1000171264 | 180 |
| 234 | 3300005329 | Ga0070683_100521531 | Ga0070683_1005215312 | 180 |
| 235 | 3300005334 | Ga0068869_100064859 | Ga0068869_1000648591 | 180 |
| 236 | 3300005334 | Ga0068869_100064859 | Ga0068869_1000648592 | 180 |
| 237 | 3300005334 | Ga0068869_100381851 | Ga0068869_1003818512 | 180 |
| 238 | 3300005336 | Ga0070680_100061117 | Ga0070680_1000611173 | 180 |
| 239 | 3300005338 | Ga0068868_100130295 | Ga0068868_1001302952 | 180 |
| 240 | 3300005338 | Ga0068868_100137064 | Ga0068868_1001370641 | 180 |
| 241 | 3300005338 | Ga0068868_100747279 | Ga0068868_1007472792 | 180 |
| 242 | 3300005340 | Ga0070689_100504881 | Ga0070689_1005048812 | 180 |
| 243 | 3300005341 | Ga0070691_10055133 | Ga0070691_100551332 | 180 |
| 244 | 3300005343 | Ga0070687_100189376 | Ga0070687_1001893762 | 180 |
| 245 | 3300005344 | Ga0070661_100205620 | Ga0070661_1002056202 | 180 |
| 246 | 3300005347 | Ga0070668_100050535 | Ga0070668_1000505353 | 180 |
| 247 | 3300005347 | Ga0070668_100152569 | Ga0070668_1001525692 | 180 |
| 248 | 3300005353 | Ga0070669_100236187 | Ga0070669_1002361872 | 180 |
| 249 | 3300005355 | Ga0070671_100160005 | Ga0070671_1001600053 | 180 |
| 250 | 3300005355 | Ga0070671_100501845 | Ga0070671_1005018451 | 180 |
| 251 | 3300005356 | Ga0070674_100062001 | Ga0070674_1000620012 | 180 |
| 252 | 3300005365 | Ga0070688_100109774 | Ga0070688_1001097742 | 180 |
| 253 | 3300005366 | Ga0070659_100251243 | Ga0070659_1002512432 | 180 |
| 254 | 3300005366 | Ga0070659_100383741 | Ga0070659_1003837412 | 180 |
| 255 | 3300005366 | Ga0070659_100668052 | Ga0070659_1006680521 | 180 |
| 256 | 3300005406 | Ga0070703_10198342 | Ga0070703_101983421 | 180 |
| 257 | 3300005436 | Ga0070713_100061144 | Ga0070713_1000611441 | 180 |
| 258 | 3300005436 | Ga0070713_100228238 | Ga0070713_1002282382 | 180 |
| 259 | 3300005437 | Ga0070710_10527186 | Ga0070710_105271861 | 180 |
| 260 | 3300005439 | Ga0070711_100044852 | Ga0070711_1000448523 | 180 |
| 261 | 3300005439 | Ga0070711_100712389 | Ga0070711_1007123892 | 180 |
| 262 | 3300005439 | Ga0070711_100773988 | Ga0070711_1007739881 | 180 |
| 263 | 3300005455 | Ga0070663_100018549 | Ga0070663_1000185492 | 180 |
| 264 | 3300005455 | Ga0070663_100053867 | Ga0070663_1000538674 | 180 |
| 265 | 3300005456 | Ga0070678_100198168 | Ga0070678_1001981681 | 180 |
| 266 | 3300005456 | Ga0070678_100371820 | Ga0070678_1003718202 | 180 |
| 267 | 3300005456 | Ga0070678_100383583 | Ga0070678_1003835831 | 180 |
| 268 | 3300005457 | Ga0070662_100050768 | Ga0070662_1000507682 | 180 |
| 269 | 3300005457 | Ga0070662_100190683 | Ga0070662_1001906832 | 180 |
| 270 | 3300005457 | Ga0070662_100483100 | Ga0070662_1004831002 | 180 |
| 271 | 3300005459 | Ga0068867_100111788 | Ga0068867_1001117882 | 180 |
| 272 | 3300005459 | Ga0068867_100349335 | Ga0068867_1003493352 | 180 |
| 273 | 3300005467 | Ga0070706_100129052 | Ga0070706_1001290521 | 180 |
| 274 | 3300005467 | Ga0070706_100260542 | Ga0070706_1002605422 | 180 |
| 275 | 3300005468 | Ga0070707_100119818 | Ga0070707_1001198182 | 180 |
| 276 | 3300005471 | Ga0070698_100197239 | Ga0070698_1001972392 | 180 |
| 277 | 3300005471 | Ga0070698_100617451 | Ga0070698_1006174512 | 180 |
| 278 | 3300005536 | Ga0070697_100238054 | Ga0070697_1002380541 | 180 |
| 279 | 3300005539 | Ga0068853_100097793 | Ga0068853_1000977933 | 180 |
| 280 | 3300005539 | Ga0068853_100262428 | Ga0068853_1002624282 | 180 |
| 281 | 3300005539 | Ga0068853_101018183 | Ga0068853_1010181832 | 180 |
| 282 | 3300005543 | Ga0070672_100109452 | Ga0070672_1001094523 | 180 |
| 283 | 3300005543 | Ga0070672_100154769 | Ga0070672_1001547691 | 180 |
| 284 | 3300005545 | Ga0070695_100094980 | Ga0070695_1000949802 | 180 |
| 285 | 3300005545 | Ga0070695_100094980 | Ga0070695_1000949803 | 180 |
| 286 | 3300005545 | Ga0070695_100542236 | Ga0070695_1005422361 | 180 |
| 287 | 3300005546 | Ga0070696_100473956 | Ga0070696_1004739562 | 180 |
| 288 | 3300005548 | Ga0070665_100088043 | Ga0070665_1000880432 | 180 |
| 289 | 3300005548 | Ga0070665_100174517 | Ga0070665_1001745172 | 180 |
| 290 | 3300005548 | Ga0070665_100701082 | Ga0070665_1007010823 | 180 |
| 291 | 3300005549 | Ga0070704_100583576 | Ga0070704_1005835761 | 180 |
| 292 | 3300005549 | Ga0070704_100666847 | Ga0070704_1006668472 | 180 |
| 293 | 3300005563 | Ga0068855_100050191 | Ga0068855_1000501916 | 180 |
| 294 | 3300005563 | Ga0068855_100053959 | Ga0068855_1000539595 | 180 |
| 295 | 3300005563 | Ga0068855_100508206 | Ga0068855_1005082062 | 180 |
| 296 | 3300005563 | Ga0068855_100531771 | Ga0068855_1005317712 | 180 |
| 297 | 3300005564 | Ga0070664_100432562 | Ga0070664_1004325622 | 180 |
| 298 | 3300005577 | Ga0068857_100014952 | Ga0068857_1000149524 | 180 |
| 299 | 3300005577 | Ga0068857_100165432 | Ga0068857_1001654322 | 180 |
| 300 | 3300005577 | Ga0068857_100548812 | Ga0068857_1005488122 | 180 |
| 301 | 3300005578 | Ga0068854_100021501 | Ga0068854_1000215014 | 180 |
| 302 | 3300005578 | Ga0068854_100364401 | Ga0068854_1003644012 | 180 |
| 303 | 3300005614 | Ga0068856_100100529 | Ga0068856_1001005293 | 180 |
| 304 | 3300005614 | Ga0068856_100444122 | Ga0068856_1004441222 | 180 |
| 305 | 3300005616 | Ga0068852_100008462 | Ga0068852_1000084622 | 180 |
| 306 | 3300005616 | Ga0068852_100660284 | Ga0068852_1006602841 | 180 |
| 307 | 3300005616 | Ga0068852_100782486 | Ga0068852_1007824862 | 180 |
| 308 | 3300005617 | Ga0068859_100668110 | Ga0068859_1006681102 | 180 |
| 309 | 3300005617 | Ga0068859_101197883 | Ga0068859_1011978831 | 180 |
| 310 | 3300005618 | Ga0068864_100128028 | Ga0068864_1001280283 | 180 |
| 311 | 3300005618 | Ga0068864_100556159 | Ga0068864_1005561592 | 180 |
| 312 | 3300005618 | Ga0068864_100748175 | Ga0068864_1007481752 | 180 |
| 313 | 3300005718 | Ga0068866_10046902 | Ga0068866_100469023 | 180 |
| 314 | 3300005719 | Ga0068861_100030335 | Ga0068861_1000303356 | 180 |
| 315 | 3300005719 | Ga0068861_100046881 | Ga0068861_1000468811 | 180 |
| 316 | 3300005719 | Ga0068861_100046881 | Ga0068861_1000468812 | 180 |
| 317 | 3300005719 | Ga0068861_100572507 | Ga0068861_1005725072 | 180 |
| 318 | 3300005840 | Ga0068870_10242840 | Ga0068870_102428402 | 180 |
| 319 | 3300005841 | Ga0068863_100243895 | Ga0068863_1002438951 | 180 |
| 320 | 3300005841 | Ga0068863_100394052 | Ga0068863_1003940521 | 180 |
| 321 | 3300005842 | Ga0068858_100239469 | Ga0068858_1002394692 | 180 |
| 322 | 3300005842 | Ga0068858_100420222 | Ga0068858_1004202222 | 180 |
| 323 | 3300005842 | Ga0068858_100766265 | Ga0068858_1007662652 | 180 |
| 324 | 3300005843 | Ga0068860_100000533 | Ga0068860_10000053347 | 180 |
| 325 | 3300005843 | Ga0068860_100134467 | Ga0068860_1001344672 | 180 |
| 326 | 3300005843 | Ga0068860_100134467 | Ga0068860_1001344673 | 180 |
| 327 | 3300005844 | Ga0068862_100265752 | Ga0068862_1002657522 | 180 |
| 328 | 3300005844 | Ga0068862_100569862 | Ga0068862_1005698622 | 180 |
| 329 | 3300005937 | Ga0081455_10070768 | Ga0081455_100707682 | 180 |
| 330 | 3300005937 | Ga0081455_10380199 | Ga0081455_103801992 | 180 |
| 331 | 3300005983 | Ga0081540_1002213 | Ga0081540_10022134 | 180 |
| 332 | 3300005983 | Ga0081540_1005827 | Ga0081540_10058272 | 180 |
| 333 | 3300005983 | Ga0081540_1012712 | Ga0081540_10127125 | 180 |
| 334 | 3300005983 | Ga0081540_1017590 | Ga0081540_10175905 | 180 |
| 335 | 3300005983 | Ga0081540_1024174 | Ga0081540_10241742 | 180 |
| 336 | 3300005983 | Ga0081540_1025572 | Ga0081540_10255723 | 180 |
| 337 | 3300005983 | Ga0081540_1052500 | Ga0081540_10525002 | 180 |
| 338 | 3300005985 | Ga0081539_10000748 | Ga0081539_1000074850 | 180 |
| 339 | 3300006028 | Ga0070717_10133966 | Ga0070717_101339662 | 180 |
| 340 | 3300006028 | Ga0070717_10257705 | Ga0070717_102577052 | 180 |
| 341 | 3300006038 | Ga0075365_10027753 | Ga0075365_100277535 | 180 |
| 342 | 3300006038 | Ga0075365_10027753 | Ga0075365_100277536 | 180 |
| 343 | 3300006038 | Ga0075365_10039617 | Ga0075365_100396173 | 180 |
| 344 | 3300006038 | Ga0075365_10126465 | Ga0075365_101264652 | 180 |
| 345 | 3300006038 | Ga0075365_10296614 | Ga0075365_102966142 | 180 |
| 346 | 3300006038 | Ga0075365_10358222 | Ga0075365_103582222 | 180 |
| 347 | 3300006042 | Ga0075368_10020977 | Ga0075368_100209772 | 180 |
| 348 | 3300006042 | Ga0075368_10030204 | Ga0075368_100302043 | 180 |
| 349 | 3300006048 | Ga0075363_100023427 | Ga0075363_1000234272 | 180 |
| 350 | 3300006048 | Ga0075363_100052487 | Ga0075363_1000524871 | 180 |
| 351 | 3300006048 | Ga0075363_100052487 | Ga0075363_1000524872 | 180 |
| 352 | 3300006048 | Ga0075363_100448932 | Ga0075363_1004489321 | 180 |
| 353 | 3300006051 | Ga0075364_10281885 | Ga0075364_102818852 | 180 |
| 354 | 3300006058 | Ga0075432_10127059 | Ga0075432_101270592 | 180 |
| 355 | 3300006163 | Ga0070715_10001014 | Ga0070715_100010141 | 180 |
| 356 | 3300006173 | Ga0070716_100399010 | Ga0070716_1003990101 | 180 |
| 357 | 3300006173 | Ga0070716_100442075 | Ga0070716_1004420751 | 180 |
| 358 | 3300006175 | Ga0070712_100029479 | Ga0070712_1000294794 | 180 |
| 359 | 3300006175 | Ga0070712_100755187 | Ga0070712_1007551872 | 180 |
| 360 | 3300006177 | Ga0075362_10094934 | Ga0075362_100949342 | 180 |
| 361 | 3300006177 | Ga0075362_10094934 | Ga0075362_100949343 | 180 |
| 362 | 3300006178 | Ga0075367_10089243 | Ga0075367_100892432 | 180 |
| 363 | 3300006178 | Ga0075367_10119054 | Ga0075367_101190542 | 180 |
| 364 | 3300006178 | Ga0075367_10151217 | Ga0075367_101512172 | 180 |
| 365 | 3300006178 | Ga0075367_10176008 | Ga0075367_101760082 | 180 |
| 366 | 3300006178 | Ga0075367_10384087 | Ga0075367_103840872 | 180 |
| 367 | 3300006186 | Ga0075369_10065856 | Ga0075369_100658562 | 180 |
| 368 | 3300006186 | Ga0075369_10065856 | Ga0075369_100658563 | 180 |
| 369 | 3300006186 | Ga0075369_10293403 | Ga0075369_102934031 | 180 |
| 370 | 3300006186 | Ga0075369_10340714 | Ga0075369_103407141 | 180 |
| 371 | 3300006195 | Ga0075366_10409780 | Ga0075366_104097802 | 180 |
| 372 | 3300006195 | Ga0075366_10465306 | Ga0075366_104653062 | 180 |
| 373 | 3300006237 | Ga0097621_100156156 | Ga0097621_1001561562 | 180 |
| 374 | 3300006353 | Ga0075370_10055472 | Ga0075370_100554723 | 180 |
| 375 | 3300006353 | Ga0075370_10105899 | Ga0075370_101058991 | 180 |
| 376 | 3300006353 | Ga0075370_10105899 | Ga0075370_101058992 | 180 |
| 377 | 3300006353 | Ga0075370_10152099 | Ga0075370_101520991 | 180 |
| 378 | 3300006353 | Ga0075370_10477048 | Ga0075370_104770481 | 180 |
| 379 | 3300006358 | Ga0068871_100235438 | Ga0068871_1002354382 | 180 |
| 380 | 3300006358 | Ga0068871_100349535 | Ga0068871_1003495352 | 180 |
| 381 | 3300006844 | Ga0075428_100084451 | Ga0075428_1000844513 | 180 |
| 382 | 3300006844 | Ga0075428_100084451 | Ga0075428_1000844514 | 180 |
| 383 | 3300006871 | Ga0075434_100395193 | Ga0075434_1003951932 | 180 |
| 384 | 3300006881 | Ga0068865_100059062 | Ga0068865_1000590623 | 180 |
| 385 | 3300006881 | Ga0068865_100122589 | Ga0068865_1001225892 | 180 |
| 386 | 3300006881 | Ga0068865_100678081 | Ga0068865_1006780812 | 180 |
| 387 | 3300006931 | Ga0097620_100668134 | Ga0097620_1006681342 | 180 |
| 388 | 3300006931 | Ga0097620_101197797 | Ga0097620_1011977971 | 180 |
| 389 | 3300006941 | Ga0099825_1032872 | Ga0099825_10328723 | 180 |
| 390 | 3300006942 | Ga0099824_1014525 | Ga0099824_10145259 | 180 |
| 391 | 3300006943 | Ga0099822_1005034 | Ga0099822_100503410 | 180 |
| 392 | 3300007076 | Ga0075435_100401054 | Ga0075435_1004010542 | 180 |
| 393 | 3300007265 | Ga0099794_10029066 | Ga0099794_100290664 | 180 |
| 394 | 3300007265 | Ga0099794_10141477 | Ga0099794_101414771 | 180 |
| 395 | 3300007265 | Ga0099794_10148055 | Ga0099794_101480551 | 180 |
| 396 | 3300007265 | Ga0099794_10223694 | Ga0099794_102236942 | 180 |
| 397 | 3300009093 | Ga0105240_10030327 | Ga0105240_100303275 | 180 |
| 398 | 3300009093 | Ga0105240_10141354 | Ga0105240_101413542 | 180 |
| 399 | 3300009093 | Ga0105240_11578733 | Ga0105240_115787331 | 180 |
| 400 | 3300009094 | Ga0111539_10163191 | Ga0111539_101631912 | 180 |
| 401 | 3300009094 | Ga0111539_10255594 | Ga0111539_102555942 | 180 |
| 402 | 3300009098 | Ga0105245_10046675 | Ga0105245_100466752 | 180 |
| 403 | 3300009101 | Ga0105247_10036617 | Ga0105247_100366172 | 180 |
| 404 | 3300009101 | Ga0105247_10159250 | Ga0105247_101592502 | 180 |
| 405 | 3300009148 | Ga0105243_10275580 | Ga0105243_102755802 | 180 |
| 406 | 3300009148 | Ga0105243_10420205 | Ga0105243_104202051 | 180 |
| 407 | 3300009148 | Ga0105243_10742634 | Ga0105243_107426342 | 180 |
| 408 | 3300009174 | Ga0105241_10117846 | Ga0105241_101178463 | 180 |
| 409 | 3300009174 | Ga0105241_11096257 | Ga0105241_110962571 | 180 |
| 410 | 3300009176 | Ga0105242_10195163 | Ga0105242_101951633 | 180 |
| 411 | 3300009176 | Ga0105242_10894335 | Ga0105242_108943352 | 180 |
| 412 | 3300009177 | Ga0105248_11061362 | Ga0105248_110613621 | 180 |
| 413 | 3300009545 | Ga0105237_10066154 | Ga0105237_100661544 | 180 |
| 414 | 3300009545 | Ga0105237_10124394 | Ga0105237_101243942 | 180 |
| 415 | 3300009551 | Ga0105238_10008344 | Ga0105238_1000834410 | 180 |
| 416 | 3300009553 | Ga0105249_10821648 | Ga0105249_108216482 | 180 |
| 417 | 3300009553 | Ga0105249_11153238 | Ga0105249_111532382 | 180 |
| 418 | 3300009553 | Ga0105249_12059108 | Ga0105249_120591081 | 180 |
| 419 | 3300010159 | Ga0099796_10082966 | Ga0099796_100829662 | 180 |
| 420 | 3300010159 | Ga0099796_10091940 | Ga0099796_100919402 | 180 |
| 421 | 3300010159 | Ga0099796_10198341 | Ga0099796_101983411 | 180 |
| 422 | 3300010375 | Ga0105239_10007487 | Ga0105239_1000748711 | 180 |
| 423 | 3300011119 | Ga0105246_10180621 | Ga0105246_101806212 | 180 |
| 424 | 3300013104 | Ga0157370_10081244 | Ga0157370_100812442 | 180 |
| 425 | 3300013104 | Ga0157370_10519025 | Ga0157370_105190252 | 180 |
| 426 | 3300013296 | Ga0157374_10131890 | Ga0157374_101318902 | 180 |
| 427 | 3300013297 | Ga0157378_10133193 | Ga0157378_101331933 | 180 |
| 428 | 3300013297 | Ga0157378_10140689 | Ga0157378_101406892 | 180 |
| 429 | 3300013297 | Ga0157378_10496294 | Ga0157378_104962943 | 180 |
| 430 | 3300013297 | Ga0157378_10697539 | Ga0157378_106975391 | 180 |
| 431 | 3300013297 | Ga0157378_10740440 | Ga0157378_107404402 | 180 |
| 432 | 3300013297 | Ga0157378_10798558 | Ga0157378_107985582 | 180 |
| 433 | 3300013307 | Ga0157372_10719819 | Ga0157372_107198192 | 180 |
| 434 | 3300013308 | Ga0157375_10281247 | Ga0157375_102812472 | 180 |
| 435 | 3300013308 | Ga0157375_10564644 | Ga0157375_105646442 | 180 |
| 436 | 3300013308 | Ga0157375_10595944 | Ga0157375_105959442 | 180 |
| 437 | 3300013308 | Ga0157375_10750967 | Ga0157375_107509673 | 180 |
| 438 | 3300014325 | Ga0163163_10069119 | Ga0163163_100691192 | 180 |
| 439 | 3300014325 | Ga0163163_10126403 | Ga0163163_101264034 | 180 |
| 440 | 3300014326 | Ga0157380_10586871 | Ga0157380_105868712 | 180 |
| 441 | 3300014326 | Ga0157380_10857288 | Ga0157380_108572882 | 180 |
| 442 | 3300014745 | Ga0157377_10176996 | Ga0157377_101769962 | 180 |
| 443 | 3300014968 | Ga0157379_10018767 | Ga0157379_100187673 | 180 |
| 444 | 3300014968 | Ga0157379_10387674 | Ga0157379_103876742 | 180 |
| 445 | 3300014968 | Ga0157379_10562057 | Ga0157379_105620572 | 180 |
| 446 | 3300017792 | Ga0163161_10822778 | Ga0163161_108227781 | 180 |
| 447 | 3300025253 | Ga0209677_100642 | Ga0209677_1006426 | 180 |
| 448 | 3300025261 | Ga0209233_1004646 | Ga0209233_10046463 | 180 |
| 449 | 3300025297 | Ga0209758_1036446 | Ga0209758_10364462 | 180 |
| 450 | 3300025711 | Ga0207696_1022802 | Ga0207696_10228022 | 180 |
| 451 | 3300025885 | Ga0207653_10180814 | Ga0207653_101808142 | 180 |
| 452 | 3300025898 | Ga0207692_10123298 | Ga0207692_101232981 | 180 |
| 453 | 3300025900 | Ga0207710_10073815 | Ga0207710_100738151 | 180 |
| 454 | 3300025901 | Ga0207688_10067411 | Ga0207688_100674111 | 180 |
| 455 | 3300025901 | Ga0207688_10260136 | Ga0207688_102601362 | 180 |
| 456 | 3300025901 | Ga0207688_10278162 | Ga0207688_102781622 | 180 |
| 457 | 3300025901 | Ga0207688_10314184 | Ga0207688_103141841 | 180 |
| 458 | 3300025903 | Ga0207680_10377489 | Ga0207680_103774892 | 180 |
| 459 | 3300025904 | Ga0207647_10001257 | Ga0207647_1000125721 | 180 |
| 460 | 3300025904 | Ga0207647_10162990 | Ga0207647_101629902 | 180 |
| 461 | 3300025905 | Ga0207685_10019456 | Ga0207685_100194562 | 180 |
| 462 | 3300025905 | Ga0207685_10103387 | Ga0207685_101033872 | 180 |
| 463 | 3300025907 | Ga0207645_10753394 | Ga0207645_107533941 | 180 |
| 464 | 3300025908 | Ga0207643_10101886 | Ga0207643_101018862 | 180 |
| 465 | 3300025908 | Ga0207643_10113831 | Ga0207643_101138312 | 180 |
| 466 | 3300025910 | Ga0207684_10236553 | Ga0207684_102365532 | 180 |
| 467 | 3300025913 | Ga0207695_10054115 | Ga0207695_100541156 | 180 |
| 468 | 3300025913 | Ga0207695_10322828 | Ga0207695_103228282 | 180 |
| 469 | 3300025914 | Ga0207671_10034203 | Ga0207671_100342032 | 180 |
| 470 | 3300025914 | Ga0207671_10166650 | Ga0207671_101666502 | 180 |
| 471 | 3300025914 | Ga0207671_10466978 | Ga0207671_104669781 | 180 |
| 472 | 3300025915 | Ga0207693_10017003 | Ga0207693_100170032 | 180 |
| 473 | 3300025915 | Ga0207693_10142022 | Ga0207693_101420221 | 180 |
| 474 | 3300025915 | Ga0207693_10691375 | Ga0207693_106913752 | 180 |
| 475 | 3300025916 | Ga0207663_10012346 | Ga0207663_100123465 | 180 |
| 476 | 3300025916 | Ga0207663_10124585 | Ga0207663_101245852 | 180 |
| 477 | 3300025917 | Ga0207660_10465140 | Ga0207660_104651402 | 180 |
| 478 | 3300025918 | Ga0207662_10092971 | Ga0207662_100929711 | 180 |
| 479 | 3300025919 | Ga0207657_10167355 | Ga0207657_101673552 | 180 |
| 480 | 3300025920 | Ga0207649_10355527 | Ga0207649_103555272 | 180 |
| 481 | 3300025922 | Ga0207646_10141882 | Ga0207646_101418823 | 180 |
| 482 | 3300025923 | Ga0207681_10595647 | Ga0207681_105956472 | 180 |
| 483 | 3300025924 | Ga0207694_10103075 | Ga0207694_101030753 | 180 |
| 484 | 3300025924 | Ga0207694_10219612 | Ga0207694_102196122 | 180 |
| 485 | 3300025925 | Ga0207650_10614695 | Ga0207650_106146953 | 180 |
| 486 | 3300025928 | Ga0207700_10109507 | Ga0207700_101095071 | 180 |
| 487 | 3300025928 | Ga0207700_10138887 | Ga0207700_101388873 | 180 |
| 488 | 3300025929 | Ga0207664_10903405 | Ga0207664_109034052 | 180 |
| 489 | 3300025931 | Ga0207644_10157199 | Ga0207644_101571992 | 180 |
| 490 | 3300025932 | Ga0207690_10647708 | Ga0207690_106477081 | 180 |
| 491 | 3300025933 | Ga0207706_10119813 | Ga0207706_101198132 | 180 |
| 492 | 3300025933 | Ga0207706_10403780 | Ga0207706_104037802 | 180 |
| 493 | 3300025933 | Ga0207706_10470132 | Ga0207706_104701322 | 180 |
| 494 | 3300025933 | Ga0207706_10582197 | Ga0207706_105821972 | 180 |
| 495 | 3300025934 | Ga0207686_10691379 | Ga0207686_106913791 | 180 |
| 496 | 3300025935 | Ga0207709_10031008 | Ga0207709_100310083 | 180 |
| 497 | 3300025935 | Ga0207709_10632096 | Ga0207709_106320961 | 180 |
| 498 | 3300025937 | Ga0207669_10060589 | Ga0207669_100605892 | 180 |
| 499 | 3300025937 | Ga0207669_10098745 | Ga0207669_100987451 | 180 |
| 500 | 3300025937 | Ga0207669_10129629 | Ga0207669_101296291 | 180 |
| 501 | 3300025937 | Ga0207669_10360764 | Ga0207669_103607642 | 180 |
| 502 | 3300025937 | Ga0207669_10859103 | Ga0207669_108591031 | 180 |
| 503 | 3300025938 | Ga0207704_10598304 | Ga0207704_105983041 | 180 |
| 504 | 3300025939 | Ga0207665_10226175 | Ga0207665_102261752 | 180 |
| 505 | 3300025940 | Ga0207691_10162587 | Ga0207691_101625871 | 180 |
| 506 | 3300025940 | Ga0207691_10344192 | Ga0207691_103441922 | 180 |
| 507 | 3300025941 | Ga0207711_10028488 | Ga0207711_100284881 | 180 |
| 508 | 3300025942 | Ga0207689_10120260 | Ga0207689_101202603 | 180 |
| 509 | 3300025942 | Ga0207689_10136439 | Ga0207689_101364392 | 180 |
| 510 | 3300025942 | Ga0207689_10362997 | Ga0207689_103629972 | 180 |
| 511 | 3300025945 | Ga0207679_10253509 | Ga0207679_102535092 | 180 |
| 512 | 3300025945 | Ga0207679_10348912 | Ga0207679_103489122 | 180 |
| 513 | 3300025949 | Ga0207667_10082489 | Ga0207667_100824893 | 180 |
| 514 | 3300025949 | Ga0207667_10396432 | Ga0207667_103964322 | 180 |
| 515 | 3300025949 | Ga0207667_10903591 | Ga0207667_109035911 | 180 |
| 516 | 3300025961 | Ga0207712_10037317 | Ga0207712_100373174 | 180 |
| 517 | 3300025961 | Ga0207712_10037317 | Ga0207712_100373175 | 180 |
| 518 | 3300025961 | Ga0207712_10080536 | Ga0207712_100805364 | 180 |
| 519 | 3300025961 | Ga0207712_10972498 | Ga0207712_109724982 | 180 |
| 520 | 3300025972 | Ga0207668_10035131 | Ga0207668_100351313 | 180 |
| 521 | 3300025972 | Ga0207668_10142225 | Ga0207668_101422252 | 180 |
| 522 | 3300025972 | Ga0207668_10145956 | Ga0207668_101459562 | 180 |
| 523 | 3300025972 | Ga0207668_10453057 | Ga0207668_104530572 | 180 |
| 524 | 3300025981 | Ga0207640_10041115 | Ga0207640_100411153 | 180 |
| 525 | 3300025986 | Ga0207658_10191212 | Ga0207658_101912122 | 180 |
| 526 | 3300025986 | Ga0207658_11009216 | Ga0207658_110092161 | 180 |
| 527 | 3300026023 | Ga0207677_10124631 | Ga0207677_101246311 | 180 |
| 528 | 3300026023 | Ga0207677_10431955 | Ga0207677_104319552 | 180 |
| 529 | 3300026035 | Ga0207703_10240546 | Ga0207703_102405462 | 180 |
| 530 | 3300026035 | Ga0207703_11286334 | Ga0207703_112863341 | 180 |
| 531 | 3300026041 | Ga0207639_10091983 | Ga0207639_100919832 | 180 |
| 532 | 3300026041 | Ga0207639_10345083 | Ga0207639_103450832 | 180 |
| 533 | 3300026067 | Ga0207678_10032160 | Ga0207678_100321606 | 180 |
| 534 | 3300026067 | Ga0207678_10053178 | Ga0207678_100531782 | 180 |
| 535 | 3300026067 | Ga0207678_10253016 | Ga0207678_102530162 | 180 |
| 536 | 3300026075 | Ga0207708_10409201 | Ga0207708_104092012 | 180 |
| 537 | 3300026075 | Ga0207708_10727809 | Ga0207708_107278092 | 180 |
| 538 | 3300026078 | Ga0207702_10092121 | Ga0207702_100921213 | 180 |
| 539 | 3300026078 | Ga0207702_10633658 | Ga0207702_106336581 | 180 |
| 540 | 3300026088 | Ga0207641_10025466 | Ga0207641_100254665 | 180 |
| 541 | 3300026089 | Ga0207648_10059634 | Ga0207648_100596342 | 180 |
| 542 | 3300026095 | Ga0207676_10196235 | Ga0207676_101962351 | 180 |
| 543 | 3300026095 | Ga0207676_10284766 | Ga0207676_102847662 | 180 |
| 544 | 3300026116 | Ga0207674_10091312 | Ga0207674_100913124 | 180 |
| 545 | 3300026118 | Ga0207675_100110100 | Ga0207675_1001101002 | 180 |
| 546 | 3300026118 | Ga0207675_100147251 | Ga0207675_1001472512 | 180 |
| 547 | 3300026118 | Ga0207675_100263571 | Ga0207675_1002635711 | 180 |
| 548 | 3300026118 | Ga0207675_101345103 | Ga0207675_1013451031 | 180 |
| 549 | 3300026118 | Ga0207675_101692571 | Ga0207675_1016925711 | 180 |
| 550 | 3300026121 | Ga0207683_10055231 | Ga0207683_100552311 | 180 |
| 551 | 3300026121 | Ga0207683_10138242 | Ga0207683_101382422 | 180 |
| 552 | 3300026121 | Ga0207683_10506705 | Ga0207683_105067052 | 180 |
| 553 | 3300026121 | Ga0207683_11096467 | Ga0207683_110964671 | 180 |
| 554 | 3300026142 | Ga0207698_10211220 | Ga0207698_102112202 | 180 |
| 555 | 3300026142 | Ga0207698_10298222 | Ga0207698_102982222 | 180 |
| 556 | 3300027357 | Ga0209589_1000006 | Ga0209589_1000006300 | 180 |
| 557 | 3300027361 | Ga0209489_100007 | Ga0209489_100007300 | 180 |
| 558 | 3300027363 | Ga0209700_100008 | Ga0209700_100008300 | 180 |
| 559 | 3300027866 | Ga0209813_10042489 | Ga0209813_100424892 | 180 |
| 560 | 3300027907 | Ga0207428_10291146 | Ga0207428_102911462 | 180 |
| 561 | 3300028379 | Ga0268266_10020468 | Ga0268266_100204682 | 180 |
| 562 | 3300028379 | Ga0268266_10080867 | Ga0268266_100808672 | 180 |
| 563 | 3300028379 | Ga0268266_10300834 | Ga0268266_103008342 | 180 |
| 564 | 3300028379 | Ga0268266_10316897 | Ga0268266_103168972 | 180 |
| 565 | 3300028379 | Ga0268266_10449676 | Ga0268266_104496762 | 180 |
| 566 | 3300028379 | Ga0268266_10667140 | Ga0268266_106671401 | 180 |
| 567 | 3300028380 | Ga0268265_10131809 | Ga0268265_101318092 | 180 |
| 568 | 3300028380 | Ga0268265_10131809 | Ga0268265_101318093 | 180 |
| 569 | 3300028381 | Ga0268264_10000038 | Ga0268264_100000385 | 180 |
| 570 | 3300028381 | Ga0268264_10441281 | Ga0268264_104412812 | 180 |
| 571 | 3300028381 | Ga0268264_10554606 | Ga0268264_105546061 | 180 |
| 572 | 3300028381 | Ga0268264_11287691 | Ga0268264_112876911 | 180 |
| 573 | 3300028786 | Ga0307517_10000085 | Ga0307517_1000008523 | 180 |
| 574 | 3300028786 | Ga0307517_10261092 | Ga0307517_102610922 | 180 |
| 575 | 3300028794 | Ga0307515_10011214 | Ga0307515_1001121417 | 180 |
| 576 | 3300030521 | Ga0307511_10213126 | Ga0307511_102131262 | 180 |
| 577 | 3300031235 | Ga0265330_10037533 | Ga0265330_100375332 | 180 |
| 578 | 3300031238 | Ga0265332_10011292 | Ga0265332_100112925 | 180 |
| 579 | 3300031456 | Ga0307513_10238049 | Ga0307513_102380492 | 180 |
| 580 | 3300031456 | Ga0307513_10314383 | Ga0307513_103143831 | 180 |
| 581 | 3300031507 | Ga0307509_10345403 | Ga0307509_103454032 | 180 |
| 582 | 3300031507 | Ga0307509_10523554 | Ga0307509_105235541 | 180 |
| 583 | 3300031616 | Ga0307508_10000034 | Ga0307508_1000003434 | 180 |
| 584 | 3300031616 | Ga0307508_10210415 | Ga0307508_102104152 | 180 |
| 585 | 3300031711 | Ga0265314_10004394 | Ga0265314_1000439413 | 180 |
| 586 | 3300031730 | Ga0307516_10012741 | Ga0307516_100127417 | 180 |
| 587 | 3300031730 | Ga0307516_10032981 | Ga0307516_100329815 | 180 |
| 588 | 3300031730 | Ga0307516_10065038 | Ga0307516_100650384 | 180 |
| 589 | 3300031730 | Ga0307516_10252513 | Ga0307516_102525132 | 180 |
| 590 | 3300031731 | Ga0307405_10698883 | Ga0307405_106988831 | 180 |
| 591 | 3300031852 | Ga0307410_10233930 | Ga0307410_102339302 | 180 |
| 592 | 3300031901 | Ga0307406_10101760 | Ga0307406_101017602 | 180 |
| 593 | 3300031901 | Ga0307406_10444783 | Ga0307406_104447832 | 180 |
| 594 | 3300031911 | Ga0307412_10213504 | Ga0307412_102135042 | 180 |
| 595 | 3300031995 | Ga0307409_100054772 | Ga0307409_1000547724 | 180 |
| 596 | 3300032004 | Ga0307414_10374532 | Ga0307414_103745322 | 180 |
| 597 | 3300032005 | Ga0307411_10144349 | Ga0307411_101443492 | 180 |
| 598 | 3300032126 | Ga0307415_100150032 | Ga0307415_1001500322 | 180 |
| 599 | 3300032126 | Ga0307415_100854509 | Ga0307415_1008545092 | 180 |
| 600 | 3300033179 | Ga0307507_10154469 | Ga0307507_101544692 | 180 |
| 601 | 3300033180 | Ga0307510_10003336 | Ga0307510_1000333615 | 180 |
| 602 | 3300033180 | Ga0307510_10066449 | Ga0307510_100664493 | 180 |
| 603 | 3300033442 | Ga0315911_1000010 | Ga0315911_1000010241 | 180 |
| 604 | 3300035083 | Ga0373926_0117731 | Ga0373926_0117731_386_988 | 180 |
| 605 | 3300035086 | Ga0373934_0018370 | Ga0373934_0018370_1017_1619 | 180 |
| 606 | 3300035086 | Ga0373934_0023403 | Ga0373934_0023403_1571_2173 | 180 |
| 607 | 3300035086 | Ga0373934_0116398 | Ga0373934_0116398_237_839 | 180 |
| 608 | 3300035111 | Ga0373923_0002503 | Ga0373923_0002503_3902_4504 | 180 |
| 609 | 3300035113 | Ga0373936_0005856 | Ga0373936_0005856_547_1149 | 180 |
| 610 | 3300035113 | Ga0373936_0012112 | Ga0373936_0012112_247_849 | 180 |
| 611 | 3300035113 | Ga0373936_0072403 | Ga0373936_0072403_72_674 | 180 |
| 612 | 3300035113 | Ga0373936_0168920 | Ga0373936_0168920_38_640 | 180 |
| 613 | 3300035113 | Ga0373936_0172971 | Ga0373936_0172971_12_614 | 180 |
| 614 | 3300035117 | Ga0373953_0001969 | Ga0373953_0001969_4875_5477 | 180 |
| 615 | 3300035118 | Ga0373954_0005665 | Ga0373954_0005665_3061_3663 | 180 |
| 616 | 3300035118 | Ga0373954_0084697 | Ga0373954_0084697_457_1059 | 180 |
| 617 | 3300035119 | Ga0373956_0095529 | Ga0373956_0095529_352_954 | 180 |
| 618 | 3300035120 | Ga0373957_0000736 | Ga0373957_0000736_7594_8196 | 180 |
| 619 | 3300035170 | Ga0373943_0003952 | Ga0373943_0003952_1187_1789 | 180 |
| 620 | 3300035170 | Ga0373943_0059547 | Ga0373943_0059547_161_763 | 180 |
| 621 | 3300035170 | Ga0373943_0140225 | Ga0373943_0140225_441_1043 | 180 |
| 622 | 3300035171 | Ga0373946_0028442 | Ga0373946_0028442_734_1336 | 180 |
| 623 | 3300035172 | Ga0373955_0005145 | Ga0373955_0005145_4385_4987 | 180 |
| 624 | 3300035172 | Ga0373955_0054932 | Ga0373955_0054932_1363_1965 | 180 |
| 625 | 3300035172 | Ga0373955_0122066 | Ga0373955_0122066_627_1229 | 180 |
| 626 | 3300035241 | Ga0373961_0233487 | Ga0373961_0233487_18_620 | 180 |
| 627 | 3300035410 | Ga0373924_0049264 | Ga0373924_0049264_702_1304 | 180 |
| 628 | 3300035410 | Ga0373924_0095738 | Ga0373924_0095738_223_825 | 180 |
| 629 | 3300035691 | Ga0373931_0045962 | Ga0373931_0045962_1142_1744 | 180 |
| 630 | 3300035692 | Ga0373935_0000757 | Ga0373935_0000757_4476_5078 | 180 |
| 631 | 3300035692 | Ga0373935_0252555 | Ga0373935_0252555_319_921 | 180 |
| 632 | 3300035695 | Ga0373927_0005694 | Ga0373927_0005694_6926_7528 | 180 |
| 633 | 3300035695 | Ga0373927_0366000 | Ga0373927_0366000_263_865 | 180 |
| 634 | 3300035724 | Ga0373933_0024456 | Ga0373933_0024456_362_964 | 180 |
| 635 | 3300035724 | Ga0373933_0069371 | Ga0373933_0069371_806_1408 | 180 |
| 636 | 3300035724 | Ga0373933_0359702 | Ga0373933_0359702_233_835 | 180 |
| 637 | 3300035725 | Ga0373947_0008292 | Ga0373947_0008292_1240_1842 | 180 |
| 638 | 3300035725 | Ga0373947_0137760 | Ga0373947_0137760_33_635 | 180 |
| 639 | 3300035725 | Ga0373947_0323315 | Ga0373947_0323315_42_644 | 180 |
| 640 | 3300036401 | Ga0373937_0036098 | Ga0373937_0036098_1035_1637 | 180 |
| 641 | 3300036401 | Ga0373937_0047886 | Ga0373937_0047886_115_717 | 180 |
| 642 | 3300036401 | Ga0373937_0460668 | Ga0373937_0460668_311_913 | 180 |
| 643 | 3300036534 | Ga0310109_024739 | Ga0310109_024739_102_704 | 180 |
| 644 | 3300037068 | Ga0373925_0002155 | Ga0373925_0002155_9137_9739 | 180 |
| 645 | 3300037068 | Ga0373925_0112186 | Ga0373925_0112186_991_1593 | 180 |
| 646 | 3300037068 | Ga0373925_0245252 | Ga0373925_0245252_46_648 | 180 |
| 647 | 3300039438 | Ga0436360_0668865 | Ga0436360_0668865_969_1571 | 180 |
| 648 | 3300041451 | Ga0451791_0424928 | Ga0451791_0424928_487_1089 | 180 |
| 649 | 3300041453 | Ga0451797_1273054 | Ga0451797_1273054_65_667 | 180 |
| 650 | 3300041460 | Ga0451802_1317356 | Ga0451802_1317356_165_767 | 180 |
| 651 | 3300044684 | Ga0466966_0326218 | Ga0466966_0326218_29_637 | 180 |
| 652 | 3300044684 | Ga0466966_0405775 | Ga0466966_0405775_70_672 | 180 |
| 653 | 3300044694 | Ga0466963_0310919 | Ga0466963_0310919_274_876 | 180 |
| 654 | 3300044694 | Ga0466963_0632677 | Ga0466963_0632677_64_669 | 180 |
| 655 | 3300044765 | Ga0466970_0188141 | Ga0466970_0188141_59_670 | 180 |
| 656 | 3300045049 | Ga0466959_0216038 | Ga0466959_0216038_289_900 | 180 |
| 657 | 3300045976 | Ga0466967_0274971 | Ga0466967_0274971_953_1555 | 180 |
| 658 | 3300046452 | Ga0495617_034968 | Ga0495617_034968_615_1217 | 180 |
| 659 | 3300046453 | Ga0495627_098624 | Ga0495627_098624_70_672 | 180 |
| 660 | 3300046454 | Ga0495592_0027847 | Ga0495592_0027847_2886_3488 | 180 |
| 661 | 3300046454 | Ga0495592_0395414 | Ga0495592_0395414_115_717 | 180 |
| 662 | 3300046454 | Ga0495592_0464859 | Ga0495592_0464859_36_638 | 180 |
| 663 | 3300046455 | Ga0495603_0000064 | Ga0495603_0000064_23865_24467 | 180 |
| 664 | 3300046455 | Ga0495603_0034710 | Ga0495603_0034710_844_1446 | 180 |
| 665 | 3300046455 | Ga0495603_0038842 | Ga0495603_0038842_1776_2378 | 180 |
| 666 | 3300046459 | Ga0495629_0004224 | Ga0495629_0004224_5557_6159 | 180 |
| 667 | 3300046459 | Ga0495629_0043875 | Ga0495629_0043875_735_1337 | 180 |
| 668 | 3300046459 | Ga0495629_0090717 | Ga0495629_0090717_1241_1843 | 180 |
| 669 | 3300046459 | Ga0495629_0245663 | Ga0495629_0245663_220_822 | 180 |
| 670 | 3300046460 | Ga0495638_0072979 | Ga0495638_0072979_323_925 | 180 |
| 671 | 3300046460 | Ga0495638_0220774 | Ga0495638_0220774_39_641 | 180 |
| 672 | 3300046461 | Ga0495641_0020444 | Ga0495641_0020444_1022_1624 | 180 |
| 673 | 3300046461 | Ga0495641_0063503 | Ga0495641_0063503_811_1413 | 180 |
| 674 | 3300046462 | Ga0495651_0021786 | Ga0495651_0021786_1649_2251 | 180 |
| 675 | 3300046462 | Ga0495651_0109822 | Ga0495651_0109822_860_1474 | 180 |
| 676 | 3300046463 | Ga0495653_0003792 | Ga0495653_0003792_7241_7843 | 180 |
| 677 | 3300046463 | Ga0495653_0152036 | Ga0495653_0152036_278_880 | 180 |
| 678 | 3300046472 | Ga0495580_0002461 | Ga0495580_0002461_7605_8207 | 180 |
| 679 | 3300046472 | Ga0495580_0276473 | Ga0495580_0276473_33_635 | 180 |
| 680 | 3300046473 | Ga0495582_0000197 | Ga0495582_0000197_25702_26304 | 180 |
| 681 | 3300046473 | Ga0495582_0060111 | Ga0495582_0060111_1450_2052 | 180 |
| 682 | 3300046475 | Ga0495639_0000218 | Ga0495639_0000218_17696_18298 | 180 |
| 683 | 3300046475 | Ga0495639_0435893 | Ga0495639_0435893_29_631 | 180 |
| 684 | 3300046476 | Ga0495662_0000732 | Ga0495662_0000732_5319_5921 | 180 |
| 685 | 3300046476 | Ga0495662_0122431 | Ga0495662_0122431_450_1052 | 180 |
| 686 | 3300046477 | Ga0495664_0009846 | Ga0495664_0009846_548_1150 | 180 |
| 687 | 3300046477 | Ga0495664_0045608 | Ga0495664_0045608_719_1321 | 180 |
| 688 | 3300046477 | Ga0495664_0209359 | Ga0495664_0209359_206_808 | 180 |
| 689 | 3300046477 | Ga0495664_0331204 | Ga0495664_0331204_205_807 | 180 |
| 690 | 3300046491 | Ga0495584_0201231 | Ga0495584_0201231_392_994 | 180 |
| 691 | 3300046491 | Ga0495584_0220792 | Ga0495584_0220792_161_763 | 180 |
| 692 | 3300046491 | Ga0495584_0227339 | Ga0495584_0227339_39_641 | 180 |
| 693 | 3300046499 | Ga0495594_0002513 | Ga0495594_0002513_5559_6161 | 180 |
| 694 | 3300046499 | Ga0495594_0051126 | Ga0495594_0051126_1194_1796 | 180 |
| 695 | 3300046506 | Ga0495583_0121704 | Ga0495583_0121704_337_939 | 180 |
| 696 | 3300046507 | Ga0495606_0000976 | Ga0495606_0000976_36352_36954 | 180 |
| 697 | 3300046507 | Ga0495606_0103261 | Ga0495606_0103261_128_730 | 180 |
| 698 | 3300046507 | Ga0495606_0103261 | Ga0495606_0103261_753_1355 | 180 |
| 699 | 3300046511 | Ga0495608_0006251 | Ga0495608_0006251_5121_5723 | 180 |
| 700 | 3300046511 | Ga0495608_0151565 | Ga0495608_0151565_206_808 | 180 |
| 701 | 3300046512 | Ga0495610_0106976 | Ga0495610_0106976_233_835 | 180 |
| 702 | 3300046513 | Ga0495616_0160909 | Ga0495616_0160909_311_913 | 180 |
| 703 | 3300046514 | Ga0495618_0085231 | Ga0495618_0085231_621_1223 | 180 |
| 704 | 3300046515 | Ga0495620_0183965 | Ga0495620_0183965_24_626 | 180 |
| 705 | 3300046516 | Ga0495628_0020250 | Ga0495628_0020250_4424_5026 | 180 |
| 706 | 3300046516 | Ga0495628_0036805 | Ga0495628_0036805_2702_3304 | 180 |
| 707 | 3300046516 | Ga0495628_0086580 | Ga0495628_0086580_112_714 | 180 |
| 708 | 3300046516 | Ga0495628_0319043 | Ga0495628_0319043_308_910 | 180 |
| 709 | 3300046517 | Ga0495630_0004218 | Ga0495630_0004218_4954_5556 | 180 |
| 710 | 3300046517 | Ga0495630_0139522 | Ga0495630_0139522_292_894 | 180 |
| 711 | 3300046518 | Ga0495631_0064932 | Ga0495631_0064932_516_1118 | 180 |
| 712 | 3300046519 | Ga0495632_0120324 | Ga0495632_0120324_361_963 | 180 |
| 713 | 3300046519 | Ga0495632_0147885 | Ga0495632_0147885_385_987 | 180 |
| 714 | 3300046526 | Ga0495666_0066999 | Ga0495666_0066999_858_1460 | 180 |
| 715 | 3300046529 | Ga0495652_0111215 | Ga0495652_0111215_1036_1638 | 180 |
| 716 | 3300046529 | Ga0495652_0129640 | Ga0495652_0129640_51_653 | 180 |
| 717 | 3300046529 | Ga0495652_0688806 | Ga0495652_0688806_26_628 | 180 |
| 718 | 3300046531 | Ga0495665_0000531 | Ga0495665_0000531_17947_18549 | 180 |
| 719 | 3300046533 | Ga0495640_0001572 | Ga0495640_0001572_691_1293 | 180 |
| 720 | 3300046533 | Ga0495640_0055146 | Ga0495640_0055146_1255_1857 | 180 |
| 721 | 3300046533 | Ga0495640_0059939 | Ga0495640_0059939_783_1385 | 180 |
| 722 | 3300046533 | Ga0495640_0439086 | Ga0495640_0439086_15_617 | 180 |
| 723 | 3300046535 | Ga0495586_0341001 | Ga0495586_0341001_26_631 | 180 |
| 724 | 3300046536 | Ga0495587_0073220 | Ga0495587_0073220_205_807 | 180 |
| 725 | 3300046536 | Ga0495587_0357461 | Ga0495587_0357461_97_699 | 180 |
| 726 | 3300046537 | Ga0495598_0030150 | Ga0495598_0030150_293_895 | 180 |
| 727 | 3300046538 | Ga0495609_0055347 | Ga0495609_0055347_941_1543 | 180 |
| 728 | 3300046543 | Ga0495645_0066733 | Ga0495645_0066733_775_1377 | 180 |
| 729 | 3300046543 | Ga0495645_0189922 | Ga0495645_0189922_25_627 | 180 |
| 730 | 3300046557 | Ga0495622_0014503 | Ga0495622_0014503_2153_2755 | 180 |
| 731 | 3300046557 | Ga0495622_0067417 | Ga0495622_0067417_800_1402 | 180 |
| 732 | 3300046557 | Ga0495622_0137244 | Ga0495622_0137244_302_904 | 180 |
| 733 | 3300046559 | Ga0495667_0036833 | Ga0495667_0036833_837_1439 | 180 |
| 734 | 3300046559 | Ga0495667_0037334 | Ga0495667_0037334_1774_2376 | 180 |
| 735 | 3300046615 | Ga0495656_0025190 | Ga0495656_0025190_1449_2051 | 180 |
| 736 | 3300046615 | Ga0495656_0047390 | Ga0495656_0047390_494_1096 | 180 |
| 737 | 3300046615 | Ga0495656_0141490 | Ga0495656_0141490_63_665 | 180 |
| 738 | 3300046616 | Ga0495668_0082544 | Ga0495668_0082544_399_1001 | 180 |
| 739 | 3300046616 | Ga0495668_0111202 | Ga0495668_0111202_829_1431 | 180 |
| 740 | 3300046616 | Ga0495668_0360483 | Ga0495668_0360483_109_711 | 180 |
| 741 | 3300046616 | Ga0495668_0492791 | Ga0495668_0492791_55_657 | 180 |
| 742 | 3300046642 | Ga0495634_0032723 | Ga0495634_0032723_2105_2707 | 180 |
| 743 | 3300046642 | Ga0495634_0045928 | Ga0495634_0045928_570_1172 | 180 |
| 744 | 3300046642 | Ga0495634_0382784 | Ga0495634_0382784_182_784 | 180 |
| 745 | 3300046648 | Ga0495611_0163675 | Ga0495611_0163675_307_909 | 180 |
| 746 | 3300046648 | Ga0495611_0290356 | Ga0495611_0290356_80_682 | 180 |
| 747 | 3300046660 | Ga0495625_0185670 | Ga0495625_0185670_293_895 | 180 |
| 748 | 3300046660 | Ga0495625_0214035 | Ga0495625_0214035_507_1109 | 180 |
| 749 | 3300046660 | Ga0495625_0358749 | Ga0495625_0358749_263_865 | 180 |
| 750 | 3300046660 | Ga0495625_0368236 | Ga0495625_0368236_126_728 | 180 |
| 751 | 3300046663 | Ga0495635_0000356 | Ga0495635_0000356_24497_25099 | 180 |
| 752 | 3300046663 | Ga0495635_0009382 | Ga0495635_0009382_4286_4888 | 180 |
| 753 | 3300046663 | Ga0495635_0522968 | Ga0495635_0522968_82_684 | 180 |
| 754 | 3300046664 | Ga0495659_0074733 | Ga0495659_0074733_125_727 | 180 |
| 755 | 3300046674 | Ga0495588_0005017 | Ga0495588_0005017_873_1475 | 180 |
| 756 | 3300046674 | Ga0495588_0129229 | Ga0495588_0129229_164_766 | 180 |
| 757 | 3300046675 | Ga0495657_0042456 | Ga0495657_0042456_1640_2242 | 180 |
| 758 | 3300046678 | Ga0495599_0142463 | Ga0495599_0142463_54_656 | 180 |
| 759 | 3300046679 | Ga0495623_0102188 | Ga0495623_0102188_115_717 | 180 |
| 760 | 3300046680 | Ga0495646_0019745 | Ga0495646_0019745_791_1393 | 180 |
| 761 | 3300046681 | Ga0495647_0038637 | Ga0495647_0038637_518_1120 | 180 |
| 762 | 3300046683 | Ga0495658_0001357 | Ga0495658_0001357_4857_5459 | 180 |
| 763 | 3300046683 | Ga0495658_0171387 | Ga0495658_0171387_119_721 | 180 |
| 764 | 3300046683 | Ga0495658_0616318 | Ga0495658_0616318_61_663 | 180 |
| 765 | 3300046684 | Ga0495669_0141445 | Ga0495669_0141445_110_712 | 180 |
| 766 | 3300046684 | Ga0495669_0322155 | Ga0495669_0322155_102_704 | 180 |
| 767 | 3300046689 | Ga0495613_0001784 | Ga0495613_0001784_3814_4416 | 180 |
| 768 | 3300046689 | Ga0495613_0027914 | Ga0495613_0027914_3303_3905 | 180 |
| 769 | 3300046690 | Ga0495624_0003608 | Ga0495624_0003608_780_1382 | 180 |
| 770 | 3300046690 | Ga0495624_0402922 | Ga0495624_0402922_47_649 | 180 |
| 771 | 3300046691 | Ga0495670_0238679 | Ga0495670_0238679_73_675 | 180 |
| 772 | 3300046692 | Ga0495671_0031809 | Ga0495671_0031809_546_1148 | 180 |
| 773 | 3300046692 | Ga0495671_0204737 | Ga0495671_0204737_239_841 | 180 |
| 774 | 3300046794 | Ga0495589_0093356 | Ga0495589_0093356_378_980 | 180 |
| 775 | 3300046809 | Ga0495600_0028015 | Ga0495600_0028015_160_762 | 180 |
| 776 | 3300047315 | Ga0495581_0001121 | Ga0495581_0001121_10034_10636 | 180 |
| 777 | 3300047317 | Ga0495604_0024387 | Ga0495604_0024387_2575_3177 | 180 |
| 778 | 3300047317 | Ga0495604_0365405 | Ga0495604_0365405_278_880 | 180 |
| 779 | 3300047318 | Ga0495636_0060684 | Ga0495636_0060684_598_1200 | 180 |
| 780 | 3300047318 | Ga0495636_0394425 | Ga0495636_0394425_36_638 | 180 |
| 781 | 3300047319 | Ga0495674_0000910 | Ga0495674_0000910_15616_16218 | 180 |
| 782 | 3300047319 | Ga0495674_0023623 | Ga0495674_0023623_589_1191 | 180 |
| 783 | 3300047319 | Ga0495674_0312652 | Ga0495674_0312652_232_834 | 180 |
| 784 | 3300047320 | Ga0495672_0033942 | Ga0495672_0033942_1792_2394 | 180 |
| 785 | 3300047320 | Ga0495672_0194269 | Ga0495672_0194269_396_998 | 180 |
| 786 | 3300047322 | Ga0495680_0054687 | Ga0495680_0054687_735_1337 | 180 |
| 787 | 3300047322 | Ga0495680_0058904 | Ga0495680_0058904_1497_2099 | 180 |
| 788 | 3300047322 | Ga0495680_0144985 | Ga0495680_0144985_224_826 | 180 |
| 789 | 3300047444 | Ga0495675_0009561 | Ga0495675_0009561_2757_3359 | 180 |
| 790 | 3300047444 | Ga0495675_0060330 | Ga0495675_0060330_1076_1678 | 180 |
| 791 | 3300047445 | Ga0495677_0034533 | Ga0495677_0034533_107_709 | 180 |
| 792 | 3300047445 | Ga0495677_0080280 | Ga0495677_0080280_476_1078 | 180 |
| 793 | 3300047445 | Ga0495677_0145479 | Ga0495677_0145479_35_637 | 180 |
| 794 | 3300047447 | Ga0495685_059848 | Ga0495685_059848_306_908 | 180 |
| 795 | 3300047469 | Ga0495673_0038103 | Ga0495673_0038103_939_1541 | 180 |
| 796 | 3300047469 | Ga0495673_0094597 | Ga0495673_0094597_13_615 | 180 |
| 797 | 3300047470 | Ga0495681_0103225 | Ga0495681_0103225_468_1070 | 180 |
| 798 | 3300047471 | Ga0495684_0001020 | Ga0495684_0001020_16392_16994 | 180 |
| 799 | 3300047471 | Ga0495684_0383689 | Ga0495684_0383689_358_960 | 180 |
| 800 | 3300047673 | Ga0495593_0000053 | Ga0495593_0000053_23735_24337 | 180 |
| 801 | 3300047673 | Ga0495593_0007888 | Ga0495593_0007888_4870_5472 | 180 |
| 802 | 3300047673 | Ga0495593_0242344 | Ga0495593_0242344_261_863 | 180 |
| 803 | 3300048088 | Ga0495602_0077062 | Ga0495602_0077062_986_1588 | 180 |
| 804 | 3300048089 | Ga0495614_0180337 | Ga0495614_0180337_290_892 | 180 |
| 805 | 3300048903 | Ga0496100_0148326 | Ga0496100_0148326_755_1357 | 180 |
| 806 | 3300048904 | Ga0496101_0090913 | Ga0496101_0090913_604_1206 | 180 |
| 807 | 3300048905 | Ga0496102_0625952 | Ga0496102_0625952_343_948 | 180 |
| 808 | 3300048905 | Ga0496102_0626103 | Ga0496102_0626103_277_879 | 180 |
| 809 | 3300048905 | Ga0496102_0702912 | Ga0496102_0702912_244_852 | 180 |
| 810 | 3300048906 | Ga0496103_0255405 | Ga0496103_0255405_258_860 | 180 |
| 811 | 3300048906 | Ga0496103_0306827 | Ga0496103_0306827_61_663 | 180 |
| 812 | 3300048907 | Ga0496104_0368281 | Ga0496104_0368281_382_984 | 180 |
| 813 | 3300048907 | Ga0496104_0424482 | Ga0496104_0424482_623_1225 | 180 |
| 814 | 3300048907 | Ga0496104_0677574 | Ga0496104_0677574_183_785 | 180 |
| 815 | 3300048908 | Ga0496105_0415518 | Ga0496105_0415518_10_612 | 180 |
| 816 | 3300048908 | Ga0496105_0495984 | Ga0496105_0495984_190_792 | 180 |
| 817 | 3300048909 | Ga0496106_0054025 | Ga0496106_0054025_1506_2108 | 180 |
| 818 | 3300048909 | Ga0496106_0349821 | Ga0496106_0349821_498_1100 | 180 |
| 819 | 3300048909 | Ga0496106_0801556 | Ga0496106_0801556_79_681 | 180 |
| 820 | 3300048910 | Ga0496107_0369921 | Ga0496107_0369921_259_861 | 180 |
| 821 | 3300048911 | Ga0496108_0043253 | Ga0496108_0043253_59_661 | 180 |
| 822 | 3300048911 | Ga0496108_0634035 | Ga0496108_0634035_73_675 | 180 |
| 823 | 3300048912 | Ga0496109_0368697 | Ga0496109_0368697_203_805 | 180 |
| 824 | 3300048912 | Ga0496109_1271712 | Ga0496109_1271712_48_650 | 180 |
| 825 | 3300048913 | Ga0496110_0563044 | Ga0496110_0563044_185_787 | 180 |
| 826 | 3300048914 | Ga0496111_0254025 | Ga0496111_0254025_135_737 | 180 |
| 827 | 3300048914 | Ga0496111_0672150 | Ga0496111_0672150_139_741 | 180 |
| 828 | 3300048915 | Ga0496112_0000008 | Ga0496112_0000008_76687_77289 | 180 |
| 829 | 3300048915 | Ga0496112_0017278 | Ga0496112_0017278_16_618 | 180 |
| 830 | 3300048915 | Ga0496112_0552225 | Ga0496112_0552225_97_699 | 180 |
| 831 | 3300048916 | Ga0496113_0108920 | Ga0496113_0108920_803_1405 | 180 |
| 832 | 3300048916 | Ga0496113_0118535 | Ga0496113_0118535_1220_1822 | 180 |
| 833 | 3300048916 | Ga0496113_0346479 | Ga0496113_0346479_452_1054 | 180 |
| 834 | 3300048918 | Ga0496115_0054879 | Ga0496115_0054879_637_1239 | 180 |
| 835 | 3300048920 | Ga0496117_0025346 | Ga0496117_0025346_3333_3935 | 180 |
| 836 | 3300048920 | Ga0496117_0224367 | Ga0496117_0224367_75_677 | 180 |
| 837 | 3300048921 | Ga0496118_0018656 | Ga0496118_0018656_1772_2374 | 180 |
| 838 | 3300048921 | Ga0496118_0137994 | Ga0496118_0137994_406_1008 | 180 |
| 839 | 3300048921 | Ga0496118_0220837 | Ga0496118_0220837_411_1013 | 180 |
| 840 | 3300048921 | Ga0496118_0383114 | Ga0496118_0383114_17_619 | 180 |
| 841 | 3300048922 | Ga0496119_0088159 | Ga0496119_0088159_260_862 | 180 |
| 842 | 3300048924 | Ga0496121_0000178 | Ga0496121_0000178_29042_29644 | 180 |
| 843 | 3300048924 | Ga0496121_0000381 | Ga0496121_0000381_717_1319 | 180 |
| 844 | 3300048924 | Ga0496121_0065155 | Ga0496121_0065155_62_664 | 180 |
| 845 | 3300048924 | Ga0496121_0074199 | Ga0496121_0074199_1848_2456 | 180 |
| 846 | 3300048924 | Ga0496121_0094181 | Ga0496121_0094181_1288_1890 | 180 |
| 847 | 3300048924 | Ga0496121_0122575 | Ga0496121_0122575_698_1300 | 180 |
| 848 | 3300048924 | Ga0496121_0144549 | Ga0496121_0144549_773_1375 | 180 |
| 849 | 3300048924 | Ga0496121_0251455 | Ga0496121_0251455_82_684 | 180 |
| 850 | 3300048924 | Ga0496121_0438888 | Ga0496121_0438888_48_650 | 180 |
| 851 | 3300048924 | Ga0496121_0448240 | Ga0496121_0448240_194_802 | 180 |
| 852 | 3300048924 | Ga0496121_0455858 | Ga0496121_0455858_156_758 | 180 |
| 853 | 3300048927 | Ga0496124_0057960 | Ga0496124_0057960_662_1264 | 180 |
| 854 | 3300048927 | Ga0496124_0227694 | Ga0496124_0227694_613_1215 | 180 |
| 855 | 3300048928 | Ga0496125_0172081 | Ga0496125_0172081_473_1075 | 180 |
| 856 | 3300048929 | Ga0496126_0072513 | Ga0496126_0072513_1740_2342 | 180 |
| 857 | 3300048929 | Ga0496126_0145644 | Ga0496126_0145644_449_1051 | 180 |
| 858 | 3300048929 | Ga0496126_0180012 | Ga0496126_0180012_89_691 | 180 |
| 859 | 3300048929 | Ga0496126_0218646 | Ga0496126_0218646_207_809 | 180 |
| 860 | 3300048929 | Ga0496126_0507847 | Ga0496126_0507847_262_864 | 180 |
| 861 | 3300049459 | Ga0495678_169183 | Ga0495678_169183_29_631 | 180 |
| 862 | 3300049460 | Ga0495682_0207520 | Ga0495682_0207520_57_659 | 180 |
| 863 | 3300049570 | Ga0501033_0058655 | Ga0501033_0058655_2027_2650 | 180 |
| 864 | 3300049571 | Ga0501034_0907848 | Ga0501034_0907848_67_690 | 180 |
| 865 | 3300049572 | Ga0501036_0658356 | Ga0501036_0658356_207_812 | 180 |
| 866 | 3300049575 | Ga0501039_0800798 | Ga0501039_0800798_47_652 | 180 |
| 867 | 3300049579 | Ga0501043_0062269 | Ga0501043_0062269_1893_2516 | 180 |
| 868 | 3300049580 | Ga0501046_0116454 | Ga0501046_0116454_1090_1713 | 180 |
| 869 | 3300049586 | Ga0501070_0071621 | Ga0501070_0071621_1788_2399 | 180 |
| 870 | 3300049589 | Ga0501073_0282758 | Ga0501073_0282758_11_634 | 180 |
| 871 | 3300049591 | Ga0501075_0940531 | Ga0501075_0940531_19_624 | 180 |
| 872 | 3300049822 | Ga0501035_0205489 | Ga0501035_0205489_219_842 | 180 |
| 873 | 3300049823 | Ga0501044_0056597 | Ga0501044_0056597_2833_3456 | 180 |
| 874 | 3300049823 | Ga0501044_0433402 | Ga0501044_0433402_515_1126 | 180 |
| 875 | 3300050489 | nmdc:mga03683_190444_c1 | nmdc:mga03683_190444_c1_74_676 | 180 |
| 876 | 3300050489 | nmdc:mga03683_26098_c1 | nmdc:mga03683_26098_c1_573_1175 | 180 |
| 877 | 3300050490 | nmdc:mga03n38_77539_c1 | nmdc:mga03n38_77539_c1_558_1160 | 180 |
| 878 | 3300050491 | nmdc:mga00v17_150838_c1 | nmdc:mga00v17_150838_c1_252_854 | 180 |
| 879 | 3300050491 | nmdc:mga00v17_150838_c1 | nmdc:mga00v17_150838_c1_862_1464 | 180 |
| 880 | 3300050491 | nmdc:mga00v17_464079_c1 | nmdc:mga00v17_464079_c1_145_747 | 180 |
| 881 | 3300050491 | nmdc:mga00v17_651583_c1 | nmdc:mga00v17_651583_c1_23_625 | 180 |
| 882 | 3300050492 | nmdc:mga0yw44_28665_c1 | nmdc:mga0yw44_28665_c1_1359_1961 | 180 |
| 883 | 3300050492 | nmdc:mga0yw44_28665_c1 | nmdc:mga0yw44_28665_c1_749_1351 | 180 |
| 884 | 3300050492 | nmdc:mga0yw44_95359_c1 | nmdc:mga0yw44_95359_c1_759_1361 | 180 |
| 885 | 3300050493 | nmdc:mga0k408_192270_c1 | nmdc:mga0k408_192270_c1_228_830 | 180 |
| 886 | 3300050493 | nmdc:mga0k408_199632_c1 | nmdc:mga0k408_199632_c1_564_1166 | 180 |
| 887 | 3300050493 | nmdc:mga0k408_302495_c1 | nmdc:mga0k408_302495_c1_313_915 | 180 |
| 888 | 3300050493 | nmdc:mga0k408_562543_c1 | nmdc:mga0k408_562543_c1_36_638 | 180 |
| 889 | 3300050494 | nmdc:mga06z11_180894_c1 | nmdc:mga06z11_180894_c1_201_803 | 180 |
| 890 | 3300050494 | nmdc:mga06z11_26727_c1 | nmdc:mga06z11_26727_c1_141_743 | 180 |
| 891 | 3300050495 | nmdc:mga04h51_50942_c1 | nmdc:mga04h51_50942_c1_503_1105 | 180 |
| 892 | 3300050496 | nmdc:mga07m45_134023_c1 | nmdc:mga07m45_134023_c1_502_1104 | 180 |
| 893 | 3300050496 | nmdc:mga07m45_40462_c1 | nmdc:mga07m45_40462_c1_1666_2268 | 180 |
| 894 | 3300050496 | nmdc:mga07m45_40483_c1 | nmdc:mga07m45_40483_c1_1712_2314 | 180 |
| 895 | 3300050496 | nmdc:mga07m45_496790_c1 | nmdc:mga07m45_496790_c1_69_671 | 180 |
| 896 | 3300050496 | nmdc:mga07m45_536427_c1 | nmdc:mga07m45_536427_c1_33_635 | 180 |
| 897 | 3300050507 | nmdc:mga05p37_284592_c1 | nmdc:mga05p37_284592_c1_1207_1809 | 180 |
| 898 | 3300050507 | nmdc:mga05p37_284592_c1 | nmdc:mga05p37_284592_c1_597_1199 | 180 |
| 899 | 3300050508 | nmdc:mga09592_1025960_c1 | nmdc:mga09592_1025960_c1_26_628 | 180 |
| 900 | 3300050509 | nmdc:mga0qj67_179462_c1 | nmdc:mga0qj67_179462_c1_619_1221 | 180 |
| 901 | 3300050511 | nmdc:mga08y16_82751_c1 | nmdc:mga08y16_82751_c1_557_1159 | 180 |
| 902 | 3300050512 | nmdc:mga0n895_730985_c1 | nmdc:mga0n895_730985_c1_41_643 | 180 |
| 903 | 3300050513 | nmdc:mga0rr50_219099_c1 | nmdc:mga0rr50_219099_c1_676_1278 | 180 |
| 904 | 3300050516 | nmdc:mga0sz30_65860_c1 | nmdc:mga0sz30_65860_c1_57_659 | 180 |
| 905 | 3300050516 | nmdc:mga0sz30_65860_c1 | nmdc:mga0sz30_65860_c1_667_1269 | 180 |
| 906 | 3300053077 | Ga0495601_0085617 | Ga0495601_0085617_1108_1710 | 180 |
| 907 | 3300053077 | Ga0495601_0231351 | Ga0495601_0231351_108_710 | 180 |
| 908 | 3300053080 | Ga0500635_0016572 | Ga0500635_0016572_1247_1849 | 180 |
| 909 | 3300053083 | Ga0495655_0027175 | Ga0495655_0027175_325_927 | 180 |
| 910 | 3300053083 | Ga0495655_0066725 | Ga0495655_0066725_265_867 | 180 |
| 911 | 3300053084 | Ga0495595_0006351 | Ga0495595_0006351_506_1108 | 180 |
| 912 | 3300053085 | Ga0495619_0004452 | Ga0495619_0004452_5276_5878 | 180 |
| 913 | 3300053085 | Ga0495619_0024318 | Ga0495619_0024318_694_1296 | 180 |
| 914 | 3300053087 | Ga0500643_079256 | Ga0500643_079256_133_735 | 180 |
| 915 | 3300053093 | Ga0500651_0226076 | Ga0500651_0226076_321_923 | 180 |
| 916 | 3300053093 | Ga0500651_0424996 | Ga0500651_0424996_19_621 | 180 |
| 917 | 3300053094 | Ga0500566_0000008 | Ga0500566_0000008_64082_64684 | 180 |
| 918 | 3300053094 | Ga0500566_0151274 | Ga0500566_0151274_154_756 | 180 |
| 919 | 3300053095 | Ga0500640_005945 | Ga0500640_005945_2147_2749 | 180 |
| 920 | 3300053096 | Ga0500641_0017543 | Ga0500641_0017543_704_1306 | 180 |
| 921 | 3300053096 | Ga0500641_0019512 | Ga0500641_0019512_1045_1647 | 180 |
| 922 | 3300053096 | Ga0500641_0055829 | Ga0500641_0055829_502_1104 | 180 |
| 923 | 3300053098 | Ga0500650_0363481 | Ga0500650_0363481_19_621 | 180 |
| 924 | 3300053104 | Ga0500556_0035598 | Ga0500556_0035598_553_1155 | 180 |
| 925 | 3300053111 | Ga0500572_001569 | Ga0500572_001569_4894_5496 | 180 |
| 926 | 3300053111 | Ga0500572_002289 | Ga0500572_002289_1920_2522 | 180 |
| 927 | 3300053115 | Ga0500591_110620 | Ga0500591_110620_435_1037 | 180 |
| 928 | 3300053119 | Ga0500595_129974 | Ga0500595_129974_73_675 | 180 |
| 929 | 3300053122 | Ga0500608_013208 | Ga0500608_013208_1290_1892 | 180 |
| 930 | 3300053133 | Ga0500655_034038 | Ga0500655_034038_286_888 | 180 |
| 931 | 3300053136 | Ga0500559_0001443 | Ga0500559_0001443_12318_12920 | 180 |
| 932 | 3300053136 | Ga0500559_0002991 | Ga0500559_0002991_2616_3218 | 180 |
| 933 | 3300053137 | Ga0500561_0088660 | Ga0500561_0088660_55_657 | 180 |
| 934 | 3300053142 | Ga0500577_0045825 | Ga0500577_0045825_63_665 | 180 |
| 935 | 3300053147 | Ga0500589_052332 | Ga0500589_052332_675_1277 | 180 |
| 936 | 3300053147 | Ga0500589_136364 | Ga0500589_136364_265_867 | 180 |
| 937 | 3300053148 | Ga0500590_062564 | Ga0500590_062564_694_1296 | 180 |
| 938 | 3300053150 | Ga0500603_001477 | Ga0500603_001477_2190_2792 | 180 |
| 939 | 3300053150 | Ga0500603_126041 | Ga0500603_126041_57_659 | 180 |
| 940 | 3300053153 | Ga0500616_0227389 | Ga0500616_0227389_166_768 | 180 |
| 941 | 3300053159 | Ga0500630_032400 | Ga0500630_032400_1447_2049 | 180 |
| 942 | 3300053163 | Ga0500639_000010 | Ga0500639_000010_90794_91396 | 180 |
| 943 | 3300053163 | Ga0500639_011164 | Ga0500639_011164_3580_4182 | 180 |
| 944 | 3300053163 | Ga0500639_096015 | Ga0500639_096015_225_827 | 180 |
| 945 | 3300053177 | Ga0500636_0194460 | Ga0500636_0194460_278_880 | 180 |
| 946 | 3300053177 | Ga0500636_0328676 | Ga0500636_0328676_79_681 | 180 |
| 947 | 3300053178 | Ga0500637_0306450 | Ga0500637_0306450_107_709 | 180 |
| 948 | 3300053725 | Ga0500576_038374 | Ga0500576_038374_599_1201 | 180 |
| 949 | 3300053735 | Ga0500596_001566 | Ga0500596_001566_2112_2714 | 180 |
| 950 | 3300053735 | Ga0500596_001917 | Ga0500596_001917_2257_2859 | 180 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6iu4-assembly1.cif.gz_A | crystal structure of iron transporter vit1 with cobalt ion | 0.3366 | 9 | 173 |
| 7dz8-assembly1.cif.gz_L | state transition supercomplex psi-lhci-lhcii from the lhcbm1 lacking mutant of chlamydomonas reinhardtii | 0.3352 | 9 | 144 |
| 6iu4-assembly1.cif.gz_A | crystal structure of iron transporter vit1 with cobalt ion | 0.3142 | 9 | 173 |
| 7xzi-assembly1.cif.gz_A | cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii | 0.3133 | 8 | 174 |
| 5wk6-assembly1.cif.gz_A | cryo-em structure of p. aeruginosa flagellar filaments g420a | 0.2971 | 11 | 173 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6TIG3_1_228_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5213 | 8 | 179 | 1.20.1250.20 |
| af_C6TIG3_1_228_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4991 | 8 | 179 | 1.20.1250.20 |
| af_Q9SVE7_354_513_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4086 | 4 | 174 | 1.20.1250.20 |
| af_A0A0R4IF99_149_314_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.3447 | 34 | 141 | 3.30.40.10 |
| af_Q9SVE7_354_513_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3445 | 4 | 174 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-S6GG24-F1-model_v4 | Uncharacterized protein | 0.666 | 4 | 177 |
GO:0005886
GO:0015171 GO:0033228 |
| AF-A0A3A0EYW3-F1-model_v4 | Lysine transporter LysE | 0.664 | 2 | 180 |
GO:0005886
GO:0015171 GO:0033228 |
| AF-A0A7Y2NIA6-F1-model_v4 | LysE family translocator | 0.6576 | 1 | 177 |
GO:0005886
GO:0015171 GO:0033228 |
| AF-A0A3A0EYW3-F1-model_v4 | Lysine transporter LysE | 0.6568 | 2 | 180 |
GO:0005886
GO:0015171 GO:0033228 |
| AF-A0A258GJJ8-F1-model_v4 | Lysine transporter LysE | 0.6534 | 1 | 178 |
GO:0005886
GO:0015171 GO:0033228 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar