F486508
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 948 | 390 | 939 | 192 |
Family's Representative Sequence
| Representative Sequence | 3300013297|Ga0157378_10577608|Ga0157378_105776081 |
| Length | 228 |
| Sequence | MVAAQWLRNQVEIYTLRLRAANHRALEDRNREASVIFTETKLKGAFIIDLETRSDSRGYFARGFCRKEFEAHGLKPTIAQANIAHNIRKGTVRGMHFQYPPAAETKLVRCTRGAILDIIVDLRPESPTYLQHIEVELNEDNQRALYVPERFAHGYQALRDNTDTSYQVGEFYTPSAEGGLMYNDPKLCLKWPLPVSVISDKDQKFELLAKIEPEVKRKMAGELAMAVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 3 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 4 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 5 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 6 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 7 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 8 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 9 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 14 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 15 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 17 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 18 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 89 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 90 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 91 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 98 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 100 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 101 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 102 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 103 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 104 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 105 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 106 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 107 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 110 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 111 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 112 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 131 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 142 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 144 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 145 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 146 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 209 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 210 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 215 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 217 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 219 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 220 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 221 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 222 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 223 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 226 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 227 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 228 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 230 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 231 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 232 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 233 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 234 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 235 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 236 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 237 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 238 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 239 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 240 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 241 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 242 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 243 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 244 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 245 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 246 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 247 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 250 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 253 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 254 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 257 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 258 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 259 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 260 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 261 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 262 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 263 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 264 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 265 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 266 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 267 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 268 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 269 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 270 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 315 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 316 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 317 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 318 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 319 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 320 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 323 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 324 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 325 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 326 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 327 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 328 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 329 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 330 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 361 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 365 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 366 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 376 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 381 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 382 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 383 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 384 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 390 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.21 |
| Metatranscriptomes | 0.84 |
| Isolates | 0.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.48 |
| Nodule | 0.63 |
| Rhizoplane | 7.59 |
| Rhizosphere | 88.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_5910558 | 2162886011 | Bacteria | 1335 |
| 2 | JGI25153J46596_10000100 | 3300003215 | Bacteria | 98053 |
| 3 | rootL2_10061107 | 3300003322 | Bacteria | 3014 |
| 4 | rootL2_10073410 | 3300003322 | Bacteria | 3056 |
| 5 | rootL2_10091361 | 3300003322 | Bacteria | 1679 |
| 6 | Ga0055524_1000011 | 3300003775 | Bacteria | 261442 |
| 7 | JGI25405J52794_10002762 | 3300003911 | Bacteria | 3042 |
| 8 | Ga0058859_11489020 | 3300004798 | Bacteria | 630 |
| 9 | Ga0058861_11388695 | 3300004800 | Bacteria | 1363 |
| 10 | Ga0058862_10021887 | 3300004803 | Unclassified | 1158 |
| 11 | Ga0065712_10386821 | 3300005290 | Unclassified | 740 |
| 12 | Ga0065715_10510195 | 3300005293 | Bacteria | 772 |
| 13 | Ga0070676_10433350 | 3300005328 | Bacteria | 921 |
| 14 | Ga0070683_100001522 | 3300005329 | Bacteria | 17907 |
| 15 | Ga0070683_100005595 | 3300005329 | Bacteria | 10494 |
| 16 | Ga0070683_100078993 | 3300005329 | Bacteria | 3079 |
| 17 | Ga0070690_100177579 | 3300005330 | Bacteria | 1470 |
| 18 | Ga0070690_100378581 | 3300005330 | Bacteria | 1034 |
| 19 | Ga0070690_100508524 | 3300005330 | Bacteria | 902 |
| 20 | Ga0070690_100629644 | 3300005330 | Unclassified | 817 |
| 21 | Ga0070690_100648740 | 3300005330 | Bacteria | 806 |
| 22 | Ga0070670_100001055 | 3300005331 | Bacteria | 21884 |
| 23 | Ga0070670_101126074 | 3300005331 | Unclassified | 716 |
| 24 | Ga0068869_100005172 | 3300005334 | Bacteria | 8188 |
| 25 | Ga0068869_100026920 | 3300005334 | Bacteria | 4005 |
| 26 | Ga0068869_100090947 | 3300005334 | Bacteria | 2295 |
| 27 | Ga0068869_100156294 | 3300005334 | Bacteria | 1772 |
| 28 | Ga0068869_100182674 | 3300005334 | Bacteria | 1645 |
| 29 | Ga0070666_10734333 | 3300005335 | Bacteria | 725 |
| 30 | Ga0070680_100008542 | 3300005336 | Bacteria | 7844 |
| 31 | Ga0070680_100146350 | 3300005336 | Bacteria | 1982 |
| 32 | Ga0070682_100088871 | 3300005337 | Bacteria | 2017 |
| 33 | Ga0070682_100117419 | 3300005337 | Bacteria | 1781 |
| 34 | Ga0070660_100171521 | 3300005339 | Bacteria | 1752 |
| 35 | Ga0070689_100160156 | 3300005340 | Bacteria | 1819 |
| 36 | Ga0070689_100173939 | 3300005340 | Bacteria | 1746 |
| 37 | Ga0070689_100383957 | 3300005340 | Bacteria | 1184 |
| 38 | Ga0070689_100576246 | 3300005340 | Bacteria | 972 |
| 39 | Ga0070691_10014606 | 3300005341 | Bacteria | 3605 |
| 40 | Ga0070691_10017193 | 3300005341 | Bacteria | 3328 |
| 41 | Ga0070687_100296023 | 3300005343 | Unclassified | 1025 |
| 42 | Ga0070661_100023966 | 3300005344 | Bacteria | 4378 |
| 43 | Ga0070661_100045717 | 3300005344 | Bacteria | 3201 |
| 44 | Ga0070661_100056254 | 3300005344 | Bacteria | 2882 |
| 45 | Ga0070661_100254167 | 3300005344 | Unclassified | 1357 |
| 46 | Ga0070661_100461961 | 3300005344 | Bacteria | 1011 |
| 47 | Ga0070692_10020022 | 3300005345 | Bacteria | 3238 |
| 48 | Ga0070668_100111890 | 3300005347 | Bacteria | 2174 |
| 49 | Ga0070675_100042408 | 3300005354 | Bacteria | 3718 |
| 50 | Ga0070675_100065373 | 3300005354 | Bacteria | 3007 |
| 51 | Ga0070675_100412561 | 3300005354 | Unclassified | 1206 |
| 52 | Ga0070675_100597454 | 3300005354 | Bacteria | 1001 |
| 53 | Ga0070671_100773076 | 3300005355 | Bacteria | 835 |
| 54 | Ga0070674_100520971 | 3300005356 | Bacteria | 993 |
| 55 | Ga0070674_100780955 | 3300005356 | Bacteria | 823 |
| 56 | Ga0070673_100116463 | 3300005364 | Bacteria | 2223 |
| 57 | Ga0070688_100026962 | 3300005365 | Bacteria | 3419 |
| 58 | Ga0070688_100195391 | 3300005365 | Archaea | 1412 |
| 59 | Ga0070688_100483835 | 3300005365 | Unclassified | 931 |
| 60 | Ga0070659_100164338 | 3300005366 | Bacteria | 1816 |
| 61 | Ga0070659_100250101 | 3300005366 | Bacteria | 1469 |
| 62 | Ga0070659_100337158 | 3300005366 | Bacteria | 1263 |
| 63 | Ga0070703_10000441 | 3300005406 | Bacteria | 16907 |
| 64 | Ga0070709_10034389 | 3300005434 | Bacteria | 3072 |
| 65 | Ga0070709_10567987 | 3300005434 | Unclassified | 870 |
| 66 | Ga0070714_100002329 | 3300005435 | Bacteria | 13963 |
| 67 | Ga0070714_100015276 | 3300005435 | Bacteria | 6176 |
| 68 | Ga0070714_100017469 | 3300005435 | Bacteria | 5812 |
| 69 | Ga0070714_100296206 | 3300005435 | Unclassified | 1507 |
| 70 | Ga0070714_100309487 | 3300005435 | Bacteria | 1474 |
| 71 | Ga0070713_100019735 | 3300005436 | Bacteria | 5156 |
| 72 | Ga0070713_100080624 | 3300005436 | Bacteria | 2775 |
| 73 | Ga0070713_100103328 | 3300005436 | Bacteria | 2472 |
| 74 | Ga0070713_100379353 | 3300005436 | Bacteria | 1317 |
| 75 | Ga0070710_10010313 | 3300005437 | Bacteria | 4587 |
| 76 | Ga0070710_10026570 | 3300005437 | Bacteria | 3077 |
| 77 | Ga0070710_10148220 | 3300005437 | Bacteria | 1445 |
| 78 | Ga0070701_10003386 | 3300005438 | Bacteria | 6299 |
| 79 | Ga0070701_10010894 | 3300005438 | Bacteria | 4039 |
| 80 | Ga0070701_10073179 | 3300005438 | Bacteria | 1837 |
| 81 | Ga0070701_10121134 | 3300005438 | Unclassified | 1474 |
| 82 | Ga0070701_10215967 | 3300005438 | Unclassified | 1141 |
| 83 | Ga0070711_100007151 | 3300005439 | Bacteria | 6775 |
| 84 | Ga0070711_100027931 | 3300005439 | Bacteria | 3709 |
| 85 | Ga0070711_100569007 | 3300005439 | Bacteria | 942 |
| 86 | Ga0070705_100000032 | 3300005440 | Bacteria | 70341 |
| 87 | Ga0070705_100355295 | 3300005440 | Bacteria | 1070 |
| 88 | Ga0070700_100275018 | 3300005441 | Bacteria | 1218 |
| 89 | Ga0070700_100377285 | 3300005441 | Archaea | 1059 |
| 90 | Ga0070694_100001908 | 3300005444 | Bacteria | 12343 |
| 91 | Ga0070694_100045163 | 3300005444 | Bacteria | 2952 |
| 92 | Ga0070694_100140279 | 3300005444 | Bacteria | 1755 |
| 93 | Ga0070694_100857798 | 3300005444 | Bacteria | 748 |
| 94 | Ga0070708_100092880 | 3300005445 | Bacteria | 2750 |
| 95 | Ga0070708_100346821 | 3300005445 | Bacteria | 1399 |
| 96 | Ga0070708_101403958 | 3300005445 | Bacteria | 651 |
| 97 | Ga0070663_100011611 | 3300005455 | Bacteria | 5536 |
| 98 | Ga0070663_100534055 | 3300005455 | Bacteria | 978 |
| 99 | Ga0070663_100590536 | 3300005455 | Bacteria | 933 |
| 100 | Ga0070663_100853935 | 3300005455 | Bacteria | 784 |
| 101 | Ga0070663_100935991 | 3300005455 | Bacteria | 750 |
| 102 | Ga0070678_100565190 | 3300005456 | Bacteria | 1011 |
| 103 | Ga0070678_100845862 | 3300005456 | Bacteria | 833 |
| 104 | Ga0070662_100049951 | 3300005457 | Bacteria | 3017 |
| 105 | Ga0070662_100708808 | 3300005457 | Unclassified | 852 |
| 106 | Ga0070681_10007840 | 3300005458 | Bacteria | 10441 |
| 107 | Ga0070681_10042828 | 3300005458 | Bacteria | 4536 |
| 108 | Ga0070681_10067018 | 3300005458 | Bacteria | 3559 |
| 109 | Ga0070681_10415209 | 3300005458 | Bacteria | 1257 |
| 110 | Ga0070681_10632008 | 3300005458 | Bacteria | 985 |
| 111 | Ga0068867_100062179 | 3300005459 | Bacteria | 2774 |
| 112 | Ga0068867_100377232 | 3300005459 | Bacteria | 1190 |
| 113 | Ga0068867_101081462 | 3300005459 | Unclassified | 731 |
| 114 | Ga0070685_10168261 | 3300005466 | Bacteria | 1403 |
| 115 | Ga0070706_100015547 | 3300005467 | Bacteria | 7029 |
| 116 | Ga0070706_100211063 | 3300005467 | Bacteria | 1813 |
| 117 | Ga0070707_100010108 | 3300005468 | Bacteria | 8782 |
| 118 | Ga0070698_100003041 | 3300005471 | Bacteria | 18475 |
| 119 | Ga0070698_100186839 | 3300005471 | Bacteria | 2010 |
| 120 | Ga0070699_100001445 | 3300005518 | Bacteria | 21813 |
| 121 | Ga0070699_100603124 | 3300005518 | Bacteria | 1001 |
| 122 | Ga0070699_100919474 | 3300005518 | Unclassified | 801 |
| 123 | Ga0070699_101322889 | 3300005518 | Bacteria | 661 |
| 124 | Ga0070679_100016854 | 3300005530 | Bacteria | 7062 |
| 125 | Ga0070679_100434728 | 3300005530 | Bacteria | 1257 |
| 126 | Ga0070679_100440351 | 3300005530 | Bacteria | 1248 |
| 127 | Ga0070679_101037549 | 3300005530 | Bacteria | 764 |
| 128 | Ga0070684_100036102 | 3300005535 | Bacteria | 4235 |
| 129 | Ga0070684_100044445 | 3300005535 | Bacteria | 3842 |
| 130 | Ga0070684_100106805 | 3300005535 | Bacteria | 2507 |
| 131 | Ga0070684_100256907 | 3300005535 | Bacteria | 1598 |
| 132 | Ga0070684_100272588 | 3300005535 | Bacteria | 1549 |
| 133 | Ga0070697_100111821 | 3300005536 | Bacteria | 2277 |
| 134 | Ga0070697_100618893 | 3300005536 | Unclassified | 952 |
| 135 | Ga0068853_100033849 | 3300005539 | Bacteria | 4335 |
| 136 | Ga0068853_100271405 | 3300005539 | Bacteria | 1562 |
| 137 | Ga0068853_100412703 | 3300005539 | Bacteria | 1265 |
| 138 | Ga0070672_100016698 | 3300005543 | Bacteria | 5262 |
| 139 | Ga0070672_100195024 | 3300005543 | Bacteria | 1692 |
| 140 | Ga0070672_100261292 | 3300005543 | Bacteria | 1460 |
| 141 | Ga0070686_100036321 | 3300005544 | Bacteria | 3050 |
| 142 | Ga0070695_100000937 | 3300005545 | Bacteria | 15780 |
| 143 | Ga0070695_100271699 | 3300005545 | Unclassified | 1242 |
| 144 | Ga0070696_100000826 | 3300005546 | Bacteria | 19955 |
| 145 | Ga0070696_100054405 | 3300005546 | Bacteria | 2789 |
| 146 | Ga0070696_100169371 | 3300005546 | Unclassified | 1614 |
| 147 | Ga0070696_100228743 | 3300005546 | Bacteria | 1398 |
| 148 | Ga0070696_100424043 | 3300005546 | Unclassified | 1045 |
| 149 | Ga0070696_100466040 | 3300005546 | Bacteria | 999 |
| 150 | Ga0070665_100494675 | 3300005548 | Bacteria | 1234 |
| 151 | Ga0070704_100005197 | 3300005549 | Bacteria | 7571 |
| 152 | Ga0070704_100006752 | 3300005549 | Bacteria | 6792 |
| 153 | Ga0070704_100062631 | 3300005549 | Bacteria | 2667 |
| 154 | Ga0070704_100116708 | 3300005549 | Bacteria | 2041 |
| 155 | Ga0070704_100201188 | 3300005549 | Bacteria | 1608 |
| 156 | Ga0070704_100607691 | 3300005549 | Unclassified | 962 |
| 157 | Ga0068855_100108380 | 3300005563 | Bacteria | 3190 |
| 158 | Ga0068855_100139908 | 3300005563 | Bacteria | 2760 |
| 159 | Ga0068855_100171128 | 3300005563 | Bacteria | 2460 |
| 160 | Ga0068855_100210590 | 3300005563 | Bacteria | 2184 |
| 161 | Ga0070664_100008005 | 3300005564 | Bacteria | 8538 |
| 162 | Ga0070664_100008019 | 3300005564 | Bacteria | 8529 |
| 163 | Ga0070664_100057020 | 3300005564 | Bacteria | 3320 |
| 164 | Ga0070664_100131911 | 3300005564 | Bacteria | 2195 |
| 165 | Ga0070664_100339964 | 3300005564 | Bacteria | 1363 |
| 166 | Ga0068857_100034239 | 3300005577 | Bacteria | 4492 |
| 167 | Ga0068857_100172348 | 3300005577 | Bacteria | 1967 |
| 168 | Ga0068857_100243728 | 3300005577 | Bacteria | 1646 |
| 169 | Ga0068857_100291240 | 3300005577 | Bacteria | 1503 |
| 170 | Ga0068857_100584840 | 3300005577 | Bacteria | 1054 |
| 171 | Ga0068854_100090031 | 3300005578 | Bacteria | 2281 |
| 172 | Ga0068854_100265832 | 3300005578 | Bacteria | 1375 |
| 173 | Ga0068856_100003167 | 3300005614 | Bacteria | 16769 |
| 174 | Ga0068856_100069586 | 3300005614 | Bacteria | 3480 |
| 175 | Ga0068856_100108887 | 3300005614 | Bacteria | 2767 |
| 176 | Ga0070702_100135371 | 3300005615 | Bacteria | 1562 |
| 177 | Ga0070702_100321205 | 3300005615 | Bacteria | 1079 |
| 178 | Ga0070702_100403449 | 3300005615 | Bacteria | 979 |
| 179 | Ga0068859_100001900 | 3300005617 | Bacteria | 21287 |
| 180 | Ga0068859_100002751 | 3300005617 | Bacteria | 17831 |
| 181 | Ga0068859_100404630 | 3300005617 | Bacteria | 1461 |
| 182 | Ga0068864_100011945 | 3300005618 | Bacteria | 7169 |
| 183 | Ga0068864_100411570 | 3300005618 | Bacteria | 1287 |
| 184 | Ga0068866_10127992 | 3300005718 | Bacteria | 1440 |
| 185 | Ga0068866_10179243 | 3300005718 | Unclassified | 1250 |
| 186 | Ga0068861_100011697 | 3300005719 | Bacteria | 6106 |
| 187 | Ga0068861_100191016 | 3300005719 | Bacteria | 1712 |
| 188 | Ga0068861_100406332 | 3300005719 | Bacteria | 1210 |
| 189 | Ga0068861_100457479 | 3300005719 | Bacteria | 1145 |
| 190 | Ga0068851_10000500 | 3300005834 | Bacteria | 17092 |
| 191 | Ga0068870_10088005 | 3300005840 | Bacteria | 1730 |
| 192 | Ga0068870_10110343 | 3300005840 | Unclassified | 1570 |
| 193 | Ga0068870_10242701 | 3300005840 | Bacteria | 1113 |
| 194 | Ga0068863_100048611 | 3300005841 | Bacteria | 4022 |
| 195 | Ga0068863_100115767 | 3300005841 | Bacteria | 2554 |
| 196 | Ga0068863_100468931 | 3300005841 | Bacteria | 1237 |
| 197 | Ga0068863_100904458 | 3300005841 | Unclassified | 883 |
| 198 | Ga0068858_100158156 | 3300005842 | Bacteria | 2133 |
| 199 | Ga0068858_100361606 | 3300005842 | Unclassified | 1391 |
| 200 | Ga0068858_101444916 | 3300005842 | Bacteria | 678 |
| 201 | Ga0068860_100000870 | 3300005843 | Bacteria | 33607 |
| 202 | Ga0068860_100082372 | 3300005843 | Bacteria | 3060 |
| 203 | Ga0068860_100105252 | 3300005843 | Bacteria | 2694 |
| 204 | Ga0068860_100353300 | 3300005843 | Bacteria | 1447 |
| 205 | Ga0068860_100388175 | 3300005843 | Bacteria | 1379 |
| 206 | Ga0068860_100588532 | 3300005843 | Bacteria | 1117 |
| 207 | Ga0068862_100001615 | 3300005844 | Bacteria | 20525 |
| 208 | Ga0068862_100191213 | 3300005844 | Bacteria | 1842 |
| 209 | Ga0068862_100604902 | 3300005844 | Bacteria | 1053 |
| 210 | Ga0081455_10000119 | 3300005937 | Bacteria | 90937 |
| 211 | Ga0081455_10003170 | 3300005937 | Bacteria | 19093 |
| 212 | Ga0081455_10004119 | 3300005937 | Bacteria | 16443 |
| 213 | Ga0081455_10008686 | 3300005937 | Bacteria | 10522 |
| 214 | Ga0081455_10010105 | 3300005937 | Bacteria | 9622 |
| 215 | Ga0081455_10017243 | 3300005937 | Bacteria | 6932 |
| 216 | Ga0081455_10139075 | 3300005937 | Bacteria | 1888 |
| 217 | Ga0081455_10184583 | 3300005937 | Bacteria | 1576 |
| 218 | Ga0081455_10397911 | 3300005937 | Unclassified | 957 |
| 219 | Ga0081455_10487375 | 3300005937 | Bacteria | 832 |
| 220 | Ga0081538_10055537 | 3300005981 | Bacteria | 2330 |
| 221 | Ga0081538_10100479 | 3300005981 | Bacteria | 1458 |
| 222 | Ga0081540_1032177 | 3300005983 | Bacteria | 2868 |
| 223 | Ga0081540_1038817 | 3300005983 | Bacteria | 2504 |
| 224 | Ga0081540_1158584 | 3300005983 | Bacteria | 881 |
| 225 | Ga0081539_10005293 | 3300005985 | Bacteria | 13278 |
| 226 | Ga0081539_10205066 | 3300005985 | Bacteria | 907 |
| 227 | Ga0075368_10169108 | 3300006042 | Bacteria | 918 |
| 228 | Ga0070715_10065785 | 3300006163 | Unclassified | 1605 |
| 229 | Ga0070715_10103903 | 3300006163 | Bacteria | 1330 |
| 230 | Ga0070716_100506808 | 3300006173 | Bacteria | 891 |
| 231 | Ga0070716_101009395 | 3300006173 | Bacteria | 658 |
| 232 | Ga0070712_100002273 | 3300006175 | Bacteria | 11830 |
| 233 | Ga0070712_100031647 | 3300006175 | Bacteria | 3566 |
| 234 | Ga0070712_100040183 | 3300006175 | Bacteria | 3205 |
| 235 | Ga0070712_100040648 | 3300006175 | Bacteria | 3189 |
| 236 | Ga0070712_100045039 | 3300006175 | Bacteria | 3045 |
| 237 | Ga0070712_100086388 | 3300006175 | Bacteria | 2286 |
| 238 | Ga0070712_100810028 | 3300006175 | Unclassified | 804 |
| 239 | Ga0075362_10015526 | 3300006177 | Bacteria | 3099 |
| 240 | Ga0075367_10030118 | 3300006178 | Bacteria | 3109 |
| 241 | Ga0075369_10042153 | 3300006186 | Bacteria | 1956 |
| 242 | Ga0097621_100040333 | 3300006237 | Unclassified | 3754 |
| 243 | Ga0097621_100137202 | 3300006237 | Bacteria | 2087 |
| 244 | Ga0097621_100140901 | 3300006237 | Unclassified | 2060 |
| 245 | Ga0097621_100653949 | 3300006237 | Bacteria | 965 |
| 246 | Ga0068871_100013249 | 3300006358 | Bacteria | 6114 |
| 247 | Ga0068871_100063640 | 3300006358 | Bacteria | 3018 |
| 248 | Ga0068871_101103567 | 3300006358 | Bacteria | 742 |
| 249 | Ga0075428_100014795 | 3300006844 | Bacteria | 8670 |
| 250 | Ga0075428_100040465 | 3300006844 | Bacteria | 5127 |
| 251 | Ga0075428_100849644 | 3300006844 | Bacteria | 969 |
| 252 | Ga0075428_101353837 | 3300006844 | Bacteria | 748 |
| 253 | Ga0075430_100161440 | 3300006846 | Bacteria | 1865 |
| 254 | Ga0075430_100211930 | 3300006846 | Bacteria | 1607 |
| 255 | Ga0075430_100461444 | 3300006846 | Bacteria | 1048 |
| 256 | Ga0075431_100040935 | 3300006847 | Unclassified | 4777 |
| 257 | Ga0075431_100187585 | 3300006847 | Bacteria | 2120 |
| 258 | Ga0075433_10416862 | 3300006852 | Bacteria | 1184 |
| 259 | Ga0075434_100059001 | 3300006871 | Bacteria | 3814 |
| 260 | Ga0075434_100268291 | 3300006871 | Bacteria | 1726 |
| 261 | Ga0075434_100350962 | 3300006871 | Bacteria | 1496 |
| 262 | Ga0075434_100440650 | 3300006871 | Bacteria | 1324 |
| 263 | Ga0075434_100683642 | 3300006871 | Unclassified | 1044 |
| 264 | Ga0075434_100801115 | 3300006871 | Bacteria | 958 |
| 265 | Ga0075429_100240735 | 3300006880 | Bacteria | 1585 |
| 266 | Ga0068865_100009081 | 3300006881 | Bacteria | 6151 |
| 267 | Ga0068865_100361902 | 3300006881 | Bacteria | 1178 |
| 268 | Ga0068865_100778100 | 3300006881 | Bacteria | 824 |
| 269 | Ga0068865_101035649 | 3300006881 | Unclassified | 720 |
| 270 | Ga0075436_100024514 | 3300006914 | Bacteria | 4146 |
| 271 | Ga0075436_100187998 | 3300006914 | Bacteria | 1461 |
| 272 | Ga0075436_100209942 | 3300006914 | Bacteria | 1380 |
| 273 | Ga0075436_100219034 | 3300006914 | Unclassified | 1350 |
| 274 | Ga0075436_100423504 | 3300006914 | Bacteria | 967 |
| 275 | Ga0075436_100463914 | 3300006914 | Unclassified | 923 |
| 276 | Ga0097620_100001900 | 3300006931 | Bacteria | 21287 |
| 277 | Ga0097620_100002751 | 3300006931 | Bacteria | 17831 |
| 278 | Ga0097620_100404625 | 3300006931 | Bacteria | 1461 |
| 279 | Ga0099823_1024448 | 3300006944 | Bacteria | 5464 |
| 280 | Ga0075435_100144319 | 3300007076 | Bacteria | 1999 |
| 281 | Ga0099795_10001115 | 3300007788 | Bacteria | 5585 |
| 282 | Ga0099795_10180550 | 3300007788 | Unclassified | 881 |
| 283 | Ga0105240_10046260 | 3300009093 | Bacteria | 5515 |
| 284 | Ga0105240_10368771 | 3300009093 | Bacteria | 1624 |
| 285 | Ga0111539_10002011 | 3300009094 | Bacteria | 27132 |
| 286 | Ga0111539_10038472 | 3300009094 | Bacteria | 5769 |
| 287 | Ga0111539_10078450 | 3300009094 | Bacteria | 3885 |
| 288 | Ga0111539_10094234 | 3300009094 | Bacteria | 3517 |
| 289 | Ga0111539_10179662 | 3300009094 | Bacteria | 2472 |
| 290 | Ga0111539_10235858 | 3300009094 | Bacteria | 2130 |
| 291 | Ga0111539_10353482 | 3300009094 | Bacteria | 1710 |
| 292 | Ga0111539_10488853 | 3300009094 | Unclassified | 1434 |
| 293 | Ga0111539_11151418 | 3300009094 | Bacteria | 901 |
| 294 | Ga0105245_10201236 | 3300009098 | Bacteria | 1912 |
| 295 | Ga0105247_10234281 | 3300009101 | Bacteria | 1248 |
| 296 | Ga0114129_10013291 | 3300009147 | Bacteria | 11731 |
| 297 | Ga0114129_10055169 | 3300009147 | Bacteria | 5570 |
| 298 | Ga0114129_10186680 | 3300009147 | Bacteria | 2817 |
| 299 | Ga0114129_10285123 | 3300009147 | Bacteria | 2206 |
| 300 | Ga0114129_10384671 | 3300009147 | Bacteria | 1852 |
| 301 | Ga0114129_10389251 | 3300009147 | Bacteria | 1839 |
| 302 | Ga0114129_10506256 | 3300009147 | Bacteria | 1576 |
| 303 | Ga0114129_10624806 | 3300009147 | Bacteria | 1393 |
| 304 | Ga0114129_11130365 | 3300009147 | Bacteria | 979 |
| 305 | Ga0114129_11155908 | 3300009147 | Bacteria | 966 |
| 306 | Ga0114129_11333174 | 3300009147 | Bacteria | 888 |
| 307 | Ga0114129_11509410 | 3300009147 | Unclassified | 825 |
| 308 | Ga0114129_11621281 | 3300009147 | Bacteria | 792 |
| 309 | Ga0105243_10552502 | 3300009148 | Bacteria | 1100 |
| 310 | Ga0105243_10602355 | 3300009148 | Bacteria | 1058 |
| 311 | Ga0105243_10978035 | 3300009148 | Unclassified | 847 |
| 312 | Ga0105241_10148370 | 3300009174 | Bacteria | 1916 |
| 313 | Ga0105241_10158688 | 3300009174 | Bacteria | 1857 |
| 314 | Ga0105242_10378762 | 3300009176 | Bacteria | 1315 |
| 315 | Ga0105242_10396315 | 3300009176 | Bacteria | 1287 |
| 316 | Ga0105242_10589539 | 3300009176 | Bacteria | 1072 |
| 317 | Ga0105242_10776779 | 3300009176 | Bacteria | 946 |
| 318 | Ga0105242_11245096 | 3300009176 | Unclassified | 765 |
| 319 | Ga0105248_10176427 | 3300009177 | Bacteria | 2408 |
| 320 | Ga0105248_10680438 | 3300009177 | Bacteria | 1161 |
| 321 | Ga0105248_11060786 | 3300009177 | Bacteria | 916 |
| 322 | Ga0105237_10006095 | 3300009545 | Bacteria | 13480 |
| 323 | Ga0105237_10020853 | 3300009545 | Bacteria | 6748 |
| 324 | Ga0105237_10109102 | 3300009545 | Bacteria | 2759 |
| 325 | Ga0105237_10377707 | 3300009545 | Bacteria | 1422 |
| 326 | Ga0105237_10622452 | 3300009545 | Bacteria | 1086 |
| 327 | Ga0105238_10000679 | 3300009551 | Bacteria | 35795 |
| 328 | Ga0105238_10010451 | 3300009551 | Bacteria | 9315 |
| 329 | Ga0105238_10027367 | 3300009551 | Bacteria | 5809 |
| 330 | Ga0105238_10287277 | 3300009551 | Bacteria | 1627 |
| 331 | Ga0105249_10001320 | 3300009553 | Bacteria | 21711 |
| 332 | Ga0105249_10395607 | 3300009553 | Unclassified | 1411 |
| 333 | Ga0105249_10429497 | 3300009553 | Bacteria | 1356 |
| 334 | Ga0105249_10463690 | 3300009553 | Bacteria | 1307 |
| 335 | Ga0099796_10187129 | 3300010159 | Bacteria | 834 |
| 336 | Ga0105239_10002049 | 3300010375 | Bacteria | 26140 |
| 337 | Ga0105239_10008461 | 3300010375 | Bacteria | 11701 |
| 338 | Ga0105239_10012961 | 3300010375 | Bacteria | 9276 |
| 339 | Ga0105239_10013235 | 3300010375 | Bacteria | 9169 |
| 340 | Ga0105239_10123513 | 3300010375 | Bacteria | 2876 |
| 341 | Ga0105239_10193538 | 3300010375 | Bacteria | 2277 |
| 342 | Ga0105239_10376430 | 3300010375 | Bacteria | 1605 |
| 343 | Ga0105239_10740467 | 3300010375 | Bacteria | 1125 |
| 344 | Ga0105246_10013675 | 3300011119 | Bacteria | 5092 |
| 345 | Ga0105246_10292567 | 3300011119 | Bacteria | 1311 |
| 346 | Ga0105246_10564285 | 3300011119 | Bacteria | 978 |
| 347 | Ga0157373_10122589 | 3300013100 | Bacteria | 1827 |
| 348 | Ga0157373_10316729 | 3300013100 | Bacteria | 1109 |
| 349 | Ga0157370_10005882 | 3300013104 | Bacteria | 13674 |
| 350 | Ga0157370_10039454 | 3300013104 | Bacteria | 4563 |
| 351 | Ga0157370_10091494 | 3300013104 | Bacteria | 2856 |
| 352 | Ga0157370_10403493 | 3300013104 | Bacteria | 1258 |
| 353 | Ga0157369_10001683 | 3300013105 | Bacteria | 26984 |
| 354 | Ga0157369_10009927 | 3300013105 | Bacteria | 10878 |
| 355 | Ga0157369_10029345 | 3300013105 | Bacteria | 6078 |
| 356 | Ga0157369_10197739 | 3300013105 | Bacteria | 2110 |
| 357 | Ga0171462_1011 | 3300013250 | Bacteria | 229282 |
| 358 | Ga0157374_10037229 | 3300013296 | Unclassified | 4464 |
| 359 | Ga0157374_10041905 | 3300013296 | Bacteria | 4221 |
| 360 | Ga0157374_10094657 | 3300013296 | Bacteria | 2855 |
| 361 | Ga0157374_10294597 | 3300013296 | Bacteria | 1604 |
| 362 | Ga0157378_10020587 | 3300013297 | Bacteria | 5801 |
| 363 | Ga0157378_10121156 | 3300013297 | Bacteria | 2411 |
| 364 | Ga0157378_10168508 | 3300013297 | Bacteria | 2052 |
| 365 | Ga0157378_10174250 | 3300013297 | Bacteria | 2020 |
| 366 | Ga0157378_10293061 | 3300013297 | Bacteria | 1572 |
| 367 | Ga0157378_10308421 | 3300013297 | Bacteria | 1534 |
| 368 | Ga0157378_10385015 | 3300013297 | Unclassified | 1378 |
| 369 | Ga0157378_10577608 | 3300013297 | Bacteria | 1133 |
| 370 | Ga0163162_10025885 | 3300013306 | Bacteria | 5798 |
| 371 | Ga0163162_10053017 | 3300013306 | Bacteria | 4076 |
| 372 | Ga0163162_10222402 | 3300013306 | Bacteria | 2018 |
| 373 | Ga0157372_10031051 | 3300013307 | Bacteria | 5848 |
| 374 | Ga0157372_10431177 | 3300013307 | Bacteria | 1537 |
| 375 | Ga0157375_10001967 | 3300013308 | Bacteria | 17714 |
| 376 | Ga0157375_10058333 | 3300013308 | Bacteria | 3818 |
| 377 | Ga0157375_10087812 | 3300013308 | Bacteria | 3163 |
| 378 | Ga0157375_10200558 | 3300013308 | Unclassified | 2151 |
| 379 | Ga0157375_10542526 | 3300013308 | Bacteria | 1325 |
| 380 | Ga0157375_10627423 | 3300013308 | Bacteria | 1232 |
| 381 | Ga0157375_11620631 | 3300013308 | Bacteria | 765 |
| 382 | Ga0157375_11639488 | 3300013308 | Unclassified | 761 |
| 383 | Ga0163163_10001306 | 3300014325 | Bacteria | 21051 |
| 384 | Ga0163163_10170273 | 3300014325 | Bacteria | 2224 |
| 385 | Ga0163163_10202111 | 3300014325 | Bacteria | 2035 |
| 386 | Ga0157380_10026287 | 3300014326 | Bacteria | 4419 |
| 387 | Ga0157380_10322618 | 3300014326 | Bacteria | 1432 |
| 388 | Ga0157377_10124201 | 3300014745 | Bacteria | 1568 |
| 389 | Ga0157377_10367727 | 3300014745 | Unclassified | 970 |
| 390 | Ga0157379_10029505 | 3300014968 | Bacteria | 4877 |
| 391 | Ga0157379_10129263 | 3300014968 | Bacteria | 2273 |
| 392 | Ga0157379_10160461 | 3300014968 | Bacteria | 2029 |
| 393 | Ga0157379_10211813 | 3300014968 | Bacteria | 1754 |
| 394 | Ga0157376_10023471 | 3300014969 | Bacteria | 4827 |
| 395 | Ga0157376_10040980 | 3300014969 | Bacteria | 3789 |
| 396 | Ga0157376_10261577 | 3300014969 | Bacteria | 1621 |
| 397 | Ga0157376_10309989 | 3300014969 | Bacteria | 1497 |
| 398 | Ga0157376_10315375 | 3300014969 | Unclassified | 1485 |
| 399 | Ga0157376_10452634 | 3300014969 | Unclassified | 1252 |
| 400 | Ga0182006_1109436 | 3300015261 | Unclassified | 971 |
| 401 | Ga0163161_10663337 | 3300017792 | Bacteria | 865 |
| 402 | Ga0163161_10960066 | 3300017792 | Bacteria | 727 |
| 403 | Ga0213872_10023263 | 3300021361 | Bacteria | 2851 |
| 404 | Ga0213876_10052853 | 3300021384 | Bacteria | 2146 |
| 405 | Ga0213876_10099456 | 3300021384 | Unclassified | 1542 |
| 406 | Ga0213871_10022240 | 3300021441 | Bacteria | 1588 |
| 407 | Ga0209675_1000957 | 3300025291 | Bacteria | 18303 |
| 408 | Ga0209564_1000143 | 3300025295 | Bacteria | 177136 |
| 409 | Ga0209758_1000189 | 3300025297 | Bacteria | 138296 |
| 410 | Ga0209256_1000111 | 3300025299 | Bacteria | 178442 |
| 411 | Ga0209257_1048775 | 3300025304 | Bacteria | 1210 |
| 412 | Ga0207697_10010945 | 3300025315 | Bacteria | 3854 |
| 413 | Ga0207697_10025775 | 3300025315 | Bacteria | 2404 |
| 414 | Ga0207653_10001223 | 3300025885 | Bacteria | 8400 |
| 415 | Ga0207692_10029000 | 3300025898 | Bacteria | 2624 |
| 416 | Ga0207692_10043848 | 3300025898 | Bacteria | 2228 |
| 417 | Ga0207692_10429061 | 3300025898 | Unclassified | 829 |
| 418 | Ga0207642_10195459 | 3300025899 | Bacteria | 1113 |
| 419 | Ga0207688_10070309 | 3300025901 | Archaea | 1984 |
| 420 | Ga0207680_10102001 | 3300025903 | Bacteria | 1845 |
| 421 | Ga0207680_10259370 | 3300025903 | Bacteria | 1203 |
| 422 | Ga0207647_10074469 | 3300025904 | Bacteria | 2045 |
| 423 | Ga0207685_10095939 | 3300025905 | Unclassified | 1259 |
| 424 | Ga0207699_10003869 | 3300025906 | Bacteria | 7153 |
| 425 | Ga0207699_10021822 | 3300025906 | Bacteria | 3459 |
| 426 | Ga0207645_10112242 | 3300025907 | Bacteria | 1765 |
| 427 | Ga0207643_10152057 | 3300025908 | Bacteria | 1388 |
| 428 | Ga0207684_10054127 | 3300025910 | Bacteria | 3405 |
| 429 | Ga0207684_10065115 | 3300025910 | Bacteria | 3095 |
| 430 | Ga0207684_10112531 | 3300025910 | Bacteria | 2330 |
| 431 | Ga0207654_10066580 | 3300025911 | Unclassified | 2125 |
| 432 | Ga0207654_10094388 | 3300025911 | Bacteria | 1831 |
| 433 | Ga0207654_10121236 | 3300025911 | Bacteria | 1642 |
| 434 | Ga0207707_10000541 | 3300025912 | Bacteria | 38481 |
| 435 | Ga0207707_10076207 | 3300025912 | Bacteria | 2927 |
| 436 | Ga0207707_10089339 | 3300025912 | Bacteria | 2692 |
| 437 | Ga0207707_10163949 | 3300025912 | Bacteria | 1942 |
| 438 | Ga0207707_10832948 | 3300025912 | Bacteria | 767 |
| 439 | Ga0207695_10118403 | 3300025913 | Bacteria | 2620 |
| 440 | Ga0207671_10033203 | 3300025914 | Unclassified | 3840 |
| 441 | Ga0207693_10000618 | 3300025915 | Bacteria | 31778 |
| 442 | Ga0207693_10012664 | 3300025915 | Bacteria | 6813 |
| 443 | Ga0207693_10013607 | 3300025915 | Bacteria | 6557 |
| 444 | Ga0207693_10026456 | 3300025915 | Bacteria | 4592 |
| 445 | Ga0207693_10027324 | 3300025915 | Bacteria | 4512 |
| 446 | Ga0207693_10052515 | 3300025915 | Bacteria | 3197 |
| 447 | Ga0207693_10185032 | 3300025915 | Bacteria | 1640 |
| 448 | Ga0207663_10001846 | 3300025916 | Bacteria | 10003 |
| 449 | Ga0207663_10017163 | 3300025916 | Bacteria | 4027 |
| 450 | Ga0207663_10039414 | 3300025916 | Bacteria | 2863 |
| 451 | Ga0207663_10064525 | 3300025916 | Bacteria | 2337 |
| 452 | Ga0207660_10008198 | 3300025917 | Bacteria | 6761 |
| 453 | Ga0207660_10011616 | 3300025917 | Bacteria | 5741 |
| 454 | Ga0207660_10493938 | 3300025917 | Bacteria | 993 |
| 455 | Ga0207660_10609006 | 3300025917 | Bacteria | 890 |
| 456 | Ga0207662_10034726 | 3300025918 | Bacteria | 2943 |
| 457 | Ga0207662_10122212 | 3300025918 | Bacteria | 1634 |
| 458 | Ga0207657_10000717 | 3300025919 | Bacteria | 35166 |
| 459 | Ga0207657_10002950 | 3300025919 | Bacteria | 18254 |
| 460 | Ga0207657_10042712 | 3300025919 | Bacteria | 3998 |
| 461 | Ga0207649_10016319 | 3300025920 | Bacteria | 4184 |
| 462 | Ga0207649_10022079 | 3300025920 | Bacteria | 3675 |
| 463 | Ga0207649_10370137 | 3300025920 | Bacteria | 1065 |
| 464 | Ga0207649_10388441 | 3300025920 | Bacteria | 1042 |
| 465 | Ga0207652_10005910 | 3300025921 | Bacteria | 9899 |
| 466 | Ga0207652_10201794 | 3300025921 | Bacteria | 1790 |
| 467 | Ga0207694_10089548 | 3300025924 | Bacteria | 2427 |
| 468 | Ga0207694_10233146 | 3300025924 | Bacteria | 1504 |
| 469 | Ga0207694_10291895 | 3300025924 | Unclassified | 1341 |
| 470 | Ga0207650_10002100 | 3300025925 | Bacteria | 13924 |
| 471 | Ga0207659_10029567 | 3300025926 | Bacteria | 3736 |
| 472 | Ga0207659_10050229 | 3300025926 | Bacteria | 2962 |
| 473 | Ga0207659_10670400 | 3300025926 | Bacteria | 887 |
| 474 | Ga0207700_10070167 | 3300025928 | Bacteria | 2692 |
| 475 | Ga0207700_10160358 | 3300025928 | Bacteria | 1867 |
| 476 | Ga0207664_10033072 | 3300025929 | Unclassified | 3969 |
| 477 | Ga0207664_10062432 | 3300025929 | Bacteria | 2976 |
| 478 | Ga0207664_10105987 | 3300025929 | Bacteria | 2330 |
| 479 | Ga0207664_10267410 | 3300025929 | Unclassified | 1497 |
| 480 | Ga0207664_10315615 | 3300025929 | Bacteria | 1378 |
| 481 | Ga0207664_10333431 | 3300025929 | Bacteria | 1340 |
| 482 | Ga0207644_10337171 | 3300025931 | Unclassified | 1222 |
| 483 | Ga0207644_10402589 | 3300025931 | Bacteria | 1119 |
| 484 | Ga0207690_10098241 | 3300025932 | Bacteria | 2085 |
| 485 | Ga0207690_10261233 | 3300025932 | Bacteria | 1342 |
| 486 | Ga0207690_10285163 | 3300025932 | Bacteria | 1287 |
| 487 | Ga0207706_10075427 | 3300025933 | Bacteria | 2966 |
| 488 | Ga0207706_10515868 | 3300025933 | Unclassified | 1031 |
| 489 | Ga0207706_10687361 | 3300025933 | Unclassified | 875 |
| 490 | Ga0207709_10216070 | 3300025935 | Bacteria | 1379 |
| 491 | Ga0207709_10319217 | 3300025935 | Bacteria | 1162 |
| 492 | Ga0207670_10206838 | 3300025936 | Bacteria | 1494 |
| 493 | Ga0207670_10533799 | 3300025936 | Bacteria | 957 |
| 494 | Ga0207669_10593924 | 3300025937 | Bacteria | 899 |
| 495 | Ga0207665_10012300 | 3300025939 | Bacteria | 5621 |
| 496 | Ga0207665_10167118 | 3300025939 | Bacteria | 1586 |
| 497 | Ga0207665_10901704 | 3300025939 | Bacteria | 701 |
| 498 | Ga0207691_10412429 | 3300025940 | Bacteria | 1151 |
| 499 | Ga0207691_10439135 | 3300025940 | Unclassified | 1111 |
| 500 | Ga0207711_10092722 | 3300025941 | Bacteria | 2659 |
| 501 | Ga0207711_10287360 | 3300025941 | Bacteria | 1515 |
| 502 | Ga0207689_10004614 | 3300025942 | Bacteria | 12460 |
| 503 | Ga0207689_10046924 | 3300025942 | Bacteria | 3568 |
| 504 | Ga0207689_10151595 | 3300025942 | Bacteria | 1911 |
| 505 | Ga0207661_10005842 | 3300025944 | Bacteria | 8682 |
| 506 | Ga0207661_10008495 | 3300025944 | Bacteria | 7340 |
| 507 | Ga0207661_10096883 | 3300025944 | Bacteria | 2469 |
| 508 | Ga0207679_10523364 | 3300025945 | Bacteria | 1061 |
| 509 | Ga0207667_10168343 | 3300025949 | Bacteria | 2252 |
| 510 | Ga0207667_10259558 | 3300025949 | Bacteria | 1777 |
| 511 | Ga0207651_10026977 | 3300025960 | Bacteria | 3600 |
| 512 | Ga0207651_10027427 | 3300025960 | Bacteria | 3577 |
| 513 | Ga0207651_10115557 | 3300025960 | Bacteria | 2024 |
| 514 | Ga0207651_10732040 | 3300025960 | Bacteria | 873 |
| 515 | Ga0207712_10061112 | 3300025961 | Bacteria | 2673 |
| 516 | Ga0207712_10344833 | 3300025961 | Bacteria | 1236 |
| 517 | Ga0207668_10059052 | 3300025972 | Bacteria | 2685 |
| 518 | Ga0207677_10048957 | 3300026023 | Unclassified | 2848 |
| 519 | Ga0207703_10411021 | 3300026035 | Bacteria | 1257 |
| 520 | Ga0207639_10022195 | 3300026041 | Bacteria | 4569 |
| 521 | Ga0207639_10110242 | 3300026041 | Bacteria | 2241 |
| 522 | Ga0207639_10773549 | 3300026041 | Bacteria | 894 |
| 523 | Ga0207639_10780454 | 3300026041 | Archaea | 890 |
| 524 | Ga0207678_10007780 | 3300026067 | Bacteria | 9468 |
| 525 | Ga0207678_10012879 | 3300026067 | Bacteria | 7341 |
| 526 | Ga0207678_10020352 | 3300026067 | Bacteria | 5821 |
| 527 | Ga0207678_10087387 | 3300026067 | Bacteria | 2664 |
| 528 | Ga0207678_10179764 | 3300026067 | Bacteria | 1806 |
| 529 | Ga0207678_10391407 | 3300026067 | Bacteria | 1202 |
| 530 | Ga0207678_10541343 | 3300026067 | Bacteria | 1018 |
| 531 | Ga0207708_10001022 | 3300026075 | Bacteria | 20938 |
| 532 | Ga0207708_10005193 | 3300026075 | Bacteria | 9600 |
| 533 | Ga0207708_10062463 | 3300026075 | Bacteria | 2846 |
| 534 | Ga0207708_10233878 | 3300026075 | Bacteria | 1476 |
| 535 | Ga0207708_10854836 | 3300026075 | Unclassified | 786 |
| 536 | Ga0207702_10019580 | 3300026078 | Bacteria | 5601 |
| 537 | Ga0207702_10082938 | 3300026078 | Bacteria | 2788 |
| 538 | Ga0207702_11117688 | 3300026078 | Bacteria | 782 |
| 539 | Ga0207641_10044330 | 3300026088 | Bacteria | 3741 |
| 540 | Ga0207641_10296644 | 3300026088 | Unclassified | 1525 |
| 541 | Ga0207648_10337789 | 3300026089 | Bacteria | 1356 |
| 542 | Ga0207648_10432810 | 3300026089 | Bacteria | 1196 |
| 543 | Ga0207676_10008478 | 3300026095 | Bacteria | 7308 |
| 544 | Ga0207676_10351517 | 3300026095 | Unclassified | 1363 |
| 545 | Ga0207676_10356425 | 3300026095 | Bacteria | 1354 |
| 546 | Ga0207674_10003569 | 3300026116 | Bacteria | 18971 |
| 547 | Ga0207674_10059274 | 3300026116 | Bacteria | 3874 |
| 548 | Ga0207674_10097832 | 3300026116 | Bacteria | 2918 |
| 549 | Ga0207674_10257606 | 3300026116 | Bacteria | 1692 |
| 550 | Ga0207674_10339096 | 3300026116 | Bacteria | 1453 |
| 551 | Ga0207674_10459910 | 3300026116 | Bacteria | 1230 |
| 552 | Ga0207674_10573474 | 3300026116 | Bacteria | 1090 |
| 553 | Ga0207674_10603567 | 3300026116 | Bacteria | 1060 |
| 554 | Ga0207675_100010598 | 3300026118 | Bacteria | 8633 |
| 555 | Ga0207675_100086481 | 3300026118 | Bacteria | 2944 |
| 556 | Ga0207675_100112491 | 3300026118 | Bacteria | 2570 |
| 557 | Ga0207675_100191758 | 3300026118 | Unclassified | 1960 |
| 558 | Ga0207675_100506599 | 3300026118 | Unclassified | 1202 |
| 559 | Ga0207683_10015532 | 3300026121 | Bacteria | 6483 |
| 560 | Ga0207683_10151702 | 3300026121 | Bacteria | 2091 |
| 561 | Ga0207683_10222157 | 3300026121 | Bacteria | 1721 |
| 562 | Ga0207698_10098675 | 3300026142 | Bacteria | 2414 |
| 563 | Ga0209389_1000222 | 3300027296 | Bacteria | 38949 |
| 564 | Ga0209489_101154 | 3300027361 | Bacteria | 53677 |
| 565 | Ga0207428_10018250 | 3300027907 | Bacteria | 5996 |
| 566 | Ga0207428_10067820 | 3300027907 | Bacteria | 2808 |
| 567 | Ga0268266_11046144 | 3300028379 | Bacteria | 790 |
| 568 | Ga0268265_10002040 | 3300028380 | Bacteria | 15844 |
| 569 | Ga0268264_10001009 | 3300028381 | Bacteria | 28574 |
| 570 | Ga0268264_10089061 | 3300028381 | Bacteria | 2657 |
| 571 | Ga0268264_10090713 | 3300028381 | Unclassified | 2634 |
| 572 | Ga0268264_10503933 | 3300028381 | Unclassified | 1181 |
| 573 | Ga0268264_10784014 | 3300028381 | Unclassified | 951 |
| 574 | Ga0265319_1039497 | 3300028563 | Bacteria | 1599 |
| 575 | Ga0265334_10177353 | 3300028573 | Unclassified | 745 |
| 576 | Ga0265318_10001006 | 3300028577 | Bacteria | 18018 |
| 577 | Ga0265332_10102283 | 3300031238 | Bacteria | 1208 |
| 578 | Ga0265328_10021814 | 3300031239 | Bacteria | 2441 |
| 579 | Ga0265320_10000218 | 3300031240 | Bacteria | 46495 |
| 580 | Ga0265325_10011290 | 3300031241 | Bacteria | 5132 |
| 581 | Ga0265329_10000485 | 3300031242 | Bacteria | 20653 |
| 582 | Ga0265329_10126595 | 3300031242 | Unclassified | 821 |
| 583 | Ga0265340_10001203 | 3300031247 | Bacteria | 14795 |
| 584 | Ga0265339_10007117 | 3300031249 | Bacteria | 7265 |
| 585 | Ga0265331_10001063 | 3300031250 | Bacteria | 21390 |
| 586 | Ga0265316_10006166 | 3300031344 | Bacteria | 11503 |
| 587 | Ga0265316_10188917 | 3300031344 | Unclassified | 1531 |
| 588 | Ga0307408_100009589 | 3300031548 | Bacteria | 6387 |
| 589 | Ga0307408_100426121 | 3300031548 | Unclassified | 1145 |
| 590 | Ga0265313_10004470 | 3300031595 | Bacteria | 10713 |
| 591 | Ga0265314_10013146 | 3300031711 | Bacteria | 6707 |
| 592 | Ga0265314_10015537 | 3300031711 | Bacteria | 6040 |
| 593 | Ga0265342_10000161 | 3300031712 | Bacteria | 75750 |
| 594 | Ga0316576_10030162 | 3300031727 | Bacteria | 3838 |
| 595 | Ga0307405_10008433 | 3300031731 | Bacteria | 5224 |
| 596 | Ga0307405_10372126 | 3300031731 | Archaea | 1109 |
| 597 | Ga0307413_10004713 | 3300031824 | Bacteria | 5985 |
| 598 | Ga0307410_10001714 | 3300031852 | Bacteria | 10114 |
| 599 | Ga0307410_10009911 | 3300031852 | Bacteria | 5372 |
| 600 | Ga0307410_10022097 | 3300031852 | Bacteria | 3926 |
| 601 | Ga0307410_10689604 | 3300031852 | Bacteria | 860 |
| 602 | Ga0307406_10011701 | 3300031901 | Bacteria | 4982 |
| 603 | Ga0307406_10099027 | 3300031901 | Bacteria | 1981 |
| 604 | Ga0307407_10002469 | 3300031903 | Bacteria | 7250 |
| 605 | Ga0307407_10003660 | 3300031903 | Bacteria | 6360 |
| 606 | Ga0307407_10015910 | 3300031903 | Bacteria | 3732 |
| 607 | Ga0307412_10440661 | 3300031911 | Bacteria | 1071 |
| 608 | Ga0307409_100000929 | 3300031995 | Bacteria | 13622 |
| 609 | Ga0307409_100005561 | 3300031995 | Bacteria | 7278 |
| 610 | Ga0307409_100015738 | 3300031995 | Bacteria | 4976 |
| 611 | Ga0307416_100009215 | 3300032002 | Bacteria | 6443 |
| 612 | Ga0307416_100014606 | 3300032002 | Bacteria | 5390 |
| 613 | Ga0307416_100217598 | 3300032002 | Bacteria | 1829 |
| 614 | Ga0307416_100355916 | 3300032002 | Bacteria | 1484 |
| 615 | Ga0307416_101709002 | 3300032002 | Unclassified | 734 |
| 616 | Ga0307414_10012130 | 3300032004 | Bacteria | 5083 |
| 617 | Ga0307414_10110349 | 3300032004 | Bacteria | 2092 |
| 618 | Ga0307411_10043854 | 3300032005 | Bacteria | 2864 |
| 619 | Ga0307411_10129070 | 3300032005 | Bacteria | 1844 |
| 620 | Ga0307411_10984723 | 3300032005 | Bacteria | 754 |
| 621 | Ga0307415_100002073 | 3300032126 | Bacteria | 9911 |
| 622 | Ga0307415_100017931 | 3300032126 | Bacteria | 4259 |
| 623 | Ga0307415_100233927 | 3300032126 | Bacteria | 1482 |
| 624 | Ga0373958_0002462 | 3300034819 | Bacteria | 2598 |
| 625 | Ga0373944_0000743 | 3300035089 | Bacteria | 7923 |
| 626 | Ga0373936_0092848 | 3300035113 | Bacteria | 1267 |
| 627 | Ga0373939_0040620 | 3300035114 | Bacteria | 1398 |
| 628 | Ga0373939_0159073 | 3300035114 | Bacteria | 828 |
| 629 | Ga0373943_0000966 | 3300035170 | Bacteria | 12768 |
| 630 | Ga0373946_0001677 | 3300035171 | Bacteria | 7717 |
| 631 | Ga0373961_0019263 | 3300035241 | Bacteria | 1791 |
| 632 | Ga0316574_0553214 | 3300035398 | Bacteria | 714 |
| 633 | Ga0373931_0237084 | 3300035691 | Unclassified | 1104 |
| 634 | Ga0373931_0239484 | 3300035691 | Bacteria | 1099 |
| 635 | Ga0373935_0011156 | 3300035692 | Bacteria | 5395 |
| 636 | Ga0373927_0010448 | 3300035695 | Bacteria | 6189 |
| 637 | Ga0373927_0059848 | 3300035695 | Bacteria | 2464 |
| 638 | Ga0373927_0092120 | 3300035695 | Bacteria | 1969 |
| 639 | Ga0373947_0023317 | 3300035725 | Bacteria | 3598 |
| 640 | Ga0373947_0189742 | 3300035725 | Bacteria | 1341 |
| 641 | Ga0373937_0268436 | 3300036401 | Bacteria | 1610 |
| 642 | Ga0373925_0003069 | 3300037068 | Bacteria | 13129 |
| 643 | Ga0395899_0172406 | 3300037312 | Bacteria | 1523 |
| 644 | Ga0395900_0003828 | 3300037418 | Bacteria | 16091 |
| 645 | Ga0395900_0582459 | 3300037418 | Unclassified | 1061 |
| 646 | Ga0395898_0087829 | 3300037466 | Bacteria | 2995 |
| 647 | Ga0395898_0982073 | 3300037466 | Bacteria | 781 |
| 648 | Ga0395901_0001187 | 3300038443 | Bacteria | 27723 |
| 649 | Ga0436365_0127917 | 3300039437 | Bacteria | 8397 |
| 650 | Ga0436365_0234493 | 3300039437 | Bacteria | 2074 |
| 651 | Ga0436360_0669019 | 3300039438 | Bacteria | 1033 |
| 652 | Ga0436360_1377598 | 3300039438 | Viruses | 2788 |
| 653 | Ga0436361_0905442 | 3300039447 | Bacteria | 13471 |
| 654 | Ga0436363_1400321 | 3300039450 | Bacteria | 644 |
| 655 | Ga0451802_0958627 | 3300041460 | Bacteria | 687 |
| 656 | Ga0439458_0023570 | 3300042157 | Bacteria | 1436 |
| 657 | Ga0453683_0457529 | 3300044673 | Unclassified | 826 |
| 658 | Ga0466963_0008636 | 3300044694 | Bacteria | 6115 |
| 659 | Ga0451576_0059128 | 3300045051 | Bacteria | 4002 |
| 660 | Ga0451576_0194241 | 3300045051 | Unclassified | 2120 |
| 661 | Ga0451576_0326113 | 3300045051 | Bacteria | 1607 |
| 662 | Ga0466967_0180843 | 3300045976 | Bacteria | 1989 |
| 663 | Ga0495592_0093137 | 3300046454 | Bacteria | 2158 |
| 664 | Ga0495603_0060187 | 3300046455 | Bacteria | 2244 |
| 665 | Ga0495629_0000349 | 3300046459 | Bacteria | 39311 |
| 666 | Ga0495641_0000494 | 3300046461 | Bacteria | 33001 |
| 667 | Ga0495653_0003625 | 3300046463 | Bacteria | 12451 |
| 668 | Ga0495653_0024077 | 3300046463 | Bacteria | 4912 |
| 669 | Ga0495580_0253343 | 3300046472 | Bacteria | 1205 |
| 670 | Ga0495582_0000253 | 3300046473 | Bacteria | 29763 |
| 671 | Ga0495639_0006126 | 3300046475 | Bacteria | 5169 |
| 672 | Ga0495662_0000205 | 3300046476 | Bacteria | 24502 |
| 673 | Ga0495662_0043692 | 3300046476 | Bacteria | 2163 |
| 674 | Ga0495664_0022915 | 3300046477 | Bacteria | 3622 |
| 675 | Ga0495618_0034297 | 3300046514 | Bacteria | 3182 |
| 676 | Ga0495628_0017929 | 3300046516 | Bacteria | 5876 |
| 677 | Ga0495628_0481563 | 3300046516 | Unclassified | 898 |
| 678 | Ga0495630_0257104 | 3300046517 | Bacteria | 1334 |
| 679 | Ga0495630_0308423 | 3300046517 | Bacteria | 1209 |
| 680 | Ga0495648_0177987 | 3300046524 | Bacteria | 1084 |
| 681 | Ga0495666_0016357 | 3300046526 | Bacteria | 3695 |
| 682 | Ga0495642_0254516 | 3300046528 | Bacteria | 768 |
| 683 | Ga0495665_0000739 | 3300046531 | Bacteria | 16923 |
| 684 | Ga0495640_0018948 | 3300046533 | Bacteria | 5090 |
| 685 | Ga0495640_0027138 | 3300046533 | Bacteria | 4133 |
| 686 | Ga0495586_0220147 | 3300046535 | Bacteria | 1079 |
| 687 | Ga0495621_0007307 | 3300046539 | Bacteria | 3267 |
| 688 | Ga0495645_0066369 | 3300046543 | Bacteria | 2608 |
| 689 | Ga0495667_0065619 | 3300046559 | Bacteria | 2374 |
| 690 | Ga0495634_0018604 | 3300046642 | Bacteria | 4942 |
| 691 | Ga0495635_0010686 | 3300046663 | Bacteria | 6427 |
| 692 | Ga0495635_0012684 | 3300046663 | Bacteria | 5911 |
| 693 | Ga0495599_0021649 | 3300046678 | Bacteria | 4011 |
| 694 | Ga0495623_0090655 | 3300046679 | Bacteria | 1877 |
| 695 | Ga0495646_0052672 | 3300046680 | Bacteria | 2457 |
| 696 | Ga0495647_0005575 | 3300046681 | Bacteria | 4132 |
| 697 | Ga0495658_0001095 | 3300046683 | Bacteria | 14299 |
| 698 | Ga0495658_0178012 | 3300046683 | Bacteria | 1319 |
| 699 | Ga0495669_0160901 | 3300046684 | Bacteria | 1065 |
| 700 | Ga0495613_0001699 | 3300046689 | Bacteria | 16771 |
| 701 | Ga0495624_0007533 | 3300046690 | Bacteria | 7638 |
| 702 | Ga0495600_0012981 | 3300046809 | Bacteria | 5223 |
| 703 | Ga0495581_0005659 | 3300047315 | Bacteria | 7246 |
| 704 | Ga0495604_0132326 | 3300047317 | Bacteria | 1791 |
| 705 | Ga0495674_0014632 | 3300047319 | Bacteria | 7343 |
| 706 | Ga0495674_0018393 | 3300047319 | Bacteria | 6505 |
| 707 | Ga0495672_0000252 | 3300047320 | Bacteria | 75012 |
| 708 | Ga0495672_0043084 | 3300047320 | Bacteria | 2716 |
| 709 | Ga0495676_0000940 | 3300047321 | Bacteria | 24451 |
| 710 | Ga0495680_0000259 | 3300047322 | Bacteria | 58560 |
| 711 | Ga0495680_0022942 | 3300047322 | Bacteria | 5195 |
| 712 | Ga0495684_0011822 | 3300047471 | Bacteria | 6734 |
| 713 | Ga0495684_0056659 | 3300047471 | Bacteria | 2987 |
| 714 | Ga0495593_0002481 | 3300047673 | Bacteria | 11097 |
| 715 | Ga0495614_0001088 | 3300048089 | Bacteria | 11627 |
| 716 | Ga0496100_0004514 | 3300048903 | Bacteria | 7390 |
| 717 | Ga0496100_0110783 | 3300048903 | Bacteria | 1906 |
| 718 | Ga0496100_0354437 | 3300048903 | Bacteria | 1109 |
| 719 | Ga0496101_0044033 | 3300048904 | Bacteria | 3193 |
| 720 | Ga0496101_0070616 | 3300048904 | Bacteria | 2558 |
| 721 | Ga0496101_0179135 | 3300048904 | Bacteria | 1631 |
| 722 | Ga0496101_0520546 | 3300048904 | Unclassified | 940 |
| 723 | Ga0496101_0529270 | 3300048904 | Bacteria | 932 |
| 724 | Ga0496102_0001079 | 3300048905 | Bacteria | 25231 |
| 725 | Ga0496102_0005628 | 3300048905 | Bacteria | 10635 |
| 726 | Ga0496102_0099696 | 3300048905 | Bacteria | 2697 |
| 727 | Ga0496102_0474165 | 3300048905 | Bacteria | 1173 |
| 728 | Ga0496102_0515282 | 3300048905 | Bacteria | 1118 |
| 729 | Ga0496102_0893884 | 3300048905 | Bacteria | 810 |
| 730 | Ga0496103_0005182 | 3300048906 | Bacteria | 7843 |
| 731 | Ga0496103_0450283 | 3300048906 | Bacteria | 826 |
| 732 | Ga0496104_0009713 | 3300048907 | Bacteria | 8576 |
| 733 | Ga0496104_0037487 | 3300048907 | Bacteria | 4534 |
| 734 | Ga0496104_0076592 | 3300048907 | Bacteria | 3186 |
| 735 | Ga0496104_0098271 | 3300048907 | Bacteria | 2802 |
| 736 | Ga0496104_0147025 | 3300048907 | Bacteria | 2263 |
| 737 | Ga0496104_0228192 | 3300048907 | Bacteria | 1774 |
| 738 | Ga0496105_0012687 | 3300048908 | Bacteria | 6674 |
| 739 | Ga0496105_0019247 | 3300048908 | Bacteria | 5506 |
| 740 | Ga0496105_0031405 | 3300048908 | Bacteria | 4354 |
| 741 | Ga0496105_0036081 | 3300048908 | Bacteria | 4071 |
| 742 | Ga0496105_0132171 | 3300048908 | Bacteria | 2057 |
| 743 | Ga0496106_0001865 | 3300048909 | Bacteria | 15770 |
| 744 | Ga0496106_0009863 | 3300048909 | Bacteria | 7050 |
| 745 | Ga0496106_0035374 | 3300048909 | Bacteria | 3735 |
| 746 | Ga0496106_0137969 | 3300048909 | Bacteria | 1917 |
| 747 | Ga0496106_0230381 | 3300048909 | Bacteria | 1479 |
| 748 | Ga0496106_0748422 | 3300048909 | Unclassified | 777 |
| 749 | Ga0496107_0003491 | 3300048910 | Bacteria | 10515 |
| 750 | Ga0496107_0004909 | 3300048910 | Bacteria | 9092 |
| 751 | Ga0496108_0001245 | 3300048911 | Bacteria | 19959 |
| 752 | Ga0496108_0014845 | 3300048911 | Bacteria | 6354 |
| 753 | Ga0496108_0064999 | 3300048911 | Bacteria | 3074 |
| 754 | Ga0496108_0188551 | 3300048911 | Bacteria | 1787 |
| 755 | Ga0496109_0000776 | 3300048912 | Bacteria | 26522 |
| 756 | Ga0496109_0025178 | 3300048912 | Bacteria | 5300 |
| 757 | Ga0496109_0062596 | 3300048912 | Bacteria | 3403 |
| 758 | Ga0496109_0164855 | 3300048912 | Bacteria | 2077 |
| 759 | Ga0496109_0185305 | 3300048912 | Bacteria | 1956 |
| 760 | Ga0496110_0009842 | 3300048913 | Bacteria | 7746 |
| 761 | Ga0496110_0047300 | 3300048913 | Bacteria | 3766 |
| 762 | Ga0496110_0147871 | 3300048913 | Bacteria | 2126 |
| 763 | Ga0496110_0330428 | 3300048913 | Bacteria | 1389 |
| 764 | Ga0496111_0005089 | 3300048914 | Bacteria | 8365 |
| 765 | Ga0496111_0158184 | 3300048914 | Bacteria | 1681 |
| 766 | Ga0496112_0001988 | 3300048915 | Bacteria | 16174 |
| 767 | Ga0496112_0055010 | 3300048915 | Unclassified | 3911 |
| 768 | Ga0496112_0135857 | 3300048915 | Bacteria | 2429 |
| 769 | Ga0496112_0575533 | 3300048915 | Unclassified | 1059 |
| 770 | Ga0496113_0004169 | 3300048916 | Bacteria | 8829 |
| 771 | Ga0496113_0316436 | 3300048916 | Bacteria | 1251 |
| 772 | Ga0496113_0509490 | 3300048916 | Bacteria | 966 |
| 773 | Ga0496114_0001324 | 3300048917 | Bacteria | 18766 |
| 774 | Ga0496114_0054464 | 3300048917 | Bacteria | 3335 |
| 775 | Ga0496114_0056712 | 3300048917 | Bacteria | 3269 |
| 776 | Ga0496114_0342937 | 3300048917 | Bacteria | 1321 |
| 777 | Ga0496114_0390085 | 3300048917 | Bacteria | 1233 |
| 778 | Ga0496114_0570909 | 3300048917 | Bacteria | 999 |
| 779 | Ga0496115_0017003 | 3300048918 | Bacteria | 5548 |
| 780 | Ga0496115_0022385 | 3300048918 | Bacteria | 4896 |
| 781 | Ga0496115_0027930 | 3300048918 | Bacteria | 4417 |
| 782 | Ga0496115_0044451 | 3300048918 | Bacteria | 3542 |
| 783 | Ga0496115_0122277 | 3300048918 | Bacteria | 2142 |
| 784 | Ga0496115_0415150 | 3300048918 | Unclassified | 1091 |
| 785 | Ga0496115_0430586 | 3300048918 | Bacteria | 1068 |
| 786 | Ga0496115_0772558 | 3300048918 | Bacteria | 750 |
| 787 | Ga0496121_0136933 | 3300048924 | Bacteria | 1823 |
| 788 | Ga0496126_0023838 | 3300048929 | Bacteria | 5924 |
| 789 | Ga0496126_0032926 | 3300048929 | Bacteria | 4878 |
| 790 | Ga0501323_054010 | 3300049539 | Bacteria | 615 |
| 791 | Ga0501031_0018701 | 3300049568 | Bacteria | 4511 |
| 792 | Ga0501032_0003322 | 3300049569 | Bacteria | 12372 |
| 793 | Ga0501032_0004094 | 3300049569 | Bacteria | 11049 |
| 794 | Ga0501033_0003616 | 3300049570 | Bacteria | 12609 |
| 795 | Ga0501034_0000013 | 3300049571 | Bacteria | 297898 |
| 796 | Ga0501034_0005157 | 3300049571 | Bacteria | 14326 |
| 797 | Ga0501036_0000908 | 3300049572 | Bacteria | 22186 |
| 798 | Ga0501036_0055583 | 3300049572 | Unclassified | 3354 |
| 799 | Ga0501037_0014276 | 3300049573 | Bacteria | 5853 |
| 800 | Ga0501038_0004868 | 3300049574 | Bacteria | 12472 |
| 801 | Ga0501038_0051627 | 3300049574 | Bacteria | 3548 |
| 802 | Ga0501038_0263893 | 3300049574 | Bacteria | 1360 |
| 803 | Ga0501039_0000710 | 3300049575 | Bacteria | 23980 |
| 804 | Ga0501039_0004417 | 3300049575 | Bacteria | 10614 |
| 805 | Ga0501039_0070384 | 3300049575 | Bacteria | 2718 |
| 806 | Ga0501040_0034120 | 3300049576 | Bacteria | 3448 |
| 807 | Ga0501040_0119523 | 3300049576 | Bacteria | 1848 |
| 808 | Ga0501040_0424185 | 3300049576 | Unclassified | 956 |
| 809 | Ga0501041_0013390 | 3300049577 | Bacteria | 4862 |
| 810 | Ga0501041_0443249 | 3300049577 | Unclassified | 824 |
| 811 | Ga0501041_0495899 | 3300049577 | Bacteria | 777 |
| 812 | Ga0501042_0032369 | 3300049578 | Unclassified | 3703 |
| 813 | Ga0501042_0037432 | 3300049578 | Bacteria | 3443 |
| 814 | Ga0501043_0038619 | 3300049579 | Unclassified | 3753 |
| 815 | Ga0501046_0004067 | 3300049580 | Bacteria | 13341 |
| 816 | Ga0501046_0020906 | 3300049580 | Bacteria | 5404 |
| 817 | Ga0501047_0000721 | 3300049581 | Bacteria | 34396 |
| 818 | Ga0501047_0013191 | 3300049581 | Bacteria | 7826 |
| 819 | Ga0501048_0011129 | 3300049582 | Bacteria | 6708 |
| 820 | Ga0501067_0003660 | 3300049583 | Bacteria | 8467 |
| 821 | Ga0501067_0013214 | 3300049583 | Bacteria | 4571 |
| 822 | Ga0501067_0267409 | 3300049583 | Unclassified | 952 |
| 823 | Ga0501068_0000491 | 3300049584 | Bacteria | 20048 |
| 824 | Ga0501068_0301100 | 3300049584 | Bacteria | 1026 |
| 825 | Ga0501069_0001666 | 3300049585 | Bacteria | 11051 |
| 826 | Ga0501070_0016220 | 3300049586 | Bacteria | 6260 |
| 827 | Ga0501070_0016282 | 3300049586 | Bacteria | 6247 |
| 828 | Ga0501070_0886258 | 3300049586 | Bacteria | 697 |
| 829 | Ga0501071_0047690 | 3300049587 | Unclassified | 3078 |
| 830 | Ga0501071_0084982 | 3300049587 | Bacteria | 2320 |
| 831 | Ga0501071_0165551 | 3300049587 | Unclassified | 1654 |
| 832 | Ga0501071_0195931 | 3300049587 | Bacteria | 1516 |
| 833 | Ga0501072_0001477 | 3300049588 | Bacteria | 17625 |
| 834 | Ga0501072_0017019 | 3300049588 | Bacteria | 5585 |
| 835 | Ga0501072_0433861 | 3300049588 | Unclassified | 1041 |
| 836 | Ga0501074_0043128 | 3300049590 | Bacteria | 3265 |
| 837 | Ga0501075_0003578 | 3300049591 | Bacteria | 10409 |
| 838 | Ga0501075_0309780 | 3300049591 | Bacteria | 1203 |
| 839 | Ga0501076_0014627 | 3300049592 | Bacteria | 5916 |
| 840 | Ga0501076_0185538 | 3300049592 | Bacteria | 1696 |
| 841 | Ga0501076_0679225 | 3300049592 | Bacteria | 850 |
| 842 | Ga0501076_0682761 | 3300049592 | Bacteria | 848 |
| 843 | Ga0501077_0028261 | 3300049593 | Unclassified | 3564 |
| 844 | Ga0501077_0032240 | 3300049593 | Bacteria | 3336 |
| 845 | Ga0501077_0175178 | 3300049593 | Unclassified | 1363 |
| 846 | Ga0501079_0000655 | 3300049741 | Bacteria | 23110 |
| 847 | Ga0501079_0014573 | 3300049741 | Bacteria | 5996 |
| 848 | Ga0501079_0072552 | 3300049741 | Bacteria | 2661 |
| 849 | Ga0501079_0457157 | 3300049741 | Bacteria | 1003 |
| 850 | Ga0501079_0571708 | 3300049741 | Bacteria | 889 |
| 851 | Ga0501079_0744536 | 3300049741 | Unclassified | 771 |
| 852 | Ga0501080_0000003 | 3300049742 | Bacteria | 214890 |
| 853 | Ga0501080_0000166 | 3300049742 | Bacteria | 47741 |
| 854 | Ga0501081_0043455 | 3300049743 | Bacteria | 3083 |
| 855 | Ga0501081_0167354 | 3300049743 | Bacteria | 1586 |
| 856 | Ga0501081_0574141 | 3300049743 | Unclassified | 843 |
| 857 | Ga0501083_0019539 | 3300049744 | Bacteria | 4718 |
| 858 | Ga0501263_000121 | 3300049760 | Bacteria | 4281 |
| 859 | Ga0501035_0000058 | 3300049822 | Bacteria | 135089 |
| 860 | Ga0501035_0006144 | 3300049822 | Bacteria | 11304 |
| 861 | Ga0501035_0232151 | 3300049822 | Bacteria | 1572 |
| 862 | Ga0501044_0000023 | 3300049823 | Bacteria | 196555 |
| 863 | Ga0501044_0113356 | 3300049823 | Bacteria | 2718 |
| 864 | Ga0501044_0128828 | 3300049823 | Bacteria | 2526 |
| 865 | Ga0501044_0939894 | 3300049823 | Bacteria | 738 |
| 866 | Ga0501045_0008050 | 3300049824 | Bacteria | 7344 |
| 867 | Ga0501045_0104355 | 3300049824 | Bacteria | 2100 |
| 868 | nmdc:mga06z11_13679_c1 | 3300050494 | Bacteria | 3571 |
| 869 | nmdc:mga07m45_386843_c1 | 3300050496 | Bacteria | 812 |
| 870 | nmdc:mga05p37_1237837_c1 | 3300050507 | Unclassified | 767 |
| 871 | nmdc:mga05p37_251440_c1 | 3300050507 | Bacteria | 2120 |
| 872 | nmdc:mga05p37_327807_c1 | 3300050507 | Bacteria | 1810 |
| 873 | nmdc:mga05p37_524055_c1 | 3300050507 | Bacteria | 1355 |
| 874 | nmdc:mga05p37_559844_c1 | 3300050507 | Bacteria | 1299 |
| 875 | nmdc:mga05p37_57346_c1 | 3300050507 | Bacteria | 4797 |
| 876 | nmdc:mga05p37_60228_c1 | 3300050507 | Bacteria | 4675 |
| 877 | nmdc:mga05p37_736011_c1 | 3300050507 | Bacteria | 1089 |
| 878 | nmdc:mga05p37_838007_c1 | 3300050507 | Bacteria | 1000 |
| 879 | nmdc:mga09592_43070_c1 | 3300050508 | Bacteria | 3798 |
| 880 | nmdc:mga0qj67_203511_c1 | 3300050509 | Bacteria | 1608 |
| 881 | nmdc:mga0qj67_59044_c1 | 3300050509 | Bacteria | 3041 |
| 882 | nmdc:mga06r32_72884_c1 | 3300050510 | Unclassified | 3325 |
| 883 | nmdc:mga08y16_111546_c1 | 3300050511 | Unclassified | 2847 |
| 884 | nmdc:mga08y16_44885_c1 | 3300050511 | Bacteria | 4632 |
| 885 | nmdc:mga08y16_713090_c1 | 3300050511 | Unclassified | 1002 |
| 886 | nmdc:mga0n895_177138_c1 | 3300050512 | Bacteria | 2163 |
| 887 | nmdc:mga0n895_191681_c1 | 3300050512 | Bacteria | 2075 |
| 888 | nmdc:mga0n895_3395_c1 | 3300050512 | Bacteria | 12823 |
| 889 | nmdc:mga0n895_340808_c1 | 3300050512 | Unclassified | 1518 |
| 890 | nmdc:mga0n895_459499_c1 | 3300050512 | Bacteria | 1285 |
| 891 | nmdc:mga0n895_521772_c1 | 3300050512 | Bacteria | 1195 |
| 892 | nmdc:mga0rr50_180301_c1 | 3300050513 | Bacteria | 1726 |
| 893 | nmdc:mga0rr50_296304_c1 | 3300050513 | Bacteria | 1352 |
| 894 | nmdc:mga0rr50_447440_c1 | 3300050513 | Unclassified | 1095 |
| 895 | nmdc:mga08x19_164526_c1 | 3300050514 | Bacteria | 1508 |
| 896 | nmdc:mga08x19_396707_c1 | 3300050514 | Bacteria | 967 |
| 897 | nmdc:mga08x19_46448_c1 | 3300050514 | Bacteria | 2777 |
| 898 | nmdc:mga08x19_52943_c2 | 3300050514 | Bacteria | 1519 |
| 899 | nmdc:mga08x19_5499_c1 | 3300050514 | Bacteria | 7495 |
| 900 | nmdc:mga0a205_150179_c1 | 3300050515 | Bacteria | 2230 |
| 901 | nmdc:mga0a205_198145_c1 | 3300050515 | Bacteria | 1899 |
| 902 | nmdc:mga0a205_455553_c1 | 3300050515 | Bacteria | 1139 |
| 903 | nmdc:mga0a205_458124_c1 | 3300050515 | Unclassified | 1135 |
| 904 | nmdc:mga0a205_500426_c1 | 3300050515 | Unclassified | 1072 |
| 905 | nmdc:mga0a205_80807_c1 | 3300050515 | Bacteria | 3140 |
| 906 | nmdc:mga0sz30_5495_c3 | 3300050516 | Bacteria | 3483 |
| 907 | Ga0495612_0015636 | 3300053078 | Bacteria | 3042 |
| 908 | Ga0495595_0093165 | 3300053084 | Bacteria | 1447 |
| 909 | Ga0495619_0227674 | 3300053085 | Bacteria | 1291 |
| 910 | Ga0501084_0000632 | 3300054114 | Bacteria | 26843 |
| 911 | Ga0501084_0061930 | 3300054114 | Bacteria | 3133 |
| 912 | Ga0501084_0115244 | 3300054114 | Unclassified | 2259 |
| 913 | Ga0501084_0321023 | 3300054114 | Bacteria | 1308 |
| 914 | Ga0590071_000099 | 3300059421 | Bacteria | 24341 |
| 915 | Ga0590071_011290 | 3300059421 | Bacteria | 2090 |
| 916 | Ga0590074_004504 | 3300059423 | Bacteria | 2307 |
| 917 | Ga0590074_061519 | 3300059423 | Unclassified | 698 |
| 918 | Ga0590075_000144 | 3300059424 | Bacteria | 18953 |
| 919 | Ga0590075_006802 | 3300059424 | Bacteria | 2707 |
| 920 | Ga0590075_010192 | 3300059424 | Bacteria | 2260 |
| 921 | Ga0590077_002229 | 3300059426 | Bacteria | 4196 |
| 922 | Ga0590077_012208 | 3300059426 | Bacteria | 1778 |
| 923 | Ga0587084_038722 | 3300059477 | Bacteria | 801 |
| 924 | Ga0587070_051433 | 3300059491 | Bacteria | 824 |
| 925 | Ga0587085_008886 | 3300059506 | Bacteria | 1294 |
| 926 | Ga0587062_006187 | 3300059639 | Bacteria | 1351 |
| 927 | Ga0501082_0007237 | 3300060353 | Bacteria | 9569 |
| 928 | Ga0501082_0014537 | 3300060353 | Bacteria | 6778 |
| 929 | Ga0501082_0060235 | 3300060353 | Unclassified | 3269 |
| 930 | Ga0501082_0175116 | 3300060353 | Bacteria | 1865 |
| 931 | Ga0501082_0224618 | 3300060353 | Bacteria | 1634 |
| 932 | Ga0501082_0254781 | 3300060353 | Unclassified | 1527 |
| 933 | Ga0501082_0824905 | 3300060353 | Bacteria | 811 |
| 934 | Ga0530510_0005438 | 3300061734 | Bacteria | 8815 |
| 935 | Ga0530510_0042094 | 3300061734 | Unclassified | 3299 |
| 936 | Ga0530510_0089305 | 3300061734 | Bacteria | 2247 |
| 937 | Ga0530510_0517380 | 3300061734 | Unclassified | 905 |
| 938 | Ga0530510_0669581 | 3300061734 | Unclassified | 790 |
| 939 | Ga0530510_0852040 | 3300061734 | Bacteria | 696 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300032002 | Ga0307416_100217598 | Ga0307416_1002175982 | 185 |
| 2 | 3300003911 | JGI25405J52794_10002762 | JGI25405J52794_100027622 | 187 |
| 3 | 3300005328 | Ga0070676_10433350 | Ga0070676_104333501 | 187 |
| 4 | 3300005330 | Ga0070690_100629644 | Ga0070690_1006296442 | 187 |
| 5 | 3300005334 | Ga0068869_100026920 | Ga0068869_1000269202 | 187 |
| 6 | 3300005340 | Ga0070689_100576246 | Ga0070689_1005762461 | 187 |
| 7 | 3300005347 | Ga0070668_100111890 | Ga0070668_1001118902 | 187 |
| 8 | 3300005354 | Ga0070675_100597454 | Ga0070675_1005974541 | 187 |
| 9 | 3300005355 | Ga0070671_100773076 | Ga0070671_1007730762 | 187 |
| 10 | 3300005356 | Ga0070674_100780955 | Ga0070674_1007809551 | 187 |
| 11 | 3300005365 | Ga0070688_100195391 | Ga0070688_1001953912 | 187 |
| 12 | 3300005438 | Ga0070701_10215967 | Ga0070701_102159672 | 187 |
| 13 | 3300005456 | Ga0070678_100845862 | Ga0070678_1008458621 | 187 |
| 14 | 3300005458 | Ga0070681_10067018 | Ga0070681_100670183 | 187 |
| 15 | 3300005459 | Ga0068867_100062179 | Ga0068867_1000621791 | 187 |
| 16 | 3300005471 | Ga0070698_100186839 | Ga0070698_1001868392 | 187 |
| 17 | 3300005518 | Ga0070699_100603124 | Ga0070699_1006031242 | 187 |
| 18 | 3300005518 | Ga0070699_101322889 | Ga0070699_1013228891 | 187 |
| 19 | 3300005530 | Ga0070679_100440351 | Ga0070679_1004403512 | 187 |
| 20 | 3300005536 | Ga0070697_100618893 | Ga0070697_1006188931 | 187 |
| 21 | 3300005543 | Ga0070672_100195024 | Ga0070672_1001950242 | 187 |
| 22 | 3300005545 | Ga0070695_100271699 | Ga0070695_1002716992 | 187 |
| 23 | 3300005546 | Ga0070696_100169371 | Ga0070696_1001693712 | 187 |
| 24 | 3300005548 | Ga0070665_100494675 | Ga0070665_1004946752 | 187 |
| 25 | 3300005549 | Ga0070704_100006752 | Ga0070704_1000067522 | 187 |
| 26 | 3300005549 | Ga0070704_100607691 | Ga0070704_1006076911 | 187 |
| 27 | 3300005577 | Ga0068857_100243728 | Ga0068857_1002437282 | 187 |
| 28 | 3300005577 | Ga0068857_100291240 | Ga0068857_1002912402 | 187 |
| 29 | 3300005617 | Ga0068859_100002751 | Ga0068859_1000027519 | 187 |
| 30 | 3300005617 | Ga0068859_100404630 | Ga0068859_1004046302 | 187 |
| 31 | 3300005842 | Ga0068858_100158156 | Ga0068858_1001581563 | 187 |
| 32 | 3300005843 | Ga0068860_100105252 | Ga0068860_1001052523 | 187 |
| 33 | 3300005843 | Ga0068860_100588532 | Ga0068860_1005885322 | 187 |
| 34 | 3300005937 | Ga0081455_10008686 | Ga0081455_1000868610 | 187 |
| 35 | 3300005937 | Ga0081455_10010105 | Ga0081455_100101057 | 187 |
| 36 | 3300005937 | Ga0081455_10184583 | Ga0081455_101845831 | 187 |
| 37 | 3300005937 | Ga0081455_10397911 | Ga0081455_103979112 | 187 |
| 38 | 3300006175 | Ga0070712_100031647 | Ga0070712_1000316472 | 187 |
| 39 | 3300006175 | Ga0070712_100810028 | Ga0070712_1008100282 | 187 |
| 40 | 3300006237 | Ga0097621_100137202 | Ga0097621_1001372023 | 187 |
| 41 | 3300006358 | Ga0068871_100063640 | Ga0068871_1000636403 | 187 |
| 42 | 3300006844 | Ga0075428_100014795 | Ga0075428_1000147953 | 187 |
| 43 | 3300006844 | Ga0075428_101353837 | Ga0075428_1013538371 | 187 |
| 44 | 3300006846 | Ga0075430_100161440 | Ga0075430_1001614402 | 187 |
| 45 | 3300006846 | Ga0075430_100211930 | Ga0075430_1002119302 | 187 |
| 46 | 3300006847 | Ga0075431_100187585 | Ga0075431_1001875852 | 187 |
| 47 | 3300006880 | Ga0075429_100240735 | Ga0075429_1002407351 | 187 |
| 48 | 3300006914 | Ga0075436_100187998 | Ga0075436_1001879982 | 187 |
| 49 | 3300006931 | Ga0097620_100002751 | Ga0097620_1000027519 | 187 |
| 50 | 3300006931 | Ga0097620_100404625 | Ga0097620_1004046252 | 187 |
| 51 | 3300009094 | Ga0111539_10094234 | Ga0111539_100942342 | 187 |
| 52 | 3300009094 | Ga0111539_10235858 | Ga0111539_102358582 | 187 |
| 53 | 3300009094 | Ga0111539_11151418 | Ga0111539_111514182 | 187 |
| 54 | 3300009147 | Ga0114129_10055169 | Ga0114129_100551695 | 187 |
| 55 | 3300009147 | Ga0114129_10285123 | Ga0114129_102851232 | 187 |
| 56 | 3300009147 | Ga0114129_11509410 | Ga0114129_115094102 | 187 |
| 57 | 3300009147 | Ga0114129_11621281 | Ga0114129_116212811 | 187 |
| 58 | 3300009148 | Ga0105243_10978035 | Ga0105243_109780352 | 187 |
| 59 | 3300009176 | Ga0105242_10378762 | Ga0105242_103787622 | 187 |
| 60 | 3300009177 | Ga0105248_10680438 | Ga0105248_106804382 | 187 |
| 61 | 3300010375 | Ga0105239_10193538 | Ga0105239_101935382 | 187 |
| 62 | 3300011119 | Ga0105246_10564285 | Ga0105246_105642852 | 187 |
| 63 | 3300013296 | Ga0157374_10041905 | Ga0157374_100419055 | 187 |
| 64 | 3300013296 | Ga0157374_10094657 | Ga0157374_100946572 | 187 |
| 65 | 3300013297 | Ga0157378_10020587 | Ga0157378_100205872 | 187 |
| 66 | 3300013297 | Ga0157378_10168508 | Ga0157378_101685083 | 187 |
| 67 | 3300013297 | Ga0157378_10308421 | Ga0157378_103084212 | 187 |
| 68 | 3300013297 | Ga0157378_10385015 | Ga0157378_103850151 | 187 |
| 69 | 3300013306 | Ga0163162_10053017 | Ga0163162_100530171 | 187 |
| 70 | 3300013308 | Ga0157375_10058333 | Ga0157375_100583332 | 187 |
| 71 | 3300013308 | Ga0157375_10542526 | Ga0157375_105425262 | 187 |
| 72 | 3300013308 | Ga0157375_11620631 | Ga0157375_116206312 | 187 |
| 73 | 3300014326 | Ga0157380_10322618 | Ga0157380_103226182 | 187 |
| 74 | 3300014968 | Ga0157379_10029505 | Ga0157379_100295052 | 187 |
| 75 | 3300014969 | Ga0157376_10040980 | Ga0157376_100409802 | 187 |
| 76 | 3300021361 | Ga0213872_10023263 | Ga0213872_100232632 | 187 |
| 77 | 3300021384 | Ga0213876_10099456 | Ga0213876_100994562 | 187 |
| 78 | 3300021441 | Ga0213871_10022240 | Ga0213871_100222402 | 187 |
| 79 | 3300025315 | Ga0207697_10010945 | Ga0207697_100109454 | 187 |
| 80 | 3300025901 | Ga0207688_10070309 | Ga0207688_100703092 | 187 |
| 81 | 3300025903 | Ga0207680_10259370 | Ga0207680_102593702 | 187 |
| 82 | 3300025912 | Ga0207707_10163949 | Ga0207707_101639492 | 187 |
| 83 | 3300025915 | Ga0207693_10185032 | Ga0207693_101850322 | 187 |
| 84 | 3300025917 | Ga0207660_10493938 | Ga0207660_104939382 | 187 |
| 85 | 3300025926 | Ga0207659_10050229 | Ga0207659_100502292 | 187 |
| 86 | 3300025926 | Ga0207659_10670400 | Ga0207659_106704002 | 187 |
| 87 | 3300025931 | Ga0207644_10402589 | Ga0207644_104025892 | 187 |
| 88 | 3300025940 | Ga0207691_10412429 | Ga0207691_104124292 | 187 |
| 89 | 3300025941 | Ga0207711_10092722 | Ga0207711_100927222 | 187 |
| 90 | 3300025942 | Ga0207689_10004614 | Ga0207689_100046146 | 187 |
| 91 | 3300025960 | Ga0207651_10027427 | Ga0207651_100274273 | 187 |
| 92 | 3300025972 | Ga0207668_10059052 | Ga0207668_100590523 | 187 |
| 93 | 3300026035 | Ga0207703_10411021 | Ga0207703_104110212 | 187 |
| 94 | 3300026067 | Ga0207678_10391407 | Ga0207678_103914072 | 187 |
| 95 | 3300026075 | Ga0207708_10854836 | Ga0207708_108548361 | 187 |
| 96 | 3300026095 | Ga0207676_10351517 | Ga0207676_103515172 | 187 |
| 97 | 3300026116 | Ga0207674_10257606 | Ga0207674_102576062 | 187 |
| 98 | 3300026116 | Ga0207674_10339096 | Ga0207674_103390962 | 187 |
| 99 | 3300026121 | Ga0207683_10222157 | Ga0207683_102221572 | 187 |
| 100 | 3300028379 | Ga0268266_11046144 | Ga0268266_110461441 | 187 |
| 101 | 3300028381 | Ga0268264_10089061 | Ga0268264_100890612 | 187 |
| 102 | 3300028573 | Ga0265334_10177353 | Ga0265334_101773531 | 187 |
| 103 | 3300031242 | Ga0265329_10126595 | Ga0265329_101265951 | 187 |
| 104 | 3300031344 | Ga0265316_10188917 | Ga0265316_101889171 | 187 |
| 105 | 3300031711 | Ga0265314_10013146 | Ga0265314_100131462 | 187 |
| 106 | 3300035089 | Ga0373944_0000743 | Ga0373944_0000743_2360_2923 | 187 |
| 107 | 3300035113 | Ga0373936_0092848 | Ga0373936_0092848_586_1149 | 187 |
| 108 | 3300035170 | Ga0373943_0000966 | Ga0373943_0000966_6182_6745 | 187 |
| 109 | 3300035171 | Ga0373946_0001677 | Ga0373946_0001677_908_1471 | 187 |
| 110 | 3300035692 | Ga0373935_0011156 | Ga0373935_0011156_873_1436 | 187 |
| 111 | 3300035695 | Ga0373927_0092120 | Ga0373927_0092120_1173_1736 | 187 |
| 112 | 3300035725 | Ga0373947_0023317 | Ga0373947_0023317_2424_2987 | 187 |
| 113 | 3300037068 | Ga0373925_0003069 | Ga0373925_0003069_8450_9013 | 187 |
| 114 | 3300039437 | Ga0436365_0234493 | Ga0436365_0234493_1174_1737 | 187 |
| 115 | 3300039438 | Ga0436360_0669019 | Ga0436360_0669019_309_872 | 187 |
| 116 | 3300039438 | Ga0436360_1377598 | Ga0436360_1377598_884_1447 | 187 |
| 117 | 3300039447 | Ga0436361_0905442 | Ga0436361_0905442_11566_12129 | 187 |
| 118 | 3300044673 | Ga0453683_0457529 | Ga0453683_0457529_10_573 | 187 |
| 119 | 3300045051 | Ga0451576_0059128 | Ga0451576_0059128_1791_2354 | 187 |
| 120 | 3300046454 | Ga0495592_0093137 | Ga0495592_0093137_1432_1995 | 187 |
| 121 | 3300046455 | Ga0495603_0060187 | Ga0495603_0060187_94_657 | 187 |
| 122 | 3300046459 | Ga0495629_0000349 | Ga0495629_0000349_5616_6179 | 187 |
| 123 | 3300046461 | Ga0495641_0000494 | Ga0495641_0000494_21098_21661 | 187 |
| 124 | 3300046463 | Ga0495653_0003625 | Ga0495653_0003625_7116_7679 | 187 |
| 125 | 3300046463 | Ga0495653_0024077 | Ga0495653_0024077_1144_1707 | 187 |
| 126 | 3300046473 | Ga0495582_0000253 | Ga0495582_0000253_4525_5088 | 187 |
| 127 | 3300046475 | Ga0495639_0006126 | Ga0495639_0006126_799_1362 | 187 |
| 128 | 3300046476 | Ga0495662_0000205 | Ga0495662_0000205_13797_14360 | 187 |
| 129 | 3300046476 | Ga0495662_0043692 | Ga0495662_0043692_451_1014 | 187 |
| 130 | 3300046477 | Ga0495664_0022915 | Ga0495664_0022915_640_1203 | 187 |
| 131 | 3300046514 | Ga0495618_0034297 | Ga0495618_0034297_278_841 | 187 |
| 132 | 3300046516 | Ga0495628_0017929 | Ga0495628_0017929_2512_3075 | 187 |
| 133 | 3300046516 | Ga0495628_0481563 | Ga0495628_0481563_56_619 | 187 |
| 134 | 3300046517 | Ga0495630_0257104 | Ga0495630_0257104_259_822 | 187 |
| 135 | 3300046517 | Ga0495630_0308423 | Ga0495630_0308423_612_1175 | 187 |
| 136 | 3300046526 | Ga0495666_0016357 | Ga0495666_0016357_1613_2176 | 187 |
| 137 | 3300046531 | Ga0495665_0000739 | Ga0495665_0000739_8681_9244 | 187 |
| 138 | 3300046533 | Ga0495640_0018948 | Ga0495640_0018948_4013_4576 | 187 |
| 139 | 3300046533 | Ga0495640_0027138 | Ga0495640_0027138_1552_2115 | 187 |
| 140 | 3300046535 | Ga0495586_0220147 | Ga0495586_0220147_475_1038 | 187 |
| 141 | 3300046543 | Ga0495645_0066369 | Ga0495645_0066369_2024_2587 | 187 |
| 142 | 3300046559 | Ga0495667_0065619 | Ga0495667_0065619_450_1013 | 187 |
| 143 | 3300046642 | Ga0495634_0018604 | Ga0495634_0018604_1674_2237 | 187 |
| 144 | 3300046663 | Ga0495635_0010686 | Ga0495635_0010686_4602_5165 | 187 |
| 145 | 3300046663 | Ga0495635_0012684 | Ga0495635_0012684_3638_4201 | 187 |
| 146 | 3300046678 | Ga0495599_0021649 | Ga0495599_0021649_1745_2308 | 187 |
| 147 | 3300046679 | Ga0495623_0090655 | Ga0495623_0090655_1206_1769 | 187 |
| 148 | 3300046680 | Ga0495646_0052672 | Ga0495646_0052672_758_1321 | 187 |
| 149 | 3300046681 | Ga0495647_0005575 | Ga0495647_0005575_1775_2338 | 187 |
| 150 | 3300046683 | Ga0495658_0001095 | Ga0495658_0001095_2534_3097 | 187 |
| 151 | 3300046689 | Ga0495613_0001699 | Ga0495613_0001699_12555_13118 | 187 |
| 152 | 3300046690 | Ga0495624_0007533 | Ga0495624_0007533_2550_3113 | 187 |
| 153 | 3300046809 | Ga0495600_0012981 | Ga0495600_0012981_2239_2802 | 187 |
| 154 | 3300047315 | Ga0495581_0005659 | Ga0495581_0005659_253_816 | 187 |
| 155 | 3300047317 | Ga0495604_0132326 | Ga0495604_0132326_308_871 | 187 |
| 156 | 3300047319 | Ga0495674_0014632 | Ga0495674_0014632_2636_3199 | 187 |
| 157 | 3300047319 | Ga0495674_0018393 | Ga0495674_0018393_3513_4076 | 187 |
| 158 | 3300047321 | Ga0495676_0000940 | Ga0495676_0000940_14881_15444 | 187 |
| 159 | 3300047322 | Ga0495680_0000259 | Ga0495680_0000259_33686_34249 | 187 |
| 160 | 3300047322 | Ga0495680_0022942 | Ga0495680_0022942_373_936 | 187 |
| 161 | 3300047471 | Ga0495684_0011822 | Ga0495684_0011822_2396_2959 | 187 |
| 162 | 3300047471 | Ga0495684_0056659 | Ga0495684_0056659_2331_2894 | 187 |
| 163 | 3300047673 | Ga0495593_0002481 | Ga0495593_0002481_4415_4978 | 187 |
| 164 | 3300048089 | Ga0495614_0001088 | Ga0495614_0001088_3881_4444 | 187 |
| 165 | 3300048907 | Ga0496104_0228192 | Ga0496104_0228192_655_1218 | 187 |
| 166 | 3300048908 | Ga0496105_0031405 | Ga0496105_0031405_160_723 | 187 |
| 167 | 3300048915 | Ga0496112_0575533 | Ga0496112_0575533_429_992 | 187 |
| 168 | 3300048917 | Ga0496114_0056712 | Ga0496114_0056712_858_1421 | 187 |
| 169 | 3300048918 | Ga0496115_0122277 | Ga0496115_0122277_488_1051 | 187 |
| 170 | 3300048918 | Ga0496115_0415150 | Ga0496115_0415150_42_605 | 187 |
| 171 | 3300049577 | Ga0501041_0495899 | Ga0501041_0495899_45_608 | 187 |
| 172 | 3300049578 | Ga0501042_0037432 | Ga0501042_0037432_2207_2770 | 187 |
| 173 | 3300049587 | Ga0501071_0047690 | Ga0501071_0047690_2497_3060 | 187 |
| 174 | 3300049593 | Ga0501077_0032240 | Ga0501077_0032240_2113_2676 | 187 |
| 175 | 3300049760 | Ga0501263_000121 | Ga0501263_000121_1596_2159 | 187 |
| 176 | 3300049823 | Ga0501044_0128828 | Ga0501044_0128828_566_1129 | 187 |
| 177 | 3300050507 | nmdc:mga05p37_1237837_c1 | nmdc:mga05p37_1237837_c1_50_646 | 187 |
| 178 | 3300050507 | nmdc:mga05p37_57346_c1 | nmdc:mga05p37_57346_c1_3103_3666 | 187 |
| 179 | 3300050507 | nmdc:mga05p37_60228_c1 | nmdc:mga05p37_60228_c1_1543_2106 | 187 |
| 180 | 3300050508 | nmdc:mga09592_43070_c1 | nmdc:mga09592_43070_c1_1334_1897 | 187 |
| 181 | 3300050509 | nmdc:mga0qj67_203511_c1 | nmdc:mga0qj67_203511_c1_787_1350 | 187 |
| 182 | 3300050509 | nmdc:mga0qj67_59044_c1 | nmdc:mga0qj67_59044_c1_1968_2531 | 187 |
| 183 | 3300050514 | nmdc:mga08x19_52943_c2 | nmdc:mga08x19_52943_c2_769_1332 | 187 |
| 184 | 3300050515 | nmdc:mga0a205_198145_c1 | nmdc:mga0a205_198145_c1_959_1522 | 187 |
| 185 | 3300053078 | Ga0495612_0015636 | Ga0495612_0015636_64_627 | 187 |
| 186 | 3300053084 | Ga0495595_0093165 | Ga0495595_0093165_466_1029 | 187 |
| 187 | 3300053085 | Ga0495619_0227674 | Ga0495619_0227674_245_808 | 187 |
| 188 | 3300054114 | Ga0501084_0061930 | Ga0501084_0061930_2015_2578 | 187 |
| 189 | 3300059421 | Ga0590071_011290 | Ga0590071_011290_752_1315 | 187 |
| 190 | 3300059423 | Ga0590074_061519 | Ga0590074_061519_14_577 | 187 |
| 191 | 3300059424 | Ga0590075_010192 | Ga0590075_010192_1114_1677 | 187 |
| 192 | 3300059426 | Ga0590077_012208 | Ga0590077_012208_298_861 | 187 |
| 193 | 3300060353 | Ga0501082_0224618 | Ga0501082_0224618_19_582 | 187 |
| 194 | 3300061734 | Ga0530510_0852040 | Ga0530510_0852040_98_661 | 187 |
| 195 | 3300003322 | rootL2_10061107 | rootL2_100611072 | 188 |
| 196 | 3300005330 | Ga0070690_100378581 | Ga0070690_1003785811 | 188 |
| 197 | 3300005334 | Ga0068869_100090947 | Ga0068869_1000909472 | 188 |
| 198 | 3300005334 | Ga0068869_100156294 | Ga0068869_1001562942 | 188 |
| 199 | 3300005340 | Ga0070689_100160156 | Ga0070689_1001601561 | 188 |
| 200 | 3300005341 | Ga0070691_10017193 | Ga0070691_100171934 | 188 |
| 201 | 3300005345 | Ga0070692_10020022 | Ga0070692_100200222 | 188 |
| 202 | 3300005365 | Ga0070688_100026962 | Ga0070688_1000269622 | 188 |
| 203 | 3300005406 | Ga0070703_10000441 | Ga0070703_100004415 | 188 |
| 204 | 3300005436 | Ga0070713_100080624 | Ga0070713_1000806241 | 188 |
| 205 | 3300005438 | Ga0070701_10003386 | Ga0070701_100033864 | 188 |
| 206 | 3300005440 | Ga0070705_100000032 | Ga0070705_10000003218 | 188 |
| 207 | 3300005444 | Ga0070694_100001908 | Ga0070694_10000190810 | 188 |
| 208 | 3300005445 | Ga0070708_100092880 | Ga0070708_1000928802 | 188 |
| 209 | 3300005455 | Ga0070663_100590536 | Ga0070663_1005905361 | 188 |
| 210 | 3300005457 | Ga0070662_100049951 | Ga0070662_1000499513 | 188 |
| 211 | 3300005458 | Ga0070681_10007840 | Ga0070681_100078403 | 188 |
| 212 | 3300005467 | Ga0070706_100211063 | Ga0070706_1002110632 | 188 |
| 213 | 3300005518 | Ga0070699_100001445 | Ga0070699_10000144515 | 188 |
| 214 | 3300005545 | Ga0070695_100000937 | Ga0070695_1000009379 | 188 |
| 215 | 3300005546 | Ga0070696_100000826 | Ga0070696_10000082614 | 188 |
| 216 | 3300005549 | Ga0070704_100005197 | Ga0070704_1000051975 | 188 |
| 217 | 3300005549 | Ga0070704_100201188 | Ga0070704_1002011882 | 188 |
| 218 | 3300005564 | Ga0070664_100131911 | Ga0070664_1001319111 | 188 |
| 219 | 3300005617 | Ga0068859_100001900 | Ga0068859_10000190018 | 188 |
| 220 | 3300005618 | Ga0068864_100011945 | Ga0068864_1000119455 | 188 |
| 221 | 3300005719 | Ga0068861_100011697 | Ga0068861_1000116974 | 188 |
| 222 | 3300005840 | Ga0068870_10088005 | Ga0068870_100880052 | 188 |
| 223 | 3300005841 | Ga0068863_100468931 | Ga0068863_1004689311 | 188 |
| 224 | 3300005843 | Ga0068860_100000870 | Ga0068860_10000087011 | 188 |
| 225 | 3300005844 | Ga0068862_100001615 | Ga0068862_10000161518 | 188 |
| 226 | 3300005844 | Ga0068862_100604902 | Ga0068862_1006049022 | 188 |
| 227 | 3300006173 | Ga0070716_101009395 | Ga0070716_1010093951 | 188 |
| 228 | 3300006175 | Ga0070712_100040183 | Ga0070712_1000401832 | 188 |
| 229 | 3300006871 | Ga0075434_100440650 | Ga0075434_1004406502 | 188 |
| 230 | 3300006871 | Ga0075434_100683642 | Ga0075434_1006836422 | 188 |
| 231 | 3300006881 | Ga0068865_100778100 | Ga0068865_1007781002 | 188 |
| 232 | 3300006931 | Ga0097620_100001900 | Ga0097620_1000019004 | 188 |
| 233 | 3300007788 | Ga0099795_10180550 | Ga0099795_101805501 | 188 |
| 234 | 3300009101 | Ga0105247_10234281 | Ga0105247_102342812 | 188 |
| 235 | 3300009148 | Ga0105243_10602355 | Ga0105243_106023552 | 188 |
| 236 | 3300009553 | Ga0105249_10001320 | Ga0105249_1000132012 | 188 |
| 237 | 3300010375 | Ga0105239_10740467 | Ga0105239_107404671 | 188 |
| 238 | 3300011119 | Ga0105246_10013675 | Ga0105246_100136755 | 188 |
| 239 | 3300013306 | Ga0163162_10222402 | Ga0163162_102224022 | 188 |
| 240 | 3300013308 | Ga0157375_10087812 | Ga0157375_100878122 | 188 |
| 241 | 3300014968 | Ga0157379_10211813 | Ga0157379_102118132 | 188 |
| 242 | 3300025885 | Ga0207653_10001223 | Ga0207653_100012235 | 188 |
| 243 | 3300025898 | Ga0207692_10429061 | Ga0207692_104290611 | 188 |
| 244 | 3300025908 | Ga0207643_10152057 | Ga0207643_101520572 | 188 |
| 245 | 3300025910 | Ga0207684_10065115 | Ga0207684_100651154 | 188 |
| 246 | 3300025912 | Ga0207707_10076207 | Ga0207707_100762072 | 188 |
| 247 | 3300025915 | Ga0207693_10012664 | Ga0207693_100126643 | 188 |
| 248 | 3300025917 | Ga0207660_10011616 | Ga0207660_100116162 | 188 |
| 249 | 3300025918 | Ga0207662_10034726 | Ga0207662_100347262 | 188 |
| 250 | 3300025928 | Ga0207700_10160358 | Ga0207700_101603582 | 188 |
| 251 | 3300025933 | Ga0207706_10075427 | Ga0207706_100754272 | 188 |
| 252 | 3300025935 | Ga0207709_10216070 | Ga0207709_102160702 | 188 |
| 253 | 3300025936 | Ga0207670_10533799 | Ga0207670_105337991 | 188 |
| 254 | 3300025942 | Ga0207689_10151595 | Ga0207689_101515951 | 188 |
| 255 | 3300025960 | Ga0207651_10115557 | Ga0207651_101155572 | 188 |
| 256 | 3300025961 | Ga0207712_10061112 | Ga0207712_100611124 | 188 |
| 257 | 3300026041 | Ga0207639_10773549 | Ga0207639_107735491 | 188 |
| 258 | 3300026067 | Ga0207678_10007780 | Ga0207678_100077809 | 188 |
| 259 | 3300026075 | Ga0207708_10001022 | Ga0207708_1000102215 | 188 |
| 260 | 3300026095 | Ga0207676_10008478 | Ga0207676_100084784 | 188 |
| 261 | 3300026116 | Ga0207674_10003569 | Ga0207674_1000356918 | 188 |
| 262 | 3300026118 | Ga0207675_100112491 | Ga0207675_1001124912 | 188 |
| 263 | 3300028380 | Ga0268265_10002040 | Ga0268265_1000204014 | 188 |
| 264 | 3300028381 | Ga0268264_10001009 | Ga0268264_1000100910 | 188 |
| 265 | 3300031727 | Ga0316576_10030162 | Ga0316576_100301624 | 188 |
| 266 | 3300034819 | Ga0373958_0002462 | Ga0373958_0002462_1771_2337 | 188 |
| 267 | 3300035114 | Ga0373939_0040620 | Ga0373939_0040620_169_735 | 188 |
| 268 | 3300035398 | Ga0316574_0553214 | Ga0316574_0553214_98_664 | 188 |
| 269 | 3300035691 | Ga0373931_0239484 | Ga0373931_0239484_373_939 | 188 |
| 270 | 3300035695 | Ga0373927_0010448 | Ga0373927_0010448_2019_2642 | 188 |
| 271 | 3300035725 | Ga0373947_0189742 | Ga0373947_0189742_232_798 | 188 |
| 272 | 3300046528 | Ga0495642_0254516 | Ga0495642_0254516_132_755 | 188 |
| 273 | 3300046683 | Ga0495658_0178012 | Ga0495658_0178012_198_764 | 188 |
| 274 | 3300048905 | Ga0496102_0005628 | Ga0496102_0005628_1769_2335 | 188 |
| 275 | 3300048905 | Ga0496102_0474165 | Ga0496102_0474165_297_920 | 188 |
| 276 | 3300048909 | Ga0496106_0001865 | Ga0496106_0001865_7576_8142 | 188 |
| 277 | 3300048909 | Ga0496106_0137969 | Ga0496106_0137969_134_700 | 188 |
| 278 | 3300048911 | Ga0496108_0064999 | Ga0496108_0064999_710_1333 | 188 |
| 279 | 3300048912 | Ga0496109_0062596 | Ga0496109_0062596_861_1427 | 188 |
| 280 | 3300048913 | Ga0496110_0147871 | Ga0496110_0147871_907_1473 | 188 |
| 281 | 3300048917 | Ga0496114_0570909 | Ga0496114_0570909_113_679 | 188 |
| 282 | 3300048918 | Ga0496115_0022385 | Ga0496115_0022385_651_1217 | 188 |
| 283 | 3300049576 | Ga0501040_0424185 | Ga0501040_0424185_206_772 | 188 |
| 284 | 3300050507 | nmdc:mga05p37_524055_c1 | nmdc:mga05p37_524055_c1_653_1219 | 188 |
| 285 | 3300050512 | nmdc:mga0n895_521772_c1 | nmdc:mga0n895_521772_c1_75_674 | 188 |
| 286 | 3300050513 | nmdc:mga0rr50_447440_c1 | nmdc:mga0rr50_447440_c1_45_668 | 188 |
| 287 | 3300050515 | nmdc:mga0a205_150179_c1 | nmdc:mga0a205_150179_c1_917_1540 | 188 |
| 288 | 3300061734 | Ga0530510_0517380 | Ga0530510_0517380_219_785 | 188 |
| 289 | iso_pu_bacteria | 2847930680 | 2847933755 | 188 |
| 290 | iso_pu_bacteria | 2879083081 | 2879087281 | 188 |
| 291 | iso_pu_bacteria | 2881364244 | 2881368352 | 188 |
| 292 | iso_pu_bacteria | 2885366525 | 2885372704 | 188 |
| 293 | iso_pu_bacteria | 2906643746 | 2906644280 | 188 |
| 294 | iso_pu_bacteria | 8056673599 | 8056674735 | 188 |
| 295 | 3300005434 | Ga0070709_10034389 | Ga0070709_100343893 | 189 |
| 296 | 3300005435 | Ga0070714_100015276 | Ga0070714_1000152763 | 189 |
| 297 | 3300005436 | Ga0070713_100019735 | Ga0070713_1000197355 | 189 |
| 298 | 3300005437 | Ga0070710_10026570 | Ga0070710_100265701 | 189 |
| 299 | 3300005614 | Ga0068856_100003167 | Ga0068856_1000031674 | 189 |
| 300 | 3300005983 | Ga0081540_1038817 | Ga0081540_10388172 | 189 |
| 301 | 3300006163 | Ga0070715_10065785 | Ga0070715_100657852 | 189 |
| 302 | 3300006175 | Ga0070712_100086388 | Ga0070712_1000863882 | 189 |
| 303 | 3300006237 | Ga0097621_100040333 | Ga0097621_1000403334 | 189 |
| 304 | 3300006358 | Ga0068871_100013249 | Ga0068871_1000132492 | 189 |
| 305 | 3300006871 | Ga0075434_100268291 | Ga0075434_1002682912 | 189 |
| 306 | 3300006914 | Ga0075436_100209942 | Ga0075436_1002099422 | 189 |
| 307 | 3300009094 | Ga0111539_10488853 | Ga0111539_104888533 | 189 |
| 308 | 3300013100 | Ga0157373_10316729 | Ga0157373_103167292 | 189 |
| 309 | 3300014969 | Ga0157376_10023471 | Ga0157376_100234714 | 189 |
| 310 | 3300025898 | Ga0207692_10029000 | Ga0207692_100290002 | 189 |
| 311 | 3300025905 | Ga0207685_10095939 | Ga0207685_100959392 | 189 |
| 312 | 3300025906 | Ga0207699_10003869 | Ga0207699_100038692 | 189 |
| 313 | 3300025911 | Ga0207654_10094388 | Ga0207654_100943882 | 189 |
| 314 | 3300025915 | Ga0207693_10013607 | Ga0207693_100136077 | 189 |
| 315 | 3300025915 | Ga0207693_10026456 | Ga0207693_100264562 | 189 |
| 316 | 3300025916 | Ga0207663_10001846 | Ga0207663_100018462 | 189 |
| 317 | 3300025916 | Ga0207663_10064525 | Ga0207663_100645252 | 189 |
| 318 | 3300025929 | Ga0207664_10033072 | Ga0207664_100330721 | 189 |
| 319 | 3300025929 | Ga0207664_10315615 | Ga0207664_103156152 | 189 |
| 320 | 3300025939 | Ga0207665_10167118 | Ga0207665_101671182 | 189 |
| 321 | 3300026067 | Ga0207678_10087387 | Ga0207678_100873873 | 189 |
| 322 | 3300026078 | Ga0207702_10019580 | Ga0207702_100195804 | 189 |
| 323 | 3300026121 | Ga0207683_10015532 | Ga0207683_100155322 | 189 |
| 324 | 3300035114 | Ga0373939_0159073 | Ga0373939_0159073_248_817 | 189 |
| 325 | 3300035241 | Ga0373961_0019263 | Ga0373961_0019263_627_1196 | 189 |
| 326 | 3300035691 | Ga0373931_0237084 | Ga0373931_0237084_328_897 | 189 |
| 327 | 3300035695 | Ga0373927_0059848 | Ga0373927_0059848_535_1104 | 189 |
| 328 | 3300042157 | Ga0439458_0023570 | Ga0439458_0023570_196_765 | 189 |
| 329 | 3300046472 | Ga0495580_0253343 | Ga0495580_0253343_535_1104 | 189 |
| 330 | 3300048903 | Ga0496100_0004514 | Ga0496100_0004514_6249_6818 | 189 |
| 331 | 3300048903 | Ga0496100_0110783 | Ga0496100_0110783_359_928 | 189 |
| 332 | 3300048904 | Ga0496101_0179135 | Ga0496101_0179135_362_931 | 189 |
| 333 | 3300048905 | Ga0496102_0001079 | Ga0496102_0001079_22346_22915 | 189 |
| 334 | 3300048906 | Ga0496103_0005182 | Ga0496103_0005182_6258_6827 | 189 |
| 335 | 3300048907 | Ga0496104_0037487 | Ga0496104_0037487_1293_1862 | 189 |
| 336 | 3300048907 | Ga0496104_0098271 | Ga0496104_0098271_386_955 | 189 |
| 337 | 3300048908 | Ga0496105_0036081 | Ga0496105_0036081_2201_2770 | 189 |
| 338 | 3300048908 | Ga0496105_0132171 | Ga0496105_0132171_1408_1977 | 189 |
| 339 | 3300048909 | Ga0496106_0009863 | Ga0496106_0009863_2929_3498 | 189 |
| 340 | 3300048910 | Ga0496107_0003491 | Ga0496107_0003491_1022_1591 | 189 |
| 341 | 3300048910 | Ga0496107_0004909 | Ga0496107_0004909_2305_2874 | 189 |
| 342 | 3300048912 | Ga0496109_0185305 | Ga0496109_0185305_195_764 | 189 |
| 343 | 3300048916 | Ga0496113_0316436 | Ga0496113_0316436_147_716 | 189 |
| 344 | 3300048917 | Ga0496114_0001324 | Ga0496114_0001324_1293_1862 | 189 |
| 345 | 3300048917 | Ga0496114_0054464 | Ga0496114_0054464_2212_2781 | 189 |
| 346 | 3300048918 | Ga0496115_0017003 | Ga0496115_0017003_1585_2154 | 189 |
| 347 | 3300048918 | Ga0496115_0044451 | Ga0496115_0044451_1613_2182 | 189 |
| 348 | 3300049743 | Ga0501081_0574141 | Ga0501081_0574141_61_630 | 189 |
| 349 | 3300050512 | nmdc:mga0n895_191681_c1 | nmdc:mga0n895_191681_c1_1167_1736 | 189 |
| 350 | 3300050514 | nmdc:mga08x19_164526_c1 | nmdc:mga08x19_164526_c1_715_1284 | 189 |
| 351 | iso_pu_bacteria | 2932801729 | 2932807390 | 189 |
| 352 | iso_pu_bacteria | 2935883170 | 2935884403 | 189 |
| 353 | 3300005983 | Ga0081540_1032177 | Ga0081540_10321772 | 190 |
| 354 | 3300005983 | Ga0081540_1158584 | Ga0081540_11585842 | 190 |
| 355 | 3300006844 | Ga0075428_100849644 | Ga0075428_1008496442 | 190 |
| 356 | 3300006871 | Ga0075434_100059001 | Ga0075434_1000590016 | 190 |
| 357 | 3300007076 | Ga0075435_100144319 | Ga0075435_1001443193 | 190 |
| 358 | 3300041460 | Ga0451802_0958627 | Ga0451802_0958627_56_637 | 190 |
| 359 | 3300049568 | Ga0501031_0018701 | Ga0501031_0018701_1940_2512 | 190 |
| 360 | 3300049569 | Ga0501032_0004094 | Ga0501032_0004094_1634_2206 | 190 |
| 361 | 3300049570 | Ga0501033_0003616 | Ga0501033_0003616_3900_4472 | 190 |
| 362 | 3300049571 | Ga0501034_0005157 | Ga0501034_0005157_274_846 | 190 |
| 363 | 3300049572 | Ga0501036_0000908 | Ga0501036_0000908_12745_13317 | 190 |
| 364 | 3300049573 | Ga0501037_0014276 | Ga0501037_0014276_1339_1911 | 190 |
| 365 | 3300049574 | Ga0501038_0004868 | Ga0501038_0004868_9909_10481 | 190 |
| 366 | 3300049575 | Ga0501039_0004417 | Ga0501039_0004417_2914_3486 | 190 |
| 367 | 3300049579 | Ga0501043_0038619 | Ga0501043_0038619_2467_3039 | 190 |
| 368 | 3300049580 | Ga0501046_0004067 | Ga0501046_0004067_4255_4827 | 190 |
| 369 | 3300049581 | Ga0501047_0013191 | Ga0501047_0013191_3943_4515 | 190 |
| 370 | 3300049582 | Ga0501048_0011129 | Ga0501048_0011129_5645_6217 | 190 |
| 371 | 3300049583 | Ga0501067_0013214 | Ga0501067_0013214_3598_4170 | 190 |
| 372 | 3300049584 | Ga0501068_0000491 | Ga0501068_0000491_9909_10481 | 190 |
| 373 | 3300049585 | Ga0501069_0001666 | Ga0501069_0001666_6736_7308 | 190 |
| 374 | 3300049586 | Ga0501070_0016282 | Ga0501070_0016282_402_974 | 190 |
| 375 | 3300049588 | Ga0501072_0001477 | Ga0501072_0001477_8671_9243 | 190 |
| 376 | 3300049592 | Ga0501076_0014627 | Ga0501076_0014627_3394_3966 | 190 |
| 377 | 3300049741 | Ga0501079_0000655 | Ga0501079_0000655_3307_3879 | 190 |
| 378 | 3300049742 | Ga0501080_0000166 | Ga0501080_0000166_8742_9314 | 190 |
| 379 | 3300049744 | Ga0501083_0019539 | Ga0501083_0019539_3745_4317 | 190 |
| 380 | 3300049822 | Ga0501035_0006144 | Ga0501035_0006144_8138_8710 | 190 |
| 381 | 3300049823 | Ga0501044_0113356 | Ga0501044_0113356_1873_2445 | 190 |
| 382 | 3300050512 | nmdc:mga0n895_3395_c1 | nmdc:mga0n895_3395_c1_2998_3579 | 190 |
| 383 | 3300050513 | nmdc:mga0rr50_180301_c1 | nmdc:mga0rr50_180301_c1_360_941 | 190 |
| 384 | 3300054114 | Ga0501084_0000632 | Ga0501084_0000632_17797_18369 | 190 |
| 385 | 3300060353 | Ga0501082_0007237 | Ga0501082_0007237_5018_5590 | 190 |
| 386 | iso_pu_bacteria | 2917699015 | 2917702545 | 190 |
| 387 | 3300003322 | rootL2_10091361 | rootL2_100913612 | 191 |
| 388 | 3300004798 | Ga0058859_11489020 | Ga0058859_114890201 | 191 |
| 389 | 3300004800 | Ga0058861_11388695 | Ga0058861_113886952 | 191 |
| 390 | 3300005329 | Ga0070683_100005595 | Ga0070683_1000055952 | 191 |
| 391 | 3300005330 | Ga0070690_100177579 | Ga0070690_1001775792 | 191 |
| 392 | 3300005330 | Ga0070690_100508524 | Ga0070690_1005085242 | 191 |
| 393 | 3300005334 | Ga0068869_100005172 | Ga0068869_1000051726 | 191 |
| 394 | 3300005334 | Ga0068869_100182674 | Ga0068869_1001826742 | 191 |
| 395 | 3300005340 | Ga0070689_100173939 | Ga0070689_1001739392 | 191 |
| 396 | 3300005340 | Ga0070689_100383957 | Ga0070689_1003839572 | 191 |
| 397 | 3300005343 | Ga0070687_100296023 | Ga0070687_1002960231 | 191 |
| 398 | 3300005344 | Ga0070661_100023966 | Ga0070661_1000239662 | 191 |
| 399 | 3300005364 | Ga0070673_100116463 | Ga0070673_1001164632 | 191 |
| 400 | 3300005366 | Ga0070659_100250101 | Ga0070659_1002501012 | 191 |
| 401 | 3300005434 | Ga0070709_10567987 | Ga0070709_105679871 | 191 |
| 402 | 3300005435 | Ga0070714_100002329 | Ga0070714_1000023298 | 191 |
| 403 | 3300005435 | Ga0070714_100309487 | Ga0070714_1003094871 | 191 |
| 404 | 3300005438 | Ga0070701_10121134 | Ga0070701_101211342 | 191 |
| 405 | 3300005439 | Ga0070711_100027931 | Ga0070711_1000279315 | 191 |
| 406 | 3300005441 | Ga0070700_100377285 | Ga0070700_1003772852 | 191 |
| 407 | 3300005444 | Ga0070694_100857798 | Ga0070694_1008577981 | 191 |
| 408 | 3300005445 | Ga0070708_101403958 | Ga0070708_1014039581 | 191 |
| 409 | 3300005455 | Ga0070663_100534055 | Ga0070663_1005340552 | 191 |
| 410 | 3300005458 | Ga0070681_10632008 | Ga0070681_106320082 | 191 |
| 411 | 3300005535 | Ga0070684_100106805 | Ga0070684_1001068052 | 191 |
| 412 | 3300005539 | Ga0068853_100271405 | Ga0068853_1002714051 | 191 |
| 413 | 3300005539 | Ga0068853_100412703 | Ga0068853_1004127031 | 191 |
| 414 | 3300005543 | Ga0070672_100261292 | Ga0070672_1002612922 | 191 |
| 415 | 3300005544 | Ga0070686_100036321 | Ga0070686_1000363213 | 191 |
| 416 | 3300005546 | Ga0070696_100466040 | Ga0070696_1004660401 | 191 |
| 417 | 3300005563 | Ga0068855_100108380 | Ga0068855_1001083803 | 191 |
| 418 | 3300005564 | Ga0070664_100008019 | Ga0070664_1000080192 | 191 |
| 419 | 3300005614 | Ga0068856_100069586 | Ga0068856_1000695863 | 191 |
| 420 | 3300005615 | Ga0070702_100135371 | Ga0070702_1001353712 | 191 |
| 421 | 3300005718 | Ga0068866_10179243 | Ga0068866_101792432 | 191 |
| 422 | 3300005719 | Ga0068861_100191016 | Ga0068861_1001910162 | 191 |
| 423 | 3300005719 | Ga0068861_100406332 | Ga0068861_1004063322 | 191 |
| 424 | 3300005840 | Ga0068870_10242701 | Ga0068870_102427012 | 191 |
| 425 | 3300005841 | Ga0068863_100048611 | Ga0068863_1000486112 | 191 |
| 426 | 3300005841 | Ga0068863_100115767 | Ga0068863_1001157672 | 191 |
| 427 | 3300005842 | Ga0068858_100361606 | Ga0068858_1003616062 | 191 |
| 428 | 3300005842 | Ga0068858_101444916 | Ga0068858_1014449161 | 191 |
| 429 | 3300005843 | Ga0068860_100082372 | Ga0068860_1000823722 | 191 |
| 430 | 3300005843 | Ga0068860_100353300 | Ga0068860_1003533002 | 191 |
| 431 | 3300006173 | Ga0070716_100506808 | Ga0070716_1005068081 | 191 |
| 432 | 3300006175 | Ga0070712_100002273 | Ga0070712_10000227310 | 191 |
| 433 | 3300006237 | Ga0097621_100140901 | Ga0097621_1001409012 | 191 |
| 434 | 3300006237 | Ga0097621_100653949 | Ga0097621_1006539492 | 191 |
| 435 | 3300006881 | Ga0068865_100009081 | Ga0068865_1000090816 | 191 |
| 436 | 3300006914 | Ga0075436_100219034 | Ga0075436_1002190341 | 191 |
| 437 | 3300006914 | Ga0075436_100463914 | Ga0075436_1004639142 | 191 |
| 438 | 3300009093 | Ga0105240_10368771 | Ga0105240_103687712 | 191 |
| 439 | 3300009174 | Ga0105241_10148370 | Ga0105241_101483702 | 191 |
| 440 | 3300009176 | Ga0105242_10589539 | Ga0105242_105895391 | 191 |
| 441 | 3300009545 | Ga0105237_10109102 | Ga0105237_101091022 | 191 |
| 442 | 3300009545 | Ga0105237_10377707 | Ga0105237_103777072 | 191 |
| 443 | 3300009545 | Ga0105237_10622452 | Ga0105237_106224522 | 191 |
| 444 | 3300009551 | Ga0105238_10027367 | Ga0105238_100273673 | 191 |
| 445 | 3300009553 | Ga0105249_10429497 | Ga0105249_104294972 | 191 |
| 446 | 3300010375 | Ga0105239_10012961 | Ga0105239_100129617 | 191 |
| 447 | 3300010375 | Ga0105239_10013235 | Ga0105239_100132355 | 191 |
| 448 | 3300013100 | Ga0157373_10122589 | Ga0157373_101225892 | 191 |
| 449 | 3300013104 | Ga0157370_10039454 | Ga0157370_100394542 | 191 |
| 450 | 3300013104 | Ga0157370_10091494 | Ga0157370_100914943 | 191 |
| 451 | 3300013105 | Ga0157369_10029345 | Ga0157369_100293456 | 191 |
| 452 | 3300013296 | Ga0157374_10037229 | Ga0157374_100372293 | 191 |
| 453 | 3300013297 | Ga0157378_10174250 | Ga0157378_101742502 | 191 |
| 454 | 3300013306 | Ga0163162_10025885 | Ga0163162_100258853 | 191 |
| 455 | 3300013307 | Ga0157372_10431177 | Ga0157372_104311772 | 191 |
| 456 | 3300013308 | Ga0157375_10001967 | Ga0157375_1000196712 | 191 |
| 457 | 3300013308 | Ga0157375_10200558 | Ga0157375_102005582 | 191 |
| 458 | 3300014745 | Ga0157377_10124201 | Ga0157377_101242011 | 191 |
| 459 | 3300014968 | Ga0157379_10160461 | Ga0157379_101604612 | 191 |
| 460 | 3300014969 | Ga0157376_10261577 | Ga0157376_102615771 | 191 |
| 461 | 3300014969 | Ga0157376_10309989 | Ga0157376_103099892 | 191 |
| 462 | 3300014969 | Ga0157376_10315375 | Ga0157376_103153752 | 191 |
| 463 | 3300014969 | Ga0157376_10452634 | Ga0157376_104526341 | 191 |
| 464 | 3300025899 | Ga0207642_10195459 | Ga0207642_101954592 | 191 |
| 465 | 3300025904 | Ga0207647_10074469 | Ga0207647_100744692 | 191 |
| 466 | 3300025912 | Ga0207707_10832948 | Ga0207707_108329482 | 191 |
| 467 | 3300025914 | Ga0207671_10033203 | Ga0207671_100332035 | 191 |
| 468 | 3300025915 | Ga0207693_10000618 | Ga0207693_1000061810 | 191 |
| 469 | 3300025916 | Ga0207663_10039414 | Ga0207663_100394143 | 191 |
| 470 | 3300025918 | Ga0207662_10122212 | Ga0207662_101222122 | 191 |
| 471 | 3300025920 | Ga0207649_10016319 | Ga0207649_100163193 | 191 |
| 472 | 3300025921 | Ga0207652_10201794 | Ga0207652_102017942 | 191 |
| 473 | 3300025929 | Ga0207664_10062432 | Ga0207664_100624323 | 191 |
| 474 | 3300025929 | Ga0207664_10333431 | Ga0207664_103334312 | 191 |
| 475 | 3300025931 | Ga0207644_10337171 | Ga0207644_103371712 | 191 |
| 476 | 3300025932 | Ga0207690_10098241 | Ga0207690_100982411 | 191 |
| 477 | 3300025933 | Ga0207706_10515868 | Ga0207706_105158682 | 191 |
| 478 | 3300025936 | Ga0207670_10206838 | Ga0207670_102068382 | 191 |
| 479 | 3300025940 | Ga0207691_10439135 | Ga0207691_104391352 | 191 |
| 480 | 3300025942 | Ga0207689_10046924 | Ga0207689_100469242 | 191 |
| 481 | 3300025949 | Ga0207667_10168343 | Ga0207667_101683432 | 191 |
| 482 | 3300025960 | Ga0207651_10732040 | Ga0207651_107320402 | 191 |
| 483 | 3300026023 | Ga0207677_10048957 | Ga0207677_100489572 | 191 |
| 484 | 3300026041 | Ga0207639_10110242 | Ga0207639_101102423 | 191 |
| 485 | 3300026041 | Ga0207639_10780454 | Ga0207639_107804542 | 191 |
| 486 | 3300026067 | Ga0207678_10541343 | Ga0207678_105413432 | 191 |
| 487 | 3300026075 | Ga0207708_10233878 | Ga0207708_102338782 | 191 |
| 488 | 3300026078 | Ga0207702_10082938 | Ga0207702_100829382 | 191 |
| 489 | 3300026088 | Ga0207641_10044330 | Ga0207641_100443303 | 191 |
| 490 | 3300026088 | Ga0207641_10296644 | Ga0207641_102966442 | 191 |
| 491 | 3300026116 | Ga0207674_10097832 | Ga0207674_100978322 | 191 |
| 492 | 3300026118 | Ga0207675_100010598 | Ga0207675_1000105988 | 191 |
| 493 | 3300026118 | Ga0207675_100086481 | Ga0207675_1000864812 | 191 |
| 494 | 3300028381 | Ga0268264_10090713 | Ga0268264_100907133 | 191 |
| 495 | 3300028381 | Ga0268264_10784014 | Ga0268264_107840142 | 191 |
| 496 | 3300028563 | Ga0265319_1039497 | Ga0265319_10394972 | 191 |
| 497 | 3300028577 | Ga0265318_10001006 | Ga0265318_100010066 | 191 |
| 498 | 3300031238 | Ga0265332_10102283 | Ga0265332_101022831 | 191 |
| 499 | 3300031239 | Ga0265328_10021814 | Ga0265328_100218143 | 191 |
| 500 | 3300031240 | Ga0265320_10000218 | Ga0265320_1000021834 | 191 |
| 501 | 3300031241 | Ga0265325_10011290 | Ga0265325_100112901 | 191 |
| 502 | 3300031242 | Ga0265329_10000485 | Ga0265329_1000048516 | 191 |
| 503 | 3300031247 | Ga0265340_10001203 | Ga0265340_100012036 | 191 |
| 504 | 3300031249 | Ga0265339_10007117 | Ga0265339_100071175 | 191 |
| 505 | 3300031250 | Ga0265331_10001063 | Ga0265331_1000106311 | 191 |
| 506 | 3300031344 | Ga0265316_10006166 | Ga0265316_100061663 | 191 |
| 507 | 3300031595 | Ga0265313_10004470 | Ga0265313_100044702 | 191 |
| 508 | 3300031711 | Ga0265314_10015537 | Ga0265314_100155373 | 191 |
| 509 | 3300031712 | Ga0265342_10000161 | Ga0265342_1000016164 | 191 |
| 510 | 3300032002 | Ga0307416_100355916 | Ga0307416_1003559162 | 191 |
| 511 | 3300037312 | Ga0395899_0172406 | Ga0395899_0172406_387_962 | 191 |
| 512 | 3300037418 | Ga0395900_0003828 | Ga0395900_0003828_6970_7545 | 191 |
| 513 | 3300038443 | Ga0395901_0001187 | Ga0395901_0001187_3374_3949 | 191 |
| 514 | 3300044694 | Ga0466963_0008636 | Ga0466963_0008636_4504_5079 | 191 |
| 515 | 3300045051 | Ga0451576_0326113 | Ga0451576_0326113_577_1161 | 191 |
| 516 | 3300048906 | Ga0496103_0450283 | Ga0496103_0450283_165_740 | 191 |
| 517 | 3300048909 | Ga0496106_0748422 | Ga0496106_0748422_52_627 | 191 |
| 518 | 3300048915 | Ga0496112_0055010 | Ga0496112_0055010_30_614 | 191 |
| 519 | 3300048917 | Ga0496114_0390085 | Ga0496114_0390085_491_1066 | 191 |
| 520 | 3300048918 | Ga0496115_0027930 | Ga0496115_0027930_2751_3326 | 191 |
| 521 | 3300048918 | Ga0496115_0772558 | Ga0496115_0772558_26_601 | 191 |
| 522 | 3300048924 | Ga0496121_0136933 | Ga0496121_0136933_1182_1757 | 191 |
| 523 | 3300050514 | nmdc:mga08x19_5499_c1 | nmdc:mga08x19_5499_c1_488_1072 | 191 |
| 524 | 3300003215 | JGI25153J46596_10000100 | JGI25153J46596_1000010067 | 192 |
| 525 | 3300003322 | rootL2_10073410 | rootL2_100734102 | 192 |
| 526 | 3300005336 | Ga0070680_100146350 | Ga0070680_1001463501 | 192 |
| 527 | 3300005341 | Ga0070691_10014606 | Ga0070691_100146061 | 192 |
| 528 | 3300005344 | Ga0070661_100045717 | Ga0070661_1000457172 | 192 |
| 529 | 3300005356 | Ga0070674_100520971 | Ga0070674_1005209711 | 192 |
| 530 | 3300005366 | Ga0070659_100164338 | Ga0070659_1001643382 | 192 |
| 531 | 3300005435 | Ga0070714_100017469 | Ga0070714_1000174692 | 192 |
| 532 | 3300005436 | Ga0070713_100103328 | Ga0070713_1001033282 | 192 |
| 533 | 3300005436 | Ga0070713_100379353 | Ga0070713_1003793532 | 192 |
| 534 | 3300005437 | Ga0070710_10010313 | Ga0070710_100103133 | 192 |
| 535 | 3300005439 | Ga0070711_100007151 | Ga0070711_1000071514 | 192 |
| 536 | 3300005439 | Ga0070711_100569007 | Ga0070711_1005690072 | 192 |
| 537 | 3300005445 | Ga0070708_100346821 | Ga0070708_1003468212 | 192 |
| 538 | 3300005455 | Ga0070663_100853935 | Ga0070663_1008539351 | 192 |
| 539 | 3300005458 | Ga0070681_10415209 | Ga0070681_104152091 | 192 |
| 540 | 3300005530 | Ga0070679_100434728 | Ga0070679_1004347281 | 192 |
| 541 | 3300005535 | Ga0070684_100044445 | Ga0070684_1000444453 | 192 |
| 542 | 3300005535 | Ga0070684_100272588 | Ga0070684_1002725882 | 192 |
| 543 | 3300005536 | Ga0070697_100111821 | Ga0070697_1001118212 | 192 |
| 544 | 3300005577 | Ga0068857_100034239 | Ga0068857_1000342394 | 192 |
| 545 | 3300005578 | Ga0068854_100265832 | Ga0068854_1002658323 | 192 |
| 546 | 3300005834 | Ga0068851_10000500 | Ga0068851_1000050015 | 192 |
| 547 | 3300005937 | Ga0081455_10017243 | Ga0081455_1001724310 | 192 |
| 548 | 3300005981 | Ga0081538_10100479 | Ga0081538_101004791 | 192 |
| 549 | 3300005985 | Ga0081539_10005293 | Ga0081539_100052932 | 192 |
| 550 | 3300005985 | Ga0081539_10205066 | Ga0081539_102050662 | 192 |
| 551 | 3300006042 | Ga0075368_10169108 | Ga0075368_101691082 | 192 |
| 552 | 3300006163 | Ga0070715_10103903 | Ga0070715_101039031 | 192 |
| 553 | 3300006175 | Ga0070712_100040648 | Ga0070712_1000406483 | 192 |
| 554 | 3300006177 | Ga0075362_10015526 | Ga0075362_100155262 | 192 |
| 555 | 3300006178 | Ga0075367_10030118 | Ga0075367_100301182 | 192 |
| 556 | 3300006358 | Ga0068871_101103567 | Ga0068871_1011035672 | 192 |
| 557 | 3300006852 | Ga0075433_10416862 | Ga0075433_104168622 | 192 |
| 558 | 3300006871 | Ga0075434_100801115 | Ga0075434_1008011151 | 192 |
| 559 | 3300006944 | Ga0099823_1024448 | Ga0099823_10244484 | 192 |
| 560 | 3300009093 | Ga0105240_10046260 | Ga0105240_100462606 | 192 |
| 561 | 3300009094 | Ga0111539_10038472 | Ga0111539_100384724 | 192 |
| 562 | 3300009147 | Ga0114129_10389251 | Ga0114129_103892512 | 192 |
| 563 | 3300009147 | Ga0114129_11333174 | Ga0114129_113331741 | 192 |
| 564 | 3300009176 | Ga0105242_10396315 | Ga0105242_103963152 | 192 |
| 565 | 3300009177 | Ga0105248_11060786 | Ga0105248_110607861 | 192 |
| 566 | 3300009545 | Ga0105237_10020853 | Ga0105237_100208534 | 192 |
| 567 | 3300009551 | Ga0105238_10010451 | Ga0105238_100104515 | 192 |
| 568 | 3300010159 | Ga0099796_10187129 | Ga0099796_101871291 | 192 |
| 569 | 3300010375 | Ga0105239_10002049 | Ga0105239_1000204919 | 192 |
| 570 | 3300013105 | Ga0157369_10009927 | Ga0157369_100099273 | 192 |
| 571 | 3300013297 | Ga0157378_10293061 | Ga0157378_102930612 | 192 |
| 572 | 3300021384 | Ga0213876_10052853 | Ga0213876_100528532 | 192 |
| 573 | 3300025297 | Ga0209758_1000189 | Ga0209758_100018972 | 192 |
| 574 | 3300025898 | Ga0207692_10043848 | Ga0207692_100438483 | 192 |
| 575 | 3300025906 | Ga0207699_10021822 | Ga0207699_100218224 | 192 |
| 576 | 3300025910 | Ga0207684_10112531 | Ga0207684_101125312 | 192 |
| 577 | 3300025912 | Ga0207707_10000541 | Ga0207707_1000054116 | 192 |
| 578 | 3300025915 | Ga0207693_10052515 | Ga0207693_100525152 | 192 |
| 579 | 3300025916 | Ga0207663_10017163 | Ga0207663_100171631 | 192 |
| 580 | 3300025917 | Ga0207660_10008198 | Ga0207660_100081985 | 192 |
| 581 | 3300025919 | Ga0207657_10002950 | Ga0207657_100029504 | 192 |
| 582 | 3300025920 | Ga0207649_10370137 | Ga0207649_103701372 | 192 |
| 583 | 3300025921 | Ga0207652_10005910 | Ga0207652_100059103 | 192 |
| 584 | 3300025924 | Ga0207694_10089548 | Ga0207694_100895483 | 192 |
| 585 | 3300025928 | Ga0207700_10070167 | Ga0207700_100701672 | 192 |
| 586 | 3300025929 | Ga0207664_10105987 | Ga0207664_101059872 | 192 |
| 587 | 3300025932 | Ga0207690_10285163 | Ga0207690_102851631 | 192 |
| 588 | 3300025937 | Ga0207669_10593924 | Ga0207669_105939242 | 192 |
| 589 | 3300025939 | Ga0207665_10012300 | Ga0207665_100123004 | 192 |
| 590 | 3300025939 | Ga0207665_10901704 | Ga0207665_109017042 | 192 |
| 591 | 3300026067 | Ga0207678_10012879 | Ga0207678_100128792 | 192 |
| 592 | 3300026116 | Ga0207674_10059274 | Ga0207674_100592743 | 192 |
| 593 | 3300026116 | Ga0207674_10459910 | Ga0207674_104599102 | 192 |
| 594 | 3300026142 | Ga0207698_10098675 | Ga0207698_100986752 | 192 |
| 595 | 3300027296 | Ga0209389_1000222 | Ga0209389_10002227 | 192 |
| 596 | 3300027361 | Ga0209489_101154 | Ga0209489_10115413 | 192 |
| 597 | 3300027907 | Ga0207428_10067820 | Ga0207428_100678202 | 192 |
| 598 | 3300032126 | Ga0307415_100233927 | Ga0307415_1002339272 | 192 |
| 599 | 3300036401 | Ga0373937_0268436 | Ga0373937_0268436_669_1247 | 192 |
| 600 | 3300037466 | Ga0395898_0982073 | Ga0395898_0982073_182_769 | 192 |
| 601 | 3300039437 | Ga0436365_0127917 | Ga0436365_0127917_5185_5763 | 192 |
| 602 | 3300039450 | Ga0436363_1400321 | Ga0436363_1400321_33_611 | 192 |
| 603 | 3300046524 | Ga0495648_0177987 | Ga0495648_0177987_164_742 | 192 |
| 604 | 3300047320 | Ga0495672_0043084 | Ga0495672_0043084_1484_2062 | 192 |
| 605 | 3300048905 | Ga0496102_0099696 | Ga0496102_0099696_1645_2223 | 192 |
| 606 | 3300048929 | Ga0496126_0023838 | Ga0496126_0023838_1269_1847 | 192 |
| 607 | 3300049577 | Ga0501041_0443249 | Ga0501041_0443249_48_635 | 192 |
| 608 | 3300049588 | Ga0501072_0433861 | Ga0501072_0433861_138_725 | 192 |
| 609 | 3300049591 | Ga0501075_0309780 | Ga0501075_0309780_177_764 | 192 |
| 610 | 3300050494 | nmdc:mga06z11_13679_c1 | nmdc:mga06z11_13679_c1_2014_2592 | 192 |
| 611 | 3300050496 | nmdc:mga07m45_386843_c1 | nmdc:mga07m45_386843_c1_182_760 | 192 |
| 612 | 3300050507 | nmdc:mga05p37_838007_c1 | nmdc:mga05p37_838007_c1_117_695 | 192 |
| 613 | 3300050511 | nmdc:mga08y16_111546_c1 | nmdc:mga08y16_111546_c1_2242_2820 | 192 |
| 614 | 3300050512 | nmdc:mga0n895_340808_c1 | nmdc:mga0n895_340808_c1_503_1081 | 192 |
| 615 | 3300059477 | Ga0587084_038722 | Ga0587084_038722_169_747 | 192 |
| 616 | 3300059491 | Ga0587070_051433 | Ga0587070_051433_76_654 | 192 |
| 617 | 3300059506 | Ga0587085_008886 | Ga0587085_008886_642_1220 | 192 |
| 618 | 3300059639 | Ga0587062_006187 | Ga0587062_006187_643_1221 | 192 |
| 619 | 3300060353 | Ga0501082_0254781 | Ga0501082_0254781_591_1178 | 192 |
| 620 | 3300061734 | Ga0530510_0669581 | Ga0530510_0669581_38_625 | 192 |
| 621 | 3300005329 | Ga0070683_100078993 | Ga0070683_1000789933 | 193 |
| 622 | 3300005337 | Ga0070682_100088871 | Ga0070682_1000888712 | 193 |
| 623 | 3300005337 | Ga0070682_100117419 | Ga0070682_1001174193 | 193 |
| 624 | 3300005339 | Ga0070660_100171521 | Ga0070660_1001715212 | 193 |
| 625 | 3300005344 | Ga0070661_100461961 | Ga0070661_1004619612 | 193 |
| 626 | 3300005354 | Ga0070675_100065373 | Ga0070675_1000653733 | 193 |
| 627 | 3300005354 | Ga0070675_100412561 | Ga0070675_1004125612 | 193 |
| 628 | 3300005365 | Ga0070688_100483835 | Ga0070688_1004838352 | 193 |
| 629 | 3300005366 | Ga0070659_100337158 | Ga0070659_1003371582 | 193 |
| 630 | 3300005437 | Ga0070710_10148220 | Ga0070710_101482202 | 193 |
| 631 | 3300005438 | Ga0070701_10073179 | Ga0070701_100731792 | 193 |
| 632 | 3300005455 | Ga0070663_100935991 | Ga0070663_1009359911 | 193 |
| 633 | 3300005456 | Ga0070678_100565190 | Ga0070678_1005651902 | 193 |
| 634 | 3300005457 | Ga0070662_100708808 | Ga0070662_1007088082 | 193 |
| 635 | 3300005466 | Ga0070685_10168261 | Ga0070685_101682611 | 193 |
| 636 | 3300005530 | Ga0070679_100016854 | Ga0070679_1000168546 | 193 |
| 637 | 3300005535 | Ga0070684_100036102 | Ga0070684_1000361022 | 193 |
| 638 | 3300005546 | Ga0070696_100424043 | Ga0070696_1004240432 | 193 |
| 639 | 3300005563 | Ga0068855_100139908 | Ga0068855_1001399083 | 193 |
| 640 | 3300005563 | Ga0068855_100171128 | Ga0068855_1001711282 | 193 |
| 641 | 3300005564 | Ga0070664_100057020 | Ga0070664_1000570203 | 193 |
| 642 | 3300005578 | Ga0068854_100090031 | Ga0068854_1000900313 | 193 |
| 643 | 3300005614 | Ga0068856_100108887 | Ga0068856_1001088873 | 193 |
| 644 | 3300005615 | Ga0070702_100403449 | Ga0070702_1004034492 | 193 |
| 645 | 3300005618 | Ga0068864_100411570 | Ga0068864_1004115702 | 193 |
| 646 | 3300005719 | Ga0068861_100457479 | Ga0068861_1004574792 | 193 |
| 647 | 3300005840 | Ga0068870_10110343 | Ga0068870_101103432 | 193 |
| 648 | 3300005841 | Ga0068863_100904458 | Ga0068863_1009044582 | 193 |
| 649 | 3300005843 | Ga0068860_100388175 | Ga0068860_1003881752 | 193 |
| 650 | 3300005844 | Ga0068862_100191213 | Ga0068862_1001912133 | 193 |
| 651 | 3300006175 | Ga0070712_100045039 | Ga0070712_1000450393 | 193 |
| 652 | 3300006846 | Ga0075430_100461444 | Ga0075430_1004614442 | 193 |
| 653 | 3300006871 | Ga0075434_100350962 | Ga0075434_1003509622 | 193 |
| 654 | 3300009094 | Ga0111539_10078450 | Ga0111539_100784503 | 193 |
| 655 | 3300009094 | Ga0111539_10353482 | Ga0111539_103534822 | 193 |
| 656 | 3300009098 | Ga0105245_10201236 | Ga0105245_102012362 | 193 |
| 657 | 3300009147 | Ga0114129_10624806 | Ga0114129_106248062 | 193 |
| 658 | 3300009147 | Ga0114129_11155908 | Ga0114129_111559081 | 193 |
| 659 | 3300009148 | Ga0105243_10552502 | Ga0105243_105525022 | 193 |
| 660 | 3300009174 | Ga0105241_10158688 | Ga0105241_101586882 | 193 |
| 661 | 3300009177 | Ga0105248_10176427 | Ga0105248_101764272 | 193 |
| 662 | 3300009545 | Ga0105237_10006095 | Ga0105237_1000609512 | 193 |
| 663 | 3300009551 | Ga0105238_10000679 | Ga0105238_1000067928 | 193 |
| 664 | 3300009551 | Ga0105238_10287277 | Ga0105238_102872773 | 193 |
| 665 | 3300009553 | Ga0105249_10395607 | Ga0105249_103956072 | 193 |
| 666 | 3300009553 | Ga0105249_10463690 | Ga0105249_104636902 | 193 |
| 667 | 3300010375 | Ga0105239_10123513 | Ga0105239_101235132 | 193 |
| 668 | 3300010375 | Ga0105239_10376430 | Ga0105239_103764303 | 193 |
| 669 | 3300013104 | Ga0157370_10005882 | Ga0157370_1000588214 | 193 |
| 670 | 3300013105 | Ga0157369_10001683 | Ga0157369_1000168313 | 193 |
| 671 | 3300013105 | Ga0157369_10197739 | Ga0157369_101977393 | 193 |
| 672 | 3300013307 | Ga0157372_10031051 | Ga0157372_100310515 | 193 |
| 673 | 3300013308 | Ga0157375_11639488 | Ga0157375_116394881 | 193 |
| 674 | 3300014325 | Ga0163163_10170273 | Ga0163163_101702732 | 193 |
| 675 | 3300014325 | Ga0163163_10202111 | Ga0163163_102021112 | 193 |
| 676 | 3300017792 | Ga0163161_10663337 | Ga0163161_106633371 | 193 |
| 677 | 3300017792 | Ga0163161_10960066 | Ga0163161_109600661 | 193 |
| 678 | 3300025907 | Ga0207645_10112242 | Ga0207645_101122422 | 193 |
| 679 | 3300025911 | Ga0207654_10121236 | Ga0207654_101212362 | 193 |
| 680 | 3300025913 | Ga0207695_10118403 | Ga0207695_101184034 | 193 |
| 681 | 3300025915 | Ga0207693_10027324 | Ga0207693_100273244 | 193 |
| 682 | 3300025917 | Ga0207660_10609006 | Ga0207660_106090061 | 193 |
| 683 | 3300025919 | Ga0207657_10000717 | Ga0207657_1000071722 | 193 |
| 684 | 3300025920 | Ga0207649_10388441 | Ga0207649_103884412 | 193 |
| 685 | 3300025924 | Ga0207694_10233146 | Ga0207694_102331462 | 193 |
| 686 | 3300025926 | Ga0207659_10029567 | Ga0207659_100295672 | 193 |
| 687 | 3300025932 | Ga0207690_10261233 | Ga0207690_102612332 | 193 |
| 688 | 3300025933 | Ga0207706_10687361 | Ga0207706_106873611 | 193 |
| 689 | 3300025944 | Ga0207661_10008495 | Ga0207661_100084953 | 193 |
| 690 | 3300025944 | Ga0207661_10096883 | Ga0207661_100968832 | 193 |
| 691 | 3300025949 | Ga0207667_10259558 | Ga0207667_102595582 | 193 |
| 692 | 3300025960 | Ga0207651_10026977 | Ga0207651_100269773 | 193 |
| 693 | 3300025961 | Ga0207712_10344833 | Ga0207712_103448332 | 193 |
| 694 | 3300026067 | Ga0207678_10179764 | Ga0207678_101797642 | 193 |
| 695 | 3300026075 | Ga0207708_10005193 | Ga0207708_100051935 | 193 |
| 696 | 3300026078 | Ga0207702_11117688 | Ga0207702_111176882 | 193 |
| 697 | 3300026089 | Ga0207648_10337789 | Ga0207648_103377892 | 193 |
| 698 | 3300026095 | Ga0207676_10356425 | Ga0207676_103564252 | 193 |
| 699 | 3300026118 | Ga0207675_100191758 | Ga0207675_1001917582 | 193 |
| 700 | 3300026118 | Ga0207675_100506599 | Ga0207675_1005065992 | 193 |
| 701 | 3300026121 | Ga0207683_10151702 | Ga0207683_101517023 | 193 |
| 702 | 3300048904 | Ga0496101_0044033 | Ga0496101_0044033_1746_2327 | 193 |
| 703 | 3300048907 | Ga0496104_0076592 | Ga0496104_0076592_2571_3152 | 193 |
| 704 | 3300048908 | Ga0496105_0012687 | Ga0496105_0012687_2624_3205 | 193 |
| 705 | 3300048909 | Ga0496106_0230381 | Ga0496106_0230381_508_1089 | 193 |
| 706 | 3300048911 | Ga0496108_0014845 | Ga0496108_0014845_4050_4631 | 193 |
| 707 | 3300048912 | Ga0496109_0025178 | Ga0496109_0025178_1827_2408 | 193 |
| 708 | 3300048913 | Ga0496110_0047300 | Ga0496110_0047300_1316_1897 | 193 |
| 709 | 3300048914 | Ga0496111_0158184 | Ga0496111_0158184_555_1136 | 193 |
| 710 | 3300048915 | Ga0496112_0135857 | Ga0496112_0135857_643_1224 | 193 |
| 711 | 3300048916 | Ga0496113_0004169 | Ga0496113_0004169_599_1180 | 193 |
| 712 | 3300048917 | Ga0496114_0342937 | Ga0496114_0342937_282_863 | 193 |
| 713 | 3300048918 | Ga0496115_0430586 | Ga0496115_0430586_269_850 | 193 |
| 714 | 3300049576 | Ga0501040_0119523 | Ga0501040_0119523_134_742 | 193 |
| 715 | 3300049587 | Ga0501071_0084982 | Ga0501071_0084982_694_1302 | 193 |
| 716 | 3300049592 | Ga0501076_0679225 | Ga0501076_0679225_29_637 | 193 |
| 717 | 3300049593 | Ga0501077_0028261 | Ga0501077_0028261_2874_3482 | 193 |
| 718 | 3300049741 | Ga0501079_0457157 | Ga0501079_0457157_198_806 | 193 |
| 719 | 3300049741 | Ga0501079_0744536 | Ga0501079_0744536_129_737 | 193 |
| 720 | 3300050507 | nmdc:mga05p37_559844_c1 | nmdc:mga05p37_559844_c1_566_1147 | 193 |
| 721 | 3300050507 | nmdc:mga05p37_736011_c1 | nmdc:mga05p37_736011_c1_340_921 | 193 |
| 722 | 3300050513 | nmdc:mga0rr50_296304_c1 | nmdc:mga0rr50_296304_c1_749_1330 | 193 |
| 723 | 3300050515 | nmdc:mga0a205_455553_c1 | nmdc:mga0a205_455553_c1_197_778 | 193 |
| 724 | 3300050515 | nmdc:mga0a205_500426_c1 | nmdc:mga0a205_500426_c1_272_853 | 193 |
| 725 | 3300054114 | Ga0501084_0321023 | Ga0501084_0321023_623_1231 | 193 |
| 726 | 3300061734 | Ga0530510_0089305 | Ga0530510_0089305_1043_1651 | 193 |
| 727 | 2162886011 | MRS1b_contig_5910558 | MRS1b_0725.00001680 | 194 |
| 728 | 3300003775 | Ga0055524_1000011 | Ga0055524_1000011111 | 194 |
| 729 | 3300004803 | Ga0058862_10021887 | Ga0058862_100218872 | 194 |
| 730 | 3300005290 | Ga0065712_10386821 | Ga0065712_103868211 | 194 |
| 731 | 3300005293 | Ga0065715_10510195 | Ga0065715_105101951 | 194 |
| 732 | 3300005329 | Ga0070683_100001522 | Ga0070683_10000152216 | 194 |
| 733 | 3300005330 | Ga0070690_100648740 | Ga0070690_1006487401 | 194 |
| 734 | 3300005331 | Ga0070670_100001055 | Ga0070670_1000010559 | 194 |
| 735 | 3300005331 | Ga0070670_101126074 | Ga0070670_1011260741 | 194 |
| 736 | 3300005335 | Ga0070666_10734333 | Ga0070666_107343331 | 194 |
| 737 | 3300005336 | Ga0070680_100008542 | Ga0070680_1000085423 | 194 |
| 738 | 3300005344 | Ga0070661_100056254 | Ga0070661_1000562543 | 194 |
| 739 | 3300005344 | Ga0070661_100254167 | Ga0070661_1002541672 | 194 |
| 740 | 3300005354 | Ga0070675_100042408 | Ga0070675_1000424083 | 194 |
| 741 | 3300005435 | Ga0070714_100296206 | Ga0070714_1002962062 | 194 |
| 742 | 3300005438 | Ga0070701_10010894 | Ga0070701_100108944 | 194 |
| 743 | 3300005440 | Ga0070705_100355295 | Ga0070705_1003552951 | 194 |
| 744 | 3300005441 | Ga0070700_100275018 | Ga0070700_1002750183 | 194 |
| 745 | 3300005444 | Ga0070694_100045163 | Ga0070694_1000451633 | 194 |
| 746 | 3300005444 | Ga0070694_100140279 | Ga0070694_1001402792 | 194 |
| 747 | 3300005455 | Ga0070663_100011611 | Ga0070663_1000116115 | 194 |
| 748 | 3300005458 | Ga0070681_10042828 | Ga0070681_100428283 | 194 |
| 749 | 3300005459 | Ga0068867_100377232 | Ga0068867_1003772322 | 194 |
| 750 | 3300005459 | Ga0068867_101081462 | Ga0068867_1010814621 | 194 |
| 751 | 3300005467 | Ga0070706_100015547 | Ga0070706_1000155472 | 194 |
| 752 | 3300005468 | Ga0070707_100010108 | Ga0070707_1000101085 | 194 |
| 753 | 3300005471 | Ga0070698_100003041 | Ga0070698_1000030415 | 194 |
| 754 | 3300005518 | Ga0070699_100919474 | Ga0070699_1009194741 | 194 |
| 755 | 3300005530 | Ga0070679_101037549 | Ga0070679_1010375491 | 194 |
| 756 | 3300005535 | Ga0070684_100256907 | Ga0070684_1002569072 | 194 |
| 757 | 3300005539 | Ga0068853_100033849 | Ga0068853_1000338492 | 194 |
| 758 | 3300005543 | Ga0070672_100016698 | Ga0070672_1000166985 | 194 |
| 759 | 3300005546 | Ga0070696_100054405 | Ga0070696_1000544052 | 194 |
| 760 | 3300005546 | Ga0070696_100228743 | Ga0070696_1002287431 | 194 |
| 761 | 3300005549 | Ga0070704_100062631 | Ga0070704_1000626312 | 194 |
| 762 | 3300005549 | Ga0070704_100116708 | Ga0070704_1001167082 | 194 |
| 763 | 3300005563 | Ga0068855_100210590 | Ga0068855_1002105902 | 194 |
| 764 | 3300005564 | Ga0070664_100008005 | Ga0070664_1000080055 | 194 |
| 765 | 3300005564 | Ga0070664_100339964 | Ga0070664_1003399642 | 194 |
| 766 | 3300005577 | Ga0068857_100172348 | Ga0068857_1001723482 | 194 |
| 767 | 3300005577 | Ga0068857_100584840 | Ga0068857_1005848402 | 194 |
| 768 | 3300005615 | Ga0070702_100321205 | Ga0070702_1003212051 | 194 |
| 769 | 3300005718 | Ga0068866_10127992 | Ga0068866_101279922 | 194 |
| 770 | 3300005937 | Ga0081455_10000119 | Ga0081455_1000011947 | 194 |
| 771 | 3300005937 | Ga0081455_10003170 | Ga0081455_100031708 | 194 |
| 772 | 3300005937 | Ga0081455_10004119 | Ga0081455_100041198 | 194 |
| 773 | 3300005937 | Ga0081455_10139075 | Ga0081455_101390752 | 194 |
| 774 | 3300005937 | Ga0081455_10487375 | Ga0081455_104873752 | 194 |
| 775 | 3300005981 | Ga0081538_10055537 | Ga0081538_100555372 | 194 |
| 776 | 3300006186 | Ga0075369_10042153 | Ga0075369_100421532 | 194 |
| 777 | 3300006844 | Ga0075428_100040465 | Ga0075428_1000404653 | 194 |
| 778 | 3300006847 | Ga0075431_100040935 | Ga0075431_1000409352 | 194 |
| 779 | 3300006881 | Ga0068865_100361902 | Ga0068865_1003619022 | 194 |
| 780 | 3300006881 | Ga0068865_101035649 | Ga0068865_1010356491 | 194 |
| 781 | 3300006914 | Ga0075436_100024514 | Ga0075436_1000245143 | 194 |
| 782 | 3300006914 | Ga0075436_100423504 | Ga0075436_1004235041 | 194 |
| 783 | 3300007788 | Ga0099795_10001115 | Ga0099795_100011155 | 194 |
| 784 | 3300009094 | Ga0111539_10002011 | Ga0111539_1000201113 | 194 |
| 785 | 3300009094 | Ga0111539_10179662 | Ga0111539_101796621 | 194 |
| 786 | 3300009147 | Ga0114129_10013291 | Ga0114129_100132913 | 194 |
| 787 | 3300009147 | Ga0114129_10186680 | Ga0114129_101866803 | 194 |
| 788 | 3300009147 | Ga0114129_10384671 | Ga0114129_103846712 | 194 |
| 789 | 3300009147 | Ga0114129_10506256 | Ga0114129_105062561 | 194 |
| 790 | 3300009147 | Ga0114129_11130365 | Ga0114129_111303651 | 194 |
| 791 | 3300009176 | Ga0105242_10776779 | Ga0105242_107767792 | 194 |
| 792 | 3300009176 | Ga0105242_11245096 | Ga0105242_112450962 | 194 |
| 793 | 3300010375 | Ga0105239_10008461 | Ga0105239_100084618 | 194 |
| 794 | 3300011119 | Ga0105246_10292567 | Ga0105246_102925672 | 194 |
| 795 | 3300013104 | Ga0157370_10403493 | Ga0157370_104034931 | 194 |
| 796 | 3300013250 | Ga0171462_1011 | Ga0171462_1011108 | 194 |
| 797 | 3300013296 | Ga0157374_10294597 | Ga0157374_102945972 | 194 |
| 798 | 3300013297 | Ga0157378_10121156 | Ga0157378_101211563 | 194 |
| 799 | 3300013297 | Ga0157378_10577608 | Ga0157378_105776081 | 194 |
| 800 | 3300013308 | Ga0157375_10627423 | Ga0157375_106274232 | 194 |
| 801 | 3300014325 | Ga0163163_10001306 | Ga0163163_100013062 | 194 |
| 802 | 3300014326 | Ga0157380_10026287 | Ga0157380_100262872 | 194 |
| 803 | 3300014745 | Ga0157377_10367727 | Ga0157377_103677271 | 194 |
| 804 | 3300014968 | Ga0157379_10129263 | Ga0157379_101292632 | 194 |
| 805 | 3300015261 | Ga0182006_1109436 | Ga0182006_11094361 | 194 |
| 806 | 3300025291 | Ga0209675_1000957 | Ga0209675_100095711 | 194 |
| 807 | 3300025295 | Ga0209564_1000143 | Ga0209564_1000143110 | 194 |
| 808 | 3300025299 | Ga0209256_1000111 | Ga0209256_100011145 | 194 |
| 809 | 3300025304 | Ga0209257_1048775 | Ga0209257_10487751 | 194 |
| 810 | 3300025315 | Ga0207697_10025775 | Ga0207697_100257752 | 194 |
| 811 | 3300025903 | Ga0207680_10102001 | Ga0207680_101020012 | 194 |
| 812 | 3300025910 | Ga0207684_10054127 | Ga0207684_100541273 | 194 |
| 813 | 3300025911 | Ga0207654_10066580 | Ga0207654_100665802 | 194 |
| 814 | 3300025912 | Ga0207707_10089339 | Ga0207707_100893392 | 194 |
| 815 | 3300025919 | Ga0207657_10042712 | Ga0207657_100427122 | 194 |
| 816 | 3300025920 | Ga0207649_10022079 | Ga0207649_100220793 | 194 |
| 817 | 3300025924 | Ga0207694_10291895 | Ga0207694_102918952 | 194 |
| 818 | 3300025925 | Ga0207650_10002100 | Ga0207650_100021007 | 194 |
| 819 | 3300025929 | Ga0207664_10267410 | Ga0207664_102674102 | 194 |
| 820 | 3300025935 | Ga0207709_10319217 | Ga0207709_103192172 | 194 |
| 821 | 3300025941 | Ga0207711_10287360 | Ga0207711_102873601 | 194 |
| 822 | 3300025944 | Ga0207661_10005842 | Ga0207661_100058422 | 194 |
| 823 | 3300025945 | Ga0207679_10523364 | Ga0207679_105233642 | 194 |
| 824 | 3300026041 | Ga0207639_10022195 | Ga0207639_100221952 | 194 |
| 825 | 3300026067 | Ga0207678_10020352 | Ga0207678_100203522 | 194 |
| 826 | 3300026075 | Ga0207708_10062463 | Ga0207708_100624632 | 194 |
| 827 | 3300026089 | Ga0207648_10432810 | Ga0207648_104328102 | 194 |
| 828 | 3300026116 | Ga0207674_10573474 | Ga0207674_105734741 | 194 |
| 829 | 3300026116 | Ga0207674_10603567 | Ga0207674_106035672 | 194 |
| 830 | 3300027907 | Ga0207428_10018250 | Ga0207428_100182503 | 194 |
| 831 | 3300028381 | Ga0268264_10503933 | Ga0268264_105039332 | 194 |
| 832 | 3300031548 | Ga0307408_100009589 | Ga0307408_1000095895 | 194 |
| 833 | 3300031548 | Ga0307408_100426121 | Ga0307408_1004261211 | 194 |
| 834 | 3300031731 | Ga0307405_10008433 | Ga0307405_100084333 | 194 |
| 835 | 3300031731 | Ga0307405_10372126 | Ga0307405_103721262 | 194 |
| 836 | 3300031824 | Ga0307413_10004713 | Ga0307413_100047134 | 194 |
| 837 | 3300031852 | Ga0307410_10001714 | Ga0307410_100017145 | 194 |
| 838 | 3300031852 | Ga0307410_10009911 | Ga0307410_100099115 | 194 |
| 839 | 3300031852 | Ga0307410_10022097 | Ga0307410_100220973 | 194 |
| 840 | 3300031852 | Ga0307410_10689604 | Ga0307410_106896041 | 194 |
| 841 | 3300031901 | Ga0307406_10011701 | Ga0307406_100117015 | 194 |
| 842 | 3300031901 | Ga0307406_10099027 | Ga0307406_100990272 | 194 |
| 843 | 3300031903 | Ga0307407_10002469 | Ga0307407_100024694 | 194 |
| 844 | 3300031903 | Ga0307407_10003660 | Ga0307407_100036602 | 194 |
| 845 | 3300031903 | Ga0307407_10015910 | Ga0307407_100159104 | 194 |
| 846 | 3300031911 | Ga0307412_10440661 | Ga0307412_104406612 | 194 |
| 847 | 3300031995 | Ga0307409_100000929 | Ga0307409_1000009298 | 194 |
| 848 | 3300031995 | Ga0307409_100005561 | Ga0307409_1000055615 | 194 |
| 849 | 3300031995 | Ga0307409_100015738 | Ga0307409_1000157382 | 194 |
| 850 | 3300032002 | Ga0307416_100009215 | Ga0307416_1000092154 | 194 |
| 851 | 3300032002 | Ga0307416_100014606 | Ga0307416_1000146064 | 194 |
| 852 | 3300032002 | Ga0307416_101709002 | Ga0307416_1017090021 | 194 |
| 853 | 3300032004 | Ga0307414_10012130 | Ga0307414_100121305 | 194 |
| 854 | 3300032004 | Ga0307414_10110349 | Ga0307414_101103492 | 194 |
| 855 | 3300032005 | Ga0307411_10043854 | Ga0307411_100438544 | 194 |
| 856 | 3300032005 | Ga0307411_10129070 | Ga0307411_101290702 | 194 |
| 857 | 3300032005 | Ga0307411_10984723 | Ga0307411_109847232 | 194 |
| 858 | 3300032126 | Ga0307415_100002073 | Ga0307415_1000020736 | 194 |
| 859 | 3300032126 | Ga0307415_100017931 | Ga0307415_1000179312 | 194 |
| 860 | 3300037418 | Ga0395900_0582459 | Ga0395900_0582459_347_943 | 194 |
| 861 | 3300037466 | Ga0395898_0087829 | Ga0395898_0087829_471_1067 | 194 |
| 862 | 3300045051 | Ga0451576_0194241 | Ga0451576_0194241_1015_1602 | 194 |
| 863 | 3300045976 | Ga0466967_0180843 | Ga0466967_0180843_577_1164 | 194 |
| 864 | 3300046539 | Ga0495621_0007307 | Ga0495621_0007307_1186_1773 | 194 |
| 865 | 3300046684 | Ga0495669_0160901 | Ga0495669_0160901_209_793 | 194 |
| 866 | 3300047320 | Ga0495672_0000252 | Ga0495672_0000252_57276_57860 | 194 |
| 867 | 3300048903 | Ga0496100_0354437 | Ga0496100_0354437_11_595 | 194 |
| 868 | 3300048904 | Ga0496101_0070616 | Ga0496101_0070616_1181_1795 | 194 |
| 869 | 3300048904 | Ga0496101_0520546 | Ga0496101_0520546_221_805 | 194 |
| 870 | 3300048904 | Ga0496101_0529270 | Ga0496101_0529270_71_655 | 194 |
| 871 | 3300048905 | Ga0496102_0515282 | Ga0496102_0515282_377_991 | 194 |
| 872 | 3300048905 | Ga0496102_0893884 | Ga0496102_0893884_56_658 | 194 |
| 873 | 3300048907 | Ga0496104_0009713 | Ga0496104_0009713_6595_7179 | 194 |
| 874 | 3300048907 | Ga0496104_0147025 | Ga0496104_0147025_864_1466 | 194 |
| 875 | 3300048908 | Ga0496105_0019247 | Ga0496105_0019247_3688_4272 | 194 |
| 876 | 3300048909 | Ga0496106_0035374 | Ga0496106_0035374_93_707 | 194 |
| 877 | 3300048911 | Ga0496108_0001245 | Ga0496108_0001245_5503_6087 | 194 |
| 878 | 3300048911 | Ga0496108_0188551 | Ga0496108_0188551_943_1527 | 194 |
| 879 | 3300048912 | Ga0496109_0000776 | Ga0496109_0000776_3356_3940 | 194 |
| 880 | 3300048912 | Ga0496109_0164855 | Ga0496109_0164855_1156_1740 | 194 |
| 881 | 3300048913 | Ga0496110_0009842 | Ga0496110_0009842_2770_3354 | 194 |
| 882 | 3300048913 | Ga0496110_0330428 | Ga0496110_0330428_420_1034 | 194 |
| 883 | 3300048914 | Ga0496111_0005089 | Ga0496111_0005089_2398_2982 | 194 |
| 884 | 3300048915 | Ga0496112_0001988 | Ga0496112_0001988_224_808 | 194 |
| 885 | 3300048916 | Ga0496113_0509490 | Ga0496113_0509490_218_802 | 194 |
| 886 | 3300048929 | Ga0496126_0032926 | Ga0496126_0032926_2600_3187 | 194 |
| 887 | 3300049539 | Ga0501323_054010 | Ga0501323_054010_10_597 | 194 |
| 888 | 3300049569 | Ga0501032_0003322 | Ga0501032_0003322_5759_6367 | 194 |
| 889 | 3300049571 | Ga0501034_0000013 | Ga0501034_0000013_217635_218243 | 194 |
| 890 | 3300049572 | Ga0501036_0055583 | Ga0501036_0055583_1343_1927 | 194 |
| 891 | 3300049574 | Ga0501038_0051627 | Ga0501038_0051627_1057_1665 | 194 |
| 892 | 3300049574 | Ga0501038_0263893 | Ga0501038_0263893_433_1032 | 194 |
| 893 | 3300049575 | Ga0501039_0000710 | Ga0501039_0000710_5691_6299 | 194 |
| 894 | 3300049575 | Ga0501039_0070384 | Ga0501039_0070384_723_1322 | 194 |
| 895 | 3300049576 | Ga0501040_0034120 | Ga0501040_0034120_1695_2294 | 194 |
| 896 | 3300049577 | Ga0501041_0013390 | Ga0501041_0013390_3025_3624 | 194 |
| 897 | 3300049578 | Ga0501042_0032369 | Ga0501042_0032369_1555_2139 | 194 |
| 898 | 3300049580 | Ga0501046_0020906 | Ga0501046_0020906_3590_4198 | 194 |
| 899 | 3300049581 | Ga0501047_0000721 | Ga0501047_0000721_15995_16603 | 194 |
| 900 | 3300049583 | Ga0501067_0003660 | Ga0501067_0003660_5290_5898 | 194 |
| 901 | 3300049583 | Ga0501067_0267409 | Ga0501067_0267409_149_733 | 194 |
| 902 | 3300049584 | Ga0501068_0301100 | Ga0501068_0301100_313_912 | 194 |
| 903 | 3300049586 | Ga0501070_0016220 | Ga0501070_0016220_4573_5181 | 194 |
| 904 | 3300049586 | Ga0501070_0886258 | Ga0501070_0886258_68_652 | 194 |
| 905 | 3300049587 | Ga0501071_0165551 | Ga0501071_0165551_943_1527 | 194 |
| 906 | 3300049587 | Ga0501071_0195931 | Ga0501071_0195931_855_1454 | 194 |
| 907 | 3300049588 | Ga0501072_0017019 | Ga0501072_0017019_3826_4425 | 194 |
| 908 | 3300049590 | Ga0501074_0043128 | Ga0501074_0043128_1758_2357 | 194 |
| 909 | 3300049591 | Ga0501075_0003578 | Ga0501075_0003578_1803_2402 | 194 |
| 910 | 3300049592 | Ga0501076_0185538 | Ga0501076_0185538_364_963 | 194 |
| 911 | 3300049592 | Ga0501076_0682761 | Ga0501076_0682761_189_791 | 194 |
| 912 | 3300049593 | Ga0501077_0175178 | Ga0501077_0175178_692_1276 | 194 |
| 913 | 3300049741 | Ga0501079_0014573 | Ga0501079_0014573_2047_2646 | 194 |
| 914 | 3300049741 | Ga0501079_0072552 | Ga0501079_0072552_203_787 | 194 |
| 915 | 3300049741 | Ga0501079_0571708 | Ga0501079_0571708_41_640 | 194 |
| 916 | 3300049742 | Ga0501080_0000003 | Ga0501080_0000003_210165_210773 | 194 |
| 917 | 3300049743 | Ga0501081_0043455 | Ga0501081_0043455_2367_2951 | 194 |
| 918 | 3300049743 | Ga0501081_0167354 | Ga0501081_0167354_160_744 | 194 |
| 919 | 3300049822 | Ga0501035_0000058 | Ga0501035_0000058_53488_54096 | 194 |
| 920 | 3300049822 | Ga0501035_0232151 | Ga0501035_0232151_363_947 | 194 |
| 921 | 3300049823 | Ga0501044_0000023 | Ga0501044_0000023_114903_115511 | 194 |
| 922 | 3300049823 | Ga0501044_0939894 | Ga0501044_0939894_55_639 | 194 |
| 923 | 3300049824 | Ga0501045_0008050 | Ga0501045_0008050_1711_2310 | 194 |
| 924 | 3300049824 | Ga0501045_0104355 | Ga0501045_0104355_1263_1871 | 194 |
| 925 | 3300050507 | nmdc:mga05p37_251440_c1 | nmdc:mga05p37_251440_c1_1334_1918 | 194 |
| 926 | 3300050507 | nmdc:mga05p37_327807_c1 | nmdc:mga05p37_327807_c1_794_1378 | 194 |
| 927 | 3300050510 | nmdc:mga06r32_72884_c1 | nmdc:mga06r32_72884_c1_567_1151 | 194 |
| 928 | 3300050511 | nmdc:mga08y16_44885_c1 | nmdc:mga08y16_44885_c1_649_1287 | 194 |
| 929 | 3300050511 | nmdc:mga08y16_713090_c1 | nmdc:mga08y16_713090_c1_286_870 | 194 |
| 930 | 3300050512 | nmdc:mga0n895_177138_c1 | nmdc:mga0n895_177138_c1_659_1243 | 194 |
| 931 | 3300050512 | nmdc:mga0n895_459499_c1 | nmdc:mga0n895_459499_c1_43_627 | 194 |
| 932 | 3300050514 | nmdc:mga08x19_396707_c1 | nmdc:mga08x19_396707_c1_65_655 | 194 |
| 933 | 3300050514 | nmdc:mga08x19_46448_c1 | nmdc:mga08x19_46448_c1_1279_1866 | 194 |
| 934 | 3300050515 | nmdc:mga0a205_458124_c1 | nmdc:mga0a205_458124_c1_78_662 | 194 |
| 935 | 3300050515 | nmdc:mga0a205_80807_c1 | nmdc:mga0a205_80807_c1_474_1058 | 194 |
| 936 | 3300050516 | nmdc:mga0sz30_5495_c3 | nmdc:mga0sz30_5495_c3_2173_2757 | 194 |
| 937 | 3300054114 | Ga0501084_0115244 | Ga0501084_0115244_670_1254 | 194 |
| 938 | 3300059421 | Ga0590071_000099 | Ga0590071_000099_15481_16083 | 194 |
| 939 | 3300059423 | Ga0590074_004504 | Ga0590074_004504_216_818 | 194 |
| 940 | 3300059424 | Ga0590075_000144 | Ga0590075_000144_11714_12316 | 194 |
| 941 | 3300059424 | Ga0590075_006802 | Ga0590075_006802_262_885 | 194 |
| 942 | 3300059426 | Ga0590077_002229 | Ga0590077_002229_3029_3631 | 194 |
| 943 | 3300060353 | Ga0501082_0014537 | Ga0501082_0014537_1691_2290 | 194 |
| 944 | 3300060353 | Ga0501082_0060235 | Ga0501082_0060235_457_1065 | 194 |
| 945 | 3300060353 | Ga0501082_0175116 | Ga0501082_0175116_935_1519 | 194 |
| 946 | 3300060353 | Ga0501082_0824905 | Ga0501082_0824905_64_648 | 194 |
| 947 | 3300061734 | Ga0530510_0005438 | Ga0530510_0005438_1432_2031 | 194 |
| 948 | 3300061734 | Ga0530510_0042094 | Ga0530510_0042094_1635_2219 | 194 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ryk-assembly1.cif.gz_B | 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound | 0.9702 | 2 | 174 |
| 6c46-assembly3.cif.gz_E-2 | crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase from elizabethkingia anophelis nuhp1 | 0.969 | 1 | 175 |
| 7pvi-assembly1.cif.gz_BBB | dtdp-sugar epimerase | 0.9643 | 2 | 176 |
| 5buv-assembly2.cif.gz_B-2 | x-ray structure of wbca from yersinia enterocolitica | 0.9634 | 2 | 173 |
| 6c46-assembly2.cif.gz_C | crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase from elizabethkingia anophelis nuhp1 | 0.9632 | 1 | 175 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5buvB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9634 | 2 | 173 | 2.60.120.10 |
| 1epzA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9546 | 2 | 176 | 2.60.120.10 |
| 2c0zA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9454 | 1 | 182 | 2.60.120.10 |
| 6dinA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9424 | 2 | 176 | 2.60.120.10 |
| 5buvB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9365 | 2 | 173 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L5FCZ6-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 1.001 | 1 | 187 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A1I7NFN2-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 1.001 | 1 | 187 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A1Q6VP32-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase | 0.9977 | 1 | 145 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A3D5H8T3-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9965 | 1 | 173 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A2Z2P1Z2-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9962 | 1 | 174 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar