F486508

General Info

Members Datasets Scaffolds Average Seq Length
948 390 939 192

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10577608|Ga0157378_105776081
Length 228
Sequence MVAAQWLRNQVEIYTLRLRAANHRALEDRNREASVIFTETKLKGAFIIDLETRSDSRGYFARGFCRKEFEAHGLKPTIAQANIAHNIRKGTVRGMHFQYPPAAETKLVRCTRGAILDIIVDLRPESPTYLQHIEVELNEDNQRALYVPERFAHGYQALRDNTDTSYQVGEFYTPSAEGGLMYNDPKLCLKWPLPVSVISDKDQKFELLAKIEPEVKRKMAGELAMAVA

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
3 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
4 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
5 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
6 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
7 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
8 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
9 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
89 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
90 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
91 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
101 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
102 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
103 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
104 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
105 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
110 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
111 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
144 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
145 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
146 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
149 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
209 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
215 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
216 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
217 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
218 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
219 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
220 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
221 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
222 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
223 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
224 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
225 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
226 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
227 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
228 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
229 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
230 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
231 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
232 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
233 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
234 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
235 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
236 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
237 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
238 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
239 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
240 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
241 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
242 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
243 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
244 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
245 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
246 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
247 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
248 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
249 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
250 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
251 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
253 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
254 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
255 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
257 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
258 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
259 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
260 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
261 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
262 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
263 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
264 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
265 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
266 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
267 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
268 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
269 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
270 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
271 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
272 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
273 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
274 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
275 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
276 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
277 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
278 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
279 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
280 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
281 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
282 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
283 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
284 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
285 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
286 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
287 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
288 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
289 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
290 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
291 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
292 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
293 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
294 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
295 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
296 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
297 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
298 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
299 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
300 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
301 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
302 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
303 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
304 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
305 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
306 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
307 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
308 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
309 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
310 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
311 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
312 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
313 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
314 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
315 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
316 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
317 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
318 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
319 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
320 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
321 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
322 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
323 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
324 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
325 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
326 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
327 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
328 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
329 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
330 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
347 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
348 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
349 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
350 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
351 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
352 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
353 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
354 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
355 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
356 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
357 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
358 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
359 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
360 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
364 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
365 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
366 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
367 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
368 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
369 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
370 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
371 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
372 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
373 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
374 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
375 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
376 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
377 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
378 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
379 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
380 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
381 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
382 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
383 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
384 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
389 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
390 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.21
Metatranscriptomes 0.84
Isolates 0.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.48
Nodule 0.63
Rhizoplane 7.59
Rhizosphere 88.5
Stem 0
Stem Tuber 0
Unclassified 1.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_5910558 2162886011 Bacteria 1335
2 JGI25153J46596_10000100 3300003215 Bacteria 98053
3 rootL2_10061107 3300003322 Bacteria 3014
4 rootL2_10073410 3300003322 Bacteria 3056
5 rootL2_10091361 3300003322 Bacteria 1679
6 Ga0055524_1000011 3300003775 Bacteria 261442
7 JGI25405J52794_10002762 3300003911 Bacteria 3042
8 Ga0058859_11489020 3300004798 Bacteria 630
9 Ga0058861_11388695 3300004800 Bacteria 1363
10 Ga0058862_10021887 3300004803 Unclassified 1158
11 Ga0065712_10386821 3300005290 Unclassified 740
12 Ga0065715_10510195 3300005293 Bacteria 772
13 Ga0070676_10433350 3300005328 Bacteria 921
14 Ga0070683_100001522 3300005329 Bacteria 17907
15 Ga0070683_100005595 3300005329 Bacteria 10494
16 Ga0070683_100078993 3300005329 Bacteria 3079
17 Ga0070690_100177579 3300005330 Bacteria 1470
18 Ga0070690_100378581 3300005330 Bacteria 1034
19 Ga0070690_100508524 3300005330 Bacteria 902
20 Ga0070690_100629644 3300005330 Unclassified 817
21 Ga0070690_100648740 3300005330 Bacteria 806
22 Ga0070670_100001055 3300005331 Bacteria 21884
23 Ga0070670_101126074 3300005331 Unclassified 716
24 Ga0068869_100005172 3300005334 Bacteria 8188
25 Ga0068869_100026920 3300005334 Bacteria 4005
26 Ga0068869_100090947 3300005334 Bacteria 2295
27 Ga0068869_100156294 3300005334 Bacteria 1772
28 Ga0068869_100182674 3300005334 Bacteria 1645
29 Ga0070666_10734333 3300005335 Bacteria 725
30 Ga0070680_100008542 3300005336 Bacteria 7844
31 Ga0070680_100146350 3300005336 Bacteria 1982
32 Ga0070682_100088871 3300005337 Bacteria 2017
33 Ga0070682_100117419 3300005337 Bacteria 1781
34 Ga0070660_100171521 3300005339 Bacteria 1752
35 Ga0070689_100160156 3300005340 Bacteria 1819
36 Ga0070689_100173939 3300005340 Bacteria 1746
37 Ga0070689_100383957 3300005340 Bacteria 1184
38 Ga0070689_100576246 3300005340 Bacteria 972
39 Ga0070691_10014606 3300005341 Bacteria 3605
40 Ga0070691_10017193 3300005341 Bacteria 3328
41 Ga0070687_100296023 3300005343 Unclassified 1025
42 Ga0070661_100023966 3300005344 Bacteria 4378
43 Ga0070661_100045717 3300005344 Bacteria 3201
44 Ga0070661_100056254 3300005344 Bacteria 2882
45 Ga0070661_100254167 3300005344 Unclassified 1357
46 Ga0070661_100461961 3300005344 Bacteria 1011
47 Ga0070692_10020022 3300005345 Bacteria 3238
48 Ga0070668_100111890 3300005347 Bacteria 2174
49 Ga0070675_100042408 3300005354 Bacteria 3718
50 Ga0070675_100065373 3300005354 Bacteria 3007
51 Ga0070675_100412561 3300005354 Unclassified 1206
52 Ga0070675_100597454 3300005354 Bacteria 1001
53 Ga0070671_100773076 3300005355 Bacteria 835
54 Ga0070674_100520971 3300005356 Bacteria 993
55 Ga0070674_100780955 3300005356 Bacteria 823
56 Ga0070673_100116463 3300005364 Bacteria 2223
57 Ga0070688_100026962 3300005365 Bacteria 3419
58 Ga0070688_100195391 3300005365 Archaea 1412
59 Ga0070688_100483835 3300005365 Unclassified 931
60 Ga0070659_100164338 3300005366 Bacteria 1816
61 Ga0070659_100250101 3300005366 Bacteria 1469
62 Ga0070659_100337158 3300005366 Bacteria 1263
63 Ga0070703_10000441 3300005406 Bacteria 16907
64 Ga0070709_10034389 3300005434 Bacteria 3072
65 Ga0070709_10567987 3300005434 Unclassified 870
66 Ga0070714_100002329 3300005435 Bacteria 13963
67 Ga0070714_100015276 3300005435 Bacteria 6176
68 Ga0070714_100017469 3300005435 Bacteria 5812
69 Ga0070714_100296206 3300005435 Unclassified 1507
70 Ga0070714_100309487 3300005435 Bacteria 1474
71 Ga0070713_100019735 3300005436 Bacteria 5156
72 Ga0070713_100080624 3300005436 Bacteria 2775
73 Ga0070713_100103328 3300005436 Bacteria 2472
74 Ga0070713_100379353 3300005436 Bacteria 1317
75 Ga0070710_10010313 3300005437 Bacteria 4587
76 Ga0070710_10026570 3300005437 Bacteria 3077
77 Ga0070710_10148220 3300005437 Bacteria 1445
78 Ga0070701_10003386 3300005438 Bacteria 6299
79 Ga0070701_10010894 3300005438 Bacteria 4039
80 Ga0070701_10073179 3300005438 Bacteria 1837
81 Ga0070701_10121134 3300005438 Unclassified 1474
82 Ga0070701_10215967 3300005438 Unclassified 1141
83 Ga0070711_100007151 3300005439 Bacteria 6775
84 Ga0070711_100027931 3300005439 Bacteria 3709
85 Ga0070711_100569007 3300005439 Bacteria 942
86 Ga0070705_100000032 3300005440 Bacteria 70341
87 Ga0070705_100355295 3300005440 Bacteria 1070
88 Ga0070700_100275018 3300005441 Bacteria 1218
89 Ga0070700_100377285 3300005441 Archaea 1059
90 Ga0070694_100001908 3300005444 Bacteria 12343
91 Ga0070694_100045163 3300005444 Bacteria 2952
92 Ga0070694_100140279 3300005444 Bacteria 1755
93 Ga0070694_100857798 3300005444 Bacteria 748
94 Ga0070708_100092880 3300005445 Bacteria 2750
95 Ga0070708_100346821 3300005445 Bacteria 1399
96 Ga0070708_101403958 3300005445 Bacteria 651
97 Ga0070663_100011611 3300005455 Bacteria 5536
98 Ga0070663_100534055 3300005455 Bacteria 978
99 Ga0070663_100590536 3300005455 Bacteria 933
100 Ga0070663_100853935 3300005455 Bacteria 784
101 Ga0070663_100935991 3300005455 Bacteria 750
102 Ga0070678_100565190 3300005456 Bacteria 1011
103 Ga0070678_100845862 3300005456 Bacteria 833
104 Ga0070662_100049951 3300005457 Bacteria 3017
105 Ga0070662_100708808 3300005457 Unclassified 852
106 Ga0070681_10007840 3300005458 Bacteria 10441
107 Ga0070681_10042828 3300005458 Bacteria 4536
108 Ga0070681_10067018 3300005458 Bacteria 3559
109 Ga0070681_10415209 3300005458 Bacteria 1257
110 Ga0070681_10632008 3300005458 Bacteria 985
111 Ga0068867_100062179 3300005459 Bacteria 2774
112 Ga0068867_100377232 3300005459 Bacteria 1190
113 Ga0068867_101081462 3300005459 Unclassified 731
114 Ga0070685_10168261 3300005466 Bacteria 1403
115 Ga0070706_100015547 3300005467 Bacteria 7029
116 Ga0070706_100211063 3300005467 Bacteria 1813
117 Ga0070707_100010108 3300005468 Bacteria 8782
118 Ga0070698_100003041 3300005471 Bacteria 18475
119 Ga0070698_100186839 3300005471 Bacteria 2010
120 Ga0070699_100001445 3300005518 Bacteria 21813
121 Ga0070699_100603124 3300005518 Bacteria 1001
122 Ga0070699_100919474 3300005518 Unclassified 801
123 Ga0070699_101322889 3300005518 Bacteria 661
124 Ga0070679_100016854 3300005530 Bacteria 7062
125 Ga0070679_100434728 3300005530 Bacteria 1257
126 Ga0070679_100440351 3300005530 Bacteria 1248
127 Ga0070679_101037549 3300005530 Bacteria 764
128 Ga0070684_100036102 3300005535 Bacteria 4235
129 Ga0070684_100044445 3300005535 Bacteria 3842
130 Ga0070684_100106805 3300005535 Bacteria 2507
131 Ga0070684_100256907 3300005535 Bacteria 1598
132 Ga0070684_100272588 3300005535 Bacteria 1549
133 Ga0070697_100111821 3300005536 Bacteria 2277
134 Ga0070697_100618893 3300005536 Unclassified 952
135 Ga0068853_100033849 3300005539 Bacteria 4335
136 Ga0068853_100271405 3300005539 Bacteria 1562
137 Ga0068853_100412703 3300005539 Bacteria 1265
138 Ga0070672_100016698 3300005543 Bacteria 5262
139 Ga0070672_100195024 3300005543 Bacteria 1692
140 Ga0070672_100261292 3300005543 Bacteria 1460
141 Ga0070686_100036321 3300005544 Bacteria 3050
142 Ga0070695_100000937 3300005545 Bacteria 15780
143 Ga0070695_100271699 3300005545 Unclassified 1242
144 Ga0070696_100000826 3300005546 Bacteria 19955
145 Ga0070696_100054405 3300005546 Bacteria 2789
146 Ga0070696_100169371 3300005546 Unclassified 1614
147 Ga0070696_100228743 3300005546 Bacteria 1398
148 Ga0070696_100424043 3300005546 Unclassified 1045
149 Ga0070696_100466040 3300005546 Bacteria 999
150 Ga0070665_100494675 3300005548 Bacteria 1234
151 Ga0070704_100005197 3300005549 Bacteria 7571
152 Ga0070704_100006752 3300005549 Bacteria 6792
153 Ga0070704_100062631 3300005549 Bacteria 2667
154 Ga0070704_100116708 3300005549 Bacteria 2041
155 Ga0070704_100201188 3300005549 Bacteria 1608
156 Ga0070704_100607691 3300005549 Unclassified 962
157 Ga0068855_100108380 3300005563 Bacteria 3190
158 Ga0068855_100139908 3300005563 Bacteria 2760
159 Ga0068855_100171128 3300005563 Bacteria 2460
160 Ga0068855_100210590 3300005563 Bacteria 2184
161 Ga0070664_100008005 3300005564 Bacteria 8538
162 Ga0070664_100008019 3300005564 Bacteria 8529
163 Ga0070664_100057020 3300005564 Bacteria 3320
164 Ga0070664_100131911 3300005564 Bacteria 2195
165 Ga0070664_100339964 3300005564 Bacteria 1363
166 Ga0068857_100034239 3300005577 Bacteria 4492
167 Ga0068857_100172348 3300005577 Bacteria 1967
168 Ga0068857_100243728 3300005577 Bacteria 1646
169 Ga0068857_100291240 3300005577 Bacteria 1503
170 Ga0068857_100584840 3300005577 Bacteria 1054
171 Ga0068854_100090031 3300005578 Bacteria 2281
172 Ga0068854_100265832 3300005578 Bacteria 1375
173 Ga0068856_100003167 3300005614 Bacteria 16769
174 Ga0068856_100069586 3300005614 Bacteria 3480
175 Ga0068856_100108887 3300005614 Bacteria 2767
176 Ga0070702_100135371 3300005615 Bacteria 1562
177 Ga0070702_100321205 3300005615 Bacteria 1079
178 Ga0070702_100403449 3300005615 Bacteria 979
179 Ga0068859_100001900 3300005617 Bacteria 21287
180 Ga0068859_100002751 3300005617 Bacteria 17831
181 Ga0068859_100404630 3300005617 Bacteria 1461
182 Ga0068864_100011945 3300005618 Bacteria 7169
183 Ga0068864_100411570 3300005618 Bacteria 1287
184 Ga0068866_10127992 3300005718 Bacteria 1440
185 Ga0068866_10179243 3300005718 Unclassified 1250
186 Ga0068861_100011697 3300005719 Bacteria 6106
187 Ga0068861_100191016 3300005719 Bacteria 1712
188 Ga0068861_100406332 3300005719 Bacteria 1210
189 Ga0068861_100457479 3300005719 Bacteria 1145
190 Ga0068851_10000500 3300005834 Bacteria 17092
191 Ga0068870_10088005 3300005840 Bacteria 1730
192 Ga0068870_10110343 3300005840 Unclassified 1570
193 Ga0068870_10242701 3300005840 Bacteria 1113
194 Ga0068863_100048611 3300005841 Bacteria 4022
195 Ga0068863_100115767 3300005841 Bacteria 2554
196 Ga0068863_100468931 3300005841 Bacteria 1237
197 Ga0068863_100904458 3300005841 Unclassified 883
198 Ga0068858_100158156 3300005842 Bacteria 2133
199 Ga0068858_100361606 3300005842 Unclassified 1391
200 Ga0068858_101444916 3300005842 Bacteria 678
201 Ga0068860_100000870 3300005843 Bacteria 33607
202 Ga0068860_100082372 3300005843 Bacteria 3060
203 Ga0068860_100105252 3300005843 Bacteria 2694
204 Ga0068860_100353300 3300005843 Bacteria 1447
205 Ga0068860_100388175 3300005843 Bacteria 1379
206 Ga0068860_100588532 3300005843 Bacteria 1117
207 Ga0068862_100001615 3300005844 Bacteria 20525
208 Ga0068862_100191213 3300005844 Bacteria 1842
209 Ga0068862_100604902 3300005844 Bacteria 1053
210 Ga0081455_10000119 3300005937 Bacteria 90937
211 Ga0081455_10003170 3300005937 Bacteria 19093
212 Ga0081455_10004119 3300005937 Bacteria 16443
213 Ga0081455_10008686 3300005937 Bacteria 10522
214 Ga0081455_10010105 3300005937 Bacteria 9622
215 Ga0081455_10017243 3300005937 Bacteria 6932
216 Ga0081455_10139075 3300005937 Bacteria 1888
217 Ga0081455_10184583 3300005937 Bacteria 1576
218 Ga0081455_10397911 3300005937 Unclassified 957
219 Ga0081455_10487375 3300005937 Bacteria 832
220 Ga0081538_10055537 3300005981 Bacteria 2330
221 Ga0081538_10100479 3300005981 Bacteria 1458
222 Ga0081540_1032177 3300005983 Bacteria 2868
223 Ga0081540_1038817 3300005983 Bacteria 2504
224 Ga0081540_1158584 3300005983 Bacteria 881
225 Ga0081539_10005293 3300005985 Bacteria 13278
226 Ga0081539_10205066 3300005985 Bacteria 907
227 Ga0075368_10169108 3300006042 Bacteria 918
228 Ga0070715_10065785 3300006163 Unclassified 1605
229 Ga0070715_10103903 3300006163 Bacteria 1330
230 Ga0070716_100506808 3300006173 Bacteria 891
231 Ga0070716_101009395 3300006173 Bacteria 658
232 Ga0070712_100002273 3300006175 Bacteria 11830
233 Ga0070712_100031647 3300006175 Bacteria 3566
234 Ga0070712_100040183 3300006175 Bacteria 3205
235 Ga0070712_100040648 3300006175 Bacteria 3189
236 Ga0070712_100045039 3300006175 Bacteria 3045
237 Ga0070712_100086388 3300006175 Bacteria 2286
238 Ga0070712_100810028 3300006175 Unclassified 804
239 Ga0075362_10015526 3300006177 Bacteria 3099
240 Ga0075367_10030118 3300006178 Bacteria 3109
241 Ga0075369_10042153 3300006186 Bacteria 1956
242 Ga0097621_100040333 3300006237 Unclassified 3754
243 Ga0097621_100137202 3300006237 Bacteria 2087
244 Ga0097621_100140901 3300006237 Unclassified 2060
245 Ga0097621_100653949 3300006237 Bacteria 965
246 Ga0068871_100013249 3300006358 Bacteria 6114
247 Ga0068871_100063640 3300006358 Bacteria 3018
248 Ga0068871_101103567 3300006358 Bacteria 742
249 Ga0075428_100014795 3300006844 Bacteria 8670
250 Ga0075428_100040465 3300006844 Bacteria 5127
251 Ga0075428_100849644 3300006844 Bacteria 969
252 Ga0075428_101353837 3300006844 Bacteria 748
253 Ga0075430_100161440 3300006846 Bacteria 1865
254 Ga0075430_100211930 3300006846 Bacteria 1607
255 Ga0075430_100461444 3300006846 Bacteria 1048
256 Ga0075431_100040935 3300006847 Unclassified 4777
257 Ga0075431_100187585 3300006847 Bacteria 2120
258 Ga0075433_10416862 3300006852 Bacteria 1184
259 Ga0075434_100059001 3300006871 Bacteria 3814
260 Ga0075434_100268291 3300006871 Bacteria 1726
261 Ga0075434_100350962 3300006871 Bacteria 1496
262 Ga0075434_100440650 3300006871 Bacteria 1324
263 Ga0075434_100683642 3300006871 Unclassified 1044
264 Ga0075434_100801115 3300006871 Bacteria 958
265 Ga0075429_100240735 3300006880 Bacteria 1585
266 Ga0068865_100009081 3300006881 Bacteria 6151
267 Ga0068865_100361902 3300006881 Bacteria 1178
268 Ga0068865_100778100 3300006881 Bacteria 824
269 Ga0068865_101035649 3300006881 Unclassified 720
270 Ga0075436_100024514 3300006914 Bacteria 4146
271 Ga0075436_100187998 3300006914 Bacteria 1461
272 Ga0075436_100209942 3300006914 Bacteria 1380
273 Ga0075436_100219034 3300006914 Unclassified 1350
274 Ga0075436_100423504 3300006914 Bacteria 967
275 Ga0075436_100463914 3300006914 Unclassified 923
276 Ga0097620_100001900 3300006931 Bacteria 21287
277 Ga0097620_100002751 3300006931 Bacteria 17831
278 Ga0097620_100404625 3300006931 Bacteria 1461
279 Ga0099823_1024448 3300006944 Bacteria 5464
280 Ga0075435_100144319 3300007076 Bacteria 1999
281 Ga0099795_10001115 3300007788 Bacteria 5585
282 Ga0099795_10180550 3300007788 Unclassified 881
283 Ga0105240_10046260 3300009093 Bacteria 5515
284 Ga0105240_10368771 3300009093 Bacteria 1624
285 Ga0111539_10002011 3300009094 Bacteria 27132
286 Ga0111539_10038472 3300009094 Bacteria 5769
287 Ga0111539_10078450 3300009094 Bacteria 3885
288 Ga0111539_10094234 3300009094 Bacteria 3517
289 Ga0111539_10179662 3300009094 Bacteria 2472
290 Ga0111539_10235858 3300009094 Bacteria 2130
291 Ga0111539_10353482 3300009094 Bacteria 1710
292 Ga0111539_10488853 3300009094 Unclassified 1434
293 Ga0111539_11151418 3300009094 Bacteria 901
294 Ga0105245_10201236 3300009098 Bacteria 1912
295 Ga0105247_10234281 3300009101 Bacteria 1248
296 Ga0114129_10013291 3300009147 Bacteria 11731
297 Ga0114129_10055169 3300009147 Bacteria 5570
298 Ga0114129_10186680 3300009147 Bacteria 2817
299 Ga0114129_10285123 3300009147 Bacteria 2206
300 Ga0114129_10384671 3300009147 Bacteria 1852
301 Ga0114129_10389251 3300009147 Bacteria 1839
302 Ga0114129_10506256 3300009147 Bacteria 1576
303 Ga0114129_10624806 3300009147 Bacteria 1393
304 Ga0114129_11130365 3300009147 Bacteria 979
305 Ga0114129_11155908 3300009147 Bacteria 966
306 Ga0114129_11333174 3300009147 Bacteria 888
307 Ga0114129_11509410 3300009147 Unclassified 825
308 Ga0114129_11621281 3300009147 Bacteria 792
309 Ga0105243_10552502 3300009148 Bacteria 1100
310 Ga0105243_10602355 3300009148 Bacteria 1058
311 Ga0105243_10978035 3300009148 Unclassified 847
312 Ga0105241_10148370 3300009174 Bacteria 1916
313 Ga0105241_10158688 3300009174 Bacteria 1857
314 Ga0105242_10378762 3300009176 Bacteria 1315
315 Ga0105242_10396315 3300009176 Bacteria 1287
316 Ga0105242_10589539 3300009176 Bacteria 1072
317 Ga0105242_10776779 3300009176 Bacteria 946
318 Ga0105242_11245096 3300009176 Unclassified 765
319 Ga0105248_10176427 3300009177 Bacteria 2408
320 Ga0105248_10680438 3300009177 Bacteria 1161
321 Ga0105248_11060786 3300009177 Bacteria 916
322 Ga0105237_10006095 3300009545 Bacteria 13480
323 Ga0105237_10020853 3300009545 Bacteria 6748
324 Ga0105237_10109102 3300009545 Bacteria 2759
325 Ga0105237_10377707 3300009545 Bacteria 1422
326 Ga0105237_10622452 3300009545 Bacteria 1086
327 Ga0105238_10000679 3300009551 Bacteria 35795
328 Ga0105238_10010451 3300009551 Bacteria 9315
329 Ga0105238_10027367 3300009551 Bacteria 5809
330 Ga0105238_10287277 3300009551 Bacteria 1627
331 Ga0105249_10001320 3300009553 Bacteria 21711
332 Ga0105249_10395607 3300009553 Unclassified 1411
333 Ga0105249_10429497 3300009553 Bacteria 1356
334 Ga0105249_10463690 3300009553 Bacteria 1307
335 Ga0099796_10187129 3300010159 Bacteria 834
336 Ga0105239_10002049 3300010375 Bacteria 26140
337 Ga0105239_10008461 3300010375 Bacteria 11701
338 Ga0105239_10012961 3300010375 Bacteria 9276
339 Ga0105239_10013235 3300010375 Bacteria 9169
340 Ga0105239_10123513 3300010375 Bacteria 2876
341 Ga0105239_10193538 3300010375 Bacteria 2277
342 Ga0105239_10376430 3300010375 Bacteria 1605
343 Ga0105239_10740467 3300010375 Bacteria 1125
344 Ga0105246_10013675 3300011119 Bacteria 5092
345 Ga0105246_10292567 3300011119 Bacteria 1311
346 Ga0105246_10564285 3300011119 Bacteria 978
347 Ga0157373_10122589 3300013100 Bacteria 1827
348 Ga0157373_10316729 3300013100 Bacteria 1109
349 Ga0157370_10005882 3300013104 Bacteria 13674
350 Ga0157370_10039454 3300013104 Bacteria 4563
351 Ga0157370_10091494 3300013104 Bacteria 2856
352 Ga0157370_10403493 3300013104 Bacteria 1258
353 Ga0157369_10001683 3300013105 Bacteria 26984
354 Ga0157369_10009927 3300013105 Bacteria 10878
355 Ga0157369_10029345 3300013105 Bacteria 6078
356 Ga0157369_10197739 3300013105 Bacteria 2110
357 Ga0171462_1011 3300013250 Bacteria 229282
358 Ga0157374_10037229 3300013296 Unclassified 4464
359 Ga0157374_10041905 3300013296 Bacteria 4221
360 Ga0157374_10094657 3300013296 Bacteria 2855
361 Ga0157374_10294597 3300013296 Bacteria 1604
362 Ga0157378_10020587 3300013297 Bacteria 5801
363 Ga0157378_10121156 3300013297 Bacteria 2411
364 Ga0157378_10168508 3300013297 Bacteria 2052
365 Ga0157378_10174250 3300013297 Bacteria 2020
366 Ga0157378_10293061 3300013297 Bacteria 1572
367 Ga0157378_10308421 3300013297 Bacteria 1534
368 Ga0157378_10385015 3300013297 Unclassified 1378
369 Ga0157378_10577608 3300013297 Bacteria 1133
370 Ga0163162_10025885 3300013306 Bacteria 5798
371 Ga0163162_10053017 3300013306 Bacteria 4076
372 Ga0163162_10222402 3300013306 Bacteria 2018
373 Ga0157372_10031051 3300013307 Bacteria 5848
374 Ga0157372_10431177 3300013307 Bacteria 1537
375 Ga0157375_10001967 3300013308 Bacteria 17714
376 Ga0157375_10058333 3300013308 Bacteria 3818
377 Ga0157375_10087812 3300013308 Bacteria 3163
378 Ga0157375_10200558 3300013308 Unclassified 2151
379 Ga0157375_10542526 3300013308 Bacteria 1325
380 Ga0157375_10627423 3300013308 Bacteria 1232
381 Ga0157375_11620631 3300013308 Bacteria 765
382 Ga0157375_11639488 3300013308 Unclassified 761
383 Ga0163163_10001306 3300014325 Bacteria 21051
384 Ga0163163_10170273 3300014325 Bacteria 2224
385 Ga0163163_10202111 3300014325 Bacteria 2035
386 Ga0157380_10026287 3300014326 Bacteria 4419
387 Ga0157380_10322618 3300014326 Bacteria 1432
388 Ga0157377_10124201 3300014745 Bacteria 1568
389 Ga0157377_10367727 3300014745 Unclassified 970
390 Ga0157379_10029505 3300014968 Bacteria 4877
391 Ga0157379_10129263 3300014968 Bacteria 2273
392 Ga0157379_10160461 3300014968 Bacteria 2029
393 Ga0157379_10211813 3300014968 Bacteria 1754
394 Ga0157376_10023471 3300014969 Bacteria 4827
395 Ga0157376_10040980 3300014969 Bacteria 3789
396 Ga0157376_10261577 3300014969 Bacteria 1621
397 Ga0157376_10309989 3300014969 Bacteria 1497
398 Ga0157376_10315375 3300014969 Unclassified 1485
399 Ga0157376_10452634 3300014969 Unclassified 1252
400 Ga0182006_1109436 3300015261 Unclassified 971
401 Ga0163161_10663337 3300017792 Bacteria 865
402 Ga0163161_10960066 3300017792 Bacteria 727
403 Ga0213872_10023263 3300021361 Bacteria 2851
404 Ga0213876_10052853 3300021384 Bacteria 2146
405 Ga0213876_10099456 3300021384 Unclassified 1542
406 Ga0213871_10022240 3300021441 Bacteria 1588
407 Ga0209675_1000957 3300025291 Bacteria 18303
408 Ga0209564_1000143 3300025295 Bacteria 177136
409 Ga0209758_1000189 3300025297 Bacteria 138296
410 Ga0209256_1000111 3300025299 Bacteria 178442
411 Ga0209257_1048775 3300025304 Bacteria 1210
412 Ga0207697_10010945 3300025315 Bacteria 3854
413 Ga0207697_10025775 3300025315 Bacteria 2404
414 Ga0207653_10001223 3300025885 Bacteria 8400
415 Ga0207692_10029000 3300025898 Bacteria 2624
416 Ga0207692_10043848 3300025898 Bacteria 2228
417 Ga0207692_10429061 3300025898 Unclassified 829
418 Ga0207642_10195459 3300025899 Bacteria 1113
419 Ga0207688_10070309 3300025901 Archaea 1984
420 Ga0207680_10102001 3300025903 Bacteria 1845
421 Ga0207680_10259370 3300025903 Bacteria 1203
422 Ga0207647_10074469 3300025904 Bacteria 2045
423 Ga0207685_10095939 3300025905 Unclassified 1259
424 Ga0207699_10003869 3300025906 Bacteria 7153
425 Ga0207699_10021822 3300025906 Bacteria 3459
426 Ga0207645_10112242 3300025907 Bacteria 1765
427 Ga0207643_10152057 3300025908 Bacteria 1388
428 Ga0207684_10054127 3300025910 Bacteria 3405
429 Ga0207684_10065115 3300025910 Bacteria 3095
430 Ga0207684_10112531 3300025910 Bacteria 2330
431 Ga0207654_10066580 3300025911 Unclassified 2125
432 Ga0207654_10094388 3300025911 Bacteria 1831
433 Ga0207654_10121236 3300025911 Bacteria 1642
434 Ga0207707_10000541 3300025912 Bacteria 38481
435 Ga0207707_10076207 3300025912 Bacteria 2927
436 Ga0207707_10089339 3300025912 Bacteria 2692
437 Ga0207707_10163949 3300025912 Bacteria 1942
438 Ga0207707_10832948 3300025912 Bacteria 767
439 Ga0207695_10118403 3300025913 Bacteria 2620
440 Ga0207671_10033203 3300025914 Unclassified 3840
441 Ga0207693_10000618 3300025915 Bacteria 31778
442 Ga0207693_10012664 3300025915 Bacteria 6813
443 Ga0207693_10013607 3300025915 Bacteria 6557
444 Ga0207693_10026456 3300025915 Bacteria 4592
445 Ga0207693_10027324 3300025915 Bacteria 4512
446 Ga0207693_10052515 3300025915 Bacteria 3197
447 Ga0207693_10185032 3300025915 Bacteria 1640
448 Ga0207663_10001846 3300025916 Bacteria 10003
449 Ga0207663_10017163 3300025916 Bacteria 4027
450 Ga0207663_10039414 3300025916 Bacteria 2863
451 Ga0207663_10064525 3300025916 Bacteria 2337
452 Ga0207660_10008198 3300025917 Bacteria 6761
453 Ga0207660_10011616 3300025917 Bacteria 5741
454 Ga0207660_10493938 3300025917 Bacteria 993
455 Ga0207660_10609006 3300025917 Bacteria 890
456 Ga0207662_10034726 3300025918 Bacteria 2943
457 Ga0207662_10122212 3300025918 Bacteria 1634
458 Ga0207657_10000717 3300025919 Bacteria 35166
459 Ga0207657_10002950 3300025919 Bacteria 18254
460 Ga0207657_10042712 3300025919 Bacteria 3998
461 Ga0207649_10016319 3300025920 Bacteria 4184
462 Ga0207649_10022079 3300025920 Bacteria 3675
463 Ga0207649_10370137 3300025920 Bacteria 1065
464 Ga0207649_10388441 3300025920 Bacteria 1042
465 Ga0207652_10005910 3300025921 Bacteria 9899
466 Ga0207652_10201794 3300025921 Bacteria 1790
467 Ga0207694_10089548 3300025924 Bacteria 2427
468 Ga0207694_10233146 3300025924 Bacteria 1504
469 Ga0207694_10291895 3300025924 Unclassified 1341
470 Ga0207650_10002100 3300025925 Bacteria 13924
471 Ga0207659_10029567 3300025926 Bacteria 3736
472 Ga0207659_10050229 3300025926 Bacteria 2962
473 Ga0207659_10670400 3300025926 Bacteria 887
474 Ga0207700_10070167 3300025928 Bacteria 2692
475 Ga0207700_10160358 3300025928 Bacteria 1867
476 Ga0207664_10033072 3300025929 Unclassified 3969
477 Ga0207664_10062432 3300025929 Bacteria 2976
478 Ga0207664_10105987 3300025929 Bacteria 2330
479 Ga0207664_10267410 3300025929 Unclassified 1497
480 Ga0207664_10315615 3300025929 Bacteria 1378
481 Ga0207664_10333431 3300025929 Bacteria 1340
482 Ga0207644_10337171 3300025931 Unclassified 1222
483 Ga0207644_10402589 3300025931 Bacteria 1119
484 Ga0207690_10098241 3300025932 Bacteria 2085
485 Ga0207690_10261233 3300025932 Bacteria 1342
486 Ga0207690_10285163 3300025932 Bacteria 1287
487 Ga0207706_10075427 3300025933 Bacteria 2966
488 Ga0207706_10515868 3300025933 Unclassified 1031
489 Ga0207706_10687361 3300025933 Unclassified 875
490 Ga0207709_10216070 3300025935 Bacteria 1379
491 Ga0207709_10319217 3300025935 Bacteria 1162
492 Ga0207670_10206838 3300025936 Bacteria 1494
493 Ga0207670_10533799 3300025936 Bacteria 957
494 Ga0207669_10593924 3300025937 Bacteria 899
495 Ga0207665_10012300 3300025939 Bacteria 5621
496 Ga0207665_10167118 3300025939 Bacteria 1586
497 Ga0207665_10901704 3300025939 Bacteria 701
498 Ga0207691_10412429 3300025940 Bacteria 1151
499 Ga0207691_10439135 3300025940 Unclassified 1111
500 Ga0207711_10092722 3300025941 Bacteria 2659
501 Ga0207711_10287360 3300025941 Bacteria 1515
502 Ga0207689_10004614 3300025942 Bacteria 12460
503 Ga0207689_10046924 3300025942 Bacteria 3568
504 Ga0207689_10151595 3300025942 Bacteria 1911
505 Ga0207661_10005842 3300025944 Bacteria 8682
506 Ga0207661_10008495 3300025944 Bacteria 7340
507 Ga0207661_10096883 3300025944 Bacteria 2469
508 Ga0207679_10523364 3300025945 Bacteria 1061
509 Ga0207667_10168343 3300025949 Bacteria 2252
510 Ga0207667_10259558 3300025949 Bacteria 1777
511 Ga0207651_10026977 3300025960 Bacteria 3600
512 Ga0207651_10027427 3300025960 Bacteria 3577
513 Ga0207651_10115557 3300025960 Bacteria 2024
514 Ga0207651_10732040 3300025960 Bacteria 873
515 Ga0207712_10061112 3300025961 Bacteria 2673
516 Ga0207712_10344833 3300025961 Bacteria 1236
517 Ga0207668_10059052 3300025972 Bacteria 2685
518 Ga0207677_10048957 3300026023 Unclassified 2848
519 Ga0207703_10411021 3300026035 Bacteria 1257
520 Ga0207639_10022195 3300026041 Bacteria 4569
521 Ga0207639_10110242 3300026041 Bacteria 2241
522 Ga0207639_10773549 3300026041 Bacteria 894
523 Ga0207639_10780454 3300026041 Archaea 890
524 Ga0207678_10007780 3300026067 Bacteria 9468
525 Ga0207678_10012879 3300026067 Bacteria 7341
526 Ga0207678_10020352 3300026067 Bacteria 5821
527 Ga0207678_10087387 3300026067 Bacteria 2664
528 Ga0207678_10179764 3300026067 Bacteria 1806
529 Ga0207678_10391407 3300026067 Bacteria 1202
530 Ga0207678_10541343 3300026067 Bacteria 1018
531 Ga0207708_10001022 3300026075 Bacteria 20938
532 Ga0207708_10005193 3300026075 Bacteria 9600
533 Ga0207708_10062463 3300026075 Bacteria 2846
534 Ga0207708_10233878 3300026075 Bacteria 1476
535 Ga0207708_10854836 3300026075 Unclassified 786
536 Ga0207702_10019580 3300026078 Bacteria 5601
537 Ga0207702_10082938 3300026078 Bacteria 2788
538 Ga0207702_11117688 3300026078 Bacteria 782
539 Ga0207641_10044330 3300026088 Bacteria 3741
540 Ga0207641_10296644 3300026088 Unclassified 1525
541 Ga0207648_10337789 3300026089 Bacteria 1356
542 Ga0207648_10432810 3300026089 Bacteria 1196
543 Ga0207676_10008478 3300026095 Bacteria 7308
544 Ga0207676_10351517 3300026095 Unclassified 1363
545 Ga0207676_10356425 3300026095 Bacteria 1354
546 Ga0207674_10003569 3300026116 Bacteria 18971
547 Ga0207674_10059274 3300026116 Bacteria 3874
548 Ga0207674_10097832 3300026116 Bacteria 2918
549 Ga0207674_10257606 3300026116 Bacteria 1692
550 Ga0207674_10339096 3300026116 Bacteria 1453
551 Ga0207674_10459910 3300026116 Bacteria 1230
552 Ga0207674_10573474 3300026116 Bacteria 1090
553 Ga0207674_10603567 3300026116 Bacteria 1060
554 Ga0207675_100010598 3300026118 Bacteria 8633
555 Ga0207675_100086481 3300026118 Bacteria 2944
556 Ga0207675_100112491 3300026118 Bacteria 2570
557 Ga0207675_100191758 3300026118 Unclassified 1960
558 Ga0207675_100506599 3300026118 Unclassified 1202
559 Ga0207683_10015532 3300026121 Bacteria 6483
560 Ga0207683_10151702 3300026121 Bacteria 2091
561 Ga0207683_10222157 3300026121 Bacteria 1721
562 Ga0207698_10098675 3300026142 Bacteria 2414
563 Ga0209389_1000222 3300027296 Bacteria 38949
564 Ga0209489_101154 3300027361 Bacteria 53677
565 Ga0207428_10018250 3300027907 Bacteria 5996
566 Ga0207428_10067820 3300027907 Bacteria 2808
567 Ga0268266_11046144 3300028379 Bacteria 790
568 Ga0268265_10002040 3300028380 Bacteria 15844
569 Ga0268264_10001009 3300028381 Bacteria 28574
570 Ga0268264_10089061 3300028381 Bacteria 2657
571 Ga0268264_10090713 3300028381 Unclassified 2634
572 Ga0268264_10503933 3300028381 Unclassified 1181
573 Ga0268264_10784014 3300028381 Unclassified 951
574 Ga0265319_1039497 3300028563 Bacteria 1599
575 Ga0265334_10177353 3300028573 Unclassified 745
576 Ga0265318_10001006 3300028577 Bacteria 18018
577 Ga0265332_10102283 3300031238 Bacteria 1208
578 Ga0265328_10021814 3300031239 Bacteria 2441
579 Ga0265320_10000218 3300031240 Bacteria 46495
580 Ga0265325_10011290 3300031241 Bacteria 5132
581 Ga0265329_10000485 3300031242 Bacteria 20653
582 Ga0265329_10126595 3300031242 Unclassified 821
583 Ga0265340_10001203 3300031247 Bacteria 14795
584 Ga0265339_10007117 3300031249 Bacteria 7265
585 Ga0265331_10001063 3300031250 Bacteria 21390
586 Ga0265316_10006166 3300031344 Bacteria 11503
587 Ga0265316_10188917 3300031344 Unclassified 1531
588 Ga0307408_100009589 3300031548 Bacteria 6387
589 Ga0307408_100426121 3300031548 Unclassified 1145
590 Ga0265313_10004470 3300031595 Bacteria 10713
591 Ga0265314_10013146 3300031711 Bacteria 6707
592 Ga0265314_10015537 3300031711 Bacteria 6040
593 Ga0265342_10000161 3300031712 Bacteria 75750
594 Ga0316576_10030162 3300031727 Bacteria 3838
595 Ga0307405_10008433 3300031731 Bacteria 5224
596 Ga0307405_10372126 3300031731 Archaea 1109
597 Ga0307413_10004713 3300031824 Bacteria 5985
598 Ga0307410_10001714 3300031852 Bacteria 10114
599 Ga0307410_10009911 3300031852 Bacteria 5372
600 Ga0307410_10022097 3300031852 Bacteria 3926
601 Ga0307410_10689604 3300031852 Bacteria 860
602 Ga0307406_10011701 3300031901 Bacteria 4982
603 Ga0307406_10099027 3300031901 Bacteria 1981
604 Ga0307407_10002469 3300031903 Bacteria 7250
605 Ga0307407_10003660 3300031903 Bacteria 6360
606 Ga0307407_10015910 3300031903 Bacteria 3732
607 Ga0307412_10440661 3300031911 Bacteria 1071
608 Ga0307409_100000929 3300031995 Bacteria 13622
609 Ga0307409_100005561 3300031995 Bacteria 7278
610 Ga0307409_100015738 3300031995 Bacteria 4976
611 Ga0307416_100009215 3300032002 Bacteria 6443
612 Ga0307416_100014606 3300032002 Bacteria 5390
613 Ga0307416_100217598 3300032002 Bacteria 1829
614 Ga0307416_100355916 3300032002 Bacteria 1484
615 Ga0307416_101709002 3300032002 Unclassified 734
616 Ga0307414_10012130 3300032004 Bacteria 5083
617 Ga0307414_10110349 3300032004 Bacteria 2092
618 Ga0307411_10043854 3300032005 Bacteria 2864
619 Ga0307411_10129070 3300032005 Bacteria 1844
620 Ga0307411_10984723 3300032005 Bacteria 754
621 Ga0307415_100002073 3300032126 Bacteria 9911
622 Ga0307415_100017931 3300032126 Bacteria 4259
623 Ga0307415_100233927 3300032126 Bacteria 1482
624 Ga0373958_0002462 3300034819 Bacteria 2598
625 Ga0373944_0000743 3300035089 Bacteria 7923
626 Ga0373936_0092848 3300035113 Bacteria 1267
627 Ga0373939_0040620 3300035114 Bacteria 1398
628 Ga0373939_0159073 3300035114 Bacteria 828
629 Ga0373943_0000966 3300035170 Bacteria 12768
630 Ga0373946_0001677 3300035171 Bacteria 7717
631 Ga0373961_0019263 3300035241 Bacteria 1791
632 Ga0316574_0553214 3300035398 Bacteria 714
633 Ga0373931_0237084 3300035691 Unclassified 1104
634 Ga0373931_0239484 3300035691 Bacteria 1099
635 Ga0373935_0011156 3300035692 Bacteria 5395
636 Ga0373927_0010448 3300035695 Bacteria 6189
637 Ga0373927_0059848 3300035695 Bacteria 2464
638 Ga0373927_0092120 3300035695 Bacteria 1969
639 Ga0373947_0023317 3300035725 Bacteria 3598
640 Ga0373947_0189742 3300035725 Bacteria 1341
641 Ga0373937_0268436 3300036401 Bacteria 1610
642 Ga0373925_0003069 3300037068 Bacteria 13129
643 Ga0395899_0172406 3300037312 Bacteria 1523
644 Ga0395900_0003828 3300037418 Bacteria 16091
645 Ga0395900_0582459 3300037418 Unclassified 1061
646 Ga0395898_0087829 3300037466 Bacteria 2995
647 Ga0395898_0982073 3300037466 Bacteria 781
648 Ga0395901_0001187 3300038443 Bacteria 27723
649 Ga0436365_0127917 3300039437 Bacteria 8397
650 Ga0436365_0234493 3300039437 Bacteria 2074
651 Ga0436360_0669019 3300039438 Bacteria 1033
652 Ga0436360_1377598 3300039438 Viruses 2788
653 Ga0436361_0905442 3300039447 Bacteria 13471
654 Ga0436363_1400321 3300039450 Bacteria 644
655 Ga0451802_0958627 3300041460 Bacteria 687
656 Ga0439458_0023570 3300042157 Bacteria 1436
657 Ga0453683_0457529 3300044673 Unclassified 826
658 Ga0466963_0008636 3300044694 Bacteria 6115
659 Ga0451576_0059128 3300045051 Bacteria 4002
660 Ga0451576_0194241 3300045051 Unclassified 2120
661 Ga0451576_0326113 3300045051 Bacteria 1607
662 Ga0466967_0180843 3300045976 Bacteria 1989
663 Ga0495592_0093137 3300046454 Bacteria 2158
664 Ga0495603_0060187 3300046455 Bacteria 2244
665 Ga0495629_0000349 3300046459 Bacteria 39311
666 Ga0495641_0000494 3300046461 Bacteria 33001
667 Ga0495653_0003625 3300046463 Bacteria 12451
668 Ga0495653_0024077 3300046463 Bacteria 4912
669 Ga0495580_0253343 3300046472 Bacteria 1205
670 Ga0495582_0000253 3300046473 Bacteria 29763
671 Ga0495639_0006126 3300046475 Bacteria 5169
672 Ga0495662_0000205 3300046476 Bacteria 24502
673 Ga0495662_0043692 3300046476 Bacteria 2163
674 Ga0495664_0022915 3300046477 Bacteria 3622
675 Ga0495618_0034297 3300046514 Bacteria 3182
676 Ga0495628_0017929 3300046516 Bacteria 5876
677 Ga0495628_0481563 3300046516 Unclassified 898
678 Ga0495630_0257104 3300046517 Bacteria 1334
679 Ga0495630_0308423 3300046517 Bacteria 1209
680 Ga0495648_0177987 3300046524 Bacteria 1084
681 Ga0495666_0016357 3300046526 Bacteria 3695
682 Ga0495642_0254516 3300046528 Bacteria 768
683 Ga0495665_0000739 3300046531 Bacteria 16923
684 Ga0495640_0018948 3300046533 Bacteria 5090
685 Ga0495640_0027138 3300046533 Bacteria 4133
686 Ga0495586_0220147 3300046535 Bacteria 1079
687 Ga0495621_0007307 3300046539 Bacteria 3267
688 Ga0495645_0066369 3300046543 Bacteria 2608
689 Ga0495667_0065619 3300046559 Bacteria 2374
690 Ga0495634_0018604 3300046642 Bacteria 4942
691 Ga0495635_0010686 3300046663 Bacteria 6427
692 Ga0495635_0012684 3300046663 Bacteria 5911
693 Ga0495599_0021649 3300046678 Bacteria 4011
694 Ga0495623_0090655 3300046679 Bacteria 1877
695 Ga0495646_0052672 3300046680 Bacteria 2457
696 Ga0495647_0005575 3300046681 Bacteria 4132
697 Ga0495658_0001095 3300046683 Bacteria 14299
698 Ga0495658_0178012 3300046683 Bacteria 1319
699 Ga0495669_0160901 3300046684 Bacteria 1065
700 Ga0495613_0001699 3300046689 Bacteria 16771
701 Ga0495624_0007533 3300046690 Bacteria 7638
702 Ga0495600_0012981 3300046809 Bacteria 5223
703 Ga0495581_0005659 3300047315 Bacteria 7246
704 Ga0495604_0132326 3300047317 Bacteria 1791
705 Ga0495674_0014632 3300047319 Bacteria 7343
706 Ga0495674_0018393 3300047319 Bacteria 6505
707 Ga0495672_0000252 3300047320 Bacteria 75012
708 Ga0495672_0043084 3300047320 Bacteria 2716
709 Ga0495676_0000940 3300047321 Bacteria 24451
710 Ga0495680_0000259 3300047322 Bacteria 58560
711 Ga0495680_0022942 3300047322 Bacteria 5195
712 Ga0495684_0011822 3300047471 Bacteria 6734
713 Ga0495684_0056659 3300047471 Bacteria 2987
714 Ga0495593_0002481 3300047673 Bacteria 11097
715 Ga0495614_0001088 3300048089 Bacteria 11627
716 Ga0496100_0004514 3300048903 Bacteria 7390
717 Ga0496100_0110783 3300048903 Bacteria 1906
718 Ga0496100_0354437 3300048903 Bacteria 1109
719 Ga0496101_0044033 3300048904 Bacteria 3193
720 Ga0496101_0070616 3300048904 Bacteria 2558
721 Ga0496101_0179135 3300048904 Bacteria 1631
722 Ga0496101_0520546 3300048904 Unclassified 940
723 Ga0496101_0529270 3300048904 Bacteria 932
724 Ga0496102_0001079 3300048905 Bacteria 25231
725 Ga0496102_0005628 3300048905 Bacteria 10635
726 Ga0496102_0099696 3300048905 Bacteria 2697
727 Ga0496102_0474165 3300048905 Bacteria 1173
728 Ga0496102_0515282 3300048905 Bacteria 1118
729 Ga0496102_0893884 3300048905 Bacteria 810
730 Ga0496103_0005182 3300048906 Bacteria 7843
731 Ga0496103_0450283 3300048906 Bacteria 826
732 Ga0496104_0009713 3300048907 Bacteria 8576
733 Ga0496104_0037487 3300048907 Bacteria 4534
734 Ga0496104_0076592 3300048907 Bacteria 3186
735 Ga0496104_0098271 3300048907 Bacteria 2802
736 Ga0496104_0147025 3300048907 Bacteria 2263
737 Ga0496104_0228192 3300048907 Bacteria 1774
738 Ga0496105_0012687 3300048908 Bacteria 6674
739 Ga0496105_0019247 3300048908 Bacteria 5506
740 Ga0496105_0031405 3300048908 Bacteria 4354
741 Ga0496105_0036081 3300048908 Bacteria 4071
742 Ga0496105_0132171 3300048908 Bacteria 2057
743 Ga0496106_0001865 3300048909 Bacteria 15770
744 Ga0496106_0009863 3300048909 Bacteria 7050
745 Ga0496106_0035374 3300048909 Bacteria 3735
746 Ga0496106_0137969 3300048909 Bacteria 1917
747 Ga0496106_0230381 3300048909 Bacteria 1479
748 Ga0496106_0748422 3300048909 Unclassified 777
749 Ga0496107_0003491 3300048910 Bacteria 10515
750 Ga0496107_0004909 3300048910 Bacteria 9092
751 Ga0496108_0001245 3300048911 Bacteria 19959
752 Ga0496108_0014845 3300048911 Bacteria 6354
753 Ga0496108_0064999 3300048911 Bacteria 3074
754 Ga0496108_0188551 3300048911 Bacteria 1787
755 Ga0496109_0000776 3300048912 Bacteria 26522
756 Ga0496109_0025178 3300048912 Bacteria 5300
757 Ga0496109_0062596 3300048912 Bacteria 3403
758 Ga0496109_0164855 3300048912 Bacteria 2077
759 Ga0496109_0185305 3300048912 Bacteria 1956
760 Ga0496110_0009842 3300048913 Bacteria 7746
761 Ga0496110_0047300 3300048913 Bacteria 3766
762 Ga0496110_0147871 3300048913 Bacteria 2126
763 Ga0496110_0330428 3300048913 Bacteria 1389
764 Ga0496111_0005089 3300048914 Bacteria 8365
765 Ga0496111_0158184 3300048914 Bacteria 1681
766 Ga0496112_0001988 3300048915 Bacteria 16174
767 Ga0496112_0055010 3300048915 Unclassified 3911
768 Ga0496112_0135857 3300048915 Bacteria 2429
769 Ga0496112_0575533 3300048915 Unclassified 1059
770 Ga0496113_0004169 3300048916 Bacteria 8829
771 Ga0496113_0316436 3300048916 Bacteria 1251
772 Ga0496113_0509490 3300048916 Bacteria 966
773 Ga0496114_0001324 3300048917 Bacteria 18766
774 Ga0496114_0054464 3300048917 Bacteria 3335
775 Ga0496114_0056712 3300048917 Bacteria 3269
776 Ga0496114_0342937 3300048917 Bacteria 1321
777 Ga0496114_0390085 3300048917 Bacteria 1233
778 Ga0496114_0570909 3300048917 Bacteria 999
779 Ga0496115_0017003 3300048918 Bacteria 5548
780 Ga0496115_0022385 3300048918 Bacteria 4896
781 Ga0496115_0027930 3300048918 Bacteria 4417
782 Ga0496115_0044451 3300048918 Bacteria 3542
783 Ga0496115_0122277 3300048918 Bacteria 2142
784 Ga0496115_0415150 3300048918 Unclassified 1091
785 Ga0496115_0430586 3300048918 Bacteria 1068
786 Ga0496115_0772558 3300048918 Bacteria 750
787 Ga0496121_0136933 3300048924 Bacteria 1823
788 Ga0496126_0023838 3300048929 Bacteria 5924
789 Ga0496126_0032926 3300048929 Bacteria 4878
790 Ga0501323_054010 3300049539 Bacteria 615
791 Ga0501031_0018701 3300049568 Bacteria 4511
792 Ga0501032_0003322 3300049569 Bacteria 12372
793 Ga0501032_0004094 3300049569 Bacteria 11049
794 Ga0501033_0003616 3300049570 Bacteria 12609
795 Ga0501034_0000013 3300049571 Bacteria 297898
796 Ga0501034_0005157 3300049571 Bacteria 14326
797 Ga0501036_0000908 3300049572 Bacteria 22186
798 Ga0501036_0055583 3300049572 Unclassified 3354
799 Ga0501037_0014276 3300049573 Bacteria 5853
800 Ga0501038_0004868 3300049574 Bacteria 12472
801 Ga0501038_0051627 3300049574 Bacteria 3548
802 Ga0501038_0263893 3300049574 Bacteria 1360
803 Ga0501039_0000710 3300049575 Bacteria 23980
804 Ga0501039_0004417 3300049575 Bacteria 10614
805 Ga0501039_0070384 3300049575 Bacteria 2718
806 Ga0501040_0034120 3300049576 Bacteria 3448
807 Ga0501040_0119523 3300049576 Bacteria 1848
808 Ga0501040_0424185 3300049576 Unclassified 956
809 Ga0501041_0013390 3300049577 Bacteria 4862
810 Ga0501041_0443249 3300049577 Unclassified 824
811 Ga0501041_0495899 3300049577 Bacteria 777
812 Ga0501042_0032369 3300049578 Unclassified 3703
813 Ga0501042_0037432 3300049578 Bacteria 3443
814 Ga0501043_0038619 3300049579 Unclassified 3753
815 Ga0501046_0004067 3300049580 Bacteria 13341
816 Ga0501046_0020906 3300049580 Bacteria 5404
817 Ga0501047_0000721 3300049581 Bacteria 34396
818 Ga0501047_0013191 3300049581 Bacteria 7826
819 Ga0501048_0011129 3300049582 Bacteria 6708
820 Ga0501067_0003660 3300049583 Bacteria 8467
821 Ga0501067_0013214 3300049583 Bacteria 4571
822 Ga0501067_0267409 3300049583 Unclassified 952
823 Ga0501068_0000491 3300049584 Bacteria 20048
824 Ga0501068_0301100 3300049584 Bacteria 1026
825 Ga0501069_0001666 3300049585 Bacteria 11051
826 Ga0501070_0016220 3300049586 Bacteria 6260
827 Ga0501070_0016282 3300049586 Bacteria 6247
828 Ga0501070_0886258 3300049586 Bacteria 697
829 Ga0501071_0047690 3300049587 Unclassified 3078
830 Ga0501071_0084982 3300049587 Bacteria 2320
831 Ga0501071_0165551 3300049587 Unclassified 1654
832 Ga0501071_0195931 3300049587 Bacteria 1516
833 Ga0501072_0001477 3300049588 Bacteria 17625
834 Ga0501072_0017019 3300049588 Bacteria 5585
835 Ga0501072_0433861 3300049588 Unclassified 1041
836 Ga0501074_0043128 3300049590 Bacteria 3265
837 Ga0501075_0003578 3300049591 Bacteria 10409
838 Ga0501075_0309780 3300049591 Bacteria 1203
839 Ga0501076_0014627 3300049592 Bacteria 5916
840 Ga0501076_0185538 3300049592 Bacteria 1696
841 Ga0501076_0679225 3300049592 Bacteria 850
842 Ga0501076_0682761 3300049592 Bacteria 848
843 Ga0501077_0028261 3300049593 Unclassified 3564
844 Ga0501077_0032240 3300049593 Bacteria 3336
845 Ga0501077_0175178 3300049593 Unclassified 1363
846 Ga0501079_0000655 3300049741 Bacteria 23110
847 Ga0501079_0014573 3300049741 Bacteria 5996
848 Ga0501079_0072552 3300049741 Bacteria 2661
849 Ga0501079_0457157 3300049741 Bacteria 1003
850 Ga0501079_0571708 3300049741 Bacteria 889
851 Ga0501079_0744536 3300049741 Unclassified 771
852 Ga0501080_0000003 3300049742 Bacteria 214890
853 Ga0501080_0000166 3300049742 Bacteria 47741
854 Ga0501081_0043455 3300049743 Bacteria 3083
855 Ga0501081_0167354 3300049743 Bacteria 1586
856 Ga0501081_0574141 3300049743 Unclassified 843
857 Ga0501083_0019539 3300049744 Bacteria 4718
858 Ga0501263_000121 3300049760 Bacteria 4281
859 Ga0501035_0000058 3300049822 Bacteria 135089
860 Ga0501035_0006144 3300049822 Bacteria 11304
861 Ga0501035_0232151 3300049822 Bacteria 1572
862 Ga0501044_0000023 3300049823 Bacteria 196555
863 Ga0501044_0113356 3300049823 Bacteria 2718
864 Ga0501044_0128828 3300049823 Bacteria 2526
865 Ga0501044_0939894 3300049823 Bacteria 738
866 Ga0501045_0008050 3300049824 Bacteria 7344
867 Ga0501045_0104355 3300049824 Bacteria 2100
868 nmdc:mga06z11_13679_c1 3300050494 Bacteria 3571
869 nmdc:mga07m45_386843_c1 3300050496 Bacteria 812
870 nmdc:mga05p37_1237837_c1 3300050507 Unclassified 767
871 nmdc:mga05p37_251440_c1 3300050507 Bacteria 2120
872 nmdc:mga05p37_327807_c1 3300050507 Bacteria 1810
873 nmdc:mga05p37_524055_c1 3300050507 Bacteria 1355
874 nmdc:mga05p37_559844_c1 3300050507 Bacteria 1299
875 nmdc:mga05p37_57346_c1 3300050507 Bacteria 4797
876 nmdc:mga05p37_60228_c1 3300050507 Bacteria 4675
877 nmdc:mga05p37_736011_c1 3300050507 Bacteria 1089
878 nmdc:mga05p37_838007_c1 3300050507 Bacteria 1000
879 nmdc:mga09592_43070_c1 3300050508 Bacteria 3798
880 nmdc:mga0qj67_203511_c1 3300050509 Bacteria 1608
881 nmdc:mga0qj67_59044_c1 3300050509 Bacteria 3041
882 nmdc:mga06r32_72884_c1 3300050510 Unclassified 3325
883 nmdc:mga08y16_111546_c1 3300050511 Unclassified 2847
884 nmdc:mga08y16_44885_c1 3300050511 Bacteria 4632
885 nmdc:mga08y16_713090_c1 3300050511 Unclassified 1002
886 nmdc:mga0n895_177138_c1 3300050512 Bacteria 2163
887 nmdc:mga0n895_191681_c1 3300050512 Bacteria 2075
888 nmdc:mga0n895_3395_c1 3300050512 Bacteria 12823
889 nmdc:mga0n895_340808_c1 3300050512 Unclassified 1518
890 nmdc:mga0n895_459499_c1 3300050512 Bacteria 1285
891 nmdc:mga0n895_521772_c1 3300050512 Bacteria 1195
892 nmdc:mga0rr50_180301_c1 3300050513 Bacteria 1726
893 nmdc:mga0rr50_296304_c1 3300050513 Bacteria 1352
894 nmdc:mga0rr50_447440_c1 3300050513 Unclassified 1095
895 nmdc:mga08x19_164526_c1 3300050514 Bacteria 1508
896 nmdc:mga08x19_396707_c1 3300050514 Bacteria 967
897 nmdc:mga08x19_46448_c1 3300050514 Bacteria 2777
898 nmdc:mga08x19_52943_c2 3300050514 Bacteria 1519
899 nmdc:mga08x19_5499_c1 3300050514 Bacteria 7495
900 nmdc:mga0a205_150179_c1 3300050515 Bacteria 2230
901 nmdc:mga0a205_198145_c1 3300050515 Bacteria 1899
902 nmdc:mga0a205_455553_c1 3300050515 Bacteria 1139
903 nmdc:mga0a205_458124_c1 3300050515 Unclassified 1135
904 nmdc:mga0a205_500426_c1 3300050515 Unclassified 1072
905 nmdc:mga0a205_80807_c1 3300050515 Bacteria 3140
906 nmdc:mga0sz30_5495_c3 3300050516 Bacteria 3483
907 Ga0495612_0015636 3300053078 Bacteria 3042
908 Ga0495595_0093165 3300053084 Bacteria 1447
909 Ga0495619_0227674 3300053085 Bacteria 1291
910 Ga0501084_0000632 3300054114 Bacteria 26843
911 Ga0501084_0061930 3300054114 Bacteria 3133
912 Ga0501084_0115244 3300054114 Unclassified 2259
913 Ga0501084_0321023 3300054114 Bacteria 1308
914 Ga0590071_000099 3300059421 Bacteria 24341
915 Ga0590071_011290 3300059421 Bacteria 2090
916 Ga0590074_004504 3300059423 Bacteria 2307
917 Ga0590074_061519 3300059423 Unclassified 698
918 Ga0590075_000144 3300059424 Bacteria 18953
919 Ga0590075_006802 3300059424 Bacteria 2707
920 Ga0590075_010192 3300059424 Bacteria 2260
921 Ga0590077_002229 3300059426 Bacteria 4196
922 Ga0590077_012208 3300059426 Bacteria 1778
923 Ga0587084_038722 3300059477 Bacteria 801
924 Ga0587070_051433 3300059491 Bacteria 824
925 Ga0587085_008886 3300059506 Bacteria 1294
926 Ga0587062_006187 3300059639 Bacteria 1351
927 Ga0501082_0007237 3300060353 Bacteria 9569
928 Ga0501082_0014537 3300060353 Bacteria 6778
929 Ga0501082_0060235 3300060353 Unclassified 3269
930 Ga0501082_0175116 3300060353 Bacteria 1865
931 Ga0501082_0224618 3300060353 Bacteria 1634
932 Ga0501082_0254781 3300060353 Unclassified 1527
933 Ga0501082_0824905 3300060353 Bacteria 811
934 Ga0530510_0005438 3300061734 Bacteria 8815
935 Ga0530510_0042094 3300061734 Unclassified 3299
936 Ga0530510_0089305 3300061734 Bacteria 2247
937 Ga0530510_0517380 3300061734 Unclassified 905
938 Ga0530510_0669581 3300061734 Unclassified 790
939 Ga0530510_0852040 3300061734 Bacteria 696

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032002 Ga0307416_100217598 Ga0307416_1002175982 185
2 3300003911 JGI25405J52794_10002762 JGI25405J52794_100027622 187
3 3300005328 Ga0070676_10433350 Ga0070676_104333501 187
4 3300005330 Ga0070690_100629644 Ga0070690_1006296442 187
5 3300005334 Ga0068869_100026920 Ga0068869_1000269202 187
6 3300005340 Ga0070689_100576246 Ga0070689_1005762461 187
7 3300005347 Ga0070668_100111890 Ga0070668_1001118902 187
8 3300005354 Ga0070675_100597454 Ga0070675_1005974541 187
9 3300005355 Ga0070671_100773076 Ga0070671_1007730762 187
10 3300005356 Ga0070674_100780955 Ga0070674_1007809551 187
11 3300005365 Ga0070688_100195391 Ga0070688_1001953912 187
12 3300005438 Ga0070701_10215967 Ga0070701_102159672 187
13 3300005456 Ga0070678_100845862 Ga0070678_1008458621 187
14 3300005458 Ga0070681_10067018 Ga0070681_100670183 187
15 3300005459 Ga0068867_100062179 Ga0068867_1000621791 187
16 3300005471 Ga0070698_100186839 Ga0070698_1001868392 187
17 3300005518 Ga0070699_100603124 Ga0070699_1006031242 187
18 3300005518 Ga0070699_101322889 Ga0070699_1013228891 187
19 3300005530 Ga0070679_100440351 Ga0070679_1004403512 187
20 3300005536 Ga0070697_100618893 Ga0070697_1006188931 187
21 3300005543 Ga0070672_100195024 Ga0070672_1001950242 187
22 3300005545 Ga0070695_100271699 Ga0070695_1002716992 187
23 3300005546 Ga0070696_100169371 Ga0070696_1001693712 187
24 3300005548 Ga0070665_100494675 Ga0070665_1004946752 187
25 3300005549 Ga0070704_100006752 Ga0070704_1000067522 187
26 3300005549 Ga0070704_100607691 Ga0070704_1006076911 187
27 3300005577 Ga0068857_100243728 Ga0068857_1002437282 187
28 3300005577 Ga0068857_100291240 Ga0068857_1002912402 187
29 3300005617 Ga0068859_100002751 Ga0068859_1000027519 187
30 3300005617 Ga0068859_100404630 Ga0068859_1004046302 187
31 3300005842 Ga0068858_100158156 Ga0068858_1001581563 187
32 3300005843 Ga0068860_100105252 Ga0068860_1001052523 187
33 3300005843 Ga0068860_100588532 Ga0068860_1005885322 187
34 3300005937 Ga0081455_10008686 Ga0081455_1000868610 187
35 3300005937 Ga0081455_10010105 Ga0081455_100101057 187
36 3300005937 Ga0081455_10184583 Ga0081455_101845831 187
37 3300005937 Ga0081455_10397911 Ga0081455_103979112 187
38 3300006175 Ga0070712_100031647 Ga0070712_1000316472 187
39 3300006175 Ga0070712_100810028 Ga0070712_1008100282 187
40 3300006237 Ga0097621_100137202 Ga0097621_1001372023 187
41 3300006358 Ga0068871_100063640 Ga0068871_1000636403 187
42 3300006844 Ga0075428_100014795 Ga0075428_1000147953 187
43 3300006844 Ga0075428_101353837 Ga0075428_1013538371 187
44 3300006846 Ga0075430_100161440 Ga0075430_1001614402 187
45 3300006846 Ga0075430_100211930 Ga0075430_1002119302 187
46 3300006847 Ga0075431_100187585 Ga0075431_1001875852 187
47 3300006880 Ga0075429_100240735 Ga0075429_1002407351 187
48 3300006914 Ga0075436_100187998 Ga0075436_1001879982 187
49 3300006931 Ga0097620_100002751 Ga0097620_1000027519 187
50 3300006931 Ga0097620_100404625 Ga0097620_1004046252 187
51 3300009094 Ga0111539_10094234 Ga0111539_100942342 187
52 3300009094 Ga0111539_10235858 Ga0111539_102358582 187
53 3300009094 Ga0111539_11151418 Ga0111539_111514182 187
54 3300009147 Ga0114129_10055169 Ga0114129_100551695 187
55 3300009147 Ga0114129_10285123 Ga0114129_102851232 187
56 3300009147 Ga0114129_11509410 Ga0114129_115094102 187
57 3300009147 Ga0114129_11621281 Ga0114129_116212811 187
58 3300009148 Ga0105243_10978035 Ga0105243_109780352 187
59 3300009176 Ga0105242_10378762 Ga0105242_103787622 187
60 3300009177 Ga0105248_10680438 Ga0105248_106804382 187
61 3300010375 Ga0105239_10193538 Ga0105239_101935382 187
62 3300011119 Ga0105246_10564285 Ga0105246_105642852 187
63 3300013296 Ga0157374_10041905 Ga0157374_100419055 187
64 3300013296 Ga0157374_10094657 Ga0157374_100946572 187
65 3300013297 Ga0157378_10020587 Ga0157378_100205872 187
66 3300013297 Ga0157378_10168508 Ga0157378_101685083 187
67 3300013297 Ga0157378_10308421 Ga0157378_103084212 187
68 3300013297 Ga0157378_10385015 Ga0157378_103850151 187
69 3300013306 Ga0163162_10053017 Ga0163162_100530171 187
70 3300013308 Ga0157375_10058333 Ga0157375_100583332 187
71 3300013308 Ga0157375_10542526 Ga0157375_105425262 187
72 3300013308 Ga0157375_11620631 Ga0157375_116206312 187
73 3300014326 Ga0157380_10322618 Ga0157380_103226182 187
74 3300014968 Ga0157379_10029505 Ga0157379_100295052 187
75 3300014969 Ga0157376_10040980 Ga0157376_100409802 187
76 3300021361 Ga0213872_10023263 Ga0213872_100232632 187
77 3300021384 Ga0213876_10099456 Ga0213876_100994562 187
78 3300021441 Ga0213871_10022240 Ga0213871_100222402 187
79 3300025315 Ga0207697_10010945 Ga0207697_100109454 187
80 3300025901 Ga0207688_10070309 Ga0207688_100703092 187
81 3300025903 Ga0207680_10259370 Ga0207680_102593702 187
82 3300025912 Ga0207707_10163949 Ga0207707_101639492 187
83 3300025915 Ga0207693_10185032 Ga0207693_101850322 187
84 3300025917 Ga0207660_10493938 Ga0207660_104939382 187
85 3300025926 Ga0207659_10050229 Ga0207659_100502292 187
86 3300025926 Ga0207659_10670400 Ga0207659_106704002 187
87 3300025931 Ga0207644_10402589 Ga0207644_104025892 187
88 3300025940 Ga0207691_10412429 Ga0207691_104124292 187
89 3300025941 Ga0207711_10092722 Ga0207711_100927222 187
90 3300025942 Ga0207689_10004614 Ga0207689_100046146 187
91 3300025960 Ga0207651_10027427 Ga0207651_100274273 187
92 3300025972 Ga0207668_10059052 Ga0207668_100590523 187
93 3300026035 Ga0207703_10411021 Ga0207703_104110212 187
94 3300026067 Ga0207678_10391407 Ga0207678_103914072 187
95 3300026075 Ga0207708_10854836 Ga0207708_108548361 187
96 3300026095 Ga0207676_10351517 Ga0207676_103515172 187
97 3300026116 Ga0207674_10257606 Ga0207674_102576062 187
98 3300026116 Ga0207674_10339096 Ga0207674_103390962 187
99 3300026121 Ga0207683_10222157 Ga0207683_102221572 187
100 3300028379 Ga0268266_11046144 Ga0268266_110461441 187
101 3300028381 Ga0268264_10089061 Ga0268264_100890612 187
102 3300028573 Ga0265334_10177353 Ga0265334_101773531 187
103 3300031242 Ga0265329_10126595 Ga0265329_101265951 187
104 3300031344 Ga0265316_10188917 Ga0265316_101889171 187
105 3300031711 Ga0265314_10013146 Ga0265314_100131462 187
106 3300035089 Ga0373944_0000743 Ga0373944_0000743_2360_2923 187
107 3300035113 Ga0373936_0092848 Ga0373936_0092848_586_1149 187
108 3300035170 Ga0373943_0000966 Ga0373943_0000966_6182_6745 187
109 3300035171 Ga0373946_0001677 Ga0373946_0001677_908_1471 187
110 3300035692 Ga0373935_0011156 Ga0373935_0011156_873_1436 187
111 3300035695 Ga0373927_0092120 Ga0373927_0092120_1173_1736 187
112 3300035725 Ga0373947_0023317 Ga0373947_0023317_2424_2987 187
113 3300037068 Ga0373925_0003069 Ga0373925_0003069_8450_9013 187
114 3300039437 Ga0436365_0234493 Ga0436365_0234493_1174_1737 187
115 3300039438 Ga0436360_0669019 Ga0436360_0669019_309_872 187
116 3300039438 Ga0436360_1377598 Ga0436360_1377598_884_1447 187
117 3300039447 Ga0436361_0905442 Ga0436361_0905442_11566_12129 187
118 3300044673 Ga0453683_0457529 Ga0453683_0457529_10_573 187
119 3300045051 Ga0451576_0059128 Ga0451576_0059128_1791_2354 187
120 3300046454 Ga0495592_0093137 Ga0495592_0093137_1432_1995 187
121 3300046455 Ga0495603_0060187 Ga0495603_0060187_94_657 187
122 3300046459 Ga0495629_0000349 Ga0495629_0000349_5616_6179 187
123 3300046461 Ga0495641_0000494 Ga0495641_0000494_21098_21661 187
124 3300046463 Ga0495653_0003625 Ga0495653_0003625_7116_7679 187
125 3300046463 Ga0495653_0024077 Ga0495653_0024077_1144_1707 187
126 3300046473 Ga0495582_0000253 Ga0495582_0000253_4525_5088 187
127 3300046475 Ga0495639_0006126 Ga0495639_0006126_799_1362 187
128 3300046476 Ga0495662_0000205 Ga0495662_0000205_13797_14360 187
129 3300046476 Ga0495662_0043692 Ga0495662_0043692_451_1014 187
130 3300046477 Ga0495664_0022915 Ga0495664_0022915_640_1203 187
131 3300046514 Ga0495618_0034297 Ga0495618_0034297_278_841 187
132 3300046516 Ga0495628_0017929 Ga0495628_0017929_2512_3075 187
133 3300046516 Ga0495628_0481563 Ga0495628_0481563_56_619 187
134 3300046517 Ga0495630_0257104 Ga0495630_0257104_259_822 187
135 3300046517 Ga0495630_0308423 Ga0495630_0308423_612_1175 187
136 3300046526 Ga0495666_0016357 Ga0495666_0016357_1613_2176 187
137 3300046531 Ga0495665_0000739 Ga0495665_0000739_8681_9244 187
138 3300046533 Ga0495640_0018948 Ga0495640_0018948_4013_4576 187
139 3300046533 Ga0495640_0027138 Ga0495640_0027138_1552_2115 187
140 3300046535 Ga0495586_0220147 Ga0495586_0220147_475_1038 187
141 3300046543 Ga0495645_0066369 Ga0495645_0066369_2024_2587 187
142 3300046559 Ga0495667_0065619 Ga0495667_0065619_450_1013 187
143 3300046642 Ga0495634_0018604 Ga0495634_0018604_1674_2237 187
144 3300046663 Ga0495635_0010686 Ga0495635_0010686_4602_5165 187
145 3300046663 Ga0495635_0012684 Ga0495635_0012684_3638_4201 187
146 3300046678 Ga0495599_0021649 Ga0495599_0021649_1745_2308 187
147 3300046679 Ga0495623_0090655 Ga0495623_0090655_1206_1769 187
148 3300046680 Ga0495646_0052672 Ga0495646_0052672_758_1321 187
149 3300046681 Ga0495647_0005575 Ga0495647_0005575_1775_2338 187
150 3300046683 Ga0495658_0001095 Ga0495658_0001095_2534_3097 187
151 3300046689 Ga0495613_0001699 Ga0495613_0001699_12555_13118 187
152 3300046690 Ga0495624_0007533 Ga0495624_0007533_2550_3113 187
153 3300046809 Ga0495600_0012981 Ga0495600_0012981_2239_2802 187
154 3300047315 Ga0495581_0005659 Ga0495581_0005659_253_816 187
155 3300047317 Ga0495604_0132326 Ga0495604_0132326_308_871 187
156 3300047319 Ga0495674_0014632 Ga0495674_0014632_2636_3199 187
157 3300047319 Ga0495674_0018393 Ga0495674_0018393_3513_4076 187
158 3300047321 Ga0495676_0000940 Ga0495676_0000940_14881_15444 187
159 3300047322 Ga0495680_0000259 Ga0495680_0000259_33686_34249 187
160 3300047322 Ga0495680_0022942 Ga0495680_0022942_373_936 187
161 3300047471 Ga0495684_0011822 Ga0495684_0011822_2396_2959 187
162 3300047471 Ga0495684_0056659 Ga0495684_0056659_2331_2894 187
163 3300047673 Ga0495593_0002481 Ga0495593_0002481_4415_4978 187
164 3300048089 Ga0495614_0001088 Ga0495614_0001088_3881_4444 187
165 3300048907 Ga0496104_0228192 Ga0496104_0228192_655_1218 187
166 3300048908 Ga0496105_0031405 Ga0496105_0031405_160_723 187
167 3300048915 Ga0496112_0575533 Ga0496112_0575533_429_992 187
168 3300048917 Ga0496114_0056712 Ga0496114_0056712_858_1421 187
169 3300048918 Ga0496115_0122277 Ga0496115_0122277_488_1051 187
170 3300048918 Ga0496115_0415150 Ga0496115_0415150_42_605 187
171 3300049577 Ga0501041_0495899 Ga0501041_0495899_45_608 187
172 3300049578 Ga0501042_0037432 Ga0501042_0037432_2207_2770 187
173 3300049587 Ga0501071_0047690 Ga0501071_0047690_2497_3060 187
174 3300049593 Ga0501077_0032240 Ga0501077_0032240_2113_2676 187
175 3300049760 Ga0501263_000121 Ga0501263_000121_1596_2159 187
176 3300049823 Ga0501044_0128828 Ga0501044_0128828_566_1129 187
177 3300050507 nmdc:mga05p37_1237837_c1 nmdc:mga05p37_1237837_c1_50_646 187
178 3300050507 nmdc:mga05p37_57346_c1 nmdc:mga05p37_57346_c1_3103_3666 187
179 3300050507 nmdc:mga05p37_60228_c1 nmdc:mga05p37_60228_c1_1543_2106 187
180 3300050508 nmdc:mga09592_43070_c1 nmdc:mga09592_43070_c1_1334_1897 187
181 3300050509 nmdc:mga0qj67_203511_c1 nmdc:mga0qj67_203511_c1_787_1350 187
182 3300050509 nmdc:mga0qj67_59044_c1 nmdc:mga0qj67_59044_c1_1968_2531 187
183 3300050514 nmdc:mga08x19_52943_c2 nmdc:mga08x19_52943_c2_769_1332 187
184 3300050515 nmdc:mga0a205_198145_c1 nmdc:mga0a205_198145_c1_959_1522 187
185 3300053078 Ga0495612_0015636 Ga0495612_0015636_64_627 187
186 3300053084 Ga0495595_0093165 Ga0495595_0093165_466_1029 187
187 3300053085 Ga0495619_0227674 Ga0495619_0227674_245_808 187
188 3300054114 Ga0501084_0061930 Ga0501084_0061930_2015_2578 187
189 3300059421 Ga0590071_011290 Ga0590071_011290_752_1315 187
190 3300059423 Ga0590074_061519 Ga0590074_061519_14_577 187
191 3300059424 Ga0590075_010192 Ga0590075_010192_1114_1677 187
192 3300059426 Ga0590077_012208 Ga0590077_012208_298_861 187
193 3300060353 Ga0501082_0224618 Ga0501082_0224618_19_582 187
194 3300061734 Ga0530510_0852040 Ga0530510_0852040_98_661 187
195 3300003322 rootL2_10061107 rootL2_100611072 188
196 3300005330 Ga0070690_100378581 Ga0070690_1003785811 188
197 3300005334 Ga0068869_100090947 Ga0068869_1000909472 188
198 3300005334 Ga0068869_100156294 Ga0068869_1001562942 188
199 3300005340 Ga0070689_100160156 Ga0070689_1001601561 188
200 3300005341 Ga0070691_10017193 Ga0070691_100171934 188
201 3300005345 Ga0070692_10020022 Ga0070692_100200222 188
202 3300005365 Ga0070688_100026962 Ga0070688_1000269622 188
203 3300005406 Ga0070703_10000441 Ga0070703_100004415 188
204 3300005436 Ga0070713_100080624 Ga0070713_1000806241 188
205 3300005438 Ga0070701_10003386 Ga0070701_100033864 188
206 3300005440 Ga0070705_100000032 Ga0070705_10000003218 188
207 3300005444 Ga0070694_100001908 Ga0070694_10000190810 188
208 3300005445 Ga0070708_100092880 Ga0070708_1000928802 188
209 3300005455 Ga0070663_100590536 Ga0070663_1005905361 188
210 3300005457 Ga0070662_100049951 Ga0070662_1000499513 188
211 3300005458 Ga0070681_10007840 Ga0070681_100078403 188
212 3300005467 Ga0070706_100211063 Ga0070706_1002110632 188
213 3300005518 Ga0070699_100001445 Ga0070699_10000144515 188
214 3300005545 Ga0070695_100000937 Ga0070695_1000009379 188
215 3300005546 Ga0070696_100000826 Ga0070696_10000082614 188
216 3300005549 Ga0070704_100005197 Ga0070704_1000051975 188
217 3300005549 Ga0070704_100201188 Ga0070704_1002011882 188
218 3300005564 Ga0070664_100131911 Ga0070664_1001319111 188
219 3300005617 Ga0068859_100001900 Ga0068859_10000190018 188
220 3300005618 Ga0068864_100011945 Ga0068864_1000119455 188
221 3300005719 Ga0068861_100011697 Ga0068861_1000116974 188
222 3300005840 Ga0068870_10088005 Ga0068870_100880052 188
223 3300005841 Ga0068863_100468931 Ga0068863_1004689311 188
224 3300005843 Ga0068860_100000870 Ga0068860_10000087011 188
225 3300005844 Ga0068862_100001615 Ga0068862_10000161518 188
226 3300005844 Ga0068862_100604902 Ga0068862_1006049022 188
227 3300006173 Ga0070716_101009395 Ga0070716_1010093951 188
228 3300006175 Ga0070712_100040183 Ga0070712_1000401832 188
229 3300006871 Ga0075434_100440650 Ga0075434_1004406502 188
230 3300006871 Ga0075434_100683642 Ga0075434_1006836422 188
231 3300006881 Ga0068865_100778100 Ga0068865_1007781002 188
232 3300006931 Ga0097620_100001900 Ga0097620_1000019004 188
233 3300007788 Ga0099795_10180550 Ga0099795_101805501 188
234 3300009101 Ga0105247_10234281 Ga0105247_102342812 188
235 3300009148 Ga0105243_10602355 Ga0105243_106023552 188
236 3300009553 Ga0105249_10001320 Ga0105249_1000132012 188
237 3300010375 Ga0105239_10740467 Ga0105239_107404671 188
238 3300011119 Ga0105246_10013675 Ga0105246_100136755 188
239 3300013306 Ga0163162_10222402 Ga0163162_102224022 188
240 3300013308 Ga0157375_10087812 Ga0157375_100878122 188
241 3300014968 Ga0157379_10211813 Ga0157379_102118132 188
242 3300025885 Ga0207653_10001223 Ga0207653_100012235 188
243 3300025898 Ga0207692_10429061 Ga0207692_104290611 188
244 3300025908 Ga0207643_10152057 Ga0207643_101520572 188
245 3300025910 Ga0207684_10065115 Ga0207684_100651154 188
246 3300025912 Ga0207707_10076207 Ga0207707_100762072 188
247 3300025915 Ga0207693_10012664 Ga0207693_100126643 188
248 3300025917 Ga0207660_10011616 Ga0207660_100116162 188
249 3300025918 Ga0207662_10034726 Ga0207662_100347262 188
250 3300025928 Ga0207700_10160358 Ga0207700_101603582 188
251 3300025933 Ga0207706_10075427 Ga0207706_100754272 188
252 3300025935 Ga0207709_10216070 Ga0207709_102160702 188
253 3300025936 Ga0207670_10533799 Ga0207670_105337991 188
254 3300025942 Ga0207689_10151595 Ga0207689_101515951 188
255 3300025960 Ga0207651_10115557 Ga0207651_101155572 188
256 3300025961 Ga0207712_10061112 Ga0207712_100611124 188
257 3300026041 Ga0207639_10773549 Ga0207639_107735491 188
258 3300026067 Ga0207678_10007780 Ga0207678_100077809 188
259 3300026075 Ga0207708_10001022 Ga0207708_1000102215 188
260 3300026095 Ga0207676_10008478 Ga0207676_100084784 188
261 3300026116 Ga0207674_10003569 Ga0207674_1000356918 188
262 3300026118 Ga0207675_100112491 Ga0207675_1001124912 188
263 3300028380 Ga0268265_10002040 Ga0268265_1000204014 188
264 3300028381 Ga0268264_10001009 Ga0268264_1000100910 188
265 3300031727 Ga0316576_10030162 Ga0316576_100301624 188
266 3300034819 Ga0373958_0002462 Ga0373958_0002462_1771_2337 188
267 3300035114 Ga0373939_0040620 Ga0373939_0040620_169_735 188
268 3300035398 Ga0316574_0553214 Ga0316574_0553214_98_664 188
269 3300035691 Ga0373931_0239484 Ga0373931_0239484_373_939 188
270 3300035695 Ga0373927_0010448 Ga0373927_0010448_2019_2642 188
271 3300035725 Ga0373947_0189742 Ga0373947_0189742_232_798 188
272 3300046528 Ga0495642_0254516 Ga0495642_0254516_132_755 188
273 3300046683 Ga0495658_0178012 Ga0495658_0178012_198_764 188
274 3300048905 Ga0496102_0005628 Ga0496102_0005628_1769_2335 188
275 3300048905 Ga0496102_0474165 Ga0496102_0474165_297_920 188
276 3300048909 Ga0496106_0001865 Ga0496106_0001865_7576_8142 188
277 3300048909 Ga0496106_0137969 Ga0496106_0137969_134_700 188
278 3300048911 Ga0496108_0064999 Ga0496108_0064999_710_1333 188
279 3300048912 Ga0496109_0062596 Ga0496109_0062596_861_1427 188
280 3300048913 Ga0496110_0147871 Ga0496110_0147871_907_1473 188
281 3300048917 Ga0496114_0570909 Ga0496114_0570909_113_679 188
282 3300048918 Ga0496115_0022385 Ga0496115_0022385_651_1217 188
283 3300049576 Ga0501040_0424185 Ga0501040_0424185_206_772 188
284 3300050507 nmdc:mga05p37_524055_c1 nmdc:mga05p37_524055_c1_653_1219 188
285 3300050512 nmdc:mga0n895_521772_c1 nmdc:mga0n895_521772_c1_75_674 188
286 3300050513 nmdc:mga0rr50_447440_c1 nmdc:mga0rr50_447440_c1_45_668 188
287 3300050515 nmdc:mga0a205_150179_c1 nmdc:mga0a205_150179_c1_917_1540 188
288 3300061734 Ga0530510_0517380 Ga0530510_0517380_219_785 188
289 iso_pu_bacteria 2847930680 2847933755 188
290 iso_pu_bacteria 2879083081 2879087281 188
291 iso_pu_bacteria 2881364244 2881368352 188
292 iso_pu_bacteria 2885366525 2885372704 188
293 iso_pu_bacteria 2906643746 2906644280 188
294 iso_pu_bacteria 8056673599 8056674735 188
295 3300005434 Ga0070709_10034389 Ga0070709_100343893 189
296 3300005435 Ga0070714_100015276 Ga0070714_1000152763 189
297 3300005436 Ga0070713_100019735 Ga0070713_1000197355 189
298 3300005437 Ga0070710_10026570 Ga0070710_100265701 189
299 3300005614 Ga0068856_100003167 Ga0068856_1000031674 189
300 3300005983 Ga0081540_1038817 Ga0081540_10388172 189
301 3300006163 Ga0070715_10065785 Ga0070715_100657852 189
302 3300006175 Ga0070712_100086388 Ga0070712_1000863882 189
303 3300006237 Ga0097621_100040333 Ga0097621_1000403334 189
304 3300006358 Ga0068871_100013249 Ga0068871_1000132492 189
305 3300006871 Ga0075434_100268291 Ga0075434_1002682912 189
306 3300006914 Ga0075436_100209942 Ga0075436_1002099422 189
307 3300009094 Ga0111539_10488853 Ga0111539_104888533 189
308 3300013100 Ga0157373_10316729 Ga0157373_103167292 189
309 3300014969 Ga0157376_10023471 Ga0157376_100234714 189
310 3300025898 Ga0207692_10029000 Ga0207692_100290002 189
311 3300025905 Ga0207685_10095939 Ga0207685_100959392 189
312 3300025906 Ga0207699_10003869 Ga0207699_100038692 189
313 3300025911 Ga0207654_10094388 Ga0207654_100943882 189
314 3300025915 Ga0207693_10013607 Ga0207693_100136077 189
315 3300025915 Ga0207693_10026456 Ga0207693_100264562 189
316 3300025916 Ga0207663_10001846 Ga0207663_100018462 189
317 3300025916 Ga0207663_10064525 Ga0207663_100645252 189
318 3300025929 Ga0207664_10033072 Ga0207664_100330721 189
319 3300025929 Ga0207664_10315615 Ga0207664_103156152 189
320 3300025939 Ga0207665_10167118 Ga0207665_101671182 189
321 3300026067 Ga0207678_10087387 Ga0207678_100873873 189
322 3300026078 Ga0207702_10019580 Ga0207702_100195804 189
323 3300026121 Ga0207683_10015532 Ga0207683_100155322 189
324 3300035114 Ga0373939_0159073 Ga0373939_0159073_248_817 189
325 3300035241 Ga0373961_0019263 Ga0373961_0019263_627_1196 189
326 3300035691 Ga0373931_0237084 Ga0373931_0237084_328_897 189
327 3300035695 Ga0373927_0059848 Ga0373927_0059848_535_1104 189
328 3300042157 Ga0439458_0023570 Ga0439458_0023570_196_765 189
329 3300046472 Ga0495580_0253343 Ga0495580_0253343_535_1104 189
330 3300048903 Ga0496100_0004514 Ga0496100_0004514_6249_6818 189
331 3300048903 Ga0496100_0110783 Ga0496100_0110783_359_928 189
332 3300048904 Ga0496101_0179135 Ga0496101_0179135_362_931 189
333 3300048905 Ga0496102_0001079 Ga0496102_0001079_22346_22915 189
334 3300048906 Ga0496103_0005182 Ga0496103_0005182_6258_6827 189
335 3300048907 Ga0496104_0037487 Ga0496104_0037487_1293_1862 189
336 3300048907 Ga0496104_0098271 Ga0496104_0098271_386_955 189
337 3300048908 Ga0496105_0036081 Ga0496105_0036081_2201_2770 189
338 3300048908 Ga0496105_0132171 Ga0496105_0132171_1408_1977 189
339 3300048909 Ga0496106_0009863 Ga0496106_0009863_2929_3498 189
340 3300048910 Ga0496107_0003491 Ga0496107_0003491_1022_1591 189
341 3300048910 Ga0496107_0004909 Ga0496107_0004909_2305_2874 189
342 3300048912 Ga0496109_0185305 Ga0496109_0185305_195_764 189
343 3300048916 Ga0496113_0316436 Ga0496113_0316436_147_716 189
344 3300048917 Ga0496114_0001324 Ga0496114_0001324_1293_1862 189
345 3300048917 Ga0496114_0054464 Ga0496114_0054464_2212_2781 189
346 3300048918 Ga0496115_0017003 Ga0496115_0017003_1585_2154 189
347 3300048918 Ga0496115_0044451 Ga0496115_0044451_1613_2182 189
348 3300049743 Ga0501081_0574141 Ga0501081_0574141_61_630 189
349 3300050512 nmdc:mga0n895_191681_c1 nmdc:mga0n895_191681_c1_1167_1736 189
350 3300050514 nmdc:mga08x19_164526_c1 nmdc:mga08x19_164526_c1_715_1284 189
351 iso_pu_bacteria 2932801729 2932807390 189
352 iso_pu_bacteria 2935883170 2935884403 189
353 3300005983 Ga0081540_1032177 Ga0081540_10321772 190
354 3300005983 Ga0081540_1158584 Ga0081540_11585842 190
355 3300006844 Ga0075428_100849644 Ga0075428_1008496442 190
356 3300006871 Ga0075434_100059001 Ga0075434_1000590016 190
357 3300007076 Ga0075435_100144319 Ga0075435_1001443193 190
358 3300041460 Ga0451802_0958627 Ga0451802_0958627_56_637 190
359 3300049568 Ga0501031_0018701 Ga0501031_0018701_1940_2512 190
360 3300049569 Ga0501032_0004094 Ga0501032_0004094_1634_2206 190
361 3300049570 Ga0501033_0003616 Ga0501033_0003616_3900_4472 190
362 3300049571 Ga0501034_0005157 Ga0501034_0005157_274_846 190
363 3300049572 Ga0501036_0000908 Ga0501036_0000908_12745_13317 190
364 3300049573 Ga0501037_0014276 Ga0501037_0014276_1339_1911 190
365 3300049574 Ga0501038_0004868 Ga0501038_0004868_9909_10481 190
366 3300049575 Ga0501039_0004417 Ga0501039_0004417_2914_3486 190
367 3300049579 Ga0501043_0038619 Ga0501043_0038619_2467_3039 190
368 3300049580 Ga0501046_0004067 Ga0501046_0004067_4255_4827 190
369 3300049581 Ga0501047_0013191 Ga0501047_0013191_3943_4515 190
370 3300049582 Ga0501048_0011129 Ga0501048_0011129_5645_6217 190
371 3300049583 Ga0501067_0013214 Ga0501067_0013214_3598_4170 190
372 3300049584 Ga0501068_0000491 Ga0501068_0000491_9909_10481 190
373 3300049585 Ga0501069_0001666 Ga0501069_0001666_6736_7308 190
374 3300049586 Ga0501070_0016282 Ga0501070_0016282_402_974 190
375 3300049588 Ga0501072_0001477 Ga0501072_0001477_8671_9243 190
376 3300049592 Ga0501076_0014627 Ga0501076_0014627_3394_3966 190
377 3300049741 Ga0501079_0000655 Ga0501079_0000655_3307_3879 190
378 3300049742 Ga0501080_0000166 Ga0501080_0000166_8742_9314 190
379 3300049744 Ga0501083_0019539 Ga0501083_0019539_3745_4317 190
380 3300049822 Ga0501035_0006144 Ga0501035_0006144_8138_8710 190
381 3300049823 Ga0501044_0113356 Ga0501044_0113356_1873_2445 190
382 3300050512 nmdc:mga0n895_3395_c1 nmdc:mga0n895_3395_c1_2998_3579 190
383 3300050513 nmdc:mga0rr50_180301_c1 nmdc:mga0rr50_180301_c1_360_941 190
384 3300054114 Ga0501084_0000632 Ga0501084_0000632_17797_18369 190
385 3300060353 Ga0501082_0007237 Ga0501082_0007237_5018_5590 190
386 iso_pu_bacteria 2917699015 2917702545 190
387 3300003322 rootL2_10091361 rootL2_100913612 191
388 3300004798 Ga0058859_11489020 Ga0058859_114890201 191
389 3300004800 Ga0058861_11388695 Ga0058861_113886952 191
390 3300005329 Ga0070683_100005595 Ga0070683_1000055952 191
391 3300005330 Ga0070690_100177579 Ga0070690_1001775792 191
392 3300005330 Ga0070690_100508524 Ga0070690_1005085242 191
393 3300005334 Ga0068869_100005172 Ga0068869_1000051726 191
394 3300005334 Ga0068869_100182674 Ga0068869_1001826742 191
395 3300005340 Ga0070689_100173939 Ga0070689_1001739392 191
396 3300005340 Ga0070689_100383957 Ga0070689_1003839572 191
397 3300005343 Ga0070687_100296023 Ga0070687_1002960231 191
398 3300005344 Ga0070661_100023966 Ga0070661_1000239662 191
399 3300005364 Ga0070673_100116463 Ga0070673_1001164632 191
400 3300005366 Ga0070659_100250101 Ga0070659_1002501012 191
401 3300005434 Ga0070709_10567987 Ga0070709_105679871 191
402 3300005435 Ga0070714_100002329 Ga0070714_1000023298 191
403 3300005435 Ga0070714_100309487 Ga0070714_1003094871 191
404 3300005438 Ga0070701_10121134 Ga0070701_101211342 191
405 3300005439 Ga0070711_100027931 Ga0070711_1000279315 191
406 3300005441 Ga0070700_100377285 Ga0070700_1003772852 191
407 3300005444 Ga0070694_100857798 Ga0070694_1008577981 191
408 3300005445 Ga0070708_101403958 Ga0070708_1014039581 191
409 3300005455 Ga0070663_100534055 Ga0070663_1005340552 191
410 3300005458 Ga0070681_10632008 Ga0070681_106320082 191
411 3300005535 Ga0070684_100106805 Ga0070684_1001068052 191
412 3300005539 Ga0068853_100271405 Ga0068853_1002714051 191
413 3300005539 Ga0068853_100412703 Ga0068853_1004127031 191
414 3300005543 Ga0070672_100261292 Ga0070672_1002612922 191
415 3300005544 Ga0070686_100036321 Ga0070686_1000363213 191
416 3300005546 Ga0070696_100466040 Ga0070696_1004660401 191
417 3300005563 Ga0068855_100108380 Ga0068855_1001083803 191
418 3300005564 Ga0070664_100008019 Ga0070664_1000080192 191
419 3300005614 Ga0068856_100069586 Ga0068856_1000695863 191
420 3300005615 Ga0070702_100135371 Ga0070702_1001353712 191
421 3300005718 Ga0068866_10179243 Ga0068866_101792432 191
422 3300005719 Ga0068861_100191016 Ga0068861_1001910162 191
423 3300005719 Ga0068861_100406332 Ga0068861_1004063322 191
424 3300005840 Ga0068870_10242701 Ga0068870_102427012 191
425 3300005841 Ga0068863_100048611 Ga0068863_1000486112 191
426 3300005841 Ga0068863_100115767 Ga0068863_1001157672 191
427 3300005842 Ga0068858_100361606 Ga0068858_1003616062 191
428 3300005842 Ga0068858_101444916 Ga0068858_1014449161 191
429 3300005843 Ga0068860_100082372 Ga0068860_1000823722 191
430 3300005843 Ga0068860_100353300 Ga0068860_1003533002 191
431 3300006173 Ga0070716_100506808 Ga0070716_1005068081 191
432 3300006175 Ga0070712_100002273 Ga0070712_10000227310 191
433 3300006237 Ga0097621_100140901 Ga0097621_1001409012 191
434 3300006237 Ga0097621_100653949 Ga0097621_1006539492 191
435 3300006881 Ga0068865_100009081 Ga0068865_1000090816 191
436 3300006914 Ga0075436_100219034 Ga0075436_1002190341 191
437 3300006914 Ga0075436_100463914 Ga0075436_1004639142 191
438 3300009093 Ga0105240_10368771 Ga0105240_103687712 191
439 3300009174 Ga0105241_10148370 Ga0105241_101483702 191
440 3300009176 Ga0105242_10589539 Ga0105242_105895391 191
441 3300009545 Ga0105237_10109102 Ga0105237_101091022 191
442 3300009545 Ga0105237_10377707 Ga0105237_103777072 191
443 3300009545 Ga0105237_10622452 Ga0105237_106224522 191
444 3300009551 Ga0105238_10027367 Ga0105238_100273673 191
445 3300009553 Ga0105249_10429497 Ga0105249_104294972 191
446 3300010375 Ga0105239_10012961 Ga0105239_100129617 191
447 3300010375 Ga0105239_10013235 Ga0105239_100132355 191
448 3300013100 Ga0157373_10122589 Ga0157373_101225892 191
449 3300013104 Ga0157370_10039454 Ga0157370_100394542 191
450 3300013104 Ga0157370_10091494 Ga0157370_100914943 191
451 3300013105 Ga0157369_10029345 Ga0157369_100293456 191
452 3300013296 Ga0157374_10037229 Ga0157374_100372293 191
453 3300013297 Ga0157378_10174250 Ga0157378_101742502 191
454 3300013306 Ga0163162_10025885 Ga0163162_100258853 191
455 3300013307 Ga0157372_10431177 Ga0157372_104311772 191
456 3300013308 Ga0157375_10001967 Ga0157375_1000196712 191
457 3300013308 Ga0157375_10200558 Ga0157375_102005582 191
458 3300014745 Ga0157377_10124201 Ga0157377_101242011 191
459 3300014968 Ga0157379_10160461 Ga0157379_101604612 191
460 3300014969 Ga0157376_10261577 Ga0157376_102615771 191
461 3300014969 Ga0157376_10309989 Ga0157376_103099892 191
462 3300014969 Ga0157376_10315375 Ga0157376_103153752 191
463 3300014969 Ga0157376_10452634 Ga0157376_104526341 191
464 3300025899 Ga0207642_10195459 Ga0207642_101954592 191
465 3300025904 Ga0207647_10074469 Ga0207647_100744692 191
466 3300025912 Ga0207707_10832948 Ga0207707_108329482 191
467 3300025914 Ga0207671_10033203 Ga0207671_100332035 191
468 3300025915 Ga0207693_10000618 Ga0207693_1000061810 191
469 3300025916 Ga0207663_10039414 Ga0207663_100394143 191
470 3300025918 Ga0207662_10122212 Ga0207662_101222122 191
471 3300025920 Ga0207649_10016319 Ga0207649_100163193 191
472 3300025921 Ga0207652_10201794 Ga0207652_102017942 191
473 3300025929 Ga0207664_10062432 Ga0207664_100624323 191
474 3300025929 Ga0207664_10333431 Ga0207664_103334312 191
475 3300025931 Ga0207644_10337171 Ga0207644_103371712 191
476 3300025932 Ga0207690_10098241 Ga0207690_100982411 191
477 3300025933 Ga0207706_10515868 Ga0207706_105158682 191
478 3300025936 Ga0207670_10206838 Ga0207670_102068382 191
479 3300025940 Ga0207691_10439135 Ga0207691_104391352 191
480 3300025942 Ga0207689_10046924 Ga0207689_100469242 191
481 3300025949 Ga0207667_10168343 Ga0207667_101683432 191
482 3300025960 Ga0207651_10732040 Ga0207651_107320402 191
483 3300026023 Ga0207677_10048957 Ga0207677_100489572 191
484 3300026041 Ga0207639_10110242 Ga0207639_101102423 191
485 3300026041 Ga0207639_10780454 Ga0207639_107804542 191
486 3300026067 Ga0207678_10541343 Ga0207678_105413432 191
487 3300026075 Ga0207708_10233878 Ga0207708_102338782 191
488 3300026078 Ga0207702_10082938 Ga0207702_100829382 191
489 3300026088 Ga0207641_10044330 Ga0207641_100443303 191
490 3300026088 Ga0207641_10296644 Ga0207641_102966442 191
491 3300026116 Ga0207674_10097832 Ga0207674_100978322 191
492 3300026118 Ga0207675_100010598 Ga0207675_1000105988 191
493 3300026118 Ga0207675_100086481 Ga0207675_1000864812 191
494 3300028381 Ga0268264_10090713 Ga0268264_100907133 191
495 3300028381 Ga0268264_10784014 Ga0268264_107840142 191
496 3300028563 Ga0265319_1039497 Ga0265319_10394972 191
497 3300028577 Ga0265318_10001006 Ga0265318_100010066 191
498 3300031238 Ga0265332_10102283 Ga0265332_101022831 191
499 3300031239 Ga0265328_10021814 Ga0265328_100218143 191
500 3300031240 Ga0265320_10000218 Ga0265320_1000021834 191
501 3300031241 Ga0265325_10011290 Ga0265325_100112901 191
502 3300031242 Ga0265329_10000485 Ga0265329_1000048516 191
503 3300031247 Ga0265340_10001203 Ga0265340_100012036 191
504 3300031249 Ga0265339_10007117 Ga0265339_100071175 191
505 3300031250 Ga0265331_10001063 Ga0265331_1000106311 191
506 3300031344 Ga0265316_10006166 Ga0265316_100061663 191
507 3300031595 Ga0265313_10004470 Ga0265313_100044702 191
508 3300031711 Ga0265314_10015537 Ga0265314_100155373 191
509 3300031712 Ga0265342_10000161 Ga0265342_1000016164 191
510 3300032002 Ga0307416_100355916 Ga0307416_1003559162 191
511 3300037312 Ga0395899_0172406 Ga0395899_0172406_387_962 191
512 3300037418 Ga0395900_0003828 Ga0395900_0003828_6970_7545 191
513 3300038443 Ga0395901_0001187 Ga0395901_0001187_3374_3949 191
514 3300044694 Ga0466963_0008636 Ga0466963_0008636_4504_5079 191
515 3300045051 Ga0451576_0326113 Ga0451576_0326113_577_1161 191
516 3300048906 Ga0496103_0450283 Ga0496103_0450283_165_740 191
517 3300048909 Ga0496106_0748422 Ga0496106_0748422_52_627 191
518 3300048915 Ga0496112_0055010 Ga0496112_0055010_30_614 191
519 3300048917 Ga0496114_0390085 Ga0496114_0390085_491_1066 191
520 3300048918 Ga0496115_0027930 Ga0496115_0027930_2751_3326 191
521 3300048918 Ga0496115_0772558 Ga0496115_0772558_26_601 191
522 3300048924 Ga0496121_0136933 Ga0496121_0136933_1182_1757 191
523 3300050514 nmdc:mga08x19_5499_c1 nmdc:mga08x19_5499_c1_488_1072 191
524 3300003215 JGI25153J46596_10000100 JGI25153J46596_1000010067 192
525 3300003322 rootL2_10073410 rootL2_100734102 192
526 3300005336 Ga0070680_100146350 Ga0070680_1001463501 192
527 3300005341 Ga0070691_10014606 Ga0070691_100146061 192
528 3300005344 Ga0070661_100045717 Ga0070661_1000457172 192
529 3300005356 Ga0070674_100520971 Ga0070674_1005209711 192
530 3300005366 Ga0070659_100164338 Ga0070659_1001643382 192
531 3300005435 Ga0070714_100017469 Ga0070714_1000174692 192
532 3300005436 Ga0070713_100103328 Ga0070713_1001033282 192
533 3300005436 Ga0070713_100379353 Ga0070713_1003793532 192
534 3300005437 Ga0070710_10010313 Ga0070710_100103133 192
535 3300005439 Ga0070711_100007151 Ga0070711_1000071514 192
536 3300005439 Ga0070711_100569007 Ga0070711_1005690072 192
537 3300005445 Ga0070708_100346821 Ga0070708_1003468212 192
538 3300005455 Ga0070663_100853935 Ga0070663_1008539351 192
539 3300005458 Ga0070681_10415209 Ga0070681_104152091 192
540 3300005530 Ga0070679_100434728 Ga0070679_1004347281 192
541 3300005535 Ga0070684_100044445 Ga0070684_1000444453 192
542 3300005535 Ga0070684_100272588 Ga0070684_1002725882 192
543 3300005536 Ga0070697_100111821 Ga0070697_1001118212 192
544 3300005577 Ga0068857_100034239 Ga0068857_1000342394 192
545 3300005578 Ga0068854_100265832 Ga0068854_1002658323 192
546 3300005834 Ga0068851_10000500 Ga0068851_1000050015 192
547 3300005937 Ga0081455_10017243 Ga0081455_1001724310 192
548 3300005981 Ga0081538_10100479 Ga0081538_101004791 192
549 3300005985 Ga0081539_10005293 Ga0081539_100052932 192
550 3300005985 Ga0081539_10205066 Ga0081539_102050662 192
551 3300006042 Ga0075368_10169108 Ga0075368_101691082 192
552 3300006163 Ga0070715_10103903 Ga0070715_101039031 192
553 3300006175 Ga0070712_100040648 Ga0070712_1000406483 192
554 3300006177 Ga0075362_10015526 Ga0075362_100155262 192
555 3300006178 Ga0075367_10030118 Ga0075367_100301182 192
556 3300006358 Ga0068871_101103567 Ga0068871_1011035672 192
557 3300006852 Ga0075433_10416862 Ga0075433_104168622 192
558 3300006871 Ga0075434_100801115 Ga0075434_1008011151 192
559 3300006944 Ga0099823_1024448 Ga0099823_10244484 192
560 3300009093 Ga0105240_10046260 Ga0105240_100462606 192
561 3300009094 Ga0111539_10038472 Ga0111539_100384724 192
562 3300009147 Ga0114129_10389251 Ga0114129_103892512 192
563 3300009147 Ga0114129_11333174 Ga0114129_113331741 192
564 3300009176 Ga0105242_10396315 Ga0105242_103963152 192
565 3300009177 Ga0105248_11060786 Ga0105248_110607861 192
566 3300009545 Ga0105237_10020853 Ga0105237_100208534 192
567 3300009551 Ga0105238_10010451 Ga0105238_100104515 192
568 3300010159 Ga0099796_10187129 Ga0099796_101871291 192
569 3300010375 Ga0105239_10002049 Ga0105239_1000204919 192
570 3300013105 Ga0157369_10009927 Ga0157369_100099273 192
571 3300013297 Ga0157378_10293061 Ga0157378_102930612 192
572 3300021384 Ga0213876_10052853 Ga0213876_100528532 192
573 3300025297 Ga0209758_1000189 Ga0209758_100018972 192
574 3300025898 Ga0207692_10043848 Ga0207692_100438483 192
575 3300025906 Ga0207699_10021822 Ga0207699_100218224 192
576 3300025910 Ga0207684_10112531 Ga0207684_101125312 192
577 3300025912 Ga0207707_10000541 Ga0207707_1000054116 192
578 3300025915 Ga0207693_10052515 Ga0207693_100525152 192
579 3300025916 Ga0207663_10017163 Ga0207663_100171631 192
580 3300025917 Ga0207660_10008198 Ga0207660_100081985 192
581 3300025919 Ga0207657_10002950 Ga0207657_100029504 192
582 3300025920 Ga0207649_10370137 Ga0207649_103701372 192
583 3300025921 Ga0207652_10005910 Ga0207652_100059103 192
584 3300025924 Ga0207694_10089548 Ga0207694_100895483 192
585 3300025928 Ga0207700_10070167 Ga0207700_100701672 192
586 3300025929 Ga0207664_10105987 Ga0207664_101059872 192
587 3300025932 Ga0207690_10285163 Ga0207690_102851631 192
588 3300025937 Ga0207669_10593924 Ga0207669_105939242 192
589 3300025939 Ga0207665_10012300 Ga0207665_100123004 192
590 3300025939 Ga0207665_10901704 Ga0207665_109017042 192
591 3300026067 Ga0207678_10012879 Ga0207678_100128792 192
592 3300026116 Ga0207674_10059274 Ga0207674_100592743 192
593 3300026116 Ga0207674_10459910 Ga0207674_104599102 192
594 3300026142 Ga0207698_10098675 Ga0207698_100986752 192
595 3300027296 Ga0209389_1000222 Ga0209389_10002227 192
596 3300027361 Ga0209489_101154 Ga0209489_10115413 192
597 3300027907 Ga0207428_10067820 Ga0207428_100678202 192
598 3300032126 Ga0307415_100233927 Ga0307415_1002339272 192
599 3300036401 Ga0373937_0268436 Ga0373937_0268436_669_1247 192
600 3300037466 Ga0395898_0982073 Ga0395898_0982073_182_769 192
601 3300039437 Ga0436365_0127917 Ga0436365_0127917_5185_5763 192
602 3300039450 Ga0436363_1400321 Ga0436363_1400321_33_611 192
603 3300046524 Ga0495648_0177987 Ga0495648_0177987_164_742 192
604 3300047320 Ga0495672_0043084 Ga0495672_0043084_1484_2062 192
605 3300048905 Ga0496102_0099696 Ga0496102_0099696_1645_2223 192
606 3300048929 Ga0496126_0023838 Ga0496126_0023838_1269_1847 192
607 3300049577 Ga0501041_0443249 Ga0501041_0443249_48_635 192
608 3300049588 Ga0501072_0433861 Ga0501072_0433861_138_725 192
609 3300049591 Ga0501075_0309780 Ga0501075_0309780_177_764 192
610 3300050494 nmdc:mga06z11_13679_c1 nmdc:mga06z11_13679_c1_2014_2592 192
611 3300050496 nmdc:mga07m45_386843_c1 nmdc:mga07m45_386843_c1_182_760 192
612 3300050507 nmdc:mga05p37_838007_c1 nmdc:mga05p37_838007_c1_117_695 192
613 3300050511 nmdc:mga08y16_111546_c1 nmdc:mga08y16_111546_c1_2242_2820 192
614 3300050512 nmdc:mga0n895_340808_c1 nmdc:mga0n895_340808_c1_503_1081 192
615 3300059477 Ga0587084_038722 Ga0587084_038722_169_747 192
616 3300059491 Ga0587070_051433 Ga0587070_051433_76_654 192
617 3300059506 Ga0587085_008886 Ga0587085_008886_642_1220 192
618 3300059639 Ga0587062_006187 Ga0587062_006187_643_1221 192
619 3300060353 Ga0501082_0254781 Ga0501082_0254781_591_1178 192
620 3300061734 Ga0530510_0669581 Ga0530510_0669581_38_625 192
621 3300005329 Ga0070683_100078993 Ga0070683_1000789933 193
622 3300005337 Ga0070682_100088871 Ga0070682_1000888712 193
623 3300005337 Ga0070682_100117419 Ga0070682_1001174193 193
624 3300005339 Ga0070660_100171521 Ga0070660_1001715212 193
625 3300005344 Ga0070661_100461961 Ga0070661_1004619612 193
626 3300005354 Ga0070675_100065373 Ga0070675_1000653733 193
627 3300005354 Ga0070675_100412561 Ga0070675_1004125612 193
628 3300005365 Ga0070688_100483835 Ga0070688_1004838352 193
629 3300005366 Ga0070659_100337158 Ga0070659_1003371582 193
630 3300005437 Ga0070710_10148220 Ga0070710_101482202 193
631 3300005438 Ga0070701_10073179 Ga0070701_100731792 193
632 3300005455 Ga0070663_100935991 Ga0070663_1009359911 193
633 3300005456 Ga0070678_100565190 Ga0070678_1005651902 193
634 3300005457 Ga0070662_100708808 Ga0070662_1007088082 193
635 3300005466 Ga0070685_10168261 Ga0070685_101682611 193
636 3300005530 Ga0070679_100016854 Ga0070679_1000168546 193
637 3300005535 Ga0070684_100036102 Ga0070684_1000361022 193
638 3300005546 Ga0070696_100424043 Ga0070696_1004240432 193
639 3300005563 Ga0068855_100139908 Ga0068855_1001399083 193
640 3300005563 Ga0068855_100171128 Ga0068855_1001711282 193
641 3300005564 Ga0070664_100057020 Ga0070664_1000570203 193
642 3300005578 Ga0068854_100090031 Ga0068854_1000900313 193
643 3300005614 Ga0068856_100108887 Ga0068856_1001088873 193
644 3300005615 Ga0070702_100403449 Ga0070702_1004034492 193
645 3300005618 Ga0068864_100411570 Ga0068864_1004115702 193
646 3300005719 Ga0068861_100457479 Ga0068861_1004574792 193
647 3300005840 Ga0068870_10110343 Ga0068870_101103432 193
648 3300005841 Ga0068863_100904458 Ga0068863_1009044582 193
649 3300005843 Ga0068860_100388175 Ga0068860_1003881752 193
650 3300005844 Ga0068862_100191213 Ga0068862_1001912133 193
651 3300006175 Ga0070712_100045039 Ga0070712_1000450393 193
652 3300006846 Ga0075430_100461444 Ga0075430_1004614442 193
653 3300006871 Ga0075434_100350962 Ga0075434_1003509622 193
654 3300009094 Ga0111539_10078450 Ga0111539_100784503 193
655 3300009094 Ga0111539_10353482 Ga0111539_103534822 193
656 3300009098 Ga0105245_10201236 Ga0105245_102012362 193
657 3300009147 Ga0114129_10624806 Ga0114129_106248062 193
658 3300009147 Ga0114129_11155908 Ga0114129_111559081 193
659 3300009148 Ga0105243_10552502 Ga0105243_105525022 193
660 3300009174 Ga0105241_10158688 Ga0105241_101586882 193
661 3300009177 Ga0105248_10176427 Ga0105248_101764272 193
662 3300009545 Ga0105237_10006095 Ga0105237_1000609512 193
663 3300009551 Ga0105238_10000679 Ga0105238_1000067928 193
664 3300009551 Ga0105238_10287277 Ga0105238_102872773 193
665 3300009553 Ga0105249_10395607 Ga0105249_103956072 193
666 3300009553 Ga0105249_10463690 Ga0105249_104636902 193
667 3300010375 Ga0105239_10123513 Ga0105239_101235132 193
668 3300010375 Ga0105239_10376430 Ga0105239_103764303 193
669 3300013104 Ga0157370_10005882 Ga0157370_1000588214 193
670 3300013105 Ga0157369_10001683 Ga0157369_1000168313 193
671 3300013105 Ga0157369_10197739 Ga0157369_101977393 193
672 3300013307 Ga0157372_10031051 Ga0157372_100310515 193
673 3300013308 Ga0157375_11639488 Ga0157375_116394881 193
674 3300014325 Ga0163163_10170273 Ga0163163_101702732 193
675 3300014325 Ga0163163_10202111 Ga0163163_102021112 193
676 3300017792 Ga0163161_10663337 Ga0163161_106633371 193
677 3300017792 Ga0163161_10960066 Ga0163161_109600661 193
678 3300025907 Ga0207645_10112242 Ga0207645_101122422 193
679 3300025911 Ga0207654_10121236 Ga0207654_101212362 193
680 3300025913 Ga0207695_10118403 Ga0207695_101184034 193
681 3300025915 Ga0207693_10027324 Ga0207693_100273244 193
682 3300025917 Ga0207660_10609006 Ga0207660_106090061 193
683 3300025919 Ga0207657_10000717 Ga0207657_1000071722 193
684 3300025920 Ga0207649_10388441 Ga0207649_103884412 193
685 3300025924 Ga0207694_10233146 Ga0207694_102331462 193
686 3300025926 Ga0207659_10029567 Ga0207659_100295672 193
687 3300025932 Ga0207690_10261233 Ga0207690_102612332 193
688 3300025933 Ga0207706_10687361 Ga0207706_106873611 193
689 3300025944 Ga0207661_10008495 Ga0207661_100084953 193
690 3300025944 Ga0207661_10096883 Ga0207661_100968832 193
691 3300025949 Ga0207667_10259558 Ga0207667_102595582 193
692 3300025960 Ga0207651_10026977 Ga0207651_100269773 193
693 3300025961 Ga0207712_10344833 Ga0207712_103448332 193
694 3300026067 Ga0207678_10179764 Ga0207678_101797642 193
695 3300026075 Ga0207708_10005193 Ga0207708_100051935 193
696 3300026078 Ga0207702_11117688 Ga0207702_111176882 193
697 3300026089 Ga0207648_10337789 Ga0207648_103377892 193
698 3300026095 Ga0207676_10356425 Ga0207676_103564252 193
699 3300026118 Ga0207675_100191758 Ga0207675_1001917582 193
700 3300026118 Ga0207675_100506599 Ga0207675_1005065992 193
701 3300026121 Ga0207683_10151702 Ga0207683_101517023 193
702 3300048904 Ga0496101_0044033 Ga0496101_0044033_1746_2327 193
703 3300048907 Ga0496104_0076592 Ga0496104_0076592_2571_3152 193
704 3300048908 Ga0496105_0012687 Ga0496105_0012687_2624_3205 193
705 3300048909 Ga0496106_0230381 Ga0496106_0230381_508_1089 193
706 3300048911 Ga0496108_0014845 Ga0496108_0014845_4050_4631 193
707 3300048912 Ga0496109_0025178 Ga0496109_0025178_1827_2408 193
708 3300048913 Ga0496110_0047300 Ga0496110_0047300_1316_1897 193
709 3300048914 Ga0496111_0158184 Ga0496111_0158184_555_1136 193
710 3300048915 Ga0496112_0135857 Ga0496112_0135857_643_1224 193
711 3300048916 Ga0496113_0004169 Ga0496113_0004169_599_1180 193
712 3300048917 Ga0496114_0342937 Ga0496114_0342937_282_863 193
713 3300048918 Ga0496115_0430586 Ga0496115_0430586_269_850 193
714 3300049576 Ga0501040_0119523 Ga0501040_0119523_134_742 193
715 3300049587 Ga0501071_0084982 Ga0501071_0084982_694_1302 193
716 3300049592 Ga0501076_0679225 Ga0501076_0679225_29_637 193
717 3300049593 Ga0501077_0028261 Ga0501077_0028261_2874_3482 193
718 3300049741 Ga0501079_0457157 Ga0501079_0457157_198_806 193
719 3300049741 Ga0501079_0744536 Ga0501079_0744536_129_737 193
720 3300050507 nmdc:mga05p37_559844_c1 nmdc:mga05p37_559844_c1_566_1147 193
721 3300050507 nmdc:mga05p37_736011_c1 nmdc:mga05p37_736011_c1_340_921 193
722 3300050513 nmdc:mga0rr50_296304_c1 nmdc:mga0rr50_296304_c1_749_1330 193
723 3300050515 nmdc:mga0a205_455553_c1 nmdc:mga0a205_455553_c1_197_778 193
724 3300050515 nmdc:mga0a205_500426_c1 nmdc:mga0a205_500426_c1_272_853 193
725 3300054114 Ga0501084_0321023 Ga0501084_0321023_623_1231 193
726 3300061734 Ga0530510_0089305 Ga0530510_0089305_1043_1651 193
727 2162886011 MRS1b_contig_5910558 MRS1b_0725.00001680 194
728 3300003775 Ga0055524_1000011 Ga0055524_1000011111 194
729 3300004803 Ga0058862_10021887 Ga0058862_100218872 194
730 3300005290 Ga0065712_10386821 Ga0065712_103868211 194
731 3300005293 Ga0065715_10510195 Ga0065715_105101951 194
732 3300005329 Ga0070683_100001522 Ga0070683_10000152216 194
733 3300005330 Ga0070690_100648740 Ga0070690_1006487401 194
734 3300005331 Ga0070670_100001055 Ga0070670_1000010559 194
735 3300005331 Ga0070670_101126074 Ga0070670_1011260741 194
736 3300005335 Ga0070666_10734333 Ga0070666_107343331 194
737 3300005336 Ga0070680_100008542 Ga0070680_1000085423 194
738 3300005344 Ga0070661_100056254 Ga0070661_1000562543 194
739 3300005344 Ga0070661_100254167 Ga0070661_1002541672 194
740 3300005354 Ga0070675_100042408 Ga0070675_1000424083 194
741 3300005435 Ga0070714_100296206 Ga0070714_1002962062 194
742 3300005438 Ga0070701_10010894 Ga0070701_100108944 194
743 3300005440 Ga0070705_100355295 Ga0070705_1003552951 194
744 3300005441 Ga0070700_100275018 Ga0070700_1002750183 194
745 3300005444 Ga0070694_100045163 Ga0070694_1000451633 194
746 3300005444 Ga0070694_100140279 Ga0070694_1001402792 194
747 3300005455 Ga0070663_100011611 Ga0070663_1000116115 194
748 3300005458 Ga0070681_10042828 Ga0070681_100428283 194
749 3300005459 Ga0068867_100377232 Ga0068867_1003772322 194
750 3300005459 Ga0068867_101081462 Ga0068867_1010814621 194
751 3300005467 Ga0070706_100015547 Ga0070706_1000155472 194
752 3300005468 Ga0070707_100010108 Ga0070707_1000101085 194
753 3300005471 Ga0070698_100003041 Ga0070698_1000030415 194
754 3300005518 Ga0070699_100919474 Ga0070699_1009194741 194
755 3300005530 Ga0070679_101037549 Ga0070679_1010375491 194
756 3300005535 Ga0070684_100256907 Ga0070684_1002569072 194
757 3300005539 Ga0068853_100033849 Ga0068853_1000338492 194
758 3300005543 Ga0070672_100016698 Ga0070672_1000166985 194
759 3300005546 Ga0070696_100054405 Ga0070696_1000544052 194
760 3300005546 Ga0070696_100228743 Ga0070696_1002287431 194
761 3300005549 Ga0070704_100062631 Ga0070704_1000626312 194
762 3300005549 Ga0070704_100116708 Ga0070704_1001167082 194
763 3300005563 Ga0068855_100210590 Ga0068855_1002105902 194
764 3300005564 Ga0070664_100008005 Ga0070664_1000080055 194
765 3300005564 Ga0070664_100339964 Ga0070664_1003399642 194
766 3300005577 Ga0068857_100172348 Ga0068857_1001723482 194
767 3300005577 Ga0068857_100584840 Ga0068857_1005848402 194
768 3300005615 Ga0070702_100321205 Ga0070702_1003212051 194
769 3300005718 Ga0068866_10127992 Ga0068866_101279922 194
770 3300005937 Ga0081455_10000119 Ga0081455_1000011947 194
771 3300005937 Ga0081455_10003170 Ga0081455_100031708 194
772 3300005937 Ga0081455_10004119 Ga0081455_100041198 194
773 3300005937 Ga0081455_10139075 Ga0081455_101390752 194
774 3300005937 Ga0081455_10487375 Ga0081455_104873752 194
775 3300005981 Ga0081538_10055537 Ga0081538_100555372 194
776 3300006186 Ga0075369_10042153 Ga0075369_100421532 194
777 3300006844 Ga0075428_100040465 Ga0075428_1000404653 194
778 3300006847 Ga0075431_100040935 Ga0075431_1000409352 194
779 3300006881 Ga0068865_100361902 Ga0068865_1003619022 194
780 3300006881 Ga0068865_101035649 Ga0068865_1010356491 194
781 3300006914 Ga0075436_100024514 Ga0075436_1000245143 194
782 3300006914 Ga0075436_100423504 Ga0075436_1004235041 194
783 3300007788 Ga0099795_10001115 Ga0099795_100011155 194
784 3300009094 Ga0111539_10002011 Ga0111539_1000201113 194
785 3300009094 Ga0111539_10179662 Ga0111539_101796621 194
786 3300009147 Ga0114129_10013291 Ga0114129_100132913 194
787 3300009147 Ga0114129_10186680 Ga0114129_101866803 194
788 3300009147 Ga0114129_10384671 Ga0114129_103846712 194
789 3300009147 Ga0114129_10506256 Ga0114129_105062561 194
790 3300009147 Ga0114129_11130365 Ga0114129_111303651 194
791 3300009176 Ga0105242_10776779 Ga0105242_107767792 194
792 3300009176 Ga0105242_11245096 Ga0105242_112450962 194
793 3300010375 Ga0105239_10008461 Ga0105239_100084618 194
794 3300011119 Ga0105246_10292567 Ga0105246_102925672 194
795 3300013104 Ga0157370_10403493 Ga0157370_104034931 194
796 3300013250 Ga0171462_1011 Ga0171462_1011108 194
797 3300013296 Ga0157374_10294597 Ga0157374_102945972 194
798 3300013297 Ga0157378_10121156 Ga0157378_101211563 194
799 3300013297 Ga0157378_10577608 Ga0157378_105776081 194
800 3300013308 Ga0157375_10627423 Ga0157375_106274232 194
801 3300014325 Ga0163163_10001306 Ga0163163_100013062 194
802 3300014326 Ga0157380_10026287 Ga0157380_100262872 194
803 3300014745 Ga0157377_10367727 Ga0157377_103677271 194
804 3300014968 Ga0157379_10129263 Ga0157379_101292632 194
805 3300015261 Ga0182006_1109436 Ga0182006_11094361 194
806 3300025291 Ga0209675_1000957 Ga0209675_100095711 194
807 3300025295 Ga0209564_1000143 Ga0209564_1000143110 194
808 3300025299 Ga0209256_1000111 Ga0209256_100011145 194
809 3300025304 Ga0209257_1048775 Ga0209257_10487751 194
810 3300025315 Ga0207697_10025775 Ga0207697_100257752 194
811 3300025903 Ga0207680_10102001 Ga0207680_101020012 194
812 3300025910 Ga0207684_10054127 Ga0207684_100541273 194
813 3300025911 Ga0207654_10066580 Ga0207654_100665802 194
814 3300025912 Ga0207707_10089339 Ga0207707_100893392 194
815 3300025919 Ga0207657_10042712 Ga0207657_100427122 194
816 3300025920 Ga0207649_10022079 Ga0207649_100220793 194
817 3300025924 Ga0207694_10291895 Ga0207694_102918952 194
818 3300025925 Ga0207650_10002100 Ga0207650_100021007 194
819 3300025929 Ga0207664_10267410 Ga0207664_102674102 194
820 3300025935 Ga0207709_10319217 Ga0207709_103192172 194
821 3300025941 Ga0207711_10287360 Ga0207711_102873601 194
822 3300025944 Ga0207661_10005842 Ga0207661_100058422 194
823 3300025945 Ga0207679_10523364 Ga0207679_105233642 194
824 3300026041 Ga0207639_10022195 Ga0207639_100221952 194
825 3300026067 Ga0207678_10020352 Ga0207678_100203522 194
826 3300026075 Ga0207708_10062463 Ga0207708_100624632 194
827 3300026089 Ga0207648_10432810 Ga0207648_104328102 194
828 3300026116 Ga0207674_10573474 Ga0207674_105734741 194
829 3300026116 Ga0207674_10603567 Ga0207674_106035672 194
830 3300027907 Ga0207428_10018250 Ga0207428_100182503 194
831 3300028381 Ga0268264_10503933 Ga0268264_105039332 194
832 3300031548 Ga0307408_100009589 Ga0307408_1000095895 194
833 3300031548 Ga0307408_100426121 Ga0307408_1004261211 194
834 3300031731 Ga0307405_10008433 Ga0307405_100084333 194
835 3300031731 Ga0307405_10372126 Ga0307405_103721262 194
836 3300031824 Ga0307413_10004713 Ga0307413_100047134 194
837 3300031852 Ga0307410_10001714 Ga0307410_100017145 194
838 3300031852 Ga0307410_10009911 Ga0307410_100099115 194
839 3300031852 Ga0307410_10022097 Ga0307410_100220973 194
840 3300031852 Ga0307410_10689604 Ga0307410_106896041 194
841 3300031901 Ga0307406_10011701 Ga0307406_100117015 194
842 3300031901 Ga0307406_10099027 Ga0307406_100990272 194
843 3300031903 Ga0307407_10002469 Ga0307407_100024694 194
844 3300031903 Ga0307407_10003660 Ga0307407_100036602 194
845 3300031903 Ga0307407_10015910 Ga0307407_100159104 194
846 3300031911 Ga0307412_10440661 Ga0307412_104406612 194
847 3300031995 Ga0307409_100000929 Ga0307409_1000009298 194
848 3300031995 Ga0307409_100005561 Ga0307409_1000055615 194
849 3300031995 Ga0307409_100015738 Ga0307409_1000157382 194
850 3300032002 Ga0307416_100009215 Ga0307416_1000092154 194
851 3300032002 Ga0307416_100014606 Ga0307416_1000146064 194
852 3300032002 Ga0307416_101709002 Ga0307416_1017090021 194
853 3300032004 Ga0307414_10012130 Ga0307414_100121305 194
854 3300032004 Ga0307414_10110349 Ga0307414_101103492 194
855 3300032005 Ga0307411_10043854 Ga0307411_100438544 194
856 3300032005 Ga0307411_10129070 Ga0307411_101290702 194
857 3300032005 Ga0307411_10984723 Ga0307411_109847232 194
858 3300032126 Ga0307415_100002073 Ga0307415_1000020736 194
859 3300032126 Ga0307415_100017931 Ga0307415_1000179312 194
860 3300037418 Ga0395900_0582459 Ga0395900_0582459_347_943 194
861 3300037466 Ga0395898_0087829 Ga0395898_0087829_471_1067 194
862 3300045051 Ga0451576_0194241 Ga0451576_0194241_1015_1602 194
863 3300045976 Ga0466967_0180843 Ga0466967_0180843_577_1164 194
864 3300046539 Ga0495621_0007307 Ga0495621_0007307_1186_1773 194
865 3300046684 Ga0495669_0160901 Ga0495669_0160901_209_793 194
866 3300047320 Ga0495672_0000252 Ga0495672_0000252_57276_57860 194
867 3300048903 Ga0496100_0354437 Ga0496100_0354437_11_595 194
868 3300048904 Ga0496101_0070616 Ga0496101_0070616_1181_1795 194
869 3300048904 Ga0496101_0520546 Ga0496101_0520546_221_805 194
870 3300048904 Ga0496101_0529270 Ga0496101_0529270_71_655 194
871 3300048905 Ga0496102_0515282 Ga0496102_0515282_377_991 194
872 3300048905 Ga0496102_0893884 Ga0496102_0893884_56_658 194
873 3300048907 Ga0496104_0009713 Ga0496104_0009713_6595_7179 194
874 3300048907 Ga0496104_0147025 Ga0496104_0147025_864_1466 194
875 3300048908 Ga0496105_0019247 Ga0496105_0019247_3688_4272 194
876 3300048909 Ga0496106_0035374 Ga0496106_0035374_93_707 194
877 3300048911 Ga0496108_0001245 Ga0496108_0001245_5503_6087 194
878 3300048911 Ga0496108_0188551 Ga0496108_0188551_943_1527 194
879 3300048912 Ga0496109_0000776 Ga0496109_0000776_3356_3940 194
880 3300048912 Ga0496109_0164855 Ga0496109_0164855_1156_1740 194
881 3300048913 Ga0496110_0009842 Ga0496110_0009842_2770_3354 194
882 3300048913 Ga0496110_0330428 Ga0496110_0330428_420_1034 194
883 3300048914 Ga0496111_0005089 Ga0496111_0005089_2398_2982 194
884 3300048915 Ga0496112_0001988 Ga0496112_0001988_224_808 194
885 3300048916 Ga0496113_0509490 Ga0496113_0509490_218_802 194
886 3300048929 Ga0496126_0032926 Ga0496126_0032926_2600_3187 194
887 3300049539 Ga0501323_054010 Ga0501323_054010_10_597 194
888 3300049569 Ga0501032_0003322 Ga0501032_0003322_5759_6367 194
889 3300049571 Ga0501034_0000013 Ga0501034_0000013_217635_218243 194
890 3300049572 Ga0501036_0055583 Ga0501036_0055583_1343_1927 194
891 3300049574 Ga0501038_0051627 Ga0501038_0051627_1057_1665 194
892 3300049574 Ga0501038_0263893 Ga0501038_0263893_433_1032 194
893 3300049575 Ga0501039_0000710 Ga0501039_0000710_5691_6299 194
894 3300049575 Ga0501039_0070384 Ga0501039_0070384_723_1322 194
895 3300049576 Ga0501040_0034120 Ga0501040_0034120_1695_2294 194
896 3300049577 Ga0501041_0013390 Ga0501041_0013390_3025_3624 194
897 3300049578 Ga0501042_0032369 Ga0501042_0032369_1555_2139 194
898 3300049580 Ga0501046_0020906 Ga0501046_0020906_3590_4198 194
899 3300049581 Ga0501047_0000721 Ga0501047_0000721_15995_16603 194
900 3300049583 Ga0501067_0003660 Ga0501067_0003660_5290_5898 194
901 3300049583 Ga0501067_0267409 Ga0501067_0267409_149_733 194
902 3300049584 Ga0501068_0301100 Ga0501068_0301100_313_912 194
903 3300049586 Ga0501070_0016220 Ga0501070_0016220_4573_5181 194
904 3300049586 Ga0501070_0886258 Ga0501070_0886258_68_652 194
905 3300049587 Ga0501071_0165551 Ga0501071_0165551_943_1527 194
906 3300049587 Ga0501071_0195931 Ga0501071_0195931_855_1454 194
907 3300049588 Ga0501072_0017019 Ga0501072_0017019_3826_4425 194
908 3300049590 Ga0501074_0043128 Ga0501074_0043128_1758_2357 194
909 3300049591 Ga0501075_0003578 Ga0501075_0003578_1803_2402 194
910 3300049592 Ga0501076_0185538 Ga0501076_0185538_364_963 194
911 3300049592 Ga0501076_0682761 Ga0501076_0682761_189_791 194
912 3300049593 Ga0501077_0175178 Ga0501077_0175178_692_1276 194
913 3300049741 Ga0501079_0014573 Ga0501079_0014573_2047_2646 194
914 3300049741 Ga0501079_0072552 Ga0501079_0072552_203_787 194
915 3300049741 Ga0501079_0571708 Ga0501079_0571708_41_640 194
916 3300049742 Ga0501080_0000003 Ga0501080_0000003_210165_210773 194
917 3300049743 Ga0501081_0043455 Ga0501081_0043455_2367_2951 194
918 3300049743 Ga0501081_0167354 Ga0501081_0167354_160_744 194
919 3300049822 Ga0501035_0000058 Ga0501035_0000058_53488_54096 194
920 3300049822 Ga0501035_0232151 Ga0501035_0232151_363_947 194
921 3300049823 Ga0501044_0000023 Ga0501044_0000023_114903_115511 194
922 3300049823 Ga0501044_0939894 Ga0501044_0939894_55_639 194
923 3300049824 Ga0501045_0008050 Ga0501045_0008050_1711_2310 194
924 3300049824 Ga0501045_0104355 Ga0501045_0104355_1263_1871 194
925 3300050507 nmdc:mga05p37_251440_c1 nmdc:mga05p37_251440_c1_1334_1918 194
926 3300050507 nmdc:mga05p37_327807_c1 nmdc:mga05p37_327807_c1_794_1378 194
927 3300050510 nmdc:mga06r32_72884_c1 nmdc:mga06r32_72884_c1_567_1151 194
928 3300050511 nmdc:mga08y16_44885_c1 nmdc:mga08y16_44885_c1_649_1287 194
929 3300050511 nmdc:mga08y16_713090_c1 nmdc:mga08y16_713090_c1_286_870 194
930 3300050512 nmdc:mga0n895_177138_c1 nmdc:mga0n895_177138_c1_659_1243 194
931 3300050512 nmdc:mga0n895_459499_c1 nmdc:mga0n895_459499_c1_43_627 194
932 3300050514 nmdc:mga08x19_396707_c1 nmdc:mga08x19_396707_c1_65_655 194
933 3300050514 nmdc:mga08x19_46448_c1 nmdc:mga08x19_46448_c1_1279_1866 194
934 3300050515 nmdc:mga0a205_458124_c1 nmdc:mga0a205_458124_c1_78_662 194
935 3300050515 nmdc:mga0a205_80807_c1 nmdc:mga0a205_80807_c1_474_1058 194
936 3300050516 nmdc:mga0sz30_5495_c3 nmdc:mga0sz30_5495_c3_2173_2757 194
937 3300054114 Ga0501084_0115244 Ga0501084_0115244_670_1254 194
938 3300059421 Ga0590071_000099 Ga0590071_000099_15481_16083 194
939 3300059423 Ga0590074_004504 Ga0590074_004504_216_818 194
940 3300059424 Ga0590075_000144 Ga0590075_000144_11714_12316 194
941 3300059424 Ga0590075_006802 Ga0590075_006802_262_885 194
942 3300059426 Ga0590077_002229 Ga0590077_002229_3029_3631 194
943 3300060353 Ga0501082_0014537 Ga0501082_0014537_1691_2290 194
944 3300060353 Ga0501082_0060235 Ga0501082_0060235_457_1065 194
945 3300060353 Ga0501082_0175116 Ga0501082_0175116_935_1519 194
946 3300060353 Ga0501082_0824905 Ga0501082_0824905_64_648 194
947 3300061734 Ga0530510_0005438 Ga0530510_0005438_1432_2031 194
948 3300061734 Ga0530510_0042094 Ga0530510_0042094_1635_2219 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

39

210

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.9702 2 174
6c46-assembly3.cif.gz_E-2 crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase from elizabethkingia anophelis nuhp1 0.969 1 175
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.9643 2 176
5buv-assembly2.cif.gz_B-2 x-ray structure of wbca from yersinia enterocolitica 0.9634 2 173
6c46-assembly2.cif.gz_C crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase from elizabethkingia anophelis nuhp1 0.9632 1 175
ID Description Score Start End Superfamily
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9634 2 173 2.60.120.10
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9546 2 176 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9454 1 182 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9424 2 176 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9365 2 173 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A6L5FCZ6-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 1.001 1 187 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1I7NFN2-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 1.001 1 187 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1Q6VP32-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9977 1 145 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A3D5H8T3-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9965 1 173 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A2Z2P1Z2-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9962 1 174 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Feature Viewer

pLDDT pTM Quality
95.62 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map