F486551

General Info

Members Datasets Scaffolds Average Seq Length
950 478 887 193

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10223694|Ga0099794_102236942
Length 209
Sequence MKKKKMSTAMSQPLLIAFVMFAAVMFFTPGPNNIMLLSSGLTYGFRPTLPHIAGITFGFAFMIGVVGLGLGTIFITYPVLQTILKYAGVAYLIYLAAAIAMSGPVKPDHDNRRGPMTFWGAAMFQWINAKGWVMVIGTITAYAGIASFPWNITIQVMLSLVLGAVSCSAWALFGTALRPLLTSPRLVRTFNIVMAVLLLASLYPVFMDA

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
4 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
5 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
6 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
7 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
8 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
9 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
10 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
11 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
12 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
13 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
14 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
15 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
16 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
17 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
18 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
19 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
20 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
21 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
22 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
23 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
24 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
25 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
26 2904699407
27 2906610324
28 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
29 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
30 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
31 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
32 2922425934
33 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
34 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
35 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
36 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
37 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
38 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
39 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
40 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
41 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
42 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
44 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
45 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
46 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
51 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
52 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
53 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
54 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
59 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
60 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
61 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
62 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
63 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
64 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
65 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
66 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
67 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
68 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
69 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
70 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
71 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
72 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
73 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
74 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
77 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
78 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
79 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
80 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
81 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
82 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
83 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
84 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
85 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
86 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
87 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
88 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
89 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
90 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
93 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
97 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
98 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
99 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
100 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
101 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
102 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
103 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
104 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
105 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
106 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
107 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
108 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
109 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
110 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
111 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
112 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
113 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
114 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
115 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
116 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
117 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
118 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
119 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
120 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
121 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
122 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
124 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
125 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
126 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
127 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
128 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
130 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
131 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
132 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
133 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
134 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
135 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
136 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
138 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
139 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
140 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
141 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
142 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
143 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
144 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
145 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
146 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
147 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
148 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
149 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
150 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
151 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
152 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
153 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
154 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
155 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
156 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
157 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
158 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
159 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
160 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
161 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
162 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
163 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
164 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
167 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
169 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
170 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
230 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
231 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
232 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
233 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
234 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
238 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
239 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
240 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
241 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
242 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
243 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
244 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
245 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
246 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
247 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
248 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
249 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
250 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
251 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
252 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
253 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
254 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
255 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
256 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
257 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
258 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
259 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
260 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
261 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
262 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
263 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
264 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
265 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
266 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
267 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
268 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
269 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
270 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
271 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
272 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
273 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
274 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
275 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
276 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
277 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
278 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
279 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
280 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
281 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
282 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
283 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
284 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
285 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
286 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
287 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
288 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
289 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
290 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
291 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
292 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
293 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
294 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
295 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
296 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
297 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
298 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
299 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
300 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
301 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
302 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
303 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
304 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
305 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
306 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
307 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
308 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
309 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
310 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
311 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
312 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
313 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
314 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
315 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
316 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
317 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
318 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
319 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
320 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
321 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
322 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
323 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
324 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
325 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
326 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
327 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
328 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
329 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
330 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
331 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
332 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
333 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
334 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
335 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
336 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
337 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
338 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
339 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
340 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
341 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
342 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
343 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
344 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
345 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
346 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
347 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
348 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
349 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
350 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
351 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
352 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
353 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
354 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
355 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
356 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
357 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
358 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
359 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
360 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
361 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
362 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
363 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
364 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
365 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
366 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
367 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
368 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
369 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
370 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
371 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
372 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
373 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
374 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
375 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
376 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
377 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
378 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
379 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
380 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
381 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
382 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
383 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
384 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
385 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
386 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
387 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
388 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
389 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
390 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
391 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
392 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
393 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
394 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
395 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
396 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
397 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
398 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
399 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
400 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
401 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
402 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
403 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
404 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
405 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
406 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
409 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
413 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
414 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
415 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
416 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
418 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
419 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
420 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
421 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
422 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
423 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
424 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
425 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
426 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
427 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
428 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
429 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
430 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
431 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
432 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
433 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
434 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
435 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
436 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
437 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
438 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
439 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
440 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
441 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
442 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
443 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
444 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
445 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
446 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
447 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
448 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
449 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
450 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
451 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
452 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
453 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
454 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
455 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
456 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
457 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
458 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
459 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
460 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
461 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
462 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
463 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
464 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
465 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
466 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
467 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
468 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
469 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
470 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
471 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
472 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
473 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
474 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
475 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
476 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
477 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
478 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.46
Metatranscriptomes 0.11
Isolates 4.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.26
Nodule 3.68
Rhizoplane 5.26
Rhizosphere 69.26
Stem 0
Stem Tuber 0
Unclassified 8.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10012951 3300001989 Bacteria 3052
2 JGI24737J22298_10016177 3300001990 Bacteria 2409
3 JGI24735J21928_10016953 3300002067 Bacteria 2255
4 JGI24742J22300_10012308 3300002244 Bacteria 1425
5 JGI25406J46586_10000721 3300003203 Bacteria 15439
6 JGI25406J46586_10008215 3300003203 Bacteria 4737
7 JGI25406J46586_10017054 3300003203 Bacteria 3009
8 JGI25153J46596_10000738 3300003215 Bacteria 20026
9 rootH2_10077708 3300003320 Bacteria 1427
10 JGI25160J50197_1029660 3300003354 Bacteria 1441
11 JGI25404J52841_10015813 3300003659 Bacteria 1637
12 JGI25404J52841_10047108 3300003659 Bacteria 909
13 JGI25405J52794_10061750 3300003911 Bacteria 811
14 Ga0065165_1009382 3300005262 Bacteria 4396
15 Ga0070658_10562246 3300005327 Bacteria 987
16 Ga0070676_10212565 3300005328 Bacteria 1274
17 Ga0070683_100017126 3300005329 Bacteria 6399
18 Ga0070683_100521531 3300005329 Bacteria 1135
19 Ga0070690_100647479 3300005330 Bacteria 807
20 Ga0068869_100064859 3300005334 Bacteria 2687
21 Ga0068869_100381851 3300005334 Bacteria 1155
22 Ga0070680_100061117 3300005336 Bacteria 3084
23 Ga0068868_100130295 3300005338 Bacteria 2057
24 Ga0068868_100137064 3300005338 Bacteria 2006
25 Ga0068868_100747279 3300005338 Bacteria 879
26 Ga0070660_100884856 3300005339 Bacteria 753
27 Ga0070689_100504881 3300005340 Bacteria 1036
28 Ga0070691_10055133 3300005341 Bacteria 1903
29 Ga0070687_100189376 3300005343 Bacteria 1238
30 Ga0070661_100205620 3300005344 Bacteria 1506
31 Ga0070668_100050535 3300005347 Bacteria 3201
32 Ga0070668_100152569 3300005347 Bacteria 1869
33 Ga0070669_100236187 3300005353 Bacteria 1451
34 Ga0070671_100160005 3300005355 Bacteria 1903
35 Ga0070671_100501845 3300005355 Bacteria 1044
36 Ga0070674_100062001 3300005356 Bacteria 2612
37 Ga0070688_100109774 3300005365 Bacteria 1833
38 Ga0070688_100172809 3300005365 Bacteria 1493
39 Ga0070659_100251243 3300005366 Bacteria 1465
40 Ga0070659_100383741 3300005366 Bacteria 1184
41 Ga0070659_100668052 3300005366 Bacteria 897
42 Ga0070667_101255141 3300005367 Bacteria 694
43 Ga0070703_10198342 3300005406 Bacteria 786
44 Ga0070709_10001764 3300005434 Bacteria 11754
45 Ga0070709_10153975 3300005434 Bacteria 1591
46 Ga0070714_100051653 3300005435 Bacteria 3506
47 Ga0070714_100547529 3300005435 Bacteria 1107
48 Ga0070713_100061144 3300005436 Bacteria 3151
49 Ga0070713_100211833 3300005436 Bacteria 1754
50 Ga0070713_100228238 3300005436 Bacteria 1691
51 Ga0070713_100378511 3300005436 Bacteria 1318
52 Ga0070713_100835486 3300005436 Bacteria 884
53 Ga0070710_10001695 3300005437 Bacteria 10382
54 Ga0070710_10527186 3300005437 Bacteria 812
55 Ga0070711_100020703 3300005439 Bacteria 4243
56 Ga0070711_100044852 3300005439 Bacteria 3003
57 Ga0070711_100712389 3300005439 Bacteria 846
58 Ga0070711_100773988 3300005439 Bacteria 812
59 Ga0070708_101169909 3300005445 Bacteria 720
60 Ga0070663_100018549 3300005455 Bacteria 4566
61 Ga0070663_100053867 3300005455 Bacteria 2873
62 Ga0070663_100685201 3300005455 Bacteria 870
63 Ga0070678_100198168 3300005456 Bacteria 1655
64 Ga0070678_100371820 3300005456 Bacteria 1234
65 Ga0070678_100383583 3300005456 Bacteria 1216
66 Ga0070662_100050768 3300005457 Bacteria 2992
67 Ga0070662_100190683 3300005457 Bacteria 1621
68 Ga0070662_100483100 3300005457 Bacteria 1031
69 Ga0070681_10463553 3300005458 Bacteria 1179
70 Ga0068867_100111788 3300005459 Bacteria 2099
71 Ga0068867_100349335 3300005459 Bacteria 1234
72 Ga0070706_100129052 3300005467 Bacteria 2359
73 Ga0070706_100260542 3300005467 Bacteria 1619
74 Ga0070707_100119818 3300005468 Bacteria 2555
75 Ga0070698_100197239 3300005471 Bacteria 1949
76 Ga0070698_100617451 3300005471 Bacteria 1025
77 Ga0070697_100238054 3300005536 Bacteria 1554
78 Ga0068853_100097793 3300005539 Bacteria 2592
79 Ga0068853_100262428 3300005539 Bacteria 1588
80 Ga0068853_101018183 3300005539 Bacteria 798
81 Ga0070672_100109452 3300005543 Bacteria 2250
82 Ga0070672_100154769 3300005543 Bacteria 1898
83 Ga0070686_100356428 3300005544 Bacteria 1100
84 Ga0070695_100094980 3300005545 Bacteria 1997
85 Ga0070695_100542236 3300005545 Bacteria 906
86 Ga0070696_100473956 3300005546 Bacteria 992
87 Ga0070665_100088043 3300005548 Bacteria 3111
88 Ga0070665_100174517 3300005548 Bacteria 2150
89 Ga0070665_100701082 3300005548 Bacteria 1025
90 Ga0070704_100583576 3300005549 Bacteria 980
91 Ga0070704_100666847 3300005549 Bacteria 919
92 Ga0068855_100050191 3300005563 Bacteria 4918
93 Ga0068855_100053959 3300005563 Bacteria 4727
94 Ga0068855_100508206 3300005563 Bacteria 1309
95 Ga0068855_100531771 3300005563 Bacteria 1274
96 Ga0070664_100432562 3300005564 Bacteria 1206
97 Ga0068857_100014952 3300005577 Bacteria 6770
98 Ga0068857_100165432 3300005577 Bacteria 2008
99 Ga0068857_100548812 3300005577 Bacteria 1089
100 Ga0068854_100021501 3300005578 Bacteria 4379
101 Ga0068854_100364401 3300005578 Bacteria 1186
102 Ga0068854_101195812 3300005578 Bacteria 681
103 Ga0068856_100002538 3300005614 Bacteria 18824
104 Ga0068856_100100529 3300005614 Bacteria 2884
105 Ga0068856_100289594 3300005614 Bacteria 1654
106 Ga0068856_100444122 3300005614 Bacteria 1318
107 Ga0068852_100008462 3300005616 Bacteria 7583
108 Ga0068852_100660284 3300005616 Bacteria 1054
109 Ga0068852_100757318 3300005616 Bacteria 983
110 Ga0068852_100782486 3300005616 Bacteria 968
111 Ga0068859_100668110 3300005617 Bacteria 1130
112 Ga0068859_101197883 3300005617 Bacteria 836
113 Ga0068864_100128028 3300005618 Bacteria 2277
114 Ga0068864_100556159 3300005618 Bacteria 1110
115 Ga0068864_100748175 3300005618 Bacteria 958
116 Ga0068866_10046902 3300005718 Bacteria 2175
117 Ga0068861_100030335 3300005719 Bacteria 3961
118 Ga0068861_100046881 3300005719 Bacteria 3260
119 Ga0068861_100572507 3300005719 Bacteria 1032
120 Ga0068870_10242840 3300005840 Bacteria 1113
121 Ga0068863_100243895 3300005841 Bacteria 1734
122 Ga0068863_100394052 3300005841 Bacteria 1353
123 Ga0068858_100239469 3300005842 Bacteria 1721
124 Ga0068858_100420222 3300005842 Bacteria 1286
125 Ga0068858_100766265 3300005842 Bacteria 941
126 Ga0068860_100000533 3300005843 Bacteria 46479
127 Ga0068860_100134467 3300005843 Bacteria 2374
128 Ga0068862_100265752 3300005844 Bacteria 1567
129 Ga0068862_100569862 3300005844 Bacteria 1083
130 Ga0081455_10070768 3300005937 Bacteria 2895
131 Ga0081455_10380199 3300005937 Bacteria 987
132 Ga0081540_1002213 3300005983 Bacteria 16044
133 Ga0081540_1005827 3300005983 Bacteria 9115
134 Ga0081540_1012712 3300005983 Bacteria 5519
135 Ga0081540_1017590 3300005983 Bacteria 4418
136 Ga0081540_1024174 3300005983 Bacteria 3532
137 Ga0081540_1025572 3300005983 Bacteria 3392
138 Ga0081540_1052500 3300005983 Bacteria 2006
139 Ga0081539_10000748 3300005985 Bacteria 64594
140 Ga0081539_10001829 3300005985 Bacteria 33573
141 Ga0070717_10133966 3300006028 Bacteria 2132
142 Ga0070717_10257705 3300006028 Bacteria 1543
143 Ga0075365_10027753 3300006038 Bacteria 3605
144 Ga0075365_10039617 3300006038 Bacteria 3069
145 Ga0075365_10126465 3300006038 Bacteria 1766
146 Ga0075365_10296614 3300006038 Bacteria 1137
147 Ga0075365_10358222 3300006038 Bacteria 1028
148 Ga0075365_10479718 3300006038 Bacteria 878
149 Ga0075368_10020977 3300006042 Bacteria 2478
150 Ga0075368_10030204 3300006042 Bacteria 2098
151 Ga0075363_100023427 3300006048 Bacteria 3129
152 Ga0075363_100052487 3300006048 Bacteria 2176
153 Ga0075363_100448932 3300006048 Bacteria 761
154 Ga0075364_10281885 3300006051 Bacteria 1130
155 Ga0075432_10127059 3300006058 Bacteria 962
156 Ga0070715_10001014 3300006163 Bacteria 7909
157 Ga0070716_100019284 3300006173 Bacteria 3563
158 Ga0070716_100399010 3300006173 Bacteria 988
159 Ga0070716_100442075 3300006173 Bacteria 946
160 Ga0070712_100029479 3300006175 Bacteria 3678
161 Ga0070712_100573429 3300006175 Bacteria 953
162 Ga0070712_100755187 3300006175 Bacteria 832
163 Ga0075362_10094934 3300006177 Bacteria 1388
164 Ga0075367_10089243 3300006178 Bacteria 1874
165 Ga0075367_10119054 3300006178 Bacteria 1626
166 Ga0075367_10151217 3300006178 Bacteria 1440
167 Ga0075367_10176008 3300006178 Bacteria 1333
168 Ga0075367_10384087 3300006178 Bacteria 887
169 Ga0075369_10065856 3300006186 Bacteria 1588
170 Ga0075369_10293403 3300006186 Bacteria 759
171 Ga0075369_10340714 3300006186 Bacteria 703
172 Ga0075366_10409780 3300006195 Bacteria 834
173 Ga0075366_10465306 3300006195 Bacteria 781
174 Ga0097621_100156156 3300006237 Bacteria 1958
175 Ga0097621_100273661 3300006237 Bacteria 1484
176 Ga0075370_10055472 3300006353 Bacteria 2251
177 Ga0075370_10105899 3300006353 Bacteria 1630
178 Ga0075370_10152099 3300006353 Bacteria 1356
179 Ga0075370_10477048 3300006353 Bacteria 752
180 Ga0068871_100235438 3300006358 Bacteria 1590
181 Ga0068871_100267565 3300006358 Bacteria 1493
182 Ga0068871_100349535 3300006358 Bacteria 1307
183 Ga0075428_100084451 3300006844 Bacteria 3464
184 Ga0075434_100395193 3300006871 Bacteria 1403
185 Ga0068865_100059062 3300006881 Bacteria 2681
186 Ga0068865_100122589 3300006881 Bacteria 1935
187 Ga0068865_100678081 3300006881 Bacteria 878
188 Ga0097620_100668134 3300006931 Bacteria 1130
189 Ga0097620_101197797 3300006931 Bacteria 836
190 Ga0099825_1032872 3300006941 Bacteria 2064
191 Ga0099824_1014525 3300006942 Bacteria 7787
192 Ga0099822_1005034 3300006943 Bacteria 17247
193 Ga0075435_100401054 3300007076 Bacteria 1179
194 Ga0099794_10029066 3300007265 Bacteria 2574
195 Ga0099794_10141477 3300007265 Bacteria 1218
196 Ga0099794_10148055 3300007265 Bacteria 1191
197 Ga0099794_10223694 3300007265 Bacteria 967
198 Ga0099795_10032744 3300007788 Bacteria 1800
199 Ga0105240_10030327 3300009093 Bacteria 7028
200 Ga0105240_10036581 3300009093 Bacteria 6313
201 Ga0105240_10141354 3300009093 Bacteria 2878
202 Ga0105240_11578733 3300009093 Bacteria 687
203 Ga0111539_10163191 3300009094 Bacteria 2606
204 Ga0111539_10255594 3300009094 Bacteria 2040
205 Ga0105245_10046675 3300009098 Bacteria 3871
206 Ga0105245_10801445 3300009098 Bacteria 980
207 Ga0105247_10036617 3300009101 Bacteria 2991
208 Ga0105247_10159250 3300009101 Bacteria 1493
209 Ga0105247_10206883 3300009101 Bacteria 1322
210 Ga0105247_10420080 3300009101 Bacteria 957
211 Ga0105243_10275580 3300009148 Bacteria 1513
212 Ga0105243_10420205 3300009148 Bacteria 1247
213 Ga0105243_10742634 3300009148 Bacteria 961
214 Ga0105241_10117846 3300009174 Bacteria 2134
215 Ga0105241_11096257 3300009174 Bacteria 749
216 Ga0105242_10195163 3300009176 Bacteria 1795
217 Ga0105242_10707278 3300009176 Bacteria 987
218 Ga0105242_10894335 3300009176 Bacteria 887
219 Ga0105248_10498772 3300009177 Bacteria 1372
220 Ga0105248_11061362 3300009177 Bacteria 915
221 Ga0105248_11700760 3300009177 Bacteria 715
222 Ga0105237_10066154 3300009545 Bacteria 3610
223 Ga0105237_10124394 3300009545 Bacteria 2574
224 Ga0105237_10770205 3300009545 Bacteria 969
225 Ga0105237_10885744 3300009545 Bacteria 899
226 Ga0105238_10008344 3300009551 Bacteria 10365
227 Ga0105249_10821648 3300009553 Bacteria 994
228 Ga0105249_11153238 3300009553 Bacteria 846
229 Ga0105249_11378852 3300009553 Bacteria 777
230 Ga0105249_12059108 3300009553 Bacteria 643
231 Ga0099796_10082966 3300010159 Bacteria 1178
232 Ga0099796_10091940 3300010159 Bacteria 1129
233 Ga0099796_10198341 3300010159 Bacteria 813
234 Ga0105239_10007487 3300010375 Bacteria 12527
235 Ga0105239_10165019 3300010375 Bacteria 2476
236 Ga0105246_10180621 3300011119 Bacteria 1624
237 Ga0157370_10081244 3300013104 Bacteria 3050
238 Ga0157370_10519025 3300013104 Bacteria 1093
239 Ga0157374_10131890 3300013296 Bacteria 2418
240 Ga0157378_10133193 3300013297 Bacteria 2303
241 Ga0157378_10140689 3300013297 Bacteria 2241
242 Ga0157378_10496294 3300013297 Bacteria 1219
243 Ga0157378_10697539 3300013297 Bacteria 1034
244 Ga0157378_10740440 3300013297 Bacteria 1005
245 Ga0157378_10798558 3300013297 Bacteria 969
246 Ga0163162_10561879 3300013306 Bacteria 1269
247 Ga0157372_10719819 3300013307 Bacteria 1161
248 Ga0157375_10281247 3300013308 Bacteria 1827
249 Ga0157375_10564644 3300013308 Bacteria 1299
250 Ga0157375_10595944 3300013308 Bacteria 1265
251 Ga0157375_10750967 3300013308 Bacteria 1127
252 Ga0163163_10069119 3300014325 Bacteria 3516
253 Ga0163163_10126403 3300014325 Bacteria 2595
254 Ga0157380_10586871 3300014326 Bacteria 1100
255 Ga0157380_10857288 3300014326 Bacteria 931
256 Ga0157377_10176996 3300014745 Bacteria 1338
257 Ga0157379_10018767 3300014968 Bacteria 6098
258 Ga0157379_10387674 3300014968 Bacteria 1283
259 Ga0157379_10562057 3300014968 Bacteria 1062
260 Ga0163161_10822778 3300017792 Bacteria 782
261 Ga0213873_10035460 3300021358 Bacteria 1262
262 Ga0213872_10194607 3300021361 Bacteria 871
263 Ga0213876_10096501 3300021384 Bacteria 1566
264 Ga0213876_10367531 3300021384 Bacteria 765
265 Ga0213871_10005944 3300021441 Bacteria 2552
266 Ga0209677_100642 3300025253 Bacteria 18518
267 Ga0209148_1015784 3300025254 Bacteria 1311
268 Ga0209233_1004646 3300025261 Bacteria 4640
269 Ga0209233_1009366 3300025261 Bacteria 2984
270 Ga0209455_1007059 3300025272 Bacteria 3224
271 Ga0209758_1036446 3300025297 Bacteria 1919
272 Ga0207426_1015827 3300025302 Bacteria 2727
273 Ga0207697_10261027 3300025315 Bacteria 767
274 Ga0207696_1022802 3300025711 Bacteria 1983
275 Ga0207713_1148801 3300025735 Bacteria 758
276 Ga0207653_10180814 3300025885 Bacteria 789
277 Ga0207692_10008094 3300025898 Bacteria 4339
278 Ga0207692_10123298 3300025898 Bacteria 1454
279 Ga0207710_10073815 3300025900 Bacteria 1569
280 Ga0207710_10135880 3300025900 Bacteria 1184
281 Ga0207710_10274996 3300025900 Bacteria 846
282 Ga0207688_10067411 3300025901 Bacteria 2025
283 Ga0207688_10260136 3300025901 Bacteria 1053
284 Ga0207688_10278162 3300025901 Bacteria 1019
285 Ga0207688_10314184 3300025901 Bacteria 960
286 Ga0207680_10377489 3300025903 Bacteria 999
287 Ga0207647_10001257 3300025904 Bacteria 19505
288 Ga0207647_10162990 3300025904 Bacteria 1300
289 Ga0207685_10019456 3300025905 Bacteria 2239
290 Ga0207685_10103387 3300025905 Bacteria 1222
291 Ga0207699_10014446 3300025906 Bacteria 4071
292 Ga0207645_10753394 3300025907 Bacteria 662
293 Ga0207643_10101886 3300025908 Bacteria 1684
294 Ga0207643_10113831 3300025908 Bacteria 1596
295 Ga0207684_10236553 3300025910 Bacteria 1576
296 Ga0207695_10054115 3300025913 Bacteria 4194
297 Ga0207695_10322828 3300025913 Bacteria 1433
298 Ga0207671_10034203 3300025914 Bacteria 3778
299 Ga0207671_10166650 3300025914 Bacteria 1709
300 Ga0207671_10466978 3300025914 Bacteria 1006
301 Ga0207693_10017003 3300025915 Bacteria 5807
302 Ga0207693_10097945 3300025915 Bacteria 2300
303 Ga0207693_10142022 3300025915 Bacteria 1888
304 Ga0207693_10162362 3300025915 Bacteria 1758
305 Ga0207693_10691375 3300025915 Bacteria 790
306 Ga0207663_10012346 3300025916 Bacteria 4617
307 Ga0207663_10124585 3300025916 Bacteria 1770
308 Ga0207663_10414156 3300025916 Bacteria 1033
309 Ga0207660_10465140 3300025917 Bacteria 1024
310 Ga0207662_10092971 3300025918 Bacteria 1858
311 Ga0207657_10167355 3300025919 Bacteria 1782
312 Ga0207649_10355527 3300025920 Bacteria 1085
313 Ga0207646_10141882 3300025922 Bacteria 2164
314 Ga0207681_10595647 3300025923 Bacteria 913
315 Ga0207694_10103075 3300025924 Bacteria 2262
316 Ga0207694_10219612 3300025924 Bacteria 1550
317 Ga0207694_10586258 3300025924 Bacteria 937
318 Ga0207650_10614695 3300025925 Bacteria 914
319 Ga0207687_10749336 3300025927 Bacteria 831
320 Ga0207700_10005365 3300025928 Bacteria 7655
321 Ga0207700_10109507 3300025928 Bacteria 2220
322 Ga0207700_10138887 3300025928 Bacteria 1994
323 Ga0207700_10324013 3300025928 Bacteria 1336
324 Ga0207664_10039186 3300025929 Bacteria 3678
325 Ga0207664_10048347 3300025929 Bacteria 3344
326 Ga0207664_10903405 3300025929 Bacteria 793
327 Ga0207644_10157199 3300025931 Bacteria 1764
328 Ga0207690_10647708 3300025932 Bacteria 865
329 Ga0207706_10119813 3300025933 Bacteria 2314
330 Ga0207706_10403780 3300025933 Bacteria 1184
331 Ga0207706_10470132 3300025933 Bacteria 1087
332 Ga0207706_10582197 3300025933 Bacteria 962
333 Ga0207686_10691379 3300025934 Bacteria 810
334 Ga0207686_10905074 3300025934 Bacteria 712
335 Ga0207709_10031008 3300025935 Bacteria 3117
336 Ga0207709_10632096 3300025935 Bacteria 851
337 Ga0207669_10060589 3300025937 Bacteria 2321
338 Ga0207669_10098745 3300025937 Bacteria 1923
339 Ga0207669_10129629 3300025937 Bacteria 1730
340 Ga0207669_10360764 3300025937 Bacteria 1126
341 Ga0207669_10859103 3300025937 Bacteria 756
342 Ga0207704_10598304 3300025938 Bacteria 902
343 Ga0207665_10226175 3300025939 Bacteria 1373
344 Ga0207691_10162587 3300025940 Bacteria 1958
345 Ga0207691_10344192 3300025940 Bacteria 1276
346 Ga0207711_10028488 3300025941 Bacteria 4699
347 Ga0207689_10120260 3300025942 Bacteria 2161
348 Ga0207689_10136439 3300025942 Bacteria 2020
349 Ga0207689_10362997 3300025942 Bacteria 1204
350 Ga0207679_10253509 3300025945 Bacteria 1497
351 Ga0207679_10348912 3300025945 Bacteria 1289
352 Ga0207667_10082489 3300025949 Bacteria 3330
353 Ga0207667_10396432 3300025949 Bacteria 1405
354 Ga0207667_10903591 3300025949 Bacteria 875
355 Ga0207712_10037317 3300025961 Bacteria 3315
356 Ga0207712_10080536 3300025961 Bacteria 2369
357 Ga0207712_10972498 3300025961 Bacteria 752
358 Ga0207668_10035131 3300025972 Bacteria 3334
359 Ga0207668_10142225 3300025972 Bacteria 1846
360 Ga0207668_10145956 3300025972 Bacteria 1825
361 Ga0207668_10453057 3300025972 Bacteria 1095
362 Ga0207640_10041115 3300025981 Bacteria 2938
363 Ga0207658_10191212 3300025986 Bacteria 1701
364 Ga0207658_10511636 3300025986 Bacteria 1071
365 Ga0207658_11009216 3300025986 Bacteria 759
366 Ga0207677_10124631 3300026023 Bacteria 1944
367 Ga0207677_10431955 3300026023 Bacteria 1124
368 Ga0207703_10240546 3300026035 Bacteria 1627
369 Ga0207703_11286334 3300026035 Bacteria 703
370 Ga0207639_10091983 3300026041 Bacteria 2430
371 Ga0207639_10345083 3300026041 Bacteria 1328
372 Ga0207639_10418683 3300026041 Bacteria 1211
373 Ga0207678_10032160 3300026067 Bacteria 4572
374 Ga0207678_10053178 3300026067 Bacteria 3491
375 Ga0207678_10253016 3300026067 Bacteria 1509
376 Ga0207708_10409201 3300026075 Bacteria 1123
377 Ga0207708_10727809 3300026075 Bacteria 850
378 Ga0207702_10005495 3300026078 Bacteria 11083
379 Ga0207702_10092121 3300026078 Bacteria 2656
380 Ga0207702_10174308 3300026078 Bacteria 1975
381 Ga0207702_10633658 3300026078 Bacteria 1051
382 Ga0207641_10025466 3300026088 Bacteria 4879
383 Ga0207648_10059634 3300026089 Bacteria 3328
384 Ga0207676_10196235 3300026095 Bacteria 1780
385 Ga0207676_10284766 3300026095 Bacteria 1502
386 Ga0207674_10091312 3300026116 Bacteria 3035
387 Ga0207675_100110100 3300026118 Bacteria 2599
388 Ga0207675_100147251 3300026118 Bacteria 2240
389 Ga0207675_100263571 3300026118 Bacteria 1671
390 Ga0207675_101345103 3300026118 Bacteria 735
391 Ga0207675_101692571 3300026118 Bacteria 652
392 Ga0207683_10055231 3300026121 Bacteria 3483
393 Ga0207683_10138242 3300026121 Bacteria 2194
394 Ga0207683_10506705 3300026121 Bacteria 1115
395 Ga0207683_11096467 3300026121 Bacteria 739
396 Ga0207698_10120875 3300026142 Bacteria 2216
397 Ga0207698_10211220 3300026142 Bacteria 1746
398 Ga0207698_10298222 3300026142 Bacteria 1499
399 Ga0209589_1000006 3300027357 Bacteria 436292
400 Ga0209489_100007 3300027361 Bacteria 436292
401 Ga0209700_100008 3300027363 Bacteria 436292
402 Ga0209813_10042489 3300027866 Bacteria 1389
403 Ga0207428_10291146 3300027907 Bacteria 1210
404 Ga0268266_10020468 3300028379 Bacteria 5638
405 Ga0268266_10080867 3300028379 Bacteria 2831
406 Ga0268266_10300834 3300028379 Bacteria 1496
407 Ga0268266_10316897 3300028379 Bacteria 1458
408 Ga0268266_10449676 3300028379 Bacteria 1224
409 Ga0268266_10667140 3300028379 Bacteria 1001
410 Ga0268265_10131809 3300028380 Bacteria 2078
411 Ga0268264_10000038 3300028381 Bacteria 383623
412 Ga0268264_10441281 3300028381 Bacteria 1259
413 Ga0268264_10554606 3300028381 Bacteria 1127
414 Ga0268264_11287691 3300028381 Bacteria 741
415 Ga0307517_10000085 3300028786 Bacteria 131200
416 Ga0307517_10261092 3300028786 Bacteria 1006
417 Ga0307515_10011214 3300028794 Bacteria 17023
418 Ga0307511_10213126 3300030521 Bacteria 982
419 Ga0265330_10037533 3300031235 Bacteria 2156
420 Ga0265332_10011292 3300031238 Bacteria 3971
421 Ga0307513_10238049 3300031456 Bacteria 1628
422 Ga0307513_10314383 3300031456 Bacteria 1327
423 Ga0307509_10097844 3300031507 Bacteria 2981
424 Ga0307509_10345403 3300031507 Bacteria 1214
425 Ga0307509_10523554 3300031507 Bacteria 866
426 Ga0307408_101032590 3300031548 Bacteria 759
427 Ga0307508_10000034 3300031616 Bacteria 160115
428 Ga0307508_10210415 3300031616 Bacteria 1545
429 Ga0307508_10452355 3300031616 Bacteria 877
430 Ga0265314_10004394 3300031711 Bacteria 13098
431 Ga0307516_10012741 3300031730 Bacteria 9038
432 Ga0307516_10032981 3300031730 Bacteria 5214
433 Ga0307516_10065038 3300031730 Bacteria 3524
434 Ga0307516_10252513 3300031730 Bacteria 1457
435 Ga0307405_10698883 3300031731 Bacteria 839
436 Ga0307410_10233930 3300031852 Bacteria 1420
437 Ga0307406_10101760 3300031901 Bacteria 1959
438 Ga0307406_10444783 3300031901 Bacteria 1038
439 Ga0307412_10213504 3300031911 Bacteria 1474
440 Ga0307409_100054772 3300031995 Bacteria 3074
441 Ga0307414_10374532 3300032004 Bacteria 1229
442 Ga0307411_10144349 3300032005 Bacteria 1759
443 Ga0307415_100150032 3300032126 Bacteria 1793
444 Ga0307415_100854509 3300032126 Bacteria 835
445 Ga0307507_10154469 3300033179 Bacteria 1715
446 Ga0307510_10003336 3300033180 Bacteria 18711
447 Ga0307510_10066449 3300033180 Bacteria 3641
448 Ga0307510_10084996 3300033180 Bacteria 3044
449 Ga0315911_1000010 3300033442 Bacteria 322197
450 Ga0373926_0117731 3300035083 Bacteria 1000
451 Ga0373934_0018370 3300035086 Bacteria 2674
452 Ga0373934_0023403 3300035086 Bacteria 2387
453 Ga0373934_0116398 3300035086 Bacteria 1086
454 Ga0373923_0002503 3300035111 Bacteria 5676
455 Ga0373936_0005856 3300035113 Bacteria 4630
456 Ga0373936_0012112 3300035113 Bacteria 3275
457 Ga0373936_0072403 3300035113 Bacteria 1423
458 Ga0373936_0097159 3300035113 Bacteria 1240
459 Ga0373936_0168920 3300035113 Bacteria 956
460 Ga0373936_0172971 3300035113 Bacteria 945
461 Ga0373945_0162233 3300035116 Bacteria 912
462 Ga0373953_0001969 3300035117 Bacteria 6108
463 Ga0373954_0005665 3300035118 Bacteria 5414
464 Ga0373954_0084697 3300035118 Bacteria 1517
465 Ga0373956_0095529 3300035119 Bacteria 1374
466 Ga0373957_0000736 3300035120 Bacteria 8502
467 Ga0373943_0003952 3300035170 Bacteria 6748
468 Ga0373943_0059547 3300035170 Bacteria 1904
469 Ga0373943_0140225 3300035170 Bacteria 1302
470 Ga0373946_0028442 3300035171 Bacteria 2218
471 Ga0373955_0005145 3300035172 Bacteria 5849
472 Ga0373955_0054932 3300035172 Bacteria 2179
473 Ga0373955_0122066 3300035172 Bacteria 1515
474 Ga0373961_0233487 3300035241 Bacteria 660
475 Ga0373924_0049264 3300035410 Bacteria 1743
476 Ga0373924_0095738 3300035410 Bacteria 1273
477 Ga0373931_0045962 3300035691 Bacteria 2307
478 Ga0373931_0388267 3300035691 Bacteria 881
479 Ga0373935_0000757 3300035692 Bacteria 17195
480 Ga0373935_0252555 3300035692 Bacteria 1234
481 Ga0373935_1033344 3300035692 Bacteria 611
482 Ga0373927_0001989 3300035695 Bacteria 15069
483 Ga0373927_0005694 3300035695 Bacteria 8555
484 Ga0373927_0110911 3300035695 Bacteria 1787
485 Ga0373927_0366000 3300035695 Bacteria 950
486 Ga0373933_0001305 3300035724 Bacteria 14682
487 Ga0373933_0024456 3300035724 Bacteria 3458
488 Ga0373933_0069371 3300035724 Bacteria 2142
489 Ga0373933_0359702 3300035724 Bacteria 946
490 Ga0373947_0008292 3300035725 Bacteria 5987
491 Ga0373947_0010080 3300035725 Bacteria 5424
492 Ga0373947_0137760 3300035725 Bacteria 1563
493 Ga0373947_0323315 3300035725 Bacteria 1032
494 Ga0373937_0036098 3300036401 Bacteria 4503
495 Ga0373937_0047886 3300036401 Bacteria 3911
496 Ga0373937_0460668 3300036401 Bacteria 1208
497 Ga0310109_024739 3300036534 Bacteria 805
498 Ga0373925_0002155 3300037068 Bacteria 16079
499 Ga0373925_0112186 3300037068 Bacteria 2108
500 Ga0373925_0245252 3300037068 Bacteria 1436
501 Ga0395900_0277762 3300037418 Bacteria 1668
502 Ga0395905_0417554 3300037471 Bacteria 1237
503 Ga0436364_0160837 3300037853 Bacteria 2904
504 Ga0395901_0264121 3300038443 Bacteria 1791
505 Ga0436365_0207937 3300039437 Bacteria 18457
506 Ga0436365_0526074 3300039437 Bacteria 1963
507 Ga0436365_0797860 3300039437 Bacteria 2322
508 Ga0436365_1353163 3300039437 Bacteria 1631
509 Ga0436360_0124501 3300039438 Bacteria 2440
510 Ga0436360_0223651 3300039438 Bacteria 1228
511 Ga0436360_0668865 3300039438 Bacteria 2351
512 Ga0436361_0550718 3300039447 Bacteria 2128
513 Ga0436361_0619086 3300039447 Bacteria 1844
514 Ga0436361_0737425 3300039447 Bacteria 3002
515 Ga0436363_0989765 3300039450 Bacteria 714
516 Ga0436362_0051863 3300039453 Bacteria 1655
517 Ga0436362_0128483 3300039453 Bacteria 4975
518 Ga0451791_0424928 3300041451 Bacteria 1289
519 Ga0451797_1273054 3300041453 Bacteria 886
520 Ga0451802_1317356 3300041460 Bacteria 826
521 Ga0451855_1672864 3300041511 Bacteria 736
522 Ga0466969_0460354 3300044656 Bacteria 579
523 Ga0466966_0326218 3300044684 Bacteria 922
524 Ga0466966_0405775 3300044684 Bacteria 819
525 Ga0466963_0310919 3300044694 Bacteria 1109
526 Ga0466963_0632677 3300044694 Bacteria 755
527 Ga0466964_0295022 3300044706 Bacteria 815
528 Ga0466968_0101836 3300044735 Bacteria 1283
529 Ga0466970_0188141 3300044765 Bacteria 1147
530 Ga0466959_0216038 3300045049 Bacteria 1331
531 Ga0466967_0274971 3300045976 Bacteria 1615
532 Ga0495617_034968 3300046452 Bacteria 1687
533 Ga0495627_098624 3300046453 Bacteria 836
534 Ga0495592_0027847 3300046454 Bacteria 4280
535 Ga0495592_0395414 3300046454 Bacteria 876
536 Ga0495592_0464859 3300046454 Bacteria 790
537 Ga0495603_0000064 3300046455 Bacteria 46716
538 Ga0495603_0019088 3300046455 Bacteria 4150
539 Ga0495603_0033019 3300046455 Bacteria 3114
540 Ga0495603_0034710 3300046455 Bacteria 3031
541 Ga0495603_0038842 3300046455 Bacteria 2853
542 Ga0495629_0004224 3300046459 Bacteria 10777
543 Ga0495629_0043875 3300046459 Bacteria 3139
544 Ga0495629_0090717 3300046459 Bacteria 2132
545 Ga0495629_0245663 3300046459 Bacteria 1232
546 Ga0495638_0072979 3300046460 Bacteria 2095
547 Ga0495638_0220774 3300046460 Bacteria 1059
548 Ga0495641_0020444 3300046461 Bacteria 3356
549 Ga0495641_0063503 3300046461 Bacteria 1664
550 Ga0495651_0021786 3300046462 Bacteria 4982
551 Ga0495651_0109822 3300046462 Bacteria 2041
552 Ga0495653_0003792 3300046463 Bacteria 12222
553 Ga0495653_0152036 3300046463 Bacteria 1616
554 Ga0495650_0146722 3300046471 Bacteria 850
555 Ga0495580_0002461 3300046472 Bacteria 16173
556 Ga0495580_0276473 3300046472 Bacteria 1146
557 Ga0495582_0000197 3300046473 Bacteria 33437
558 Ga0495582_0060111 3300046473 Bacteria 2097
559 Ga0495605_0156289 3300046474 Bacteria 1014
560 Ga0495605_0203257 3300046474 Bacteria 862
561 Ga0495639_0000218 3300046475 Bacteria 29492
562 Ga0495639_0131118 3300046475 Bacteria 1200
563 Ga0495639_0435893 3300046475 Bacteria 665
564 Ga0495639_0495160 3300046475 Bacteria 624
565 Ga0495662_0000732 3300046476 Bacteria 15694
566 Ga0495662_0122431 3300046476 Bacteria 1277
567 Ga0495664_0009846 3300046477 Bacteria 5359
568 Ga0495664_0045608 3300046477 Bacteria 2600
569 Ga0495664_0209359 3300046477 Bacteria 1181
570 Ga0495664_0331204 3300046477 Bacteria 918
571 Ga0495584_0201231 3300046491 Bacteria 1012
572 Ga0495584_0220792 3300046491 Bacteria 963
573 Ga0495584_0227339 3300046491 Bacteria 948
574 Ga0495594_0002513 3300046499 Bacteria 9558
575 Ga0495594_0051126 3300046499 Bacteria 2274
576 Ga0495583_0121704 3300046506 Bacteria 1098
577 Ga0495606_0000976 3300046507 Bacteria 41812
578 Ga0495606_0103261 3300046507 Bacteria 1732
579 Ga0495608_0006251 3300046511 Bacteria 8454
580 Ga0495608_0151565 3300046511 Bacteria 1477
581 Ga0495610_0106976 3300046512 Bacteria 1244
582 Ga0495616_0160909 3300046513 Bacteria 1010
583 Ga0495618_0085231 3300046514 Bacteria 2019
584 Ga0495620_0183965 3300046515 Bacteria 807
585 Ga0495628_0020250 3300046516 Bacteria 5491
586 Ga0495628_0036805 3300046516 Bacteria 3925
587 Ga0495628_0086580 3300046516 Bacteria 2429
588 Ga0495628_0319043 3300046516 Bacteria 1147
589 Ga0495630_0004218 3300046517 Bacteria 10069
590 Ga0495630_0139522 3300046517 Bacteria 1843
591 Ga0495631_0064932 3300046518 Bacteria 1580
592 Ga0495632_0120324 3300046519 Bacteria 1227
593 Ga0495632_0147885 3300046519 Bacteria 1087
594 Ga0495648_0001038 3300046524 Bacteria 28176
595 Ga0495666_0066999 3300046526 Bacteria 1711
596 Ga0495666_0267223 3300046526 Bacteria 777
597 Ga0495652_0111215 3300046529 Bacteria 2203
598 Ga0495652_0122095 3300046529 Bacteria 2075
599 Ga0495652_0129640 3300046529 Bacteria 1998
600 Ga0495652_0688806 3300046529 Bacteria 689
601 Ga0495665_0000531 3300046531 Bacteria 19287
602 Ga0495665_0125401 3300046531 Bacteria 1345
603 Ga0495640_0001572 3300046533 Bacteria 17991
604 Ga0495640_0055146 3300046533 Bacteria 2719
605 Ga0495640_0059939 3300046533 Bacteria 2590
606 Ga0495640_0264149 3300046533 Bacteria 1075
607 Ga0495640_0439086 3300046533 Bacteria 798
608 Ga0495586_0341001 3300046535 Bacteria 860
609 Ga0495587_0073220 3300046536 Bacteria 1990
610 Ga0495587_0142881 3300046536 Bacteria 1365
611 Ga0495587_0357461 3300046536 Bacteria 813
612 Ga0495598_0030150 3300046537 Bacteria 1517
613 Ga0495609_0055347 3300046538 Bacteria 1760
614 Ga0495645_0066733 3300046543 Bacteria 2599
615 Ga0495645_0189922 3300046543 Bacteria 1401
616 Ga0495622_0014503 3300046557 Bacteria 3659
617 Ga0495622_0067417 3300046557 Bacteria 1653
618 Ga0495622_0137244 3300046557 Bacteria 1111
619 Ga0495667_0036833 3300046559 Bacteria 3262
620 Ga0495667_0037334 3300046559 Bacteria 3238
621 Ga0495656_0025190 3300046615 Bacteria 2356
622 Ga0495656_0047390 3300046615 Bacteria 1822
623 Ga0495656_0141490 3300046615 Bacteria 1154
624 Ga0495668_0082544 3300046616 Bacteria 1763
625 Ga0495668_0111202 3300046616 Bacteria 1498
626 Ga0495668_0216782 3300046616 Bacteria 1048
627 Ga0495668_0360483 3300046616 Bacteria 798
628 Ga0495668_0492791 3300046616 Bacteria 675
629 Ga0495634_0032723 3300046642 Bacteria 3574
630 Ga0495634_0045928 3300046642 Bacteria 2950
631 Ga0495634_0382784 3300046642 Bacteria 838
632 Ga0495611_0163675 3300046648 Bacteria 1040
633 Ga0495611_0290356 3300046648 Bacteria 754
634 Ga0495625_0185670 3300046660 Bacteria 1380
635 Ga0495625_0214035 3300046660 Bacteria 1265
636 Ga0495625_0358749 3300046660 Bacteria 919
637 Ga0495625_0368236 3300046660 Bacteria 904
638 Ga0495635_0000356 3300046663 Bacteria 29094
639 Ga0495635_0009382 3300046663 Bacteria 6840
640 Ga0495635_0308362 3300046663 Bacteria 1061
641 Ga0495635_0522968 3300046663 Bacteria 779
642 Ga0495659_0074733 3300046664 Bacteria 1275
643 Ga0495588_0005017 3300046674 Bacteria 5877
644 Ga0495588_0129229 3300046674 Bacteria 1332
645 Ga0495657_0042456 3300046675 Bacteria 3104
646 Ga0495599_0008747 3300046678 Bacteria 6165
647 Ga0495599_0142463 3300046678 Bacteria 1487
648 Ga0495623_0102188 3300046679 Bacteria 1745
649 Ga0495646_0019745 3300046680 Bacteria 4261
650 Ga0495647_0038637 3300046681 Bacteria 1805
651 Ga0495647_0231668 3300046681 Bacteria 818
652 Ga0495658_0001357 3300046683 Bacteria 12840
653 Ga0495658_0171387 3300046683 Bacteria 1343
654 Ga0495658_0309361 3300046683 Bacteria 1000
655 Ga0495658_0616318 3300046683 Bacteria 695
656 Ga0495669_0141445 3300046684 Bacteria 1136
657 Ga0495669_0322155 3300046684 Bacteria 746
658 Ga0495613_0001784 3300046689 Bacteria 16356
659 Ga0495613_0027914 3300046689 Bacteria 4202
660 Ga0495624_0003608 3300046690 Bacteria 11462
661 Ga0495624_0402922 3300046690 Bacteria 821
662 Ga0495670_0238679 3300046691 Bacteria 967
663 Ga0495671_0031809 3300046692 Bacteria 2696
664 Ga0495671_0204737 3300046692 Bacteria 957
665 Ga0495589_0093356 3300046794 Bacteria 1461
666 Ga0495600_0028015 3300046809 Bacteria 3643
667 Ga0495581_0001121 3300047315 Bacteria 14654
668 Ga0495604_0024387 3300047317 Bacteria 4825
669 Ga0495604_0365405 3300047317 Bacteria 956
670 Ga0495636_0060684 3300047318 Bacteria 1598
671 Ga0495636_0394425 3300047318 Bacteria 658
672 Ga0495674_0000910 3300047319 Bacteria 28292
673 Ga0495674_0023623 3300047319 Bacteria 5662
674 Ga0495674_0312652 3300047319 Bacteria 1281
675 Ga0495672_0033942 3300047320 Bacteria 3157
676 Ga0495672_0194269 3300047320 Bacteria 1018
677 Ga0495680_0054687 3300047322 Bacteria 3098
678 Ga0495680_0058904 3300047322 Bacteria 2966
679 Ga0495680_0144985 3300047322 Bacteria 1735
680 Ga0495675_0009561 3300047444 Bacteria 6038
681 Ga0495675_0060330 3300047444 Bacteria 2404
682 Ga0495677_0034533 3300047445 Bacteria 1845
683 Ga0495677_0080280 3300047445 Bacteria 1222
684 Ga0495677_0145479 3300047445 Bacteria 911
685 Ga0495685_059848 3300047447 Bacteria 1285
686 Ga0495685_149195 3300047447 Bacteria 760
687 Ga0495673_0038103 3300047469 Bacteria 2190
688 Ga0495673_0094597 3300047469 Bacteria 1216
689 Ga0495681_0103225 3300047470 Bacteria 1244
690 Ga0495684_0001020 3300047471 Bacteria 22754
691 Ga0495684_0383689 3300047471 Bacteria 990
692 Ga0495593_0000053 3300047673 Bacteria 47697
693 Ga0495593_0007888 3300047673 Bacteria 6199
694 Ga0495593_0242344 3300047673 Bacteria 903
695 Ga0495602_0077062 3300048088 Bacteria 2822
696 Ga0495614_0180337 3300048089 Bacteria 950
697 Ga0495614_0203854 3300048089 Bacteria 896
698 Ga0496100_0060633 3300048903 Bacteria 2490
699 Ga0496100_0148326 3300048903 Bacteria 1670
700 Ga0496101_0090913 3300048904 Bacteria 2271
701 Ga0496102_0625952 3300048905 Bacteria 999
702 Ga0496102_0626103 3300048905 Bacteria 999
703 Ga0496102_0702912 3300048905 Bacteria 934
704 Ga0496102_0925518 3300048905 Bacteria 793
705 Ga0496102_0940500 3300048905 Bacteria 785
706 Ga0496103_0220729 3300048906 Bacteria 1219
707 Ga0496103_0255405 3300048906 Bacteria 1128
708 Ga0496103_0306827 3300048906 Bacteria 1021
709 Ga0496104_0368281 3300048907 Bacteria 1349
710 Ga0496104_0424482 3300048907 Bacteria 1241
711 Ga0496104_0677574 3300048907 Bacteria 939
712 Ga0496105_0057058 3300048908 Bacteria 3224
713 Ga0496105_0415518 3300048908 Bacteria 1066
714 Ga0496105_0495984 3300048908 Bacteria 959
715 Ga0496106_0050763 3300048909 Bacteria 3126
716 Ga0496106_0054025 3300048909 Bacteria 3034
717 Ga0496106_0280571 3300048909 Bacteria 1335
718 Ga0496106_0349821 3300048909 Bacteria 1187
719 Ga0496106_0801556 3300048909 Bacteria 747
720 Ga0496107_0108637 3300048910 Bacteria 2037
721 Ga0496107_0369921 3300048910 Bacteria 1066
722 Ga0496107_0966489 3300048910 Bacteria 619
723 Ga0496108_0043253 3300048911 Bacteria 3763
724 Ga0496108_0634035 3300048911 Bacteria 930
725 Ga0496108_0786655 3300048911 Bacteria 821
726 Ga0496109_0052114 3300048912 Bacteria 3729
727 Ga0496109_0368697 3300048912 Bacteria 1356
728 Ga0496109_1271712 3300048912 Bacteria 672
729 Ga0496110_0425738 3300048913 Bacteria 1210
730 Ga0496110_0439236 3300048913 Bacteria 1189
731 Ga0496110_0563044 3300048913 Bacteria 1035
732 Ga0496111_0254025 3300048914 Bacteria 1304
733 Ga0496111_0672150 3300048914 Bacteria 755
734 Ga0496112_0000008 3300048915 Bacteria 310323
735 Ga0496112_0017278 3300048915 Bacteria 6774
736 Ga0496112_0552225 3300048915 Bacteria 1085
737 Ga0496112_0921247 3300048915 Bacteria 795
738 Ga0496113_0108920 3300048916 Bacteria 2154
739 Ga0496113_0118535 3300048916 Bacteria 2067
740 Ga0496113_0346479 3300048916 Bacteria 1191
741 Ga0496114_0036626 3300048917 Bacteria 4055
742 Ga0496115_0047118 3300048918 Bacteria 3446
743 Ga0496115_0054879 3300048918 Bacteria 3200
744 Ga0496117_0025346 3300048920 Bacteria 4665
745 Ga0496117_0224367 3300048920 Bacteria 1043
746 Ga0496118_0018656 3300048921 Bacteria 6238
747 Ga0496118_0137994 3300048921 Bacteria 1552
748 Ga0496118_0179292 3300048921 Bacteria 1282
749 Ga0496118_0220837 3300048921 Bacteria 1103
750 Ga0496118_0383114 3300048921 Bacteria 737
751 Ga0496119_0052904 3300048922 Bacteria 2484
752 Ga0496119_0088159 3300048922 Bacteria 1770
753 Ga0496120_0163118 3300048923 Bacteria 1109
754 Ga0496121_0000178 3300048924 Bacteria 141429
755 Ga0496121_0000381 3300048924 Bacteria 90593
756 Ga0496121_0001606 3300048924 Bacteria 37522
757 Ga0496121_0065155 3300048924 Bacteria 2966
758 Ga0496121_0074199 3300048924 Bacteria 2723
759 Ga0496121_0094181 3300048924 Bacteria 2331
760 Ga0496121_0122575 3300048924 Bacteria 1960
761 Ga0496121_0144549 3300048924 Bacteria 1759
762 Ga0496121_0251455 3300048924 Bacteria 1225
763 Ga0496121_0438888 3300048924 Bacteria 844
764 Ga0496121_0448240 3300048924 Bacteria 832
765 Ga0496121_0455858 3300048924 Bacteria 823
766 Ga0496123_0311933 3300048926 Bacteria 746
767 Ga0496124_0057960 3300048927 Bacteria 3260
768 Ga0496124_0227694 3300048927 Bacteria 1396
769 Ga0496125_0172081 3300048928 Bacteria 1454
770 Ga0496126_0072513 3300048929 Bacteria 3063
771 Ga0496126_0135415 3300048929 Bacteria 2125
772 Ga0496126_0145644 3300048929 Bacteria 2034
773 Ga0496126_0169885 3300048929 Bacteria 1858
774 Ga0496126_0180012 3300048929 Bacteria 1796
775 Ga0496126_0218646 3300048929 Bacteria 1601
776 Ga0496126_0507847 3300048929 Bacteria 962
777 Ga0496126_0512153 3300048929 Bacteria 957
778 Ga0495678_169183 3300049459 Bacteria 693
779 Ga0495682_0207520 3300049460 Bacteria 694
780 Ga0501033_0058655 3300049570 Bacteria 2843
781 Ga0501034_0907848 3300049571 Bacteria 768
782 Ga0501036_0658356 3300049572 Bacteria 867
783 Ga0501039_0800798 3300049575 Bacteria 735
784 Ga0501043_0062269 3300049579 Bacteria 2929
785 Ga0501046_0116454 3300049580 Bacteria 2037
786 Ga0501070_0071621 3300049586 Bacteria 2870
787 Ga0501073_0282758 3300049589 Bacteria 1145
788 Ga0501075_0940531 3300049591 Bacteria 657
789 Ga0501076_0942825 3300049592 Bacteria 711
790 Ga0501035_0205489 3300049822 Bacteria 1687
791 Ga0501044_0056597 3300049823 Bacteria 4026
792 Ga0501044_0433402 3300049823 Bacteria 1223
793 nmdc:mga03683_190444_c1 3300050489 Bacteria 938
794 nmdc:mga03683_26098_c1 3300050489 Bacteria 2302
795 nmdc:mga03n38_77539_c1 3300050490 Bacteria 1553
796 nmdc:mga00v17_150838_c1 3300050491 Bacteria 1494
797 nmdc:mga00v17_464079_c1 3300050491 Bacteria 822
798 nmdc:mga00v17_651583_c1 3300050491 Bacteria 677
799 nmdc:mga0yw44_28665_c1 3300050492 Bacteria 3206
800 nmdc:mga0yw44_95359_c1 3300050492 Bacteria 1887
801 nmdc:mga0k408_192270_c1 3300050493 Bacteria 1218
802 nmdc:mga0k408_199632_c1 3300050493 Bacteria 1194
803 nmdc:mga0k408_302495_c1 3300050493 Bacteria 955
804 nmdc:mga0k408_562543_c1 3300050493 Bacteria 674
805 nmdc:mga06z11_180894_c1 3300050494 Bacteria 1216
806 nmdc:mga06z11_26727_c1 3300050494 Bacteria 2750
807 nmdc:mga04h51_50942_c1 3300050495 Bacteria 1389
808 nmdc:mga07m45_134023_c1 3300050496 Bacteria 1434
809 nmdc:mga07m45_40462_c1 3300050496 Bacteria 2608
810 nmdc:mga07m45_40483_c1 3300050496 Bacteria 2607
811 nmdc:mga07m45_496790_c1 3300050496 Bacteria 706
812 nmdc:mga07m45_536427_c1 3300050496 Bacteria 677
813 nmdc:mga05p37_284592_c1 3300050507 Bacteria 1970
814 nmdc:mga09592_1025960_c1 3300050508 Bacteria 688
815 nmdc:mga0qj67_179462_c1 3300050509 Bacteria 1719
816 nmdc:mga08y16_82751_c1 3300050511 Bacteria 3346
817 nmdc:mga0n895_730985_c1 3300050512 Bacteria 984
818 nmdc:mga0rr50_219099_c1 3300050513 Bacteria 1571
819 nmdc:mga0sz30_65860_c1 3300050516 Bacteria 1554
820 Ga0495601_0085617 3300053077 Bacteria 2025
821 Ga0495601_0231351 3300053077 Bacteria 1207
822 Ga0500635_0016572 3300053080 Bacteria 2194
823 Ga0500635_0049093 3300053080 Bacteria 1439
824 Ga0500635_0268516 3300053080 Bacteria 671
825 Ga0495655_0027175 3300053083 Bacteria 1355
826 Ga0495655_0066725 3300053083 Bacteria 996
827 Ga0495655_0116550 3300053083 Bacteria 809
828 Ga0495595_0006351 3300053084 Bacteria 4815
829 Ga0495595_0120918 3300053084 Bacteria 1275
830 Ga0495619_0004452 3300053085 Bacteria 8941
831 Ga0495619_0024318 3300053085 Bacteria 3884
832 Ga0500643_079256 3300053087 Bacteria 904
833 Ga0500651_0030081 3300053093 Bacteria 3415
834 Ga0500651_0226076 3300053093 Bacteria 1096
835 Ga0500651_0424996 3300053093 Bacteria 743
836 Ga0500566_0000008 3300053094 Bacteria 143641
837 Ga0500566_0042489 3300053094 Bacteria 2622
838 Ga0500566_0151274 3300053094 Bacteria 1220
839 Ga0500640_005945 3300053095 Bacteria 4612
840 Ga0500641_0017543 3300053096 Bacteria 2679
841 Ga0500641_0019512 3300053096 Bacteria 2564
842 Ga0500641_0055829 3300053096 Bacteria 1635
843 Ga0500650_0363481 3300053098 Bacteria 631
844 Ga0500554_016759 3300053102 Bacteria 1944
845 Ga0500556_0035598 3300053104 Bacteria 1721
846 Ga0500572_001569 3300053111 Bacteria 6087
847 Ga0500572_002289 3300053111 Bacteria 4637
848 Ga0500591_110620 3300053115 Bacteria 1152
849 Ga0500594_0042046 3300053118 Bacteria 1254
850 Ga0500595_001022 3300053119 Bacteria 15703
851 Ga0500595_001796 3300053119 Bacteria 11140
852 Ga0500595_022869 3300053119 Bacteria 2204
853 Ga0500595_129974 3300053119 Bacteria 709
854 Ga0500597_217313 3300053120 Bacteria 796
855 Ga0500608_013208 3300053122 Bacteria 3653
856 Ga0500642_0009310 3300053130 Bacteria 3404
857 Ga0500655_034038 3300053133 Bacteria 987
858 Ga0500559_0001443 3300053136 Bacteria 13494
859 Ga0500559_0002991 3300053136 Bacteria 8472
860 Ga0500559_0170543 3300053136 Bacteria 1023
861 Ga0500561_0088660 3300053137 Bacteria 912
862 Ga0500577_0045825 3300053142 Bacteria 1618
863 Ga0500588_0076954 3300053146 Bacteria 1108
864 Ga0500588_0283379 3300053146 Bacteria 626
865 Ga0500589_052332 3300053147 Bacteria 1891
866 Ga0500589_136364 3300053147 Bacteria 1018
867 Ga0500590_062564 3300053148 Bacteria 1867
868 Ga0500603_001477 3300053150 Bacteria 5364
869 Ga0500603_001591 3300053150 Bacteria 5129
870 Ga0500603_126041 3300053150 Bacteria 779
871 Ga0500616_0227389 3300053153 Bacteria 810
872 Ga0500627_0197623 3300053158 Bacteria 902
873 Ga0500630_032400 3300053159 Bacteria 2566
874 Ga0500638_000896 3300053162 Bacteria 8428
875 Ga0500638_127630 3300053162 Bacteria 1157
876 Ga0500639_000010 3300053163 Bacteria 136747
877 Ga0500639_011164 3300053163 Bacteria 4712
878 Ga0500639_096015 3300053163 Bacteria 1468
879 Ga0500636_0194460 3300053177 Bacteria 1078
880 Ga0500636_0328676 3300053177 Bacteria 739
881 Ga0500637_0041226 3300053178 Bacteria 2609
882 Ga0500637_0068610 3300053178 Bacteria 2037
883 Ga0500637_0306450 3300053178 Bacteria 863
884 Ga0500576_038374 3300053725 Bacteria 2162
885 Ga0500596_001566 3300053735 Bacteria 4640
886 Ga0500596_001917 3300053735 Bacteria 4173
887 Ga0500661_001842 3300055283 Bacteria 4003

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8019687851 8019693989 141
2 3300005330 Ga0070690_100647479 Ga0070690_1006474791 147
3 3300009553 Ga0105249_11378852 Ga0105249_113788521 147
4 3300053083 Ga0495655_0116550 Ga0495655_0116550_272_799 153
5 3300035116 Ga0373945_0162233 Ga0373945_0162233_22_549 155
6 3300035695 Ga0373927_0110911 Ga0373927_0110911_27_554 155
7 3300044656 Ga0466969_0460354 Ga0466969_0460354_14_544 155
8 3300044706 Ga0466964_0295022 Ga0466964_0295022_17_547 155
9 3300046536 Ga0495587_0142881 Ga0495587_0142881_821_1348 155
10 3300046663 Ga0495635_0308362 Ga0495635_0308362_512_1039 155
11 3300047447 Ga0495685_149195 Ga0495685_149195_17_544 155
12 3300048910 Ga0496107_0966489 Ga0496107_0966489_14_541 155
13 3300048913 Ga0496110_0425738 Ga0496110_0425738_11_538 155
14 3300048929 Ga0496126_0512153 Ga0496126_0512153_17_544 155
15 3300049592 Ga0501076_0942825 Ga0501076_0942825_166_693 155
16 3300053120 Ga0500597_217313 Ga0500597_217313_15_542 155
17 3300053136 Ga0500559_0170543 Ga0500559_0170543_468_995 155
18 3300053162 Ga0500638_127630 Ga0500638_127630_10_537 155
19 3300005365 Ga0070688_100172809 Ga0070688_1001728091 162
20 3300005367 Ga0070667_101255141 Ga0070667_1012551411 162
21 3300005436 Ga0070713_100835486 Ga0070713_1008354861 162
22 3300005544 Ga0070686_100356428 Ga0070686_1003564282 162
23 3300005578 Ga0068854_101195812 Ga0068854_1011958121 162
24 3300005616 Ga0068852_100757318 Ga0068852_1007573182 162
25 3300006237 Ga0097621_100273661 Ga0097621_1002736612 162
26 3300006358 Ga0068871_100267565 Ga0068871_1002675652 162
27 3300009098 Ga0105245_10801445 Ga0105245_108014452 162
28 3300009101 Ga0105247_10206883 Ga0105247_102068831 162
29 3300009176 Ga0105242_10707278 Ga0105242_107072782 162
30 3300009177 Ga0105248_10498772 Ga0105248_104987722 162
31 3300009545 Ga0105237_10770205 Ga0105237_107702051 162
32 3300010375 Ga0105239_10165019 Ga0105239_101650192 162
33 3300025315 Ga0207697_10261027 Ga0207697_102610271 162
34 3300025900 Ga0207710_10135880 Ga0207710_101358802 162
35 3300025927 Ga0207687_10749336 Ga0207687_107493361 162
36 3300025934 Ga0207686_10905074 Ga0207686_109050742 162
37 3300025986 Ga0207658_10511636 Ga0207658_105116361 162
38 3300026041 Ga0207639_10418683 Ga0207639_104186832 162
39 3300026142 Ga0207698_10120875 Ga0207698_101208753 162
40 3300035691 Ga0373931_0388267 Ga0373931_0388267_209_811 162
41 3300048903 Ga0496100_0060633 Ga0496100_0060633_18_620 162
42 3300048905 Ga0496102_0940500 Ga0496102_0940500_134_736 162
43 3300048906 Ga0496103_0220729 Ga0496103_0220729_94_696 162
44 3300048908 Ga0496105_0057058 Ga0496105_0057058_635_1237 162
45 3300048909 Ga0496106_0050763 Ga0496106_0050763_1812_2414 162
46 3300048910 Ga0496107_0108637 Ga0496107_0108637_1184_1786 162
47 3300048911 Ga0496108_0786655 Ga0496108_0786655_94_696 162
48 3300048912 Ga0496109_0052114 Ga0496109_0052114_2282_2884 162
49 3300048913 Ga0496110_0439236 Ga0496110_0439236_320_922 162
50 3300048915 Ga0496112_0921247 Ga0496112_0921247_104_706 162
51 3300048917 Ga0496114_0036626 Ga0496114_0036626_632_1234 162
52 3300048918 Ga0496115_0047118 Ga0496115_0047118_668_1270 162
53 3300006038 Ga0075365_10479718 Ga0075365_104797181 164
54 3300053094 Ga0500566_0042489 Ga0500566_0042489_1233_1850 164
55 3300053119 Ga0500595_001796 Ga0500595_001796_6787_7434 164
56 3300053162 Ga0500638_000896 Ga0500638_000896_5895_6542 164
57 3300053178 Ga0500637_0041226 Ga0500637_0041226_1044_1661 164
58 3300055283 Ga0500661_001842 Ga0500661_001842_2523_3140 164
59 3300007788 Ga0099795_10032744 Ga0099795_100327442 165
60 3300013306 Ga0163162_10561879 Ga0163162_105618792 165
61 3300035692 Ga0373935_1033344 Ga0373935_1033344_44_601 165
62 3300041511 Ga0451855_1672864 Ga0451855_1672864_165_722 165
63 3300046475 Ga0495639_0495160 Ga0495639_0495160_55_612 165
64 3300046529 Ga0495652_0122095 Ga0495652_0122095_1504_2061 165
65 3300046531 Ga0495665_0125401 Ga0495665_0125401_10_567 165
66 3300046533 Ga0495640_0264149 Ga0495640_0264149_271_873 165
67 3300046616 Ga0495668_0216782 Ga0495668_0216782_26_583 165
68 3300046678 Ga0495599_0008747 Ga0495599_0008747_5594_6151 165
69 3300048089 Ga0495614_0203854 Ga0495614_0203854_263_865 165
70 3300053084 Ga0495595_0120918 Ga0495595_0120918_695_1252 165
71 3300003203 JGI25406J46586_10008215 JGI25406J46586_100082153 167
72 3300003203 JGI25406J46586_10017054 JGI25406J46586_100170544 167
73 3300005985 Ga0081539_10001829 Ga0081539_100018294 167
74 3300005614 Ga0068856_100002538 Ga0068856_1000025384 170
75 3300026078 Ga0207702_10005495 Ga0207702_100054955 170
76 3300046471 Ga0495650_0146722 Ga0495650_0146722_263_835 170
77 3300046474 Ga0495605_0156289 Ga0495605_0156289_428_1000 170
78 3300046474 Ga0495605_0203257 Ga0495605_0203257_273_845 170
79 3300046681 Ga0495647_0231668 Ga0495647_0231668_230_802 170
80 3300048905 Ga0496102_0925518 Ga0496102_0925518_15_587 170
81 3300053080 Ga0500635_0268516 Ga0500635_0268516_19_621 170
82 3300053146 Ga0500588_0283379 Ga0500588_0283379_14_586 170
83 3300025735 Ga0207713_1148801 Ga0207713_11488011 171
84 3300035113 Ga0373936_0097159 Ga0373936_0097159_530_1132 171
85 3300048909 Ga0496106_0280571 Ga0496106_0280571_577_1179 171
86 3300003354 JGI25160J50197_1029660 JGI25160J50197_10296602 172
87 3300005262 Ga0065165_1009382 Ga0065165_10093822 172
88 3300025302 Ga0207426_1015827 Ga0207426_10158272 172
89 3300033180 Ga0307510_10084996 Ga0307510_100849962 172
90 3300046455 Ga0495603_0033019 Ga0495603_0033019_297_899 172
91 3300053080 Ga0500635_0049093 Ga0500635_0049093_685_1287 172
92 3300053102 Ga0500554_016759 Ga0500554_016759_574_1176 172
93 3300053150 Ga0500603_001591 Ga0500603_001591_3909_4511 172
94 3300053178 Ga0500637_0068610 Ga0500637_0068610_909_1511 172
95 3300035724 Ga0373933_0001305 Ga0373933_0001305_9197_9799 173
96 3300025254 Ga0209148_1015784 Ga0209148_10157842 175
97 3300025261 Ga0209233_1009366 Ga0209233_10093665 175
98 3300025272 Ga0209455_1007059 Ga0209455_10070594 175
99 3300037853 Ga0436364_0160837 Ga0436364_0160837_1396_1998 175
100 3300039437 Ga0436365_0797860 Ga0436365_0797860_253_855 175
101 3300048922 Ga0496119_0052904 Ga0496119_0052904_988_1590 175
102 iso_pu_bacteria 2513237098 2513671135 175
103 iso_pu_bacteria 2513237101 2513697349 175
104 iso_pu_bacteria 2524023210 2524464004 175
105 iso_pu_bacteria 2721755755 2723843155 175
106 iso_pu_bacteria 2874604998 2874612513 175
107 iso_pu_bacteria 2885383462 2885389047 175
108 iso_pu_bacteria 2903768456 2903773578 175
109 iso_pu_bacteria 8006984368 8006989279 175
110 iso_pu_bacteria 8006994254 8006997756 175
111 iso_pu_bacteria 2508501128 2509147153 176
112 iso_pu_bacteria 2513237096 2513654945 176
113 iso_pu_bacteria 2513237137 2513861259 176
114 iso_pu_bacteria 2513237145 2513916032 176
115 iso_pu_bacteria 2517572143 2517894664 176
116 iso_pu_bacteria 2524023228 2524534404 176
117 iso_pu_bacteria 2667528175 2671119086 176
118 iso_pu_bacteria 2728368998 2728747677 176
119 iso_pu_bacteria 2791355197 2793071134 176
120 iso_pu_bacteria 2824617872 2824618957 176
121 iso_pu_bacteria 2824626560 2824627523 176
122 iso_pu_bacteria 2824635225 2824638848 176
123 iso_pu_bacteria 2824644064 2824647650 176
124 iso_pu_bacteria 2824714736 2824716461 176
125 iso_pu_bacteria 2824723954 2824726407 176
126 iso_pu_bacteria 2885374607 2885382418 176
127 iso_pu_bacteria 2903748898 2903757852 176
128 iso_pu_bacteria 2904690495 2904697002 176
129 iso_pu_bacteria 2904699407 2904705697 176
130 iso_pu_bacteria 2906610324 2906611391 176
131 iso_pu_bacteria 2906635258 2906641571 176
132 iso_pu_bacteria 2906660503 2906661275 176
133 iso_pu_bacteria 2908739725 2908744977 176
134 iso_pu_bacteria 2908756301 2908762730 176
135 iso_pu_bacteria 2922425934 2922427977 176
136 iso_pu_bacteria 2935630451 2935632105 176
137 iso_pu_bacteria 2941507105 2941508053 176
138 iso_pu_bacteria 2941515067 2941515442 176
139 iso_pu_bacteria 2941523033 2941523983 176
140 iso_pu_bacteria 3005474847 3005477684 176
141 iso_pu_bacteria 8006933436 8006933534 176
142 iso_pu_bacteria 8006973647 8006983207 176
143 iso_pu_bacteria 8019555841 8019559458 176
144 iso_pu_bacteria 8019565922 8019569560 176
145 iso_pu_bacteria 8056689827 8056695092 176
146 3300037471 Ga0395905_0417554 Ga0395905_0417554_473_1087 177
147 3300005434 Ga0070709_10001764 Ga0070709_1000176411 178
148 3300005435 Ga0070714_100051653 Ga0070714_1000516532 178
149 3300005436 Ga0070713_100211833 Ga0070713_1002118332 178
150 3300005437 Ga0070710_10001695 Ga0070710_1000169512 178
151 3300005439 Ga0070711_100020703 Ga0070711_1000207036 178
152 3300005458 Ga0070681_10463553 Ga0070681_104635532 178
153 3300006173 Ga0070716_100019284 Ga0070716_1000192845 178
154 3300006175 Ga0070712_100573429 Ga0070712_1005734291 178
155 3300009093 Ga0105240_10036581 Ga0105240_100365816 178
156 3300009101 Ga0105247_10420080 Ga0105247_104200801 178
157 3300009177 Ga0105248_11700760 Ga0105248_117007602 178
158 3300009545 Ga0105237_10885744 Ga0105237_108857441 178
159 3300025898 Ga0207692_10008094 Ga0207692_100080942 178
160 3300025900 Ga0207710_10274996 Ga0207710_102749961 178
161 3300025906 Ga0207699_10014446 Ga0207699_100144461 178
162 3300025915 Ga0207693_10097945 Ga0207693_100979451 178
163 3300025915 Ga0207693_10162362 Ga0207693_101623622 178
164 3300025916 Ga0207663_10414156 Ga0207663_104141561 178
165 3300025924 Ga0207694_10586258 Ga0207694_105862582 178
166 3300025928 Ga0207700_10005365 Ga0207700_100053654 178
167 3300025929 Ga0207664_10048347 Ga0207664_100483472 178
168 3300039437 Ga0436365_0207937 Ga0436365_0207937_362_961 178
169 3300039453 Ga0436362_0128483 Ga0436362_0128483_75_674 178
170 3300005339 Ga0070660_100884856 Ga0070660_1008848561 179
171 3300005434 Ga0070709_10153975 Ga0070709_101539752 179
172 3300005435 Ga0070714_100547529 Ga0070714_1005475292 179
173 3300005436 Ga0070713_100378511 Ga0070713_1003785112 179
174 3300005445 Ga0070708_101169909 Ga0070708_1011699091 179
175 3300005455 Ga0070663_100685201 Ga0070663_1006852011 179
176 3300005614 Ga0068856_100289594 Ga0068856_1002895942 179
177 3300021358 Ga0213873_10035460 Ga0213873_100354601 179
178 3300021361 Ga0213872_10194607 Ga0213872_101946072 179
179 3300021384 Ga0213876_10096501 Ga0213876_100965011 179
180 3300021384 Ga0213876_10367531 Ga0213876_103675312 179
181 3300021441 Ga0213871_10005944 Ga0213871_100059442 179
182 3300025928 Ga0207700_10324013 Ga0207700_103240132 179
183 3300025929 Ga0207664_10039186 Ga0207664_100391863 179
184 3300026078 Ga0207702_10174308 Ga0207702_101743083 179
185 3300031507 Ga0307509_10097844 Ga0307509_100978442 179
186 3300031548 Ga0307408_101032590 Ga0307408_1010325902 179
187 3300031616 Ga0307508_10452355 Ga0307508_104523551 179
188 3300035695 Ga0373927_0001989 Ga0373927_0001989_11092_11691 179
189 3300035725 Ga0373947_0010080 Ga0373947_0010080_1688_2287 179
190 3300037418 Ga0395900_0277762 Ga0395900_0277762_454_1053 179
191 3300038443 Ga0395901_0264121 Ga0395901_0264121_508_1107 179
192 3300039437 Ga0436365_0526074 Ga0436365_0526074_342_941 179
193 3300039437 Ga0436365_1353163 Ga0436365_1353163_25_624 179
194 3300039438 Ga0436360_0124501 Ga0436360_0124501_539_1138 179
195 3300039438 Ga0436360_0223651 Ga0436360_0223651_586_1185 179
196 3300039447 Ga0436361_0550718 Ga0436361_0550718_453_1052 179
197 3300039447 Ga0436361_0619086 Ga0436361_0619086_464_1063 179
198 3300039447 Ga0436361_0737425 Ga0436361_0737425_28_627 179
199 3300039450 Ga0436363_0989765 Ga0436363_0989765_42_641 179
200 3300039453 Ga0436362_0051863 Ga0436362_0051863_276_875 179
201 3300044735 Ga0466968_0101836 Ga0466968_0101836_72_671 179
202 3300046455 Ga0495603_0019088 Ga0495603_0019088_180_779 179
203 3300046475 Ga0495639_0131118 Ga0495639_0131118_294_896 179
204 3300046524 Ga0495648_0001038 Ga0495648_0001038_24605_25210 179
205 3300046526 Ga0495666_0267223 Ga0495666_0267223_154_753 179
206 3300046683 Ga0495658_0309361 Ga0495658_0309361_104_703 179
207 3300048921 Ga0496118_0179292 Ga0496118_0179292_12_626 179
208 3300048923 Ga0496120_0163118 Ga0496120_0163118_301_921 179
209 3300048924 Ga0496121_0001606 Ga0496121_0001606_32312_32932 179
210 3300048926 Ga0496123_0311933 Ga0496123_0311933_16_633 179
211 3300048929 Ga0496126_0135415 Ga0496126_0135415_696_1310 179
212 3300048929 Ga0496126_0169885 Ga0496126_0169885_54_671 179
213 3300053093 Ga0500651_0030081 Ga0500651_0030081_2008_2610 179
214 3300053118 Ga0500594_0042046 Ga0500594_0042046_594_1196 179
215 3300053119 Ga0500595_001022 Ga0500595_001022_6409_7029 179
216 3300053119 Ga0500595_022869 Ga0500595_022869_952_1566 179
217 3300053130 Ga0500642_0009310 Ga0500642_0009310_811_1413 179
218 3300053146 Ga0500588_0076954 Ga0500588_0076954_496_1098 179
219 3300053158 Ga0500627_0197623 Ga0500627_0197623_13_627 179
220 3300001989 JGI24739J22299_10012951 JGI24739J22299_100129514 180
221 3300001990 JGI24737J22298_10016177 JGI24737J22298_100161772 180
222 3300002067 JGI24735J21928_10016953 JGI24735J21928_100169532 180
223 3300002244 JGI24742J22300_10012308 JGI24742J22300_100123082 180
224 3300003203 JGI25406J46586_10000721 JGI25406J46586_1000072112 180
225 3300003215 JGI25153J46596_10000738 JGI25153J46596_1000073820 180
226 3300003320 rootH2_10077708 rootH2_100777081 180
227 3300003659 JGI25404J52841_10015813 JGI25404J52841_100158132 180
228 3300003659 JGI25404J52841_10047108 JGI25404J52841_100471081 180
229 3300003911 JGI25405J52794_10061750 JGI25405J52794_100617502 180
230 3300005327 Ga0070658_10562246 Ga0070658_105622461 180
231 3300005328 Ga0070676_10212565 Ga0070676_102125651 180
232 3300005328 Ga0070676_10212565 Ga0070676_102125652 180
233 3300005329 Ga0070683_100017126 Ga0070683_1000171264 180
234 3300005329 Ga0070683_100521531 Ga0070683_1005215312 180
235 3300005334 Ga0068869_100064859 Ga0068869_1000648591 180
236 3300005334 Ga0068869_100064859 Ga0068869_1000648592 180
237 3300005334 Ga0068869_100381851 Ga0068869_1003818512 180
238 3300005336 Ga0070680_100061117 Ga0070680_1000611173 180
239 3300005338 Ga0068868_100130295 Ga0068868_1001302952 180
240 3300005338 Ga0068868_100137064 Ga0068868_1001370641 180
241 3300005338 Ga0068868_100747279 Ga0068868_1007472792 180
242 3300005340 Ga0070689_100504881 Ga0070689_1005048812 180
243 3300005341 Ga0070691_10055133 Ga0070691_100551332 180
244 3300005343 Ga0070687_100189376 Ga0070687_1001893762 180
245 3300005344 Ga0070661_100205620 Ga0070661_1002056202 180
246 3300005347 Ga0070668_100050535 Ga0070668_1000505353 180
247 3300005347 Ga0070668_100152569 Ga0070668_1001525692 180
248 3300005353 Ga0070669_100236187 Ga0070669_1002361872 180
249 3300005355 Ga0070671_100160005 Ga0070671_1001600053 180
250 3300005355 Ga0070671_100501845 Ga0070671_1005018451 180
251 3300005356 Ga0070674_100062001 Ga0070674_1000620012 180
252 3300005365 Ga0070688_100109774 Ga0070688_1001097742 180
253 3300005366 Ga0070659_100251243 Ga0070659_1002512432 180
254 3300005366 Ga0070659_100383741 Ga0070659_1003837412 180
255 3300005366 Ga0070659_100668052 Ga0070659_1006680521 180
256 3300005406 Ga0070703_10198342 Ga0070703_101983421 180
257 3300005436 Ga0070713_100061144 Ga0070713_1000611441 180
258 3300005436 Ga0070713_100228238 Ga0070713_1002282382 180
259 3300005437 Ga0070710_10527186 Ga0070710_105271861 180
260 3300005439 Ga0070711_100044852 Ga0070711_1000448523 180
261 3300005439 Ga0070711_100712389 Ga0070711_1007123892 180
262 3300005439 Ga0070711_100773988 Ga0070711_1007739881 180
263 3300005455 Ga0070663_100018549 Ga0070663_1000185492 180
264 3300005455 Ga0070663_100053867 Ga0070663_1000538674 180
265 3300005456 Ga0070678_100198168 Ga0070678_1001981681 180
266 3300005456 Ga0070678_100371820 Ga0070678_1003718202 180
267 3300005456 Ga0070678_100383583 Ga0070678_1003835831 180
268 3300005457 Ga0070662_100050768 Ga0070662_1000507682 180
269 3300005457 Ga0070662_100190683 Ga0070662_1001906832 180
270 3300005457 Ga0070662_100483100 Ga0070662_1004831002 180
271 3300005459 Ga0068867_100111788 Ga0068867_1001117882 180
272 3300005459 Ga0068867_100349335 Ga0068867_1003493352 180
273 3300005467 Ga0070706_100129052 Ga0070706_1001290521 180
274 3300005467 Ga0070706_100260542 Ga0070706_1002605422 180
275 3300005468 Ga0070707_100119818 Ga0070707_1001198182 180
276 3300005471 Ga0070698_100197239 Ga0070698_1001972392 180
277 3300005471 Ga0070698_100617451 Ga0070698_1006174512 180
278 3300005536 Ga0070697_100238054 Ga0070697_1002380541 180
279 3300005539 Ga0068853_100097793 Ga0068853_1000977933 180
280 3300005539 Ga0068853_100262428 Ga0068853_1002624282 180
281 3300005539 Ga0068853_101018183 Ga0068853_1010181832 180
282 3300005543 Ga0070672_100109452 Ga0070672_1001094523 180
283 3300005543 Ga0070672_100154769 Ga0070672_1001547691 180
284 3300005545 Ga0070695_100094980 Ga0070695_1000949802 180
285 3300005545 Ga0070695_100094980 Ga0070695_1000949803 180
286 3300005545 Ga0070695_100542236 Ga0070695_1005422361 180
287 3300005546 Ga0070696_100473956 Ga0070696_1004739562 180
288 3300005548 Ga0070665_100088043 Ga0070665_1000880432 180
289 3300005548 Ga0070665_100174517 Ga0070665_1001745172 180
290 3300005548 Ga0070665_100701082 Ga0070665_1007010823 180
291 3300005549 Ga0070704_100583576 Ga0070704_1005835761 180
292 3300005549 Ga0070704_100666847 Ga0070704_1006668472 180
293 3300005563 Ga0068855_100050191 Ga0068855_1000501916 180
294 3300005563 Ga0068855_100053959 Ga0068855_1000539595 180
295 3300005563 Ga0068855_100508206 Ga0068855_1005082062 180
296 3300005563 Ga0068855_100531771 Ga0068855_1005317712 180
297 3300005564 Ga0070664_100432562 Ga0070664_1004325622 180
298 3300005577 Ga0068857_100014952 Ga0068857_1000149524 180
299 3300005577 Ga0068857_100165432 Ga0068857_1001654322 180
300 3300005577 Ga0068857_100548812 Ga0068857_1005488122 180
301 3300005578 Ga0068854_100021501 Ga0068854_1000215014 180
302 3300005578 Ga0068854_100364401 Ga0068854_1003644012 180
303 3300005614 Ga0068856_100100529 Ga0068856_1001005293 180
304 3300005614 Ga0068856_100444122 Ga0068856_1004441222 180
305 3300005616 Ga0068852_100008462 Ga0068852_1000084622 180
306 3300005616 Ga0068852_100660284 Ga0068852_1006602841 180
307 3300005616 Ga0068852_100782486 Ga0068852_1007824862 180
308 3300005617 Ga0068859_100668110 Ga0068859_1006681102 180
309 3300005617 Ga0068859_101197883 Ga0068859_1011978831 180
310 3300005618 Ga0068864_100128028 Ga0068864_1001280283 180
311 3300005618 Ga0068864_100556159 Ga0068864_1005561592 180
312 3300005618 Ga0068864_100748175 Ga0068864_1007481752 180
313 3300005718 Ga0068866_10046902 Ga0068866_100469023 180
314 3300005719 Ga0068861_100030335 Ga0068861_1000303356 180
315 3300005719 Ga0068861_100046881 Ga0068861_1000468811 180
316 3300005719 Ga0068861_100046881 Ga0068861_1000468812 180
317 3300005719 Ga0068861_100572507 Ga0068861_1005725072 180
318 3300005840 Ga0068870_10242840 Ga0068870_102428402 180
319 3300005841 Ga0068863_100243895 Ga0068863_1002438951 180
320 3300005841 Ga0068863_100394052 Ga0068863_1003940521 180
321 3300005842 Ga0068858_100239469 Ga0068858_1002394692 180
322 3300005842 Ga0068858_100420222 Ga0068858_1004202222 180
323 3300005842 Ga0068858_100766265 Ga0068858_1007662652 180
324 3300005843 Ga0068860_100000533 Ga0068860_10000053347 180
325 3300005843 Ga0068860_100134467 Ga0068860_1001344672 180
326 3300005843 Ga0068860_100134467 Ga0068860_1001344673 180
327 3300005844 Ga0068862_100265752 Ga0068862_1002657522 180
328 3300005844 Ga0068862_100569862 Ga0068862_1005698622 180
329 3300005937 Ga0081455_10070768 Ga0081455_100707682 180
330 3300005937 Ga0081455_10380199 Ga0081455_103801992 180
331 3300005983 Ga0081540_1002213 Ga0081540_10022134 180
332 3300005983 Ga0081540_1005827 Ga0081540_10058272 180
333 3300005983 Ga0081540_1012712 Ga0081540_10127125 180
334 3300005983 Ga0081540_1017590 Ga0081540_10175905 180
335 3300005983 Ga0081540_1024174 Ga0081540_10241742 180
336 3300005983 Ga0081540_1025572 Ga0081540_10255723 180
337 3300005983 Ga0081540_1052500 Ga0081540_10525002 180
338 3300005985 Ga0081539_10000748 Ga0081539_1000074850 180
339 3300006028 Ga0070717_10133966 Ga0070717_101339662 180
340 3300006028 Ga0070717_10257705 Ga0070717_102577052 180
341 3300006038 Ga0075365_10027753 Ga0075365_100277535 180
342 3300006038 Ga0075365_10027753 Ga0075365_100277536 180
343 3300006038 Ga0075365_10039617 Ga0075365_100396173 180
344 3300006038 Ga0075365_10126465 Ga0075365_101264652 180
345 3300006038 Ga0075365_10296614 Ga0075365_102966142 180
346 3300006038 Ga0075365_10358222 Ga0075365_103582222 180
347 3300006042 Ga0075368_10020977 Ga0075368_100209772 180
348 3300006042 Ga0075368_10030204 Ga0075368_100302043 180
349 3300006048 Ga0075363_100023427 Ga0075363_1000234272 180
350 3300006048 Ga0075363_100052487 Ga0075363_1000524871 180
351 3300006048 Ga0075363_100052487 Ga0075363_1000524872 180
352 3300006048 Ga0075363_100448932 Ga0075363_1004489321 180
353 3300006051 Ga0075364_10281885 Ga0075364_102818852 180
354 3300006058 Ga0075432_10127059 Ga0075432_101270592 180
355 3300006163 Ga0070715_10001014 Ga0070715_100010141 180
356 3300006173 Ga0070716_100399010 Ga0070716_1003990101 180
357 3300006173 Ga0070716_100442075 Ga0070716_1004420751 180
358 3300006175 Ga0070712_100029479 Ga0070712_1000294794 180
359 3300006175 Ga0070712_100755187 Ga0070712_1007551872 180
360 3300006177 Ga0075362_10094934 Ga0075362_100949342 180
361 3300006177 Ga0075362_10094934 Ga0075362_100949343 180
362 3300006178 Ga0075367_10089243 Ga0075367_100892432 180
363 3300006178 Ga0075367_10119054 Ga0075367_101190542 180
364 3300006178 Ga0075367_10151217 Ga0075367_101512172 180
365 3300006178 Ga0075367_10176008 Ga0075367_101760082 180
366 3300006178 Ga0075367_10384087 Ga0075367_103840872 180
367 3300006186 Ga0075369_10065856 Ga0075369_100658562 180
368 3300006186 Ga0075369_10065856 Ga0075369_100658563 180
369 3300006186 Ga0075369_10293403 Ga0075369_102934031 180
370 3300006186 Ga0075369_10340714 Ga0075369_103407141 180
371 3300006195 Ga0075366_10409780 Ga0075366_104097802 180
372 3300006195 Ga0075366_10465306 Ga0075366_104653062 180
373 3300006237 Ga0097621_100156156 Ga0097621_1001561562 180
374 3300006353 Ga0075370_10055472 Ga0075370_100554723 180
375 3300006353 Ga0075370_10105899 Ga0075370_101058991 180
376 3300006353 Ga0075370_10105899 Ga0075370_101058992 180
377 3300006353 Ga0075370_10152099 Ga0075370_101520991 180
378 3300006353 Ga0075370_10477048 Ga0075370_104770481 180
379 3300006358 Ga0068871_100235438 Ga0068871_1002354382 180
380 3300006358 Ga0068871_100349535 Ga0068871_1003495352 180
381 3300006844 Ga0075428_100084451 Ga0075428_1000844513 180
382 3300006844 Ga0075428_100084451 Ga0075428_1000844514 180
383 3300006871 Ga0075434_100395193 Ga0075434_1003951932 180
384 3300006881 Ga0068865_100059062 Ga0068865_1000590623 180
385 3300006881 Ga0068865_100122589 Ga0068865_1001225892 180
386 3300006881 Ga0068865_100678081 Ga0068865_1006780812 180
387 3300006931 Ga0097620_100668134 Ga0097620_1006681342 180
388 3300006931 Ga0097620_101197797 Ga0097620_1011977971 180
389 3300006941 Ga0099825_1032872 Ga0099825_10328723 180
390 3300006942 Ga0099824_1014525 Ga0099824_10145259 180
391 3300006943 Ga0099822_1005034 Ga0099822_100503410 180
392 3300007076 Ga0075435_100401054 Ga0075435_1004010542 180
393 3300007265 Ga0099794_10029066 Ga0099794_100290664 180
394 3300007265 Ga0099794_10141477 Ga0099794_101414771 180
395 3300007265 Ga0099794_10148055 Ga0099794_101480551 180
396 3300007265 Ga0099794_10223694 Ga0099794_102236942 180
397 3300009093 Ga0105240_10030327 Ga0105240_100303275 180
398 3300009093 Ga0105240_10141354 Ga0105240_101413542 180
399 3300009093 Ga0105240_11578733 Ga0105240_115787331 180
400 3300009094 Ga0111539_10163191 Ga0111539_101631912 180
401 3300009094 Ga0111539_10255594 Ga0111539_102555942 180
402 3300009098 Ga0105245_10046675 Ga0105245_100466752 180
403 3300009101 Ga0105247_10036617 Ga0105247_100366172 180
404 3300009101 Ga0105247_10159250 Ga0105247_101592502 180
405 3300009148 Ga0105243_10275580 Ga0105243_102755802 180
406 3300009148 Ga0105243_10420205 Ga0105243_104202051 180
407 3300009148 Ga0105243_10742634 Ga0105243_107426342 180
408 3300009174 Ga0105241_10117846 Ga0105241_101178463 180
409 3300009174 Ga0105241_11096257 Ga0105241_110962571 180
410 3300009176 Ga0105242_10195163 Ga0105242_101951633 180
411 3300009176 Ga0105242_10894335 Ga0105242_108943352 180
412 3300009177 Ga0105248_11061362 Ga0105248_110613621 180
413 3300009545 Ga0105237_10066154 Ga0105237_100661544 180
414 3300009545 Ga0105237_10124394 Ga0105237_101243942 180
415 3300009551 Ga0105238_10008344 Ga0105238_1000834410 180
416 3300009553 Ga0105249_10821648 Ga0105249_108216482 180
417 3300009553 Ga0105249_11153238 Ga0105249_111532382 180
418 3300009553 Ga0105249_12059108 Ga0105249_120591081 180
419 3300010159 Ga0099796_10082966 Ga0099796_100829662 180
420 3300010159 Ga0099796_10091940 Ga0099796_100919402 180
421 3300010159 Ga0099796_10198341 Ga0099796_101983411 180
422 3300010375 Ga0105239_10007487 Ga0105239_1000748711 180
423 3300011119 Ga0105246_10180621 Ga0105246_101806212 180
424 3300013104 Ga0157370_10081244 Ga0157370_100812442 180
425 3300013104 Ga0157370_10519025 Ga0157370_105190252 180
426 3300013296 Ga0157374_10131890 Ga0157374_101318902 180
427 3300013297 Ga0157378_10133193 Ga0157378_101331933 180
428 3300013297 Ga0157378_10140689 Ga0157378_101406892 180
429 3300013297 Ga0157378_10496294 Ga0157378_104962943 180
430 3300013297 Ga0157378_10697539 Ga0157378_106975391 180
431 3300013297 Ga0157378_10740440 Ga0157378_107404402 180
432 3300013297 Ga0157378_10798558 Ga0157378_107985582 180
433 3300013307 Ga0157372_10719819 Ga0157372_107198192 180
434 3300013308 Ga0157375_10281247 Ga0157375_102812472 180
435 3300013308 Ga0157375_10564644 Ga0157375_105646442 180
436 3300013308 Ga0157375_10595944 Ga0157375_105959442 180
437 3300013308 Ga0157375_10750967 Ga0157375_107509673 180
438 3300014325 Ga0163163_10069119 Ga0163163_100691192 180
439 3300014325 Ga0163163_10126403 Ga0163163_101264034 180
440 3300014326 Ga0157380_10586871 Ga0157380_105868712 180
441 3300014326 Ga0157380_10857288 Ga0157380_108572882 180
442 3300014745 Ga0157377_10176996 Ga0157377_101769962 180
443 3300014968 Ga0157379_10018767 Ga0157379_100187673 180
444 3300014968 Ga0157379_10387674 Ga0157379_103876742 180
445 3300014968 Ga0157379_10562057 Ga0157379_105620572 180
446 3300017792 Ga0163161_10822778 Ga0163161_108227781 180
447 3300025253 Ga0209677_100642 Ga0209677_1006426 180
448 3300025261 Ga0209233_1004646 Ga0209233_10046463 180
449 3300025297 Ga0209758_1036446 Ga0209758_10364462 180
450 3300025711 Ga0207696_1022802 Ga0207696_10228022 180
451 3300025885 Ga0207653_10180814 Ga0207653_101808142 180
452 3300025898 Ga0207692_10123298 Ga0207692_101232981 180
453 3300025900 Ga0207710_10073815 Ga0207710_100738151 180
454 3300025901 Ga0207688_10067411 Ga0207688_100674111 180
455 3300025901 Ga0207688_10260136 Ga0207688_102601362 180
456 3300025901 Ga0207688_10278162 Ga0207688_102781622 180
457 3300025901 Ga0207688_10314184 Ga0207688_103141841 180
458 3300025903 Ga0207680_10377489 Ga0207680_103774892 180
459 3300025904 Ga0207647_10001257 Ga0207647_1000125721 180
460 3300025904 Ga0207647_10162990 Ga0207647_101629902 180
461 3300025905 Ga0207685_10019456 Ga0207685_100194562 180
462 3300025905 Ga0207685_10103387 Ga0207685_101033872 180
463 3300025907 Ga0207645_10753394 Ga0207645_107533941 180
464 3300025908 Ga0207643_10101886 Ga0207643_101018862 180
465 3300025908 Ga0207643_10113831 Ga0207643_101138312 180
466 3300025910 Ga0207684_10236553 Ga0207684_102365532 180
467 3300025913 Ga0207695_10054115 Ga0207695_100541156 180
468 3300025913 Ga0207695_10322828 Ga0207695_103228282 180
469 3300025914 Ga0207671_10034203 Ga0207671_100342032 180
470 3300025914 Ga0207671_10166650 Ga0207671_101666502 180
471 3300025914 Ga0207671_10466978 Ga0207671_104669781 180
472 3300025915 Ga0207693_10017003 Ga0207693_100170032 180
473 3300025915 Ga0207693_10142022 Ga0207693_101420221 180
474 3300025915 Ga0207693_10691375 Ga0207693_106913752 180
475 3300025916 Ga0207663_10012346 Ga0207663_100123465 180
476 3300025916 Ga0207663_10124585 Ga0207663_101245852 180
477 3300025917 Ga0207660_10465140 Ga0207660_104651402 180
478 3300025918 Ga0207662_10092971 Ga0207662_100929711 180
479 3300025919 Ga0207657_10167355 Ga0207657_101673552 180
480 3300025920 Ga0207649_10355527 Ga0207649_103555272 180
481 3300025922 Ga0207646_10141882 Ga0207646_101418823 180
482 3300025923 Ga0207681_10595647 Ga0207681_105956472 180
483 3300025924 Ga0207694_10103075 Ga0207694_101030753 180
484 3300025924 Ga0207694_10219612 Ga0207694_102196122 180
485 3300025925 Ga0207650_10614695 Ga0207650_106146953 180
486 3300025928 Ga0207700_10109507 Ga0207700_101095071 180
487 3300025928 Ga0207700_10138887 Ga0207700_101388873 180
488 3300025929 Ga0207664_10903405 Ga0207664_109034052 180
489 3300025931 Ga0207644_10157199 Ga0207644_101571992 180
490 3300025932 Ga0207690_10647708 Ga0207690_106477081 180
491 3300025933 Ga0207706_10119813 Ga0207706_101198132 180
492 3300025933 Ga0207706_10403780 Ga0207706_104037802 180
493 3300025933 Ga0207706_10470132 Ga0207706_104701322 180
494 3300025933 Ga0207706_10582197 Ga0207706_105821972 180
495 3300025934 Ga0207686_10691379 Ga0207686_106913791 180
496 3300025935 Ga0207709_10031008 Ga0207709_100310083 180
497 3300025935 Ga0207709_10632096 Ga0207709_106320961 180
498 3300025937 Ga0207669_10060589 Ga0207669_100605892 180
499 3300025937 Ga0207669_10098745 Ga0207669_100987451 180
500 3300025937 Ga0207669_10129629 Ga0207669_101296291 180
501 3300025937 Ga0207669_10360764 Ga0207669_103607642 180
502 3300025937 Ga0207669_10859103 Ga0207669_108591031 180
503 3300025938 Ga0207704_10598304 Ga0207704_105983041 180
504 3300025939 Ga0207665_10226175 Ga0207665_102261752 180
505 3300025940 Ga0207691_10162587 Ga0207691_101625871 180
506 3300025940 Ga0207691_10344192 Ga0207691_103441922 180
507 3300025941 Ga0207711_10028488 Ga0207711_100284881 180
508 3300025942 Ga0207689_10120260 Ga0207689_101202603 180
509 3300025942 Ga0207689_10136439 Ga0207689_101364392 180
510 3300025942 Ga0207689_10362997 Ga0207689_103629972 180
511 3300025945 Ga0207679_10253509 Ga0207679_102535092 180
512 3300025945 Ga0207679_10348912 Ga0207679_103489122 180
513 3300025949 Ga0207667_10082489 Ga0207667_100824893 180
514 3300025949 Ga0207667_10396432 Ga0207667_103964322 180
515 3300025949 Ga0207667_10903591 Ga0207667_109035911 180
516 3300025961 Ga0207712_10037317 Ga0207712_100373174 180
517 3300025961 Ga0207712_10037317 Ga0207712_100373175 180
518 3300025961 Ga0207712_10080536 Ga0207712_100805364 180
519 3300025961 Ga0207712_10972498 Ga0207712_109724982 180
520 3300025972 Ga0207668_10035131 Ga0207668_100351313 180
521 3300025972 Ga0207668_10142225 Ga0207668_101422252 180
522 3300025972 Ga0207668_10145956 Ga0207668_101459562 180
523 3300025972 Ga0207668_10453057 Ga0207668_104530572 180
524 3300025981 Ga0207640_10041115 Ga0207640_100411153 180
525 3300025986 Ga0207658_10191212 Ga0207658_101912122 180
526 3300025986 Ga0207658_11009216 Ga0207658_110092161 180
527 3300026023 Ga0207677_10124631 Ga0207677_101246311 180
528 3300026023 Ga0207677_10431955 Ga0207677_104319552 180
529 3300026035 Ga0207703_10240546 Ga0207703_102405462 180
530 3300026035 Ga0207703_11286334 Ga0207703_112863341 180
531 3300026041 Ga0207639_10091983 Ga0207639_100919832 180
532 3300026041 Ga0207639_10345083 Ga0207639_103450832 180
533 3300026067 Ga0207678_10032160 Ga0207678_100321606 180
534 3300026067 Ga0207678_10053178 Ga0207678_100531782 180
535 3300026067 Ga0207678_10253016 Ga0207678_102530162 180
536 3300026075 Ga0207708_10409201 Ga0207708_104092012 180
537 3300026075 Ga0207708_10727809 Ga0207708_107278092 180
538 3300026078 Ga0207702_10092121 Ga0207702_100921213 180
539 3300026078 Ga0207702_10633658 Ga0207702_106336581 180
540 3300026088 Ga0207641_10025466 Ga0207641_100254665 180
541 3300026089 Ga0207648_10059634 Ga0207648_100596342 180
542 3300026095 Ga0207676_10196235 Ga0207676_101962351 180
543 3300026095 Ga0207676_10284766 Ga0207676_102847662 180
544 3300026116 Ga0207674_10091312 Ga0207674_100913124 180
545 3300026118 Ga0207675_100110100 Ga0207675_1001101002 180
546 3300026118 Ga0207675_100147251 Ga0207675_1001472512 180
547 3300026118 Ga0207675_100263571 Ga0207675_1002635711 180
548 3300026118 Ga0207675_101345103 Ga0207675_1013451031 180
549 3300026118 Ga0207675_101692571 Ga0207675_1016925711 180
550 3300026121 Ga0207683_10055231 Ga0207683_100552311 180
551 3300026121 Ga0207683_10138242 Ga0207683_101382422 180
552 3300026121 Ga0207683_10506705 Ga0207683_105067052 180
553 3300026121 Ga0207683_11096467 Ga0207683_110964671 180
554 3300026142 Ga0207698_10211220 Ga0207698_102112202 180
555 3300026142 Ga0207698_10298222 Ga0207698_102982222 180
556 3300027357 Ga0209589_1000006 Ga0209589_1000006300 180
557 3300027361 Ga0209489_100007 Ga0209489_100007300 180
558 3300027363 Ga0209700_100008 Ga0209700_100008300 180
559 3300027866 Ga0209813_10042489 Ga0209813_100424892 180
560 3300027907 Ga0207428_10291146 Ga0207428_102911462 180
561 3300028379 Ga0268266_10020468 Ga0268266_100204682 180
562 3300028379 Ga0268266_10080867 Ga0268266_100808672 180
563 3300028379 Ga0268266_10300834 Ga0268266_103008342 180
564 3300028379 Ga0268266_10316897 Ga0268266_103168972 180
565 3300028379 Ga0268266_10449676 Ga0268266_104496762 180
566 3300028379 Ga0268266_10667140 Ga0268266_106671401 180
567 3300028380 Ga0268265_10131809 Ga0268265_101318092 180
568 3300028380 Ga0268265_10131809 Ga0268265_101318093 180
569 3300028381 Ga0268264_10000038 Ga0268264_100000385 180
570 3300028381 Ga0268264_10441281 Ga0268264_104412812 180
571 3300028381 Ga0268264_10554606 Ga0268264_105546061 180
572 3300028381 Ga0268264_11287691 Ga0268264_112876911 180
573 3300028786 Ga0307517_10000085 Ga0307517_1000008523 180
574 3300028786 Ga0307517_10261092 Ga0307517_102610922 180
575 3300028794 Ga0307515_10011214 Ga0307515_1001121417 180
576 3300030521 Ga0307511_10213126 Ga0307511_102131262 180
577 3300031235 Ga0265330_10037533 Ga0265330_100375332 180
578 3300031238 Ga0265332_10011292 Ga0265332_100112925 180
579 3300031456 Ga0307513_10238049 Ga0307513_102380492 180
580 3300031456 Ga0307513_10314383 Ga0307513_103143831 180
581 3300031507 Ga0307509_10345403 Ga0307509_103454032 180
582 3300031507 Ga0307509_10523554 Ga0307509_105235541 180
583 3300031616 Ga0307508_10000034 Ga0307508_1000003434 180
584 3300031616 Ga0307508_10210415 Ga0307508_102104152 180
585 3300031711 Ga0265314_10004394 Ga0265314_1000439413 180
586 3300031730 Ga0307516_10012741 Ga0307516_100127417 180
587 3300031730 Ga0307516_10032981 Ga0307516_100329815 180
588 3300031730 Ga0307516_10065038 Ga0307516_100650384 180
589 3300031730 Ga0307516_10252513 Ga0307516_102525132 180
590 3300031731 Ga0307405_10698883 Ga0307405_106988831 180
591 3300031852 Ga0307410_10233930 Ga0307410_102339302 180
592 3300031901 Ga0307406_10101760 Ga0307406_101017602 180
593 3300031901 Ga0307406_10444783 Ga0307406_104447832 180
594 3300031911 Ga0307412_10213504 Ga0307412_102135042 180
595 3300031995 Ga0307409_100054772 Ga0307409_1000547724 180
596 3300032004 Ga0307414_10374532 Ga0307414_103745322 180
597 3300032005 Ga0307411_10144349 Ga0307411_101443492 180
598 3300032126 Ga0307415_100150032 Ga0307415_1001500322 180
599 3300032126 Ga0307415_100854509 Ga0307415_1008545092 180
600 3300033179 Ga0307507_10154469 Ga0307507_101544692 180
601 3300033180 Ga0307510_10003336 Ga0307510_1000333615 180
602 3300033180 Ga0307510_10066449 Ga0307510_100664493 180
603 3300033442 Ga0315911_1000010 Ga0315911_1000010241 180
604 3300035083 Ga0373926_0117731 Ga0373926_0117731_386_988 180
605 3300035086 Ga0373934_0018370 Ga0373934_0018370_1017_1619 180
606 3300035086 Ga0373934_0023403 Ga0373934_0023403_1571_2173 180
607 3300035086 Ga0373934_0116398 Ga0373934_0116398_237_839 180
608 3300035111 Ga0373923_0002503 Ga0373923_0002503_3902_4504 180
609 3300035113 Ga0373936_0005856 Ga0373936_0005856_547_1149 180
610 3300035113 Ga0373936_0012112 Ga0373936_0012112_247_849 180
611 3300035113 Ga0373936_0072403 Ga0373936_0072403_72_674 180
612 3300035113 Ga0373936_0168920 Ga0373936_0168920_38_640 180
613 3300035113 Ga0373936_0172971 Ga0373936_0172971_12_614 180
614 3300035117 Ga0373953_0001969 Ga0373953_0001969_4875_5477 180
615 3300035118 Ga0373954_0005665 Ga0373954_0005665_3061_3663 180
616 3300035118 Ga0373954_0084697 Ga0373954_0084697_457_1059 180
617 3300035119 Ga0373956_0095529 Ga0373956_0095529_352_954 180
618 3300035120 Ga0373957_0000736 Ga0373957_0000736_7594_8196 180
619 3300035170 Ga0373943_0003952 Ga0373943_0003952_1187_1789 180
620 3300035170 Ga0373943_0059547 Ga0373943_0059547_161_763 180
621 3300035170 Ga0373943_0140225 Ga0373943_0140225_441_1043 180
622 3300035171 Ga0373946_0028442 Ga0373946_0028442_734_1336 180
623 3300035172 Ga0373955_0005145 Ga0373955_0005145_4385_4987 180
624 3300035172 Ga0373955_0054932 Ga0373955_0054932_1363_1965 180
625 3300035172 Ga0373955_0122066 Ga0373955_0122066_627_1229 180
626 3300035241 Ga0373961_0233487 Ga0373961_0233487_18_620 180
627 3300035410 Ga0373924_0049264 Ga0373924_0049264_702_1304 180
628 3300035410 Ga0373924_0095738 Ga0373924_0095738_223_825 180
629 3300035691 Ga0373931_0045962 Ga0373931_0045962_1142_1744 180
630 3300035692 Ga0373935_0000757 Ga0373935_0000757_4476_5078 180
631 3300035692 Ga0373935_0252555 Ga0373935_0252555_319_921 180
632 3300035695 Ga0373927_0005694 Ga0373927_0005694_6926_7528 180
633 3300035695 Ga0373927_0366000 Ga0373927_0366000_263_865 180
634 3300035724 Ga0373933_0024456 Ga0373933_0024456_362_964 180
635 3300035724 Ga0373933_0069371 Ga0373933_0069371_806_1408 180
636 3300035724 Ga0373933_0359702 Ga0373933_0359702_233_835 180
637 3300035725 Ga0373947_0008292 Ga0373947_0008292_1240_1842 180
638 3300035725 Ga0373947_0137760 Ga0373947_0137760_33_635 180
639 3300035725 Ga0373947_0323315 Ga0373947_0323315_42_644 180
640 3300036401 Ga0373937_0036098 Ga0373937_0036098_1035_1637 180
641 3300036401 Ga0373937_0047886 Ga0373937_0047886_115_717 180
642 3300036401 Ga0373937_0460668 Ga0373937_0460668_311_913 180
643 3300036534 Ga0310109_024739 Ga0310109_024739_102_704 180
644 3300037068 Ga0373925_0002155 Ga0373925_0002155_9137_9739 180
645 3300037068 Ga0373925_0112186 Ga0373925_0112186_991_1593 180
646 3300037068 Ga0373925_0245252 Ga0373925_0245252_46_648 180
647 3300039438 Ga0436360_0668865 Ga0436360_0668865_969_1571 180
648 3300041451 Ga0451791_0424928 Ga0451791_0424928_487_1089 180
649 3300041453 Ga0451797_1273054 Ga0451797_1273054_65_667 180
650 3300041460 Ga0451802_1317356 Ga0451802_1317356_165_767 180
651 3300044684 Ga0466966_0326218 Ga0466966_0326218_29_637 180
652 3300044684 Ga0466966_0405775 Ga0466966_0405775_70_672 180
653 3300044694 Ga0466963_0310919 Ga0466963_0310919_274_876 180
654 3300044694 Ga0466963_0632677 Ga0466963_0632677_64_669 180
655 3300044765 Ga0466970_0188141 Ga0466970_0188141_59_670 180
656 3300045049 Ga0466959_0216038 Ga0466959_0216038_289_900 180
657 3300045976 Ga0466967_0274971 Ga0466967_0274971_953_1555 180
658 3300046452 Ga0495617_034968 Ga0495617_034968_615_1217 180
659 3300046453 Ga0495627_098624 Ga0495627_098624_70_672 180
660 3300046454 Ga0495592_0027847 Ga0495592_0027847_2886_3488 180
661 3300046454 Ga0495592_0395414 Ga0495592_0395414_115_717 180
662 3300046454 Ga0495592_0464859 Ga0495592_0464859_36_638 180
663 3300046455 Ga0495603_0000064 Ga0495603_0000064_23865_24467 180
664 3300046455 Ga0495603_0034710 Ga0495603_0034710_844_1446 180
665 3300046455 Ga0495603_0038842 Ga0495603_0038842_1776_2378 180
666 3300046459 Ga0495629_0004224 Ga0495629_0004224_5557_6159 180
667 3300046459 Ga0495629_0043875 Ga0495629_0043875_735_1337 180
668 3300046459 Ga0495629_0090717 Ga0495629_0090717_1241_1843 180
669 3300046459 Ga0495629_0245663 Ga0495629_0245663_220_822 180
670 3300046460 Ga0495638_0072979 Ga0495638_0072979_323_925 180
671 3300046460 Ga0495638_0220774 Ga0495638_0220774_39_641 180
672 3300046461 Ga0495641_0020444 Ga0495641_0020444_1022_1624 180
673 3300046461 Ga0495641_0063503 Ga0495641_0063503_811_1413 180
674 3300046462 Ga0495651_0021786 Ga0495651_0021786_1649_2251 180
675 3300046462 Ga0495651_0109822 Ga0495651_0109822_860_1474 180
676 3300046463 Ga0495653_0003792 Ga0495653_0003792_7241_7843 180
677 3300046463 Ga0495653_0152036 Ga0495653_0152036_278_880 180
678 3300046472 Ga0495580_0002461 Ga0495580_0002461_7605_8207 180
679 3300046472 Ga0495580_0276473 Ga0495580_0276473_33_635 180
680 3300046473 Ga0495582_0000197 Ga0495582_0000197_25702_26304 180
681 3300046473 Ga0495582_0060111 Ga0495582_0060111_1450_2052 180
682 3300046475 Ga0495639_0000218 Ga0495639_0000218_17696_18298 180
683 3300046475 Ga0495639_0435893 Ga0495639_0435893_29_631 180
684 3300046476 Ga0495662_0000732 Ga0495662_0000732_5319_5921 180
685 3300046476 Ga0495662_0122431 Ga0495662_0122431_450_1052 180
686 3300046477 Ga0495664_0009846 Ga0495664_0009846_548_1150 180
687 3300046477 Ga0495664_0045608 Ga0495664_0045608_719_1321 180
688 3300046477 Ga0495664_0209359 Ga0495664_0209359_206_808 180
689 3300046477 Ga0495664_0331204 Ga0495664_0331204_205_807 180
690 3300046491 Ga0495584_0201231 Ga0495584_0201231_392_994 180
691 3300046491 Ga0495584_0220792 Ga0495584_0220792_161_763 180
692 3300046491 Ga0495584_0227339 Ga0495584_0227339_39_641 180
693 3300046499 Ga0495594_0002513 Ga0495594_0002513_5559_6161 180
694 3300046499 Ga0495594_0051126 Ga0495594_0051126_1194_1796 180
695 3300046506 Ga0495583_0121704 Ga0495583_0121704_337_939 180
696 3300046507 Ga0495606_0000976 Ga0495606_0000976_36352_36954 180
697 3300046507 Ga0495606_0103261 Ga0495606_0103261_128_730 180
698 3300046507 Ga0495606_0103261 Ga0495606_0103261_753_1355 180
699 3300046511 Ga0495608_0006251 Ga0495608_0006251_5121_5723 180
700 3300046511 Ga0495608_0151565 Ga0495608_0151565_206_808 180
701 3300046512 Ga0495610_0106976 Ga0495610_0106976_233_835 180
702 3300046513 Ga0495616_0160909 Ga0495616_0160909_311_913 180
703 3300046514 Ga0495618_0085231 Ga0495618_0085231_621_1223 180
704 3300046515 Ga0495620_0183965 Ga0495620_0183965_24_626 180
705 3300046516 Ga0495628_0020250 Ga0495628_0020250_4424_5026 180
706 3300046516 Ga0495628_0036805 Ga0495628_0036805_2702_3304 180
707 3300046516 Ga0495628_0086580 Ga0495628_0086580_112_714 180
708 3300046516 Ga0495628_0319043 Ga0495628_0319043_308_910 180
709 3300046517 Ga0495630_0004218 Ga0495630_0004218_4954_5556 180
710 3300046517 Ga0495630_0139522 Ga0495630_0139522_292_894 180
711 3300046518 Ga0495631_0064932 Ga0495631_0064932_516_1118 180
712 3300046519 Ga0495632_0120324 Ga0495632_0120324_361_963 180
713 3300046519 Ga0495632_0147885 Ga0495632_0147885_385_987 180
714 3300046526 Ga0495666_0066999 Ga0495666_0066999_858_1460 180
715 3300046529 Ga0495652_0111215 Ga0495652_0111215_1036_1638 180
716 3300046529 Ga0495652_0129640 Ga0495652_0129640_51_653 180
717 3300046529 Ga0495652_0688806 Ga0495652_0688806_26_628 180
718 3300046531 Ga0495665_0000531 Ga0495665_0000531_17947_18549 180
719 3300046533 Ga0495640_0001572 Ga0495640_0001572_691_1293 180
720 3300046533 Ga0495640_0055146 Ga0495640_0055146_1255_1857 180
721 3300046533 Ga0495640_0059939 Ga0495640_0059939_783_1385 180
722 3300046533 Ga0495640_0439086 Ga0495640_0439086_15_617 180
723 3300046535 Ga0495586_0341001 Ga0495586_0341001_26_631 180
724 3300046536 Ga0495587_0073220 Ga0495587_0073220_205_807 180
725 3300046536 Ga0495587_0357461 Ga0495587_0357461_97_699 180
726 3300046537 Ga0495598_0030150 Ga0495598_0030150_293_895 180
727 3300046538 Ga0495609_0055347 Ga0495609_0055347_941_1543 180
728 3300046543 Ga0495645_0066733 Ga0495645_0066733_775_1377 180
729 3300046543 Ga0495645_0189922 Ga0495645_0189922_25_627 180
730 3300046557 Ga0495622_0014503 Ga0495622_0014503_2153_2755 180
731 3300046557 Ga0495622_0067417 Ga0495622_0067417_800_1402 180
732 3300046557 Ga0495622_0137244 Ga0495622_0137244_302_904 180
733 3300046559 Ga0495667_0036833 Ga0495667_0036833_837_1439 180
734 3300046559 Ga0495667_0037334 Ga0495667_0037334_1774_2376 180
735 3300046615 Ga0495656_0025190 Ga0495656_0025190_1449_2051 180
736 3300046615 Ga0495656_0047390 Ga0495656_0047390_494_1096 180
737 3300046615 Ga0495656_0141490 Ga0495656_0141490_63_665 180
738 3300046616 Ga0495668_0082544 Ga0495668_0082544_399_1001 180
739 3300046616 Ga0495668_0111202 Ga0495668_0111202_829_1431 180
740 3300046616 Ga0495668_0360483 Ga0495668_0360483_109_711 180
741 3300046616 Ga0495668_0492791 Ga0495668_0492791_55_657 180
742 3300046642 Ga0495634_0032723 Ga0495634_0032723_2105_2707 180
743 3300046642 Ga0495634_0045928 Ga0495634_0045928_570_1172 180
744 3300046642 Ga0495634_0382784 Ga0495634_0382784_182_784 180
745 3300046648 Ga0495611_0163675 Ga0495611_0163675_307_909 180
746 3300046648 Ga0495611_0290356 Ga0495611_0290356_80_682 180
747 3300046660 Ga0495625_0185670 Ga0495625_0185670_293_895 180
748 3300046660 Ga0495625_0214035 Ga0495625_0214035_507_1109 180
749 3300046660 Ga0495625_0358749 Ga0495625_0358749_263_865 180
750 3300046660 Ga0495625_0368236 Ga0495625_0368236_126_728 180
751 3300046663 Ga0495635_0000356 Ga0495635_0000356_24497_25099 180
752 3300046663 Ga0495635_0009382 Ga0495635_0009382_4286_4888 180
753 3300046663 Ga0495635_0522968 Ga0495635_0522968_82_684 180
754 3300046664 Ga0495659_0074733 Ga0495659_0074733_125_727 180
755 3300046674 Ga0495588_0005017 Ga0495588_0005017_873_1475 180
756 3300046674 Ga0495588_0129229 Ga0495588_0129229_164_766 180
757 3300046675 Ga0495657_0042456 Ga0495657_0042456_1640_2242 180
758 3300046678 Ga0495599_0142463 Ga0495599_0142463_54_656 180
759 3300046679 Ga0495623_0102188 Ga0495623_0102188_115_717 180
760 3300046680 Ga0495646_0019745 Ga0495646_0019745_791_1393 180
761 3300046681 Ga0495647_0038637 Ga0495647_0038637_518_1120 180
762 3300046683 Ga0495658_0001357 Ga0495658_0001357_4857_5459 180
763 3300046683 Ga0495658_0171387 Ga0495658_0171387_119_721 180
764 3300046683 Ga0495658_0616318 Ga0495658_0616318_61_663 180
765 3300046684 Ga0495669_0141445 Ga0495669_0141445_110_712 180
766 3300046684 Ga0495669_0322155 Ga0495669_0322155_102_704 180
767 3300046689 Ga0495613_0001784 Ga0495613_0001784_3814_4416 180
768 3300046689 Ga0495613_0027914 Ga0495613_0027914_3303_3905 180
769 3300046690 Ga0495624_0003608 Ga0495624_0003608_780_1382 180
770 3300046690 Ga0495624_0402922 Ga0495624_0402922_47_649 180
771 3300046691 Ga0495670_0238679 Ga0495670_0238679_73_675 180
772 3300046692 Ga0495671_0031809 Ga0495671_0031809_546_1148 180
773 3300046692 Ga0495671_0204737 Ga0495671_0204737_239_841 180
774 3300046794 Ga0495589_0093356 Ga0495589_0093356_378_980 180
775 3300046809 Ga0495600_0028015 Ga0495600_0028015_160_762 180
776 3300047315 Ga0495581_0001121 Ga0495581_0001121_10034_10636 180
777 3300047317 Ga0495604_0024387 Ga0495604_0024387_2575_3177 180
778 3300047317 Ga0495604_0365405 Ga0495604_0365405_278_880 180
779 3300047318 Ga0495636_0060684 Ga0495636_0060684_598_1200 180
780 3300047318 Ga0495636_0394425 Ga0495636_0394425_36_638 180
781 3300047319 Ga0495674_0000910 Ga0495674_0000910_15616_16218 180
782 3300047319 Ga0495674_0023623 Ga0495674_0023623_589_1191 180
783 3300047319 Ga0495674_0312652 Ga0495674_0312652_232_834 180
784 3300047320 Ga0495672_0033942 Ga0495672_0033942_1792_2394 180
785 3300047320 Ga0495672_0194269 Ga0495672_0194269_396_998 180
786 3300047322 Ga0495680_0054687 Ga0495680_0054687_735_1337 180
787 3300047322 Ga0495680_0058904 Ga0495680_0058904_1497_2099 180
788 3300047322 Ga0495680_0144985 Ga0495680_0144985_224_826 180
789 3300047444 Ga0495675_0009561 Ga0495675_0009561_2757_3359 180
790 3300047444 Ga0495675_0060330 Ga0495675_0060330_1076_1678 180
791 3300047445 Ga0495677_0034533 Ga0495677_0034533_107_709 180
792 3300047445 Ga0495677_0080280 Ga0495677_0080280_476_1078 180
793 3300047445 Ga0495677_0145479 Ga0495677_0145479_35_637 180
794 3300047447 Ga0495685_059848 Ga0495685_059848_306_908 180
795 3300047469 Ga0495673_0038103 Ga0495673_0038103_939_1541 180
796 3300047469 Ga0495673_0094597 Ga0495673_0094597_13_615 180
797 3300047470 Ga0495681_0103225 Ga0495681_0103225_468_1070 180
798 3300047471 Ga0495684_0001020 Ga0495684_0001020_16392_16994 180
799 3300047471 Ga0495684_0383689 Ga0495684_0383689_358_960 180
800 3300047673 Ga0495593_0000053 Ga0495593_0000053_23735_24337 180
801 3300047673 Ga0495593_0007888 Ga0495593_0007888_4870_5472 180
802 3300047673 Ga0495593_0242344 Ga0495593_0242344_261_863 180
803 3300048088 Ga0495602_0077062 Ga0495602_0077062_986_1588 180
804 3300048089 Ga0495614_0180337 Ga0495614_0180337_290_892 180
805 3300048903 Ga0496100_0148326 Ga0496100_0148326_755_1357 180
806 3300048904 Ga0496101_0090913 Ga0496101_0090913_604_1206 180
807 3300048905 Ga0496102_0625952 Ga0496102_0625952_343_948 180
808 3300048905 Ga0496102_0626103 Ga0496102_0626103_277_879 180
809 3300048905 Ga0496102_0702912 Ga0496102_0702912_244_852 180
810 3300048906 Ga0496103_0255405 Ga0496103_0255405_258_860 180
811 3300048906 Ga0496103_0306827 Ga0496103_0306827_61_663 180
812 3300048907 Ga0496104_0368281 Ga0496104_0368281_382_984 180
813 3300048907 Ga0496104_0424482 Ga0496104_0424482_623_1225 180
814 3300048907 Ga0496104_0677574 Ga0496104_0677574_183_785 180
815 3300048908 Ga0496105_0415518 Ga0496105_0415518_10_612 180
816 3300048908 Ga0496105_0495984 Ga0496105_0495984_190_792 180
817 3300048909 Ga0496106_0054025 Ga0496106_0054025_1506_2108 180
818 3300048909 Ga0496106_0349821 Ga0496106_0349821_498_1100 180
819 3300048909 Ga0496106_0801556 Ga0496106_0801556_79_681 180
820 3300048910 Ga0496107_0369921 Ga0496107_0369921_259_861 180
821 3300048911 Ga0496108_0043253 Ga0496108_0043253_59_661 180
822 3300048911 Ga0496108_0634035 Ga0496108_0634035_73_675 180
823 3300048912 Ga0496109_0368697 Ga0496109_0368697_203_805 180
824 3300048912 Ga0496109_1271712 Ga0496109_1271712_48_650 180
825 3300048913 Ga0496110_0563044 Ga0496110_0563044_185_787 180
826 3300048914 Ga0496111_0254025 Ga0496111_0254025_135_737 180
827 3300048914 Ga0496111_0672150 Ga0496111_0672150_139_741 180
828 3300048915 Ga0496112_0000008 Ga0496112_0000008_76687_77289 180
829 3300048915 Ga0496112_0017278 Ga0496112_0017278_16_618 180
830 3300048915 Ga0496112_0552225 Ga0496112_0552225_97_699 180
831 3300048916 Ga0496113_0108920 Ga0496113_0108920_803_1405 180
832 3300048916 Ga0496113_0118535 Ga0496113_0118535_1220_1822 180
833 3300048916 Ga0496113_0346479 Ga0496113_0346479_452_1054 180
834 3300048918 Ga0496115_0054879 Ga0496115_0054879_637_1239 180
835 3300048920 Ga0496117_0025346 Ga0496117_0025346_3333_3935 180
836 3300048920 Ga0496117_0224367 Ga0496117_0224367_75_677 180
837 3300048921 Ga0496118_0018656 Ga0496118_0018656_1772_2374 180
838 3300048921 Ga0496118_0137994 Ga0496118_0137994_406_1008 180
839 3300048921 Ga0496118_0220837 Ga0496118_0220837_411_1013 180
840 3300048921 Ga0496118_0383114 Ga0496118_0383114_17_619 180
841 3300048922 Ga0496119_0088159 Ga0496119_0088159_260_862 180
842 3300048924 Ga0496121_0000178 Ga0496121_0000178_29042_29644 180
843 3300048924 Ga0496121_0000381 Ga0496121_0000381_717_1319 180
844 3300048924 Ga0496121_0065155 Ga0496121_0065155_62_664 180
845 3300048924 Ga0496121_0074199 Ga0496121_0074199_1848_2456 180
846 3300048924 Ga0496121_0094181 Ga0496121_0094181_1288_1890 180
847 3300048924 Ga0496121_0122575 Ga0496121_0122575_698_1300 180
848 3300048924 Ga0496121_0144549 Ga0496121_0144549_773_1375 180
849 3300048924 Ga0496121_0251455 Ga0496121_0251455_82_684 180
850 3300048924 Ga0496121_0438888 Ga0496121_0438888_48_650 180
851 3300048924 Ga0496121_0448240 Ga0496121_0448240_194_802 180
852 3300048924 Ga0496121_0455858 Ga0496121_0455858_156_758 180
853 3300048927 Ga0496124_0057960 Ga0496124_0057960_662_1264 180
854 3300048927 Ga0496124_0227694 Ga0496124_0227694_613_1215 180
855 3300048928 Ga0496125_0172081 Ga0496125_0172081_473_1075 180
856 3300048929 Ga0496126_0072513 Ga0496126_0072513_1740_2342 180
857 3300048929 Ga0496126_0145644 Ga0496126_0145644_449_1051 180
858 3300048929 Ga0496126_0180012 Ga0496126_0180012_89_691 180
859 3300048929 Ga0496126_0218646 Ga0496126_0218646_207_809 180
860 3300048929 Ga0496126_0507847 Ga0496126_0507847_262_864 180
861 3300049459 Ga0495678_169183 Ga0495678_169183_29_631 180
862 3300049460 Ga0495682_0207520 Ga0495682_0207520_57_659 180
863 3300049570 Ga0501033_0058655 Ga0501033_0058655_2027_2650 180
864 3300049571 Ga0501034_0907848 Ga0501034_0907848_67_690 180
865 3300049572 Ga0501036_0658356 Ga0501036_0658356_207_812 180
866 3300049575 Ga0501039_0800798 Ga0501039_0800798_47_652 180
867 3300049579 Ga0501043_0062269 Ga0501043_0062269_1893_2516 180
868 3300049580 Ga0501046_0116454 Ga0501046_0116454_1090_1713 180
869 3300049586 Ga0501070_0071621 Ga0501070_0071621_1788_2399 180
870 3300049589 Ga0501073_0282758 Ga0501073_0282758_11_634 180
871 3300049591 Ga0501075_0940531 Ga0501075_0940531_19_624 180
872 3300049822 Ga0501035_0205489 Ga0501035_0205489_219_842 180
873 3300049823 Ga0501044_0056597 Ga0501044_0056597_2833_3456 180
874 3300049823 Ga0501044_0433402 Ga0501044_0433402_515_1126 180
875 3300050489 nmdc:mga03683_190444_c1 nmdc:mga03683_190444_c1_74_676 180
876 3300050489 nmdc:mga03683_26098_c1 nmdc:mga03683_26098_c1_573_1175 180
877 3300050490 nmdc:mga03n38_77539_c1 nmdc:mga03n38_77539_c1_558_1160 180
878 3300050491 nmdc:mga00v17_150838_c1 nmdc:mga00v17_150838_c1_252_854 180
879 3300050491 nmdc:mga00v17_150838_c1 nmdc:mga00v17_150838_c1_862_1464 180
880 3300050491 nmdc:mga00v17_464079_c1 nmdc:mga00v17_464079_c1_145_747 180
881 3300050491 nmdc:mga00v17_651583_c1 nmdc:mga00v17_651583_c1_23_625 180
882 3300050492 nmdc:mga0yw44_28665_c1 nmdc:mga0yw44_28665_c1_1359_1961 180
883 3300050492 nmdc:mga0yw44_28665_c1 nmdc:mga0yw44_28665_c1_749_1351 180
884 3300050492 nmdc:mga0yw44_95359_c1 nmdc:mga0yw44_95359_c1_759_1361 180
885 3300050493 nmdc:mga0k408_192270_c1 nmdc:mga0k408_192270_c1_228_830 180
886 3300050493 nmdc:mga0k408_199632_c1 nmdc:mga0k408_199632_c1_564_1166 180
887 3300050493 nmdc:mga0k408_302495_c1 nmdc:mga0k408_302495_c1_313_915 180
888 3300050493 nmdc:mga0k408_562543_c1 nmdc:mga0k408_562543_c1_36_638 180
889 3300050494 nmdc:mga06z11_180894_c1 nmdc:mga06z11_180894_c1_201_803 180
890 3300050494 nmdc:mga06z11_26727_c1 nmdc:mga06z11_26727_c1_141_743 180
891 3300050495 nmdc:mga04h51_50942_c1 nmdc:mga04h51_50942_c1_503_1105 180
892 3300050496 nmdc:mga07m45_134023_c1 nmdc:mga07m45_134023_c1_502_1104 180
893 3300050496 nmdc:mga07m45_40462_c1 nmdc:mga07m45_40462_c1_1666_2268 180
894 3300050496 nmdc:mga07m45_40483_c1 nmdc:mga07m45_40483_c1_1712_2314 180
895 3300050496 nmdc:mga07m45_496790_c1 nmdc:mga07m45_496790_c1_69_671 180
896 3300050496 nmdc:mga07m45_536427_c1 nmdc:mga07m45_536427_c1_33_635 180
897 3300050507 nmdc:mga05p37_284592_c1 nmdc:mga05p37_284592_c1_1207_1809 180
898 3300050507 nmdc:mga05p37_284592_c1 nmdc:mga05p37_284592_c1_597_1199 180
899 3300050508 nmdc:mga09592_1025960_c1 nmdc:mga09592_1025960_c1_26_628 180
900 3300050509 nmdc:mga0qj67_179462_c1 nmdc:mga0qj67_179462_c1_619_1221 180
901 3300050511 nmdc:mga08y16_82751_c1 nmdc:mga08y16_82751_c1_557_1159 180
902 3300050512 nmdc:mga0n895_730985_c1 nmdc:mga0n895_730985_c1_41_643 180
903 3300050513 nmdc:mga0rr50_219099_c1 nmdc:mga0rr50_219099_c1_676_1278 180
904 3300050516 nmdc:mga0sz30_65860_c1 nmdc:mga0sz30_65860_c1_57_659 180
905 3300050516 nmdc:mga0sz30_65860_c1 nmdc:mga0sz30_65860_c1_667_1269 180
906 3300053077 Ga0495601_0085617 Ga0495601_0085617_1108_1710 180
907 3300053077 Ga0495601_0231351 Ga0495601_0231351_108_710 180
908 3300053080 Ga0500635_0016572 Ga0500635_0016572_1247_1849 180
909 3300053083 Ga0495655_0027175 Ga0495655_0027175_325_927 180
910 3300053083 Ga0495655_0066725 Ga0495655_0066725_265_867 180
911 3300053084 Ga0495595_0006351 Ga0495595_0006351_506_1108 180
912 3300053085 Ga0495619_0004452 Ga0495619_0004452_5276_5878 180
913 3300053085 Ga0495619_0024318 Ga0495619_0024318_694_1296 180
914 3300053087 Ga0500643_079256 Ga0500643_079256_133_735 180
915 3300053093 Ga0500651_0226076 Ga0500651_0226076_321_923 180
916 3300053093 Ga0500651_0424996 Ga0500651_0424996_19_621 180
917 3300053094 Ga0500566_0000008 Ga0500566_0000008_64082_64684 180
918 3300053094 Ga0500566_0151274 Ga0500566_0151274_154_756 180
919 3300053095 Ga0500640_005945 Ga0500640_005945_2147_2749 180
920 3300053096 Ga0500641_0017543 Ga0500641_0017543_704_1306 180
921 3300053096 Ga0500641_0019512 Ga0500641_0019512_1045_1647 180
922 3300053096 Ga0500641_0055829 Ga0500641_0055829_502_1104 180
923 3300053098 Ga0500650_0363481 Ga0500650_0363481_19_621 180
924 3300053104 Ga0500556_0035598 Ga0500556_0035598_553_1155 180
925 3300053111 Ga0500572_001569 Ga0500572_001569_4894_5496 180
926 3300053111 Ga0500572_002289 Ga0500572_002289_1920_2522 180
927 3300053115 Ga0500591_110620 Ga0500591_110620_435_1037 180
928 3300053119 Ga0500595_129974 Ga0500595_129974_73_675 180
929 3300053122 Ga0500608_013208 Ga0500608_013208_1290_1892 180
930 3300053133 Ga0500655_034038 Ga0500655_034038_286_888 180
931 3300053136 Ga0500559_0001443 Ga0500559_0001443_12318_12920 180
932 3300053136 Ga0500559_0002991 Ga0500559_0002991_2616_3218 180
933 3300053137 Ga0500561_0088660 Ga0500561_0088660_55_657 180
934 3300053142 Ga0500577_0045825 Ga0500577_0045825_63_665 180
935 3300053147 Ga0500589_052332 Ga0500589_052332_675_1277 180
936 3300053147 Ga0500589_136364 Ga0500589_136364_265_867 180
937 3300053148 Ga0500590_062564 Ga0500590_062564_694_1296 180
938 3300053150 Ga0500603_001477 Ga0500603_001477_2190_2792 180
939 3300053150 Ga0500603_126041 Ga0500603_126041_57_659 180
940 3300053153 Ga0500616_0227389 Ga0500616_0227389_166_768 180
941 3300053159 Ga0500630_032400 Ga0500630_032400_1447_2049 180
942 3300053163 Ga0500639_000010 Ga0500639_000010_90794_91396 180
943 3300053163 Ga0500639_011164 Ga0500639_011164_3580_4182 180
944 3300053163 Ga0500639_096015 Ga0500639_096015_225_827 180
945 3300053177 Ga0500636_0194460 Ga0500636_0194460_278_880 180
946 3300053177 Ga0500636_0328676 Ga0500636_0328676_79_681 180
947 3300053178 Ga0500637_0306450 Ga0500637_0306450_107_709 180
948 3300053725 Ga0500576_038374 Ga0500576_038374_599_1201 180
949 3300053735 Ga0500596_001566 Ga0500596_001566_2112_2714 180
950 3300053735 Ga0500596_001917 Ga0500596_001917_2257_2859 180

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

23

201

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iu4-assembly1.cif.gz_A crystal structure of iron transporter vit1 with cobalt ion 0.3366 9 173
7dz8-assembly1.cif.gz_L state transition supercomplex psi-lhci-lhcii from the lhcbm1 lacking mutant of chlamydomonas reinhardtii 0.3352 9 144
6iu4-assembly1.cif.gz_A crystal structure of iron transporter vit1 with cobalt ion 0.3142 9 173
7xzi-assembly1.cif.gz_A cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.3133 8 174
5wk6-assembly1.cif.gz_A cryo-em structure of p. aeruginosa flagellar filaments g420a 0.2971 11 173
ID Description Score Start End Superfamily
af_C6TIG3_1_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5213 8 179 1.20.1250.20
af_C6TIG3_1_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4991 8 179 1.20.1250.20
af_Q9SVE7_354_513_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4086 4 174 1.20.1250.20
af_A0A0R4IF99_149_314_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.3447 34 141 3.30.40.10
af_Q9SVE7_354_513_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3445 4 174 1.20.1250.20
ID Description Score Start End GO Terms
AF-S6GG24-F1-model_v4 Uncharacterized protein 0.666 4 177 GO:0005886
GO:0015171
GO:0033228
AF-A0A3A0EYW3-F1-model_v4 Lysine transporter LysE 0.664 2 180 GO:0005886
GO:0015171
GO:0033228
AF-A0A7Y2NIA6-F1-model_v4 LysE family translocator 0.6576 1 177 GO:0005886
GO:0015171
GO:0033228
AF-A0A3A0EYW3-F1-model_v4 Lysine transporter LysE 0.6568 2 180 GO:0005886
GO:0015171
GO:0033228
AF-A0A258GJJ8-F1-model_v4 Lysine transporter LysE 0.6534 1 178 GO:0005886
GO:0015171
GO:0033228

Feature Viewer

pLDDT pTM Quality
77.83 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map