F486478

General Info

Members Datasets Scaffolds Average Seq Length
947 297 1894 151

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_101653125|Ga0070667_1016531251
Length 179
Sequence MGGVSGRRDSWESEQRFIFHYLGRREQENMESIGRILLVEDDPKDTELTMTALEEYNLSNEVVVATDGEEALDYLYYRGKFQRRSGENPAVMLLDLKLPKIDGLEVLQRVKADDTLKMIPVVVLTSSREERDMLSSYKLGVNAYVVKPVDFHEFVNAIKELGVFWAIINEAPPGSVRKK

Samples

Sample ID Description Type Environment
1 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
117 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
118 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
121 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
122 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
182 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
183 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
186 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
187 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
188 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
189 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
190 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
191 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
192 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
193 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
194 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
195 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
197 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
201 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
215 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
216 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
217 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
218 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
219 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
224 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
228 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
229 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
230 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
231 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
234 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
235 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
236 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
239 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
240 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
241 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
242 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
243 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
244 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
245 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
248 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
249 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
250 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
251 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
254 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
255 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
256 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
257 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
258 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
261 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
262 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
263 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
264 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
265 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
266 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
267 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
268 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
269 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
270 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
271 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
274 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
275 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
276 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
277 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
280 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
281 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
282 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
283 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
284 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
285 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
286 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
287 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
288 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
291 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
292 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
293 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
295 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
296 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
297 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.42
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0.42
Rhizoplane 5.17
Rhizosphere 91.66
Stem 0
Stem Tuber 0
Unclassified 16.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070667_101653125 3300005367 Unclassified 602
2 SwRhRL2b_contig_162399 2162886007 Unclassified 1089
3 SwRhRL2b_contig_3462230 2162886007 Bacteria 2160
4 JGI25406J46586_10007402 3300003203 Bacteria 5011
5 JGI25406J46586_10037643 3300003203 Bacteria 1741
6 rootH2_10070803 3300003320 Bacteria 6714
7 JGI25404J52841_10001641 3300003659 Bacteria 4007
8 JGI25404J52841_10006600 3300003659 Bacteria 2435
9 JGI25404J52841_10043513 3300003659 Bacteria 949
10 Ga0065704_10014484 3300005289 Bacteria 1819
11 Ga0065704_10086849 3300005289 Bacteria 3079
12 Ga0065704_10219628 3300005289 Bacteria 1079
13 Ga0065704_10516090 3300005289 Bacteria 657
14 Ga0065712_10118679 3300005290 Bacteria 1703
15 Ga0065712_10213512 3300005290 Bacteria 1065
16 Ga0065712_10494833 3300005290 Unclassified 653
17 Ga0065715_10005789 3300005293 Bacteria 3066
18 Ga0065715_10183367 3300005293 Bacteria 1461
19 Ga0065707_10417912 3300005295 Bacteria 834
20 Ga0065707_10691631 3300005295 Bacteria 643
21 Ga0070676_10110576 3300005328 Bacteria 1710
22 Ga0070690_100038547 3300005330 Bacteria 3016
23 Ga0070690_101383741 3300005330 Bacteria 566
24 Ga0070670_100133954 3300005331 Bacteria 2141
25 Ga0070677_10012726 3300005333 Bacteria 2926
26 Ga0068869_100272214 3300005334 Bacteria 1359
27 Ga0070666_10233460 3300005335 Bacteria 1299
28 Ga0070666_10503390 3300005335 Bacteria 878
29 Ga0068868_100074147 3300005338 Bacteria 2717
30 Ga0068868_100863106 3300005338 Unclassified 820
31 Ga0070660_101030356 3300005339 Unclassified 696
32 Ga0070689_100291364 3300005340 Bacteria 1356
33 Ga0070689_101407647 3300005340 Bacteria 630
34 Ga0070689_101434516 3300005340 Bacteria 624
35 Ga0070687_100135125 3300005343 Unclassified 1429
36 Ga0070668_100082648 3300005347 Bacteria 2519
37 Ga0070668_100144076 3300005347 Bacteria 1922
38 Ga0070668_100183428 3300005347 Bacteria 1711
39 Ga0070668_100208258 3300005347 Bacteria 1607
40 Ga0070668_100426221 3300005347 Bacteria 1136
41 Ga0070668_101556847 3300005347 Bacteria 605
42 Ga0070669_100011318 3300005353 Bacteria 6332
43 Ga0070669_100063987 3300005353 Bacteria 2708
44 Ga0070669_100644793 3300005353 Bacteria 891
45 Ga0070675_100147215 3300005354 Unclassified 2017
46 Ga0070675_100460133 3300005354 Bacteria 1142
47 Ga0070671_100019644 3300005355 Bacteria 5501
48 Ga0070671_100196848 3300005355 Unclassified 1708
49 Ga0070671_100503958 3300005355 Bacteria 1041
50 Ga0070671_101189905 3300005355 Unclassified 671
51 Ga0070671_101623219 3300005355 Unclassified 573
52 Ga0070674_100093059 3300005356 Bacteria 2180
53 Ga0070674_100350286 3300005356 Bacteria 1193
54 Ga0070673_100406413 3300005364 Unclassified 1218
55 Ga0070673_100453877 3300005364 Bacteria 1153
56 Ga0070673_101363800 3300005364 Bacteria 667
57 Ga0070688_100379866 3300005365 Bacteria 1041
58 Ga0070659_100051222 3300005366 Bacteria 3246
59 Ga0070667_100121465 3300005367 Bacteria 2272
60 Ga0070667_100744096 3300005367 Unclassified 908
61 Ga0070667_101807034 3300005367 Bacteria 575
62 Ga0070703_10010805 3300005406 Bacteria 2575
63 Ga0070709_10145608 3300005434 Archaea 1632
64 Ga0070709_10223491 3300005434 Unclassified 1344
65 Ga0070709_10378741 3300005434 Bacteria 1051
66 Ga0070709_10451594 3300005434 Bacteria 968
67 Ga0070709_10491900 3300005434 Bacteria 930
68 Ga0070709_10579158 3300005434 Bacteria 862
69 Ga0070709_10613400 3300005434 Bacteria 839
70 Ga0070709_10835507 3300005434 Bacteria 725
71 Ga0070714_100222750 3300005435 Bacteria 1734
72 Ga0070714_100342683 3300005435 Bacteria 1402
73 Ga0070714_100398270 3300005435 Bacteria 1301
74 Ga0070714_100481943 3300005435 Unclassified 1181
75 Ga0070714_100531862 3300005435 Bacteria 1124
76 Ga0070714_100856413 3300005435 Bacteria 881
77 Ga0070713_100048119 3300005436 Bacteria 3509
78 Ga0070713_100069663 3300005436 Bacteria 2967
79 Ga0070713_100147669 3300005436 Bacteria 2088
80 Ga0070713_100184260 3300005436 Bacteria 1878
81 Ga0070713_100234821 3300005436 Bacteria 1668
82 Ga0070713_100382721 3300005436 Bacteria 1311
83 Ga0070710_10062691 3300005437 Bacteria 2121
84 Ga0070710_10168290 3300005437 Bacteria 1364
85 Ga0070710_10279642 3300005437 Bacteria 1082
86 Ga0070710_10455118 3300005437 Bacteria 868
87 Ga0070710_10545756 3300005437 Bacteria 800
88 Ga0070710_10562865 3300005437 Bacteria 789
89 Ga0070710_10661325 3300005437 Bacteria 733
90 Ga0070710_11447407 3300005437 Unclassified 515
91 Ga0070711_100056508 3300005439 Unclassified 2714
92 Ga0070711_100069624 3300005439 Bacteria 2475
93 Ga0070711_100112901 3300005439 Bacteria 1997
94 Ga0070711_100141676 3300005439 Bacteria 1803
95 Ga0070711_100296990 3300005439 Unclassified 1283
96 Ga0070711_100328265 3300005439 Unclassified 1224
97 Ga0070711_100702459 3300005439 Bacteria 852
98 Ga0070711_100740774 3300005439 Unclassified 830
99 Ga0070711_100996384 3300005439 Bacteria 719
100 Ga0070711_101054537 3300005439 Unclassified 699
101 Ga0070711_101200419 3300005439 Bacteria 656
102 Ga0070711_101556899 3300005439 Unclassified 577
103 Ga0070705_100044102 3300005440 Bacteria 2560
104 Ga0070705_100305349 3300005440 Bacteria 1142
105 Ga0070700_100394502 3300005441 Bacteria 1039
106 Ga0070694_100120355 3300005444 Bacteria 1883
107 Ga0070694_100457866 3300005444 Bacteria 1008
108 Ga0070694_100628530 3300005444 Unclassified 867
109 Ga0070694_100660074 3300005444 Bacteria 847
110 Ga0070694_101319832 3300005444 Bacteria 607
111 Ga0070708_100000971 3300005445 Bacteria 21829
112 Ga0070708_100001860 3300005445 Bacteria 16189
113 Ga0070708_100005700 3300005445 Bacteria 9879
114 Ga0070708_100011880 3300005445 Bacteria 7089
115 Ga0070708_100026095 3300005445 Bacteria 4998
116 Ga0070708_100026433 3300005445 Bacteria 4968
117 Ga0070708_100027629 3300005445 Bacteria 4871
118 Ga0070708_100072343 3300005445 Bacteria 3106
119 Ga0070708_100338589 3300005445 Unclassified 1418
120 Ga0070708_100771369 3300005445 Bacteria 904
121 Ga0070708_100810996 3300005445 Bacteria 880
122 Ga0070678_100049801 3300005456 Bacteria 3025
123 Ga0070662_100140067 3300005457 Unclassified 1873
124 Ga0070662_100153046 3300005457 Bacteria 1797
125 Ga0070662_100369040 3300005457 Bacteria 1179
126 Ga0070662_100515310 3300005457 Bacteria 999
127 Ga0068867_100322731 3300005459 Bacteria 1280
128 Ga0068867_101079701 3300005459 Unclassified 732
129 Ga0070706_100002776 3300005467 Bacteria 17502
130 Ga0070706_100011597 3300005467 Bacteria 8190
131 Ga0070706_100015538 3300005467 Bacteria 7032
132 Ga0070706_100022580 3300005467 Bacteria 5793
133 Ga0070706_100029157 3300005467 Bacteria 5085
134 Ga0070706_100030102 3300005467 Bacteria 5000
135 Ga0070706_100038776 3300005467 Bacteria 4397
136 Ga0070706_100070747 3300005467 Bacteria 3226
137 Ga0070706_100115286 3300005467 Bacteria 2502
138 Ga0070706_100171132 3300005467 Bacteria 2028
139 Ga0070706_100391327 3300005467 Bacteria 1294
140 Ga0070706_100463697 3300005467 Bacteria 1179
141 Ga0070706_101573430 3300005467 Bacteria 600
142 Ga0070707_100003475 3300005468 Bacteria 14882
143 Ga0070707_100008920 3300005468 Bacteria 9303
144 Ga0070707_100010656 3300005468 Bacteria 8562
145 Ga0070707_100081332 3300005468 Bacteria 3128
146 Ga0070707_100081934 3300005468 Bacteria 3116
147 Ga0070707_100096226 3300005468 Unclassified 2868
148 Ga0070707_100108480 3300005468 Bacteria 2693
149 Ga0070707_100194545 3300005468 Unclassified 1977
150 Ga0070707_100358621 3300005468 Bacteria 1416
151 Ga0070707_100371192 3300005468 Bacteria 1390
152 Ga0070707_100705010 3300005468 Bacteria 972
153 Ga0070707_101050457 3300005468 Unclassified 780
154 Ga0070698_100003857 3300005471 Bacteria 16495
155 Ga0070698_100009879 3300005471 Bacteria 10202
156 Ga0070698_100010310 3300005471 Bacteria 9973
157 Ga0070698_100033245 3300005471 Bacteria 5342
158 Ga0070698_100037067 3300005471 Bacteria 5029
159 Ga0070698_100058187 3300005471 Bacteria 3908
160 Ga0070698_100086849 3300005471 Bacteria 3114
161 Ga0070698_100093144 3300005471 Bacteria 2993
162 Ga0070698_101759639 3300005471 Bacteria 572
163 Ga0070699_100004403 3300005518 Bacteria 12452
164 Ga0070699_100005458 3300005518 Bacteria 11146
165 Ga0070699_100008636 3300005518 Bacteria 8830
166 Ga0070699_100014100 3300005518 Bacteria 6876
167 Ga0070699_100064946 3300005518 Bacteria 3166
168 Ga0070699_100142200 3300005518 Unclassified 2119
169 Ga0070699_100175684 3300005518 Bacteria 1899
170 Ga0070699_100211924 3300005518 Bacteria 1725
171 Ga0070699_100219529 3300005518 Bacteria 1694
172 Ga0070699_100450234 3300005518 Bacteria 1167
173 Ga0070699_100777438 3300005518 Bacteria 876
174 Ga0070699_101370354 3300005518 Bacteria 649
175 Ga0070697_100000912 3300005536 Bacteria 22233
176 Ga0070697_100004693 3300005536 Bacteria 10477
177 Ga0070697_100015161 3300005536 Bacteria 6052
178 Ga0070697_100040221 3300005536 Bacteria 3781
179 Ga0070697_100063145 3300005536 Bacteria 3024
180 Ga0070697_100080918 3300005536 Unclassified 2676
181 Ga0070697_100129830 3300005536 Bacteria 2113
182 Ga0070697_100175026 3300005536 Bacteria 1817
183 Ga0070697_100192196 3300005536 Unclassified 1733
184 Ga0070697_101111113 3300005536 Bacteria 704
185 Ga0068853_100869279 3300005539 Bacteria 865
186 Ga0068853_101462504 3300005539 Unclassified 661
187 Ga0070672_100110446 3300005543 Bacteria 2240
188 Ga0070672_100270159 3300005543 Bacteria 1436
189 Ga0070695_100212910 3300005545 Bacteria 1388
190 Ga0070695_100285153 3300005545 Bacteria 1215
191 Ga0070696_100023591 3300005546 Bacteria 4181
192 Ga0070696_100187054 3300005546 Bacteria 1539
193 Ga0070696_101551983 3300005546 Bacteria 568
194 Ga0070665_100049262 3300005548 Bacteria 4227
195 Ga0070665_100153658 3300005548 Bacteria 2303
196 Ga0070665_100352967 3300005548 Bacteria 1476
197 Ga0070665_101191950 3300005548 Unclassified 772
198 Ga0070665_101916102 3300005548 Bacteria 598
199 Ga0070704_100192598 3300005549 Bacteria 1640
200 Ga0070704_100238007 3300005549 Bacteria 1489
201 Ga0070704_100386926 3300005549 Unclassified 1190
202 Ga0070704_100941215 3300005549 Bacteria 779
203 Ga0070664_101652142 3300005564 Bacteria 607
204 Ga0068857_100168947 3300005577 Bacteria 1987
205 Ga0068854_100067309 3300005578 Bacteria 2609
206 Ga0068856_100079585 3300005614 Bacteria 3250
207 Ga0068856_100722695 3300005614 Bacteria 1016
208 Ga0068856_100892323 3300005614 Unclassified 908
209 Ga0068856_102201361 3300005614 Bacteria 560
210 Ga0068859_100395832 3300005617 Bacteria 1477
211 Ga0068864_100062192 3300005618 Bacteria 3234
212 Ga0068864_100340165 3300005618 Bacteria 1414
213 Ga0068866_10034297 3300005718 Bacteria 2471
214 Ga0068866_10119620 3300005718 Unclassified 1482
215 Ga0068866_10454058 3300005718 Unclassified 839
216 Ga0068866_11149153 3300005718 Bacteria 558
217 Ga0068861_101227374 3300005719 Unclassified 726
218 Ga0068863_100025734 3300005841 Bacteria 5613
219 Ga0068863_100603335 3300005841 Bacteria 1087
220 Ga0068858_100112541 3300005842 Unclassified 2542
221 Ga0068858_100217214 3300005842 Bacteria 1810
222 Ga0068858_100304726 3300005842 Bacteria 1520
223 Ga0068860_100186507 3300005843 Bacteria 2006
224 Ga0068860_100315873 3300005843 Bacteria 1533
225 Ga0068860_100694017 3300005843 Unclassified 1027
226 Ga0068862_100698465 3300005844 Bacteria 982
227 Ga0081455_10002166 3300005937 Bacteria 23432
228 Ga0081455_10004257 3300005937 Bacteria 16131
229 Ga0081455_10023361 3300005937 Bacteria 5755
230 Ga0081455_10060727 3300005937 Unclassified 3185
231 Ga0081455_10953758 3300005937 Bacteria 532
232 Ga0081538_10065242 3300005981 Bacteria 2052
233 Ga0081540_1000274 3300005983 Bacteria 53893
234 Ga0081540_1001170 3300005983 Bacteria 23013
235 Ga0081540_1001186 3300005983 Bacteria 22817
236 Ga0081540_1001219 3300005983 Bacteria 22458
237 Ga0081540_1005548 3300005983 Bacteria 9402
238 Ga0081540_1011733 3300005983 Bacteria 5832
239 Ga0081540_1014259 3300005983 Bacteria 5104
240 Ga0081540_1016878 3300005983 Bacteria 4546
241 Ga0081540_1017437 3300005983 Bacteria 4445
242 Ga0081540_1020059 3300005983 Bacteria 4035
243 Ga0081540_1020766 3300005983 Bacteria 3936
244 Ga0081540_1021154 3300005983 Bacteria 3885
245 Ga0081540_1022565 3300005983 Bacteria 3715
246 Ga0081540_1024910 3300005983 Bacteria 3459
247 Ga0081540_1027222 3300005983 Bacteria 3243
248 Ga0081540_1030311 3300005983 Bacteria 2998
249 Ga0081540_1035493 3300005983 Bacteria 2673
250 Ga0081540_1050098 3300005983 Bacteria 2077
251 Ga0081540_1067089 3300005983 Bacteria 1678
252 Ga0081540_1072686 3300005983 Bacteria 1583
253 Ga0081540_1072880 3300005983 Bacteria 1580
254 Ga0081540_1086190 3300005983 Unclassified 1396
255 Ga0081540_1119340 3300005983 Bacteria 1098
256 Ga0081540_1171373 3300005983 Bacteria 826
257 Ga0081539_10005162 3300005985 Bacteria 13586
258 Ga0081539_10146088 3300005985 Bacteria 1143
259 Ga0070717_10066571 3300006028 Unclassified 2996
260 Ga0070717_10106845 3300006028 Bacteria 2383
261 Ga0070717_10152356 3300006028 Unclassified 2001
262 Ga0070717_10159262 3300006028 Bacteria 1958
263 Ga0070717_10168610 3300006028 Bacteria 1903
264 Ga0070717_10196344 3300006028 Bacteria 1765
265 Ga0070717_10396280 3300006028 Bacteria 1240
266 Ga0070717_10407212 3300006028 Bacteria 1222
267 Ga0070717_10451002 3300006028 Bacteria 1159
268 Ga0070717_10502420 3300006028 Bacteria 1096
269 Ga0070717_10545873 3300006028 Bacteria 1049
270 Ga0070717_10729829 3300006028 Bacteria 900
271 Ga0070717_10758069 3300006028 Archaea 882
272 Ga0075432_10117609 3300006058 Unclassified 996
273 Ga0070715_10092915 3300006163 Bacteria 1392
274 Ga0070715_10141945 3300006163 Bacteria 1167
275 Ga0070715_10153201 3300006163 Bacteria 1131
276 Ga0070715_10172724 3300006163 Bacteria 1078
277 Ga0070715_10375241 3300006163 Unclassified 783
278 Ga0070715_10424216 3300006163 Bacteria 745
279 Ga0070715_10435658 3300006163 Bacteria 737
280 Ga0070715_10504538 3300006163 Bacteria 693
281 Ga0070716_100012524 3300006173 Unclassified 4301
282 Ga0070716_100109843 3300006173 Unclassified 1707
283 Ga0070716_100146198 3300006173 Bacteria 1515
284 Ga0070716_100154274 3300006173 Bacteria 1481
285 Ga0070716_100195354 3300006173 Bacteria 1340
286 Ga0070716_100386854 3300006173 Unclassified 1001
287 Ga0070716_100552337 3300006173 Bacteria 859
288 Ga0070716_101323619 3300006173 Bacteria 583
289 Ga0070712_100003675 3300006175 Bacteria 9453
290 Ga0070712_100034046 3300006175 Bacteria 3451
291 Ga0070712_100041501 3300006175 Bacteria 3159
292 Ga0070712_100066686 3300006175 Bacteria 2559
293 Ga0070712_100103149 3300006175 Bacteria 2114
294 Ga0070712_100129779 3300006175 Bacteria 1909
295 Ga0070712_100151126 3300006175 Unclassified 1783
296 Ga0070712_100173997 3300006175 Bacteria 1673
297 Ga0070712_100217240 3300006175 Bacteria 1511
298 Ga0070712_100324871 3300006175 Bacteria 1252
299 Ga0070712_100336539 3300006175 Bacteria 1231
300 Ga0070712_100424941 3300006175 Bacteria 1102
301 Ga0070712_100523890 3300006175 Unclassified 996
302 Ga0070712_100873815 3300006175 Bacteria 774
303 Ga0070712_101212547 3300006175 Unclassified 656
304 Ga0070712_101238665 3300006175 Bacteria 649
305 Ga0075369_10106602 3300006186 Bacteria 1261
306 Ga0097621_100055679 3300006237 Bacteria 3230
307 Ga0097621_100075857 3300006237 Bacteria 2788
308 Ga0097621_100138052 3300006237 Bacteria 2081
309 Ga0097621_101507438 3300006237 Bacteria 638
310 Ga0068871_100052415 3300006358 Bacteria 3304
311 Ga0068871_100248297 3300006358 Bacteria 1549
312 Ga0075428_100062433 3300006844 Bacteria 4079
313 Ga0075428_100070023 3300006844 Bacteria 3835
314 Ga0075428_100418777 3300006844 Bacteria 1435
315 Ga0075428_100595741 3300006844 Unclassified 1181
316 Ga0075430_100149544 3300006846 Unclassified 1945
317 Ga0075430_100779114 3300006846 Bacteria 788
318 Ga0075431_100089152 3300006847 Bacteria 3184
319 Ga0075431_100093575 3300006847 Bacteria 3101
320 Ga0075431_100121530 3300006847 Bacteria 2695
321 Ga0075431_100169831 3300006847 Unclassified 2241
322 Ga0075431_100313889 3300006847 Bacteria 1582
323 Ga0075433_10003365 3300006852 Bacteria 12358
324 Ga0075433_10053500 3300006852 Bacteria 3520
325 Ga0075433_10059949 3300006852 Bacteria 3331
326 Ga0075433_10083774 3300006852 Bacteria 2815
327 Ga0075433_10087979 3300006852 Bacteria 2744
328 Ga0075433_10181658 3300006852 Bacteria 1872
329 Ga0075433_10181755 3300006852 Unclassified 1872
330 Ga0075433_10213816 3300006852 Unclassified 1713
331 Ga0075433_10312818 3300006852 Bacteria 1390
332 Ga0075433_10315227 3300006852 Unclassified 1384
333 Ga0075433_10374673 3300006852 Bacteria 1257
334 Ga0075433_10712773 3300006852 Unclassified 878
335 Ga0075433_11112397 3300006852 Bacteria 687
336 Ga0075434_100001766 3300006871 Bacteria 18605
337 Ga0075434_100015836 3300006871 Bacteria 7240
338 Ga0075434_100018327 3300006871 Bacteria 6761
339 Ga0075434_100068481 3300006871 Bacteria 3536
340 Ga0075434_100093529 3300006871 Bacteria 3010
341 Ga0075434_100119133 3300006871 Bacteria 2654
342 Ga0075434_100169991 3300006871 Unclassified 2200
343 Ga0075434_100292593 3300006871 Bacteria 1649
344 Ga0075434_100294632 3300006871 Bacteria 1642
345 Ga0075434_100433828 3300006871 Unclassified 1335
346 Ga0075434_100776368 3300006871 Bacteria 975
347 Ga0075434_101256886 3300006871 Unclassified 752
348 Ga0075434_101506973 3300006871 Unclassified 682
349 Ga0075429_100017829 3300006880 Bacteria 6140
350 Ga0075429_100143086 3300006880 Bacteria 2093
351 Ga0075429_100233336 3300006880 Bacteria 1612
352 Ga0068865_100256160 3300006881 Bacteria 1383
353 Ga0068865_100267547 3300006881 Unclassified 1356
354 Ga0068865_100521302 3300006881 Bacteria 994
355 Ga0075436_100002734 3300006914 Bacteria 12129
356 Ga0097620_100395896 3300006931 Bacteria 1477
357 Ga0075435_100002599 3300007076 Bacteria 12049
358 Ga0075435_100013757 3300007076 Bacteria 6031
359 Ga0075435_100221741 3300007076 Bacteria 1606
360 Ga0075435_100287568 3300007076 Bacteria 1404
361 Ga0075435_100661504 3300007076 Bacteria 907
362 Ga0099794_10014777 3300007265 Bacteria 3429
363 Ga0099794_10016752 3300007265 Bacteria 3255
364 Ga0099794_10031383 3300007265 Bacteria 2487
365 Ga0099794_10130391 3300007265 Bacteria 1269
366 Ga0099794_10250373 3300007265 Unclassified 913
367 Ga0099794_10370041 3300007265 Unclassified 747
368 Ga0099794_10473012 3300007265 Bacteria 658
369 Ga0099795_10007844 3300007788 Bacteria 3008
370 Ga0099795_10033119 3300007788 Bacteria 1792
371 Ga0099795_10069764 3300007788 Bacteria 1323
372 Ga0099795_10188908 3300007788 Unclassified 864
373 Ga0099795_10210610 3300007788 Bacteria 823
374 Ga0099795_10226019 3300007788 Bacteria 798
375 Ga0099795_10426778 3300007788 Bacteria 606
376 Ga0105250_10274500 3300009092 Bacteria 724
377 Ga0105240_10843338 3300009093 Bacteria 990
378 Ga0105240_12111331 3300009093 Bacteria 585
379 Ga0111539_10025878 3300009094 Bacteria 7183
380 Ga0111539_10262721 3300009094 Bacteria 2009
381 Ga0111539_10540594 3300009094 Bacteria 1357
382 Ga0111539_10665917 3300009094 Bacteria 1212
383 Ga0111539_11090960 3300009094 Unclassified 928
384 Ga0111539_12241781 3300009094 Bacteria 634
385 Ga0105245_10165405 3300009098 Bacteria 2102
386 Ga0105245_10410678 3300009098 Bacteria 1355
387 Ga0105247_10124730 3300009101 Bacteria 1672
388 Ga0105247_10219615 3300009101 Bacteria 1286
389 Ga0114129_10009498 3300009147 Bacteria 13869
390 Ga0114129_10036674 3300009147 Bacteria 6922
391 Ga0114129_10050125 3300009147 Bacteria 5865
392 Ga0114129_10111814 3300009147 Bacteria 3768
393 Ga0114129_10117150 3300009147 Bacteria 3671
394 Ga0114129_10136428 3300009147 Bacteria 3366
395 Ga0114129_10182508 3300009147 Bacteria 2854
396 Ga0114129_10280802 3300009147 Bacteria 2225
397 Ga0114129_10720642 3300009147 Bacteria 1280
398 Ga0114129_11361858 3300009147 Unclassified 877
399 Ga0105243_10262617 3300009148 Unclassified 1546
400 Ga0105243_10312357 3300009148 Bacteria 1429
401 Ga0105243_10350145 3300009148 Bacteria 1356
402 Ga0105241_11126429 3300009174 Bacteria 740
403 Ga0105242_10045067 3300009176 Bacteria 3573
404 Ga0105242_10138903 3300009176 Bacteria 2106
405 Ga0105242_10347182 3300009176 Unclassified 1369
406 Ga0105242_10510499 3300009176 Unclassified 1145
407 Ga0105248_10022335 3300009177 Bacteria 7017
408 Ga0105248_10026151 3300009177 Bacteria 6493
409 Ga0105248_10050165 3300009177 Unclassified 4680
410 Ga0105248_10172157 3300009177 Bacteria 2440
411 Ga0105248_11569462 3300009177 Bacteria 745
412 Ga0105237_10271956 3300009545 Bacteria 1697
413 Ga0105238_10033956 3300009551 Bacteria 5190
414 Ga0105249_10437272 3300009553 Bacteria 1345
415 Ga0099796_10012348 3300010159 Bacteria 2409
416 Ga0099796_10036083 3300010159 Bacteria 1644
417 Ga0099796_10049470 3300010159 Unclassified 1453
418 Ga0099796_10092473 3300010159 Bacteria 1126
419 Ga0099796_10242041 3300010159 Bacteria 746
420 Ga0105239_10092278 3300010375 Bacteria 3343
421 Ga0105239_10268854 3300010375 Bacteria 1917
422 Ga0105239_10691771 3300010375 Bacteria 1166
423 Ga0105239_10843951 3300010375 Bacteria 1050
424 Ga0105246_10278587 3300011119 Bacteria 1340
425 Ga0157371_10110344 3300013102 Bacteria 1953
426 Ga0157374_10101100 3300013296 Unclassified 2764
427 Ga0157374_10171600 3300013296 Bacteria 2116
428 Ga0157374_10244499 3300013296 Unclassified 1765
429 Ga0157374_10284931 3300013296 Unclassified 1631
430 Ga0157374_11394292 3300013296 Bacteria 723
431 Ga0157378_10105485 3300013297 Unclassified 2577
432 Ga0157378_10243938 3300013297 Bacteria 1717
433 Ga0157378_10536859 3300013297 Bacteria 1173
434 Ga0157378_10864266 3300013297 Bacteria 933
435 Ga0157378_11042848 3300013297 Unclassified 853
436 Ga0157378_12112762 3300013297 Unclassified 614
437 Ga0157378_12221317 3300013297 Bacteria 600
438 Ga0157378_12453989 3300013297 Bacteria 573
439 Ga0163162_10000828 3300013306 Bacteria 28789
440 Ga0163162_10030176 3300013306 Bacteria 5372
441 Ga0163162_10090422 3300013306 Bacteria 3142
442 Ga0163162_10422581 3300013306 Bacteria 1465
443 Ga0163162_10663610 3300013306 Bacteria 1166
444 Ga0163162_10715791 3300013306 Bacteria 1122
445 Ga0163162_11026438 3300013306 Bacteria 933
446 Ga0163162_11380601 3300013306 Unclassified 801
447 Ga0163162_12122218 3300013306 Unclassified 645
448 Ga0157372_10169175 3300013307 Bacteria 2528
449 Ga0157372_11429767 3300013307 Bacteria 797
450 Ga0157375_10140886 3300013308 Bacteria 2538
451 Ga0157375_10290804 3300013308 Bacteria 1797
452 Ga0157375_11357277 3300013308 Bacteria 837
453 Ga0163163_10001511 3300014325 Bacteria 19652
454 Ga0163163_10536606 3300014325 Bacteria 1232
455 Ga0157380_10950857 3300014326 Bacteria 889
456 Ga0157377_10158643 3300014745 Bacteria 1405
457 Ga0157379_10176544 3300014968 Unclassified 1929
458 Ga0157379_10556619 3300014968 Unclassified 1067
459 Ga0157376_10043108 3300014969 Unclassified 3702
460 Ga0157376_10311990 3300014969 Unclassified 1492
461 Ga0157376_10676428 3300014969 Bacteria 1035
462 Ga0157376_11192804 3300014969 Unclassified 789
463 Ga0163161_10012430 3300017792 Bacteria 5911
464 Ga0163161_10194990 3300017792 Bacteria 1559
465 Ga0213873_10004412 3300021358 Bacteria 2623
466 Ga0213873_10057745 3300021358 Bacteria 1043
467 Ga0213873_10237837 3300021358 Bacteria 574
468 Ga0213872_10000291 3300021361 Bacteria 42812
469 Ga0213872_10001618 3300021361 Bacteria 14259
470 Ga0213872_10002167 3300021361 Bacteria 11765
471 Ga0213872_10008035 3300021361 Bacteria 5130
472 Ga0213872_10020777 3300021361 Bacteria 3026
473 Ga0213872_10049642 3300021361 Unclassified 1906
474 Ga0213872_10054849 3300021361 Bacteria 1807
475 Ga0213872_10118946 3300021361 Bacteria 1169
476 Ga0213872_10127065 3300021361 Bacteria 1125
477 Ga0213872_10145720 3300021361 Bacteria 1037
478 Ga0213872_10166712 3300021361 Bacteria 956
479 Ga0213872_10205478 3300021361 Bacteria 843
480 Ga0213872_10257715 3300021361 Bacteria 733
481 Ga0213874_10011745 3300021377 Bacteria 2228
482 Ga0213876_10006962 3300021384 Bacteria 6163
483 Ga0213876_10088903 3300021384 Bacteria 1636
484 Ga0213875_10000009 3300021388 Bacteria 451129
485 Ga0213875_10044566 3300021388 Bacteria 2083
486 Ga0213875_10073425 3300021388 Bacteria 1596
487 Ga0213871_10003845 3300021441 Bacteria 2944
488 Ga0213871_10016975 3300021441 Unclassified 1762
489 Ga0213871_10025656 3300021441 Bacteria 1502
490 Ga0213871_10036996 3300021441 Bacteria 1297
491 Ga0213871_10078704 3300021441 Bacteria 942
492 Ga0207666_1007382 3300025271 Bacteria 1446
493 Ga0207673_1008193 3300025290 Bacteria 1321
494 Ga0207697_10001495 3300025315 Bacteria 12722
495 Ga0207697_10004417 3300025315 Bacteria 6725
496 Ga0207697_10036516 3300025315 Bacteria 2012
497 Ga0207653_10018128 3300025885 Bacteria 2217
498 Ga0207682_10017256 3300025893 Bacteria 2818
499 Ga0207692_10043062 3300025898 Bacteria 2244
500 Ga0207692_10262650 3300025898 Bacteria 1038
501 Ga0207692_10635794 3300025898 Bacteria 688
502 Ga0207692_10645306 3300025898 Bacteria 684
503 Ga0207692_10768984 3300025898 Bacteria 628
504 Ga0207642_10033702 3300025899 Bacteria 2169
505 Ga0207642_10104365 3300025899 Unclassified 1430
506 Ga0207642_10218688 3300025899 Bacteria 1063
507 Ga0207642_10772414 3300025899 Bacteria 610
508 Ga0207688_10014427 3300025901 Bacteria 4295
509 Ga0207680_10081370 3300025903 Bacteria 2036
510 Ga0207680_10262340 3300025903 Bacteria 1196
511 Ga0207647_10081396 3300025904 Unclassified 1940
512 Ga0207647_10556326 3300025904 Unclassified 636
513 Ga0207685_10022575 3300025905 Bacteria 2129
514 Ga0207685_10023939 3300025905 Unclassified 2086
515 Ga0207685_10057411 3300025905 Bacteria 1527
516 Ga0207685_10170841 3300025905 Bacteria 1000
517 Ga0207699_10053395 3300025906 Bacteria 2396
518 Ga0207699_10128504 3300025906 Bacteria 1649
519 Ga0207699_10306512 3300025906 Bacteria 1110
520 Ga0207699_10546027 3300025906 Bacteria 840
521 Ga0207699_10591479 3300025906 Unclassified 807
522 Ga0207684_10000307 3300025910 Bacteria 69402
523 Ga0207684_10000963 3300025910 Bacteria 32275
524 Ga0207684_10001085 3300025910 Bacteria 30497
525 Ga0207684_10017145 3300025910 Bacteria 6216
526 Ga0207684_10017588 3300025910 Bacteria 6131
527 Ga0207684_10062004 3300025910 Bacteria 3175
528 Ga0207684_10159624 3300025910 Bacteria 1941
529 Ga0207684_10164161 3300025910 Bacteria 1913
530 Ga0207684_10203351 3300025910 Bacteria 1708
531 Ga0207684_10224872 3300025910 Bacteria 1620
532 Ga0207684_10378989 3300025910 Bacteria 1217
533 Ga0207654_10141120 3300025911 Bacteria 1536
534 Ga0207671_10255750 3300025914 Bacteria 1377
535 Ga0207671_11044558 3300025914 Unclassified 643
536 Ga0207693_10002961 3300025915 Bacteria 14698
537 Ga0207693_10016192 3300025915 Bacteria 5962
538 Ga0207693_10026523 3300025915 Bacteria 4586
539 Ga0207693_10027143 3300025915 Bacteria 4528
540 Ga0207693_10031472 3300025915 Bacteria 4192
541 Ga0207693_10104502 3300025915 Bacteria 2221
542 Ga0207693_10117994 3300025915 Bacteria 2084
543 Ga0207693_10134243 3300025915 Bacteria 1946
544 Ga0207693_10139172 3300025915 Bacteria 1909
545 Ga0207693_10147645 3300025915 Bacteria 1849
546 Ga0207693_10161076 3300025915 Bacteria 1765
547 Ga0207693_10180851 3300025915 Bacteria 1659
548 Ga0207693_10253632 3300025915 Unclassified 1380
549 Ga0207693_10604105 3300025915 Bacteria 854
550 Ga0207663_10005805 3300025916 Bacteria 6254
551 Ga0207663_10018499 3300025916 Bacteria 3906
552 Ga0207663_10058651 3300025916 Bacteria 2431
553 Ga0207663_10138394 3300025916 Bacteria 1693
554 Ga0207663_10269735 3300025916 Unclassified 1260
555 Ga0207663_10278462 3300025916 Unclassified 1242
556 Ga0207663_10375214 3300025916 Bacteria 1082
557 Ga0207663_10667207 3300025916 Unclassified 821
558 Ga0207663_11111884 3300025916 Bacteria 635
559 Ga0207657_10254857 3300025919 Bacteria 1398
560 Ga0207657_10486920 3300025919 Bacteria 967
561 Ga0207657_10939957 3300025919 Unclassified 665
562 Ga0207646_10000473 3300025922 Bacteria 53710
563 Ga0207646_10002115 3300025922 Bacteria 23786
564 Ga0207646_10011772 3300025922 Bacteria 8450
565 Ga0207646_10085100 3300025922 Unclassified 2829
566 Ga0207646_10112038 3300025922 Bacteria 2449
567 Ga0207646_10128315 3300025922 Bacteria 2281
568 Ga0207646_10291907 3300025922 Unclassified 1473
569 Ga0207646_10535700 3300025922 Bacteria 1053
570 Ga0207646_10581685 3300025922 Bacteria 1006
571 Ga0207646_11586114 3300025922 Bacteria 565
572 Ga0207681_10207744 3300025923 Unclassified 1507
573 Ga0207681_10281477 3300025923 Bacteria 1310
574 Ga0207681_10378776 3300025923 Bacteria 1139
575 Ga0207694_10087467 3300025924 Bacteria 2455
576 Ga0207694_10179280 3300025924 Bacteria 1717
577 Ga0207659_10040824 3300025926 Unclassified 3247
578 Ga0207659_10052865 3300025926 Bacteria 2895
579 Ga0207687_10205117 3300025927 Bacteria 1543
580 Ga0207700_10029548 3300025928 Bacteria 3869
581 Ga0207700_10034181 3300025928 Bacteria 3647
582 Ga0207700_10195408 3300025928 Unclassified 1702
583 Ga0207700_10258016 3300025928 Bacteria 1491
584 Ga0207700_10323469 3300025928 Bacteria 1337
585 Ga0207700_10449811 3300025928 Bacteria 1135
586 Ga0207700_10559835 3300025928 Unclassified 1015
587 Ga0207664_10228075 3300025929 Bacteria 1618
588 Ga0207664_10663333 3300025929 Bacteria 938
589 Ga0207664_11022033 3300025929 Bacteria 740
590 Ga0207644_10008564 3300025931 Bacteria 6691
591 Ga0207644_10012105 3300025931 Bacteria 5722
592 Ga0207690_10484404 3300025932 Bacteria 999
593 Ga0207690_10896760 3300025932 Unclassified 735
594 Ga0207706_10102721 3300025933 Unclassified 2515
595 Ga0207706_10120223 3300025933 Unclassified 2309
596 Ga0207706_10279189 3300025933 Bacteria 1457
597 Ga0207706_10537863 3300025933 Bacteria 1007
598 Ga0207686_10172840 3300025934 Bacteria 1525
599 Ga0207709_11292000 3300025935 Bacteria 603
600 Ga0207670_10171421 3300025936 Bacteria 1627
601 Ga0207670_10204707 3300025936 Bacteria 1501
602 Ga0207670_11291292 3300025936 Bacteria 619
603 Ga0207669_10004663 3300025937 Bacteria 6058
604 Ga0207669_10697313 3300025937 Unclassified 834
605 Ga0207704_10467301 3300025938 Bacteria 1010
606 Ga0207665_10016505 3300025939 Bacteria 4849
607 Ga0207665_10042741 3300025939 Bacteria 3029
608 Ga0207665_10044594 3300025939 Bacteria 2967
609 Ga0207665_10117862 3300025939 Bacteria 1873
610 Ga0207665_10183082 3300025939 Bacteria 1518
611 Ga0207665_10245139 3300025939 Bacteria 1322
612 Ga0207665_10339103 3300025939 Unclassified 1132
613 Ga0207665_10501645 3300025939 Bacteria 937
614 Ga0207665_11054586 3300025939 Bacteria 647
615 Ga0207691_10047944 3300025940 Bacteria 3918
616 Ga0207691_10201040 3300025940 Bacteria 1734
617 Ga0207711_10013184 3300025941 Bacteria 6866
618 Ga0207711_10104549 3300025941 Unclassified 2509
619 Ga0207711_10695155 3300025941 Bacteria 948
620 Ga0207689_10637165 3300025942 Unclassified 898
621 Ga0207679_11360700 3300025945 Bacteria 651
622 Ga0207651_10138834 3300025960 Bacteria 1874
623 Ga0207712_10332521 3300025961 Bacteria 1257
624 Ga0207712_10333174 3300025961 Bacteria 1256
625 Ga0207712_11581039 3300025961 Unclassified 588
626 Ga0207668_10740279 3300025972 Bacteria 867
627 Ga0207640_10223039 3300025981 Bacteria 1444
628 Ga0207658_10062423 3300025986 Bacteria 2788
629 Ga0207658_11288786 3300025986 Unclassified 668
630 Ga0207677_10078796 3300026023 Bacteria 2354
631 Ga0207677_10628606 3300026023 Unclassified 945
632 Ga0207703_10030517 3300026035 Bacteria 4261
633 Ga0207703_10082659 3300026035 Bacteria 2681
634 Ga0207703_10092403 3300026035 Unclassified 2547
635 Ga0207703_11545322 3300026035 Bacteria 638
636 Ga0207639_10266746 3300026041 Bacteria 1500
637 Ga0207639_11928638 3300026041 Bacteria 552
638 Ga0207702_10208374 3300026078 Bacteria 1816
639 Ga0207641_10018664 3300026088 Bacteria 5686
640 Ga0207641_10422824 3300026088 Bacteria 1283
641 Ga0207648_11184064 3300026089 Unclassified 718
642 Ga0207676_10046292 3300026095 Bacteria 3365
643 Ga0207676_10429952 3300026095 Bacteria 1240
644 Ga0207675_100279801 3300026118 Unclassified 1621
645 Ga0207675_100771742 3300026118 Unclassified 973
646 Ga0207675_101607427 3300026118 Bacteria 670
647 Ga0207683_10039513 3300026121 Unclassified 4117
648 Ga0209179_1007053 3300027512 Bacteria 1840
649 Ga0209179_1074987 3300027512 Bacteria 743
650 Ga0209179_1121463 3300027512 Bacteria 583
651 Ga0209588_1002288 3300027671 Bacteria 5181
652 Ga0209588_1034185 3300027671 Bacteria 1632
653 Ga0209588_1055360 3300027671 Bacteria 1282
654 Ga0207428_10479592 3300027907 Bacteria 905
655 Ga0265356_1021865 3300028017 Bacteria 692
656 Ga0268266_10025225 3300028379 Bacteria 5061
657 Ga0268266_10154379 3300028379 Bacteria 2072
658 Ga0268265_10734490 3300028380 Bacteria 957
659 Ga0268265_11319829 3300028380 Bacteria 722
660 Ga0268264_10282811 3300028381 Bacteria 1555
661 Ga0265336_10074990 3300028666 Bacteria 1011
662 Ga0265338_10000664 3300028800 Bacteria 59474
663 Ga0265762_1001818 3300030760 Bacteria 3877
664 Ga0265760_10117304 3300031090 Bacteria 852
665 Ga0265760_10165015 3300031090 Unclassified 733
666 Ga0265330_10178324 3300031235 Bacteria 900
667 Ga0265332_10392082 3300031238 Bacteria 573
668 Ga0265339_10116331 3300031249 Bacteria 1379
669 Ga0265331_10086463 3300031250 Bacteria 1452
670 Ga0265316_10003561 3300031344 Bacteria 15702
671 Ga0373926_0069694 3300035083 Bacteria 1291
672 Ga0373928_0157535 3300035084 Unclassified 633
673 Ga0373928_0271872 3300035084 Unclassified 511
674 Ga0373940_0001449 3300035088 Bacteria 4296
675 Ga0373940_0218818 3300035088 Unclassified 632
676 Ga0373949_0059258 3300035090 Bacteria 982
677 Ga0373932_0336817 3300035112 Bacteria 571
678 Ga0373936_0225725 3300035113 Bacteria 832
679 Ga0373939_0134195 3300035114 Bacteria 886
680 Ga0373941_0101883 3300035115 Bacteria 1001
681 Ga0373943_0048157 3300035170 Bacteria 2087
682 Ga0373946_0060168 3300035171 Bacteria 1614
683 Ga0373961_0087195 3300035241 Bacteria 991
684 Ga0373962_0014443 3300035242 Bacteria 2013
685 Ga0373931_0035495 3300035691 Bacteria 2593
686 Ga0373931_0095031 3300035691 Bacteria 1667
687 Ga0373931_1097784 3300035691 Bacteria 542
688 Ga0373935_0137380 3300035692 Bacteria 1648
689 Ga0373935_0339009 3300035692 Bacteria 1070
690 Ga0373927_0033074 3300035695 Bacteria 3367
691 Ga0373927_0139516 3300035695 Unclassified 1585
692 Ga0373947_0423204 3300035725 Bacteria 900
693 Ga0373925_0221684 3300037068 Bacteria 1510
694 Ga0373925_0459253 3300037068 Bacteria 1043
695 Ga0395899_0054389 3300037312 Bacteria 2962
696 Ga0395900_0024150 3300037418 Bacteria 6223
697 Ga0395905_0009538 3300037471 Bacteria 9482
698 Ga0436364_0360426 3300037853 Bacteria 2286
699 Ga0436364_1232970 3300037853 Bacteria 3071
700 Ga0436364_1234816 3300037853 Bacteria 881
701 Ga0436364_1345244 3300037853 Bacteria 104196
702 Ga0395901_0010547 3300038443 Bacteria 9360
703 Ga0395901_0745932 3300038443 Bacteria 973
704 Ga0242420_018012 3300038996 Bacteria 1241
705 Ga0436365_0031849 3300039437 Bacteria 47942
706 Ga0436365_1926630 3300039437 Unclassified 566
707 Ga0436360_0105093 3300039438 Unclassified 1721
708 Ga0436360_0174776 3300039438 Unclassified 1978
709 Ga0436360_0217230 3300039438 Bacteria 1536
710 Ga0436360_0274074 3300039438 Bacteria 3264
711 Ga0436360_0473411 3300039438 Bacteria 960
712 Ga0436360_0523309 3300039438 Bacteria 1635
713 Ga0436360_0542945 3300039438 Bacteria 1047
714 Ga0436360_0585007 3300039438 Bacteria 804
715 Ga0436360_0602216 3300039438 Bacteria 1755
716 Ga0436360_0709329 3300039438 Bacteria 1885
717 Ga0436360_0739987 3300039438 Bacteria 1318
718 Ga0436360_0766331 3300039438 Bacteria 1202
719 Ga0436360_0816207 3300039438 Unclassified 721
720 Ga0436360_0887015 3300039438 Bacteria 736
721 Ga0436360_0924144 3300039438 Bacteria 3731
722 Ga0436360_0932956 3300039438 Bacteria 1118
723 Ga0436360_0972474 3300039438 Bacteria 1129
724 Ga0436360_1041569 3300039438 Bacteria 8568
725 Ga0436360_1194108 3300039438 Bacteria 627
726 Ga0436360_1254225 3300039438 Bacteria 1367
727 Ga0436360_1284602 3300039438 Bacteria 884
728 Ga0436360_1316349 3300039438 Bacteria 1151
729 Ga0436361_0010635 3300039447 Bacteria 60260
730 Ga0436361_0015843 3300039447 Bacteria 1216
731 Ga0436361_0036117 3300039447 Bacteria 4667
732 Ga0436361_0157559 3300039447 Bacteria 4429
733 Ga0436361_0193641 3300039447 Bacteria 3974
734 Ga0436361_0199943 3300039447 Bacteria 1058
735 Ga0436361_0272690 3300039447 Bacteria 1218
736 Ga0436361_0368868 3300039447 Bacteria 2875
737 Ga0436361_0416882 3300039447 Bacteria 8440
738 Ga0436361_0422674 3300039447 Bacteria 1641
739 Ga0436361_0446619 3300039447 Bacteria 1774
740 Ga0436361_0536693 3300039447 Bacteria 1379
741 Ga0436361_0597403 3300039447 Bacteria 1967
742 Ga0436361_0630139 3300039447 Bacteria 773
743 Ga0436361_0785610 3300039447 Bacteria 6298
744 Ga0436361_0819616 3300039447 Bacteria 3187
745 Ga0436361_0838894 3300039447 Bacteria 2868
746 Ga0436361_0853453 3300039447 Bacteria 3825
747 Ga0436361_0868468 3300039447 Bacteria 1137
748 Ga0436361_0883425 3300039447 Bacteria 22647
749 Ga0436361_0956533 3300039447 Unclassified 1012
750 Ga0436361_1047932 3300039447 Bacteria 2134
751 Ga0436361_1069074 3300039447 Unclassified 1668
752 Ga0436361_1092601 3300039447 Bacteria 2419
753 Ga0436361_1170242 3300039447 Bacteria 1146
754 Ga0436361_1179758 3300039447 Bacteria 1680
755 Ga0436363_0015942 3300039450 Bacteria 2778
756 Ga0436363_0508122 3300039450 Bacteria 1347
757 Ga0436363_0696908 3300039450 Bacteria 5670
758 Ga0436363_1002413 3300039450 Bacteria 1404
759 Ga0436363_1684865 3300039450 Bacteria 629
760 Ga0436362_0013501 3300039453 Bacteria 1251
761 Ga0436362_0054836 3300039453 Bacteria 2437
762 Ga0436362_0430029 3300039453 Bacteria 5218
763 Ga0436362_0720445 3300039453 Bacteria 951
764 Ga0436362_0838583 3300039453 Bacteria 615
765 Ga0436362_0858769 3300039453 Bacteria 1367
766 Ga0436362_1047880 3300039453 Bacteria 1469
767 Ga0436362_1104889 3300039453 Unclassified 859
768 Ga0453683_0309206 3300044673 Bacteria 1012
769 Ga0453683_0623229 3300044673 Bacteria 704
770 Ga0453683_1175436 3300044673 Unclassified 513
771 Ga0453684_0164716 3300044712 Bacteria 2618
772 Ga0453684_2562475 3300044712 Bacteria 502
773 Ga0466957_0197105 3300044842 Bacteria 1321
774 Ga0451576_0375546 3300045051 Unclassified 1490
775 Ga0466967_1113382 3300045976 Bacteria 787
776 Ga0495603_0124991 3300046455 Bacteria 1499
777 Ga0495641_0037002 3300046461 Bacteria 2290
778 Ga0495580_0219701 3300046472 Bacteria 1306
779 Ga0495580_0596255 3300046472 Bacteria 730
780 Ga0495582_0634223 3300046473 Bacteria 618
781 Ga0495605_0039929 3300046474 Bacteria 2348
782 Ga0495639_0038970 3300046475 Bacteria 2136
783 Ga0495584_0076038 3300046491 Bacteria 1689
784 Ga0495585_0226826 3300046492 Bacteria 940
785 Ga0495607_0101339 3300046501 Bacteria 1542
786 Ga0495628_0282616 3300046516 Bacteria 1232
787 Ga0495631_0110898 3300046518 Bacteria 1180
788 Ga0495637_0093372 3300046520 Bacteria 1184
789 Ga0495644_0299129 3300046523 Bacteria 629
790 Ga0495642_0047885 3300046528 Bacteria 1752
791 Ga0495652_0136498 3300046529 Bacteria 1935
792 Ga0495598_0442608 3300046537 Bacteria 513
793 Ga0495633_0044226 3300046558 Bacteria 2111
794 Ga0495656_0027070 3300046615 Bacteria 2288
795 Ga0495668_0390728 3300046616 Bacteria 764
796 Ga0495661_0249272 3300046665 Bacteria 907
797 Ga0495661_0274620 3300046665 Bacteria 852
798 Ga0495588_0148397 3300046674 Bacteria 1239
799 Ga0495657_0040397 3300046675 Bacteria 3200
800 Ga0495647_0430860 3300046681 Bacteria 609
801 Ga0495658_0591667 3300046683 Bacteria 711
802 Ga0495669_0286068 3300046684 Bacteria 794
803 Ga0495671_0319492 3300046692 Bacteria 746
804 Ga0495589_0188776 3300046794 Bacteria 976
805 Ga0495660_0406902 3300046810 Bacteria 595
806 Ga0495636_0278822 3300047318 Bacteria 778
807 Ga0495674_0311737 3300047319 Bacteria 1284
808 Ga0495672_0398566 3300047320 Bacteria 630
809 Ga0495676_0408387 3300047321 Bacteria 900
810 Ga0495676_0710447 3300047321 Bacteria 650
811 Ga0495685_099095 3300047447 Bacteria 963
812 Ga0495684_1018442 3300047471 Bacteria 525
813 Ga0496100_0017594 3300048903 Bacteria 4223
814 Ga0496100_0018186 3300048903 Bacteria 4165
815 Ga0496101_0088085 3300048904 Bacteria 2305
816 Ga0496101_0441485 3300048904 Unclassified 1027
817 Ga0496101_0552358 3300048904 Bacteria 910
818 Ga0496101_0585089 3300048904 Bacteria 883
819 Ga0496101_1550066 3300048904 Unclassified 515
820 Ga0496102_0103449 3300048905 Bacteria 2648
821 Ga0496102_0112912 3300048905 Bacteria 2535
822 Ga0496102_0202914 3300048905 Bacteria 1869
823 Ga0496102_0420640 3300048905 Bacteria 1255
824 Ga0496103_0007360 3300048906 Bacteria 6563
825 Ga0496103_1038977 3300048906 Bacteria 509
826 Ga0496104_0107249 3300048907 Bacteria 2677
827 Ga0496104_0114047 3300048907 Bacteria 2591
828 Ga0496104_0313164 3300048907 Bacteria 1482
829 Ga0496104_0422612 3300048907 Bacteria 1245
830 Ga0496105_0702892 3300048908 Bacteria 776
831 Ga0496106_0015163 3300048909 Bacteria 5703
832 Ga0496106_0089324 3300048909 Bacteria 2376
833 Ga0496106_0253375 3300048909 Bacteria 1408
834 Ga0496107_0059782 3300048910 Bacteria 2758
835 Ga0496107_0413674 3300048910 Unclassified 1003
836 Ga0496108_0002938 3300048911 Bacteria 13707
837 Ga0496108_0003444 3300048911 Bacteria 12691
838 Ga0496108_0088997 3300048911 Bacteria 2624
839 Ga0496108_0139818 3300048911 Bacteria 2086
840 Ga0496108_0547489 3300048911 Bacteria 1010
841 Ga0496109_0008458 3300048912 Bacteria 8748
842 Ga0496109_0035234 3300048912 Unclassified 4513
843 Ga0496109_0172249 3300048912 Bacteria 2031
844 Ga0496109_0251037 3300048912 Bacteria 1666
845 Ga0496110_0108698 3300048913 Bacteria 2490
846 Ga0496110_0134398 3300048913 Bacteria 2235
847 Ga0496111_0140853 3300048914 Bacteria 1787
848 Ga0496111_0195965 3300048914 Bacteria 1502
849 Ga0496112_0001512 3300048915 Bacteria 17909
850 Ga0496112_0043729 3300048915 Bacteria 4386
851 Ga0496112_0148883 3300048915 Bacteria 2308
852 Ga0496112_0231872 3300048915 Bacteria 1800
853 Ga0496112_0238401 3300048915 Bacteria 1772
854 Ga0496112_0504364 3300048915 Bacteria 1145
855 Ga0496113_0005693 3300048916 Bacteria 7802
856 Ga0496113_0128379 3300048916 Bacteria 1987
857 Ga0496114_0156886 3300048917 Unclassified 1976
858 Ga0496114_0198631 3300048917 Bacteria 1756
859 Ga0496115_0005396 3300048918 Bacteria 9294
860 Ga0496115_0077726 3300048918 Bacteria 2699
861 Ga0496115_0145638 3300048918 Bacteria 1955
862 Ga0496121_0450627 3300048924 Bacteria 829
863 Ga0496124_0207420 3300048927 Bacteria 1485
864 Ga0496125_0443666 3300048928 Bacteria 745
865 Ga0496126_0361775 3300048929 Bacteria 1185
866 Ga0501047_0001214 3300049581 Bacteria 25557
867 Ga0501073_0435418 3300049589 Bacteria 906
868 Ga0501083_0042086 3300049744 Bacteria 3098
869 Ga0501083_0823044 3300049744 Bacteria 604
870 nmdc:mga06z11_965178_c1 3300050494 Bacteria 519
871 nmdc:mga05p37_1068214_c1 3300050507 Bacteria 849
872 nmdc:mga05p37_1153151_c1 3300050507 Unclassified 806
873 nmdc:mga05p37_136216_c1 3300050507 Bacteria 3011
874 nmdc:mga05p37_139632_c1 3300050507 Bacteria 2969
875 nmdc:mga05p37_148091_c1 3300050507 Bacteria 2873
876 nmdc:mga05p37_160200_c1 3300050507 Bacteria 2749
877 nmdc:mga05p37_20303_c1 3300050507 Bacteria 8039
878 nmdc:mga05p37_228009_c1 3300050507 Bacteria 2246
879 nmdc:mga05p37_25938_c1 3300050507 Bacteria 7126
880 nmdc:mga05p37_362809_c1 3300050507 Unclassified 1703
881 nmdc:mga05p37_41911_c1 3300050507 Bacteria 5623
882 nmdc:mga05p37_50592_c1 3300050507 Bacteria 5110
883 nmdc:mga05p37_573779_c1 3300050507 Bacteria 1279
884 nmdc:mga05p37_582558_c1 3300050507 Unclassified 1267
885 nmdc:mga05p37_60488_c1 3300050507 Bacteria 4664
886 nmdc:mga05p37_778226_c1 3300050507 Bacteria 1050
887 nmdc:mga05p37_974355_c1 3300050507 Bacteria 904
888 nmdc:mga09592_29904_c1 3300050508 Bacteria 4531
889 nmdc:mga09592_299631_c1 3300050508 Unclassified 1394
890 nmdc:mga09592_320177_c1 3300050508 Unclassified 1343
891 nmdc:mga0qj67_716043_c1 3300050509 Bacteria 795
892 nmdc:mga06r32_119103_c1 3300050510 Bacteria 2603
893 nmdc:mga06r32_174495_c1 3300050510 Unclassified 2134
894 nmdc:mga06r32_253646_c1 3300050510 Bacteria 1747
895 nmdc:mga06r32_71113_c1 3300050510 Bacteria 3366
896 nmdc:mga06r32_819004_c1 3300050510 Bacteria 891
897 nmdc:mga08y16_1154953_c1 3300050511 Bacteria 747
898 nmdc:mga08y16_19584_c1 3300050511 Bacteria 7134
899 nmdc:mga08y16_343597_c1 3300050511 Bacteria 1534
900 nmdc:mga08y16_501315_c1 3300050511 Bacteria 1233
901 nmdc:mga08y16_935855_c1 3300050511 Unclassified 850
902 nmdc:mga0n895_16615_c1 3300050512 Bacteria 6758
903 nmdc:mga0n895_18754_c1 3300050512 Bacteria 6412
904 nmdc:mga0n895_21399_c1 3300050512 Bacteria 6047
905 nmdc:mga0n895_309472_c1 3300050512 Bacteria 1601
906 nmdc:mga0n895_31585_c1 3300050512 Bacteria 5072
907 nmdc:mga0n895_399278_c1 3300050512 Bacteria 1390
908 nmdc:mga0n895_452071_c1 3300050512 Bacteria 1297
909 nmdc:mga0n895_68409_c1 3300050512 Bacteria 3518
910 nmdc:mga0n895_697249_c1 3300050512 Bacteria 1011
911 nmdc:mga0n895_754712_c1 3300050512 Bacteria 966
912 nmdc:mga0n895_887475_c1 3300050512 Bacteria 878
913 nmdc:mga0n895_97665_c1 3300050512 Bacteria 2943
914 nmdc:mga0n895_988670_c1 3300050512 Unclassified 823
915 nmdc:mga0rr50_1109246_c1 3300050513 Bacteria 673
916 nmdc:mga0rr50_1688114_c1 3300050513 Bacteria 534
917 nmdc:mga0rr50_189403_c1 3300050513 Bacteria 1685
918 nmdc:mga0rr50_313915_c1 3300050513 Unclassified 1313
919 nmdc:mga0rr50_407351_c1 3300050513 Unclassified 1149
920 nmdc:mga0rr50_464126_c1 3300050513 Unclassified 1074
921 nmdc:mga0rr50_505135_c1 3300050513 Bacteria 1028
922 nmdc:mga0rr50_706106_c1 3300050513 Bacteria 861
923 nmdc:mga0rr50_7140_c1 3300050513 Bacteria 6861
924 nmdc:mga0rr50_80407_c1 3300050513 Bacteria 2513
925 nmdc:mga08x19_42175_c1 3300050514 Bacteria 2908
926 nmdc:mga08x19_865669_c1 3300050514 Bacteria 642
927 nmdc:mga0a205_115287_c1 3300050515 Bacteria 2585
928 nmdc:mga0a205_1314804_c1 3300050515 Bacteria 571
929 nmdc:mga0a205_132826_c1 3300050515 Unclassified 1370
930 nmdc:mga0a205_170933_c1 3300050515 Bacteria 2069
931 nmdc:mga0a205_193059_c1 3300050515 Unclassified 1928
932 nmdc:mga0a205_279700_c1 3300050515 Bacteria 1544
933 nmdc:mga0a205_297193_c1 3300050515 Unclassified 1488
934 nmdc:mga0a205_30705_c1 3300050515 Bacteria 5147
935 nmdc:mga0a205_4690_c1 3300050515 Bacteria 12270
936 nmdc:mga0a205_566917_c1 3300050515 Unclassified 990
937 nmdc:mga0a205_633504_c1 3300050515 Unclassified 921
938 nmdc:mga0a205_67816_c1 3300050515 Bacteria 3446
939 nmdc:mga0a205_938402_c1 3300050515 Unclassified 712
940 nmdc:mga0sz30_227788_c1 3300050516 Bacteria 829
941 Ga0495655_0149823 3300053083 Bacteria 733
942 Ga0500616_0036024 3300053153 Bacteria 2688
943 Ga0587101_140416 3300059623 Unclassified 515
944 2512350767 2512047030 Bacteria 9031815
945 2513722205 2513237104 Bacteria 10034502
946 2513893697 2513237141 Bacteria 8496279
947 2903756630 2903748898 Bacteria 9972761
948 Ga0070667_101653125
949 SwRhRL2b_contig_162399
950 SwRhRL2b_contig_3462230
951 JGI25406J46586_10007402
952 JGI25406J46586_10037643
953 rootH2_10070803
954 JGI25404J52841_10001641
955 JGI25404J52841_10006600
956 JGI25404J52841_10043513
957 Ga0065704_10014484
958 Ga0065704_10086849
959 Ga0065704_10219628
960 Ga0065704_10516090
961 Ga0065712_10118679
962 Ga0065712_10213512
963 Ga0065712_10494833
964 Ga0065715_10005789
965 Ga0065715_10183367
966 Ga0065707_10417912
967 Ga0065707_10691631
968 Ga0070676_10110576
969 Ga0070690_100038547
970 Ga0070690_101383741
971 Ga0070670_100133954
972 Ga0070677_10012726
973 Ga0068869_100272214
974 Ga0070666_10233460
975 Ga0070666_10503390
976 Ga0068868_100074147
977 Ga0068868_100863106
978 Ga0070660_101030356
979 Ga0070689_100291364
980 Ga0070689_101407647
981 Ga0070689_101434516
982 Ga0070687_100135125
983 Ga0070668_100082648
984 Ga0070668_100144076
985 Ga0070668_100183428
986 Ga0070668_100208258
987 Ga0070668_100426221
988 Ga0070668_101556847
989 Ga0070669_100011318
990 Ga0070669_100063987
991 Ga0070669_100644793
992 Ga0070675_100147215
993 Ga0070675_100460133
994 Ga0070671_100019644
995 Ga0070671_100196848
996 Ga0070671_100503958
997 Ga0070671_101189905
998 Ga0070671_101623219
999 Ga0070674_100093059
1000 Ga0070674_100350286
1001 Ga0070673_100406413
1002 Ga0070673_100453877
1003 Ga0070673_101363800
1004 Ga0070688_100379866
1005 Ga0070659_100051222
1006 Ga0070667_100121465
1007 Ga0070667_100744096
1008 Ga0070667_101807034
1009 Ga0070703_10010805
1010 Ga0070709_10145608
1011 Ga0070709_10223491
1012 Ga0070709_10378741
1013 Ga0070709_10451594
1014 Ga0070709_10491900
1015 Ga0070709_10579158
1016 Ga0070709_10613400
1017 Ga0070709_10835507
1018 Ga0070714_100222750
1019 Ga0070714_100342683
1020 Ga0070714_100398270
1021 Ga0070714_100481943
1022 Ga0070714_100531862
1023 Ga0070714_100856413
1024 Ga0070713_100048119
1025 Ga0070713_100069663
1026 Ga0070713_100147669
1027 Ga0070713_100184260
1028 Ga0070713_100234821
1029 Ga0070713_100382721
1030 Ga0070710_10062691
1031 Ga0070710_10168290
1032 Ga0070710_10279642
1033 Ga0070710_10455118
1034 Ga0070710_10545756
1035 Ga0070710_10562865
1036 Ga0070710_10661325
1037 Ga0070710_11447407
1038 Ga0070711_100056508
1039 Ga0070711_100069624
1040 Ga0070711_100112901
1041 Ga0070711_100141676
1042 Ga0070711_100296990
1043 Ga0070711_100328265
1044 Ga0070711_100702459
1045 Ga0070711_100740774
1046 Ga0070711_100996384
1047 Ga0070711_101054537
1048 Ga0070711_101200419
1049 Ga0070711_101556899
1050 Ga0070705_100044102
1051 Ga0070705_100305349
1052 Ga0070700_100394502
1053 Ga0070694_100120355
1054 Ga0070694_100457866
1055 Ga0070694_100628530
1056 Ga0070694_100660074
1057 Ga0070694_101319832
1058 Ga0070708_100000971
1059 Ga0070708_100001860
1060 Ga0070708_100005700
1061 Ga0070708_100011880
1062 Ga0070708_100026095
1063 Ga0070708_100026433
1064 Ga0070708_100027629
1065 Ga0070708_100072343
1066 Ga0070708_100338589
1067 Ga0070708_100771369
1068 Ga0070708_100810996
1069 Ga0070678_100049801
1070 Ga0070662_100140067
1071 Ga0070662_100153046
1072 Ga0070662_100369040
1073 Ga0070662_100515310
1074 Ga0068867_100322731
1075 Ga0068867_101079701
1076 Ga0070706_100002776
1077 Ga0070706_100011597
1078 Ga0070706_100015538
1079 Ga0070706_100022580
1080 Ga0070706_100029157
1081 Ga0070706_100030102
1082 Ga0070706_100038776
1083 Ga0070706_100070747
1084 Ga0070706_100115286
1085 Ga0070706_100171132
1086 Ga0070706_100391327
1087 Ga0070706_100463697
1088 Ga0070706_101573430
1089 Ga0070707_100003475
1090 Ga0070707_100008920
1091 Ga0070707_100010656
1092 Ga0070707_100081332
1093 Ga0070707_100081934
1094 Ga0070707_100096226
1095 Ga0070707_100108480
1096 Ga0070707_100194545
1097 Ga0070707_100358621
1098 Ga0070707_100371192
1099 Ga0070707_100705010
1100 Ga0070707_101050457
1101 Ga0070698_100003857
1102 Ga0070698_100009879
1103 Ga0070698_100010310
1104 Ga0070698_100033245
1105 Ga0070698_100037067
1106 Ga0070698_100058187
1107 Ga0070698_100086849
1108 Ga0070698_100093144
1109 Ga0070698_101759639
1110 Ga0070699_100004403
1111 Ga0070699_100005458
1112 Ga0070699_100008636
1113 Ga0070699_100014100
1114 Ga0070699_100064946
1115 Ga0070699_100142200
1116 Ga0070699_100175684
1117 Ga0070699_100211924
1118 Ga0070699_100219529
1119 Ga0070699_100450234
1120 Ga0070699_100777438
1121 Ga0070699_101370354
1122 Ga0070697_100000912
1123 Ga0070697_100004693
1124 Ga0070697_100015161
1125 Ga0070697_100040221
1126 Ga0070697_100063145
1127 Ga0070697_100080918
1128 Ga0070697_100129830
1129 Ga0070697_100175026
1130 Ga0070697_100192196
1131 Ga0070697_101111113
1132 Ga0068853_100869279
1133 Ga0068853_101462504
1134 Ga0070672_100110446
1135 Ga0070672_100270159
1136 Ga0070695_100212910
1137 Ga0070695_100285153
1138 Ga0070696_100023591
1139 Ga0070696_100187054
1140 Ga0070696_101551983
1141 Ga0070665_100049262
1142 Ga0070665_100153658
1143 Ga0070665_100352967
1144 Ga0070665_101191950
1145 Ga0070665_101916102
1146 Ga0070704_100192598
1147 Ga0070704_100238007
1148 Ga0070704_100386926
1149 Ga0070704_100941215
1150 Ga0070664_101652142
1151 Ga0068857_100168947
1152 Ga0068854_100067309
1153 Ga0068856_100079585
1154 Ga0068856_100722695
1155 Ga0068856_100892323
1156 Ga0068856_102201361
1157 Ga0068859_100395832
1158 Ga0068864_100062192
1159 Ga0068864_100340165
1160 Ga0068866_10034297
1161 Ga0068866_10119620
1162 Ga0068866_10454058
1163 Ga0068866_11149153
1164 Ga0068861_101227374
1165 Ga0068863_100025734
1166 Ga0068863_100603335
1167 Ga0068858_100112541
1168 Ga0068858_100217214
1169 Ga0068858_100304726
1170 Ga0068860_100186507
1171 Ga0068860_100315873
1172 Ga0068860_100694017
1173 Ga0068862_100698465
1174 Ga0081455_10002166
1175 Ga0081455_10004257
1176 Ga0081455_10023361
1177 Ga0081455_10060727
1178 Ga0081455_10953758
1179 Ga0081538_10065242
1180 Ga0081540_1000274
1181 Ga0081540_1001170
1182 Ga0081540_1001186
1183 Ga0081540_1001219
1184 Ga0081540_1005548
1185 Ga0081540_1011733
1186 Ga0081540_1014259
1187 Ga0081540_1016878
1188 Ga0081540_1017437
1189 Ga0081540_1020059
1190 Ga0081540_1020766
1191 Ga0081540_1021154
1192 Ga0081540_1022565
1193 Ga0081540_1024910
1194 Ga0081540_1027222
1195 Ga0081540_1030311
1196 Ga0081540_1035493
1197 Ga0081540_1050098
1198 Ga0081540_1067089
1199 Ga0081540_1072686
1200 Ga0081540_1072880
1201 Ga0081540_1086190
1202 Ga0081540_1119340
1203 Ga0081540_1171373
1204 Ga0081539_10005162
1205 Ga0081539_10146088
1206 Ga0070717_10066571
1207 Ga0070717_10106845
1208 Ga0070717_10152356
1209 Ga0070717_10159262
1210 Ga0070717_10168610
1211 Ga0070717_10196344
1212 Ga0070717_10396280
1213 Ga0070717_10407212
1214 Ga0070717_10451002
1215 Ga0070717_10502420
1216 Ga0070717_10545873
1217 Ga0070717_10729829
1218 Ga0070717_10758069
1219 Ga0075432_10117609
1220 Ga0070715_10092915
1221 Ga0070715_10141945
1222 Ga0070715_10153201
1223 Ga0070715_10172724
1224 Ga0070715_10375241
1225 Ga0070715_10424216
1226 Ga0070715_10435658
1227 Ga0070715_10504538
1228 Ga0070716_100012524
1229 Ga0070716_100109843
1230 Ga0070716_100146198
1231 Ga0070716_100154274
1232 Ga0070716_100195354
1233 Ga0070716_100386854
1234 Ga0070716_100552337
1235 Ga0070716_101323619
1236 Ga0070712_100003675
1237 Ga0070712_100034046
1238 Ga0070712_100041501
1239 Ga0070712_100066686
1240 Ga0070712_100103149
1241 Ga0070712_100129779
1242 Ga0070712_100151126
1243 Ga0070712_100173997
1244 Ga0070712_100217240
1245 Ga0070712_100324871
1246 Ga0070712_100336539
1247 Ga0070712_100424941
1248 Ga0070712_100523890
1249 Ga0070712_100873815
1250 Ga0070712_101212547
1251 Ga0070712_101238665
1252 Ga0075369_10106602
1253 Ga0097621_100055679
1254 Ga0097621_100075857
1255 Ga0097621_100138052
1256 Ga0097621_101507438
1257 Ga0068871_100052415
1258 Ga0068871_100248297
1259 Ga0075428_100062433
1260 Ga0075428_100070023
1261 Ga0075428_100418777
1262 Ga0075428_100595741
1263 Ga0075430_100149544
1264 Ga0075430_100779114
1265 Ga0075431_100089152
1266 Ga0075431_100093575
1267 Ga0075431_100121530
1268 Ga0075431_100169831
1269 Ga0075431_100313889
1270 Ga0075433_10003365
1271 Ga0075433_10053500
1272 Ga0075433_10059949
1273 Ga0075433_10083774
1274 Ga0075433_10087979
1275 Ga0075433_10181658
1276 Ga0075433_10181755
1277 Ga0075433_10213816
1278 Ga0075433_10312818
1279 Ga0075433_10315227
1280 Ga0075433_10374673
1281 Ga0075433_10712773
1282 Ga0075433_11112397
1283 Ga0075434_100001766
1284 Ga0075434_100015836
1285 Ga0075434_100018327
1286 Ga0075434_100068481
1287 Ga0075434_100093529
1288 Ga0075434_100119133
1289 Ga0075434_100169991
1290 Ga0075434_100292593
1291 Ga0075434_100294632
1292 Ga0075434_100433828
1293 Ga0075434_100776368
1294 Ga0075434_101256886
1295 Ga0075434_101506973
1296 Ga0075429_100017829
1297 Ga0075429_100143086
1298 Ga0075429_100233336
1299 Ga0068865_100256160
1300 Ga0068865_100267547
1301 Ga0068865_100521302
1302 Ga0075436_100002734
1303 Ga0097620_100395896
1304 Ga0075435_100002599
1305 Ga0075435_100013757
1306 Ga0075435_100221741
1307 Ga0075435_100287568
1308 Ga0075435_100661504
1309 Ga0099794_10014777
1310 Ga0099794_10016752
1311 Ga0099794_10031383
1312 Ga0099794_10130391
1313 Ga0099794_10250373
1314 Ga0099794_10370041
1315 Ga0099794_10473012
1316 Ga0099795_10007844
1317 Ga0099795_10033119
1318 Ga0099795_10069764
1319 Ga0099795_10188908
1320 Ga0099795_10210610
1321 Ga0099795_10226019
1322 Ga0099795_10426778
1323 Ga0105250_10274500
1324 Ga0105240_10843338
1325 Ga0105240_12111331
1326 Ga0111539_10025878
1327 Ga0111539_10262721
1328 Ga0111539_10540594
1329 Ga0111539_10665917
1330 Ga0111539_11090960
1331 Ga0111539_12241781
1332 Ga0105245_10165405
1333 Ga0105245_10410678
1334 Ga0105247_10124730
1335 Ga0105247_10219615
1336 Ga0114129_10009498
1337 Ga0114129_10036674
1338 Ga0114129_10050125
1339 Ga0114129_10111814
1340 Ga0114129_10117150
1341 Ga0114129_10136428
1342 Ga0114129_10182508
1343 Ga0114129_10280802
1344 Ga0114129_10720642
1345 Ga0114129_11361858
1346 Ga0105243_10262617
1347 Ga0105243_10312357
1348 Ga0105243_10350145
1349 Ga0105241_11126429
1350 Ga0105242_10045067
1351 Ga0105242_10138903
1352 Ga0105242_10347182
1353 Ga0105242_10510499
1354 Ga0105248_10022335
1355 Ga0105248_10026151
1356 Ga0105248_10050165
1357 Ga0105248_10172157
1358 Ga0105248_11569462
1359 Ga0105237_10271956
1360 Ga0105238_10033956
1361 Ga0105249_10437272
1362 Ga0099796_10012348
1363 Ga0099796_10036083
1364 Ga0099796_10049470
1365 Ga0099796_10092473
1366 Ga0099796_10242041
1367 Ga0105239_10092278
1368 Ga0105239_10268854
1369 Ga0105239_10691771
1370 Ga0105239_10843951
1371 Ga0105246_10278587
1372 Ga0157371_10110344
1373 Ga0157374_10101100
1374 Ga0157374_10171600
1375 Ga0157374_10244499
1376 Ga0157374_10284931
1377 Ga0157374_11394292
1378 Ga0157378_10105485
1379 Ga0157378_10243938
1380 Ga0157378_10536859
1381 Ga0157378_10864266
1382 Ga0157378_11042848
1383 Ga0157378_12112762
1384 Ga0157378_12221317
1385 Ga0157378_12453989
1386 Ga0163162_10000828
1387 Ga0163162_10030176
1388 Ga0163162_10090422
1389 Ga0163162_10422581
1390 Ga0163162_10663610
1391 Ga0163162_10715791
1392 Ga0163162_11026438
1393 Ga0163162_11380601
1394 Ga0163162_12122218
1395 Ga0157372_10169175
1396 Ga0157372_11429767
1397 Ga0157375_10140886
1398 Ga0157375_10290804
1399 Ga0157375_11357277
1400 Ga0163163_10001511
1401 Ga0163163_10536606
1402 Ga0157380_10950857
1403 Ga0157377_10158643
1404 Ga0157379_10176544
1405 Ga0157379_10556619
1406 Ga0157376_10043108
1407 Ga0157376_10311990
1408 Ga0157376_10676428
1409 Ga0157376_11192804
1410 Ga0163161_10012430
1411 Ga0163161_10194990
1412 Ga0213873_10004412
1413 Ga0213873_10057745
1414 Ga0213873_10237837
1415 Ga0213872_10000291
1416 Ga0213872_10001618
1417 Ga0213872_10002167
1418 Ga0213872_10008035
1419 Ga0213872_10020777
1420 Ga0213872_10049642
1421 Ga0213872_10054849
1422 Ga0213872_10118946
1423 Ga0213872_10127065
1424 Ga0213872_10145720
1425 Ga0213872_10166712
1426 Ga0213872_10205478
1427 Ga0213872_10257715
1428 Ga0213874_10011745
1429 Ga0213876_10006962
1430 Ga0213876_10088903
1431 Ga0213875_10000009
1432 Ga0213875_10044566
1433 Ga0213875_10073425
1434 Ga0213871_10003845
1435 Ga0213871_10016975
1436 Ga0213871_10025656
1437 Ga0213871_10036996
1438 Ga0213871_10078704
1439 Ga0207666_1007382
1440 Ga0207673_1008193
1441 Ga0207697_10001495
1442 Ga0207697_10004417
1443 Ga0207697_10036516
1444 Ga0207653_10018128
1445 Ga0207682_10017256
1446 Ga0207692_10043062
1447 Ga0207692_10262650
1448 Ga0207692_10635794
1449 Ga0207692_10645306
1450 Ga0207692_10768984
1451 Ga0207642_10033702
1452 Ga0207642_10104365
1453 Ga0207642_10218688
1454 Ga0207642_10772414
1455 Ga0207688_10014427
1456 Ga0207680_10081370
1457 Ga0207680_10262340
1458 Ga0207647_10081396
1459 Ga0207647_10556326
1460 Ga0207685_10022575
1461 Ga0207685_10023939
1462 Ga0207685_10057411
1463 Ga0207685_10170841
1464 Ga0207699_10053395
1465 Ga0207699_10128504
1466 Ga0207699_10306512
1467 Ga0207699_10546027
1468 Ga0207699_10591479
1469 Ga0207684_10000307
1470 Ga0207684_10000963
1471 Ga0207684_10001085
1472 Ga0207684_10017145
1473 Ga0207684_10017588
1474 Ga0207684_10062004
1475 Ga0207684_10159624
1476 Ga0207684_10164161
1477 Ga0207684_10203351
1478 Ga0207684_10224872
1479 Ga0207684_10378989
1480 Ga0207654_10141120
1481 Ga0207671_10255750
1482 Ga0207671_11044558
1483 Ga0207693_10002961
1484 Ga0207693_10016192
1485 Ga0207693_10026523
1486 Ga0207693_10027143
1487 Ga0207693_10031472
1488 Ga0207693_10104502
1489 Ga0207693_10117994
1490 Ga0207693_10134243
1491 Ga0207693_10139172
1492 Ga0207693_10147645
1493 Ga0207693_10161076
1494 Ga0207693_10180851
1495 Ga0207693_10253632
1496 Ga0207693_10604105
1497 Ga0207663_10005805
1498 Ga0207663_10018499
1499 Ga0207663_10058651
1500 Ga0207663_10138394
1501 Ga0207663_10269735
1502 Ga0207663_10278462
1503 Ga0207663_10375214
1504 Ga0207663_10667207
1505 Ga0207663_11111884
1506 Ga0207657_10254857
1507 Ga0207657_10486920
1508 Ga0207657_10939957
1509 Ga0207646_10000473
1510 Ga0207646_10002115
1511 Ga0207646_10011772
1512 Ga0207646_10085100
1513 Ga0207646_10112038
1514 Ga0207646_10128315
1515 Ga0207646_10291907
1516 Ga0207646_10535700
1517 Ga0207646_10581685
1518 Ga0207646_11586114
1519 Ga0207681_10207744
1520 Ga0207681_10281477
1521 Ga0207681_10378776
1522 Ga0207694_10087467
1523 Ga0207694_10179280
1524 Ga0207659_10040824
1525 Ga0207659_10052865
1526 Ga0207687_10205117
1527 Ga0207700_10029548
1528 Ga0207700_10034181
1529 Ga0207700_10195408
1530 Ga0207700_10258016
1531 Ga0207700_10323469
1532 Ga0207700_10449811
1533 Ga0207700_10559835
1534 Ga0207664_10228075
1535 Ga0207664_10663333
1536 Ga0207664_11022033
1537 Ga0207644_10008564
1538 Ga0207644_10012105
1539 Ga0207690_10484404
1540 Ga0207690_10896760
1541 Ga0207706_10102721
1542 Ga0207706_10120223
1543 Ga0207706_10279189
1544 Ga0207706_10537863
1545 Ga0207686_10172840
1546 Ga0207709_11292000
1547 Ga0207670_10171421
1548 Ga0207670_10204707
1549 Ga0207670_11291292
1550 Ga0207669_10004663
1551 Ga0207669_10697313
1552 Ga0207704_10467301
1553 Ga0207665_10016505
1554 Ga0207665_10042741
1555 Ga0207665_10044594
1556 Ga0207665_10117862
1557 Ga0207665_10183082
1558 Ga0207665_10245139
1559 Ga0207665_10339103
1560 Ga0207665_10501645
1561 Ga0207665_11054586
1562 Ga0207691_10047944
1563 Ga0207691_10201040
1564 Ga0207711_10013184
1565 Ga0207711_10104549
1566 Ga0207711_10695155
1567 Ga0207689_10637165
1568 Ga0207679_11360700
1569 Ga0207651_10138834
1570 Ga0207712_10332521
1571 Ga0207712_10333174
1572 Ga0207712_11581039
1573 Ga0207668_10740279
1574 Ga0207640_10223039
1575 Ga0207658_10062423
1576 Ga0207658_11288786
1577 Ga0207677_10078796
1578 Ga0207677_10628606
1579 Ga0207703_10030517
1580 Ga0207703_10082659
1581 Ga0207703_10092403
1582 Ga0207703_11545322
1583 Ga0207639_10266746
1584 Ga0207639_11928638
1585 Ga0207702_10208374
1586 Ga0207641_10018664
1587 Ga0207641_10422824
1588 Ga0207648_11184064
1589 Ga0207676_10046292
1590 Ga0207676_10429952
1591 Ga0207675_100279801
1592 Ga0207675_100771742
1593 Ga0207675_101607427
1594 Ga0207683_10039513
1595 Ga0209179_1007053
1596 Ga0209179_1074987
1597 Ga0209179_1121463
1598 Ga0209588_1002288
1599 Ga0209588_1034185
1600 Ga0209588_1055360
1601 Ga0207428_10479592
1602 Ga0265356_1021865
1603 Ga0268266_10025225
1604 Ga0268266_10154379
1605 Ga0268265_10734490
1606 Ga0268265_11319829
1607 Ga0268264_10282811
1608 Ga0265336_10074990
1609 Ga0265338_10000664
1610 Ga0265762_1001818
1611 Ga0265760_10117304
1612 Ga0265760_10165015
1613 Ga0265330_10178324
1614 Ga0265332_10392082
1615 Ga0265339_10116331
1616 Ga0265331_10086463
1617 Ga0265316_10003561
1618 Ga0373926_0069694
1619 Ga0373928_0157535
1620 Ga0373928_0271872
1621 Ga0373940_0001449
1622 Ga0373940_0218818
1623 Ga0373949_0059258
1624 Ga0373932_0336817
1625 Ga0373936_0225725
1626 Ga0373939_0134195
1627 Ga0373941_0101883
1628 Ga0373943_0048157
1629 Ga0373946_0060168
1630 Ga0373961_0087195
1631 Ga0373962_0014443
1632 Ga0373931_0035495
1633 Ga0373931_0095031
1634 Ga0373931_1097784
1635 Ga0373935_0137380
1636 Ga0373935_0339009
1637 Ga0373927_0033074
1638 Ga0373927_0139516
1639 Ga0373947_0423204
1640 Ga0373925_0221684
1641 Ga0373925_0459253
1642 Ga0395899_0054389
1643 Ga0395900_0024150
1644 Ga0395905_0009538
1645 Ga0436364_0360426
1646 Ga0436364_1232970
1647 Ga0436364_1234816
1648 Ga0436364_1345244
1649 Ga0395901_0010547
1650 Ga0395901_0745932
1651 Ga0242420_018012
1652 Ga0436365_0031849
1653 Ga0436365_1926630
1654 Ga0436360_0105093
1655 Ga0436360_0174776
1656 Ga0436360_0217230
1657 Ga0436360_0274074
1658 Ga0436360_0473411
1659 Ga0436360_0523309
1660 Ga0436360_0542945
1661 Ga0436360_0585007
1662 Ga0436360_0602216
1663 Ga0436360_0709329
1664 Ga0436360_0739987
1665 Ga0436360_0766331
1666 Ga0436360_0816207
1667 Ga0436360_0887015
1668 Ga0436360_0924144
1669 Ga0436360_0932956
1670 Ga0436360_0972474
1671 Ga0436360_1041569
1672 Ga0436360_1194108
1673 Ga0436360_1254225
1674 Ga0436360_1284602
1675 Ga0436360_1316349
1676 Ga0436361_0010635
1677 Ga0436361_0015843
1678 Ga0436361_0036117
1679 Ga0436361_0157559
1680 Ga0436361_0193641
1681 Ga0436361_0199943
1682 Ga0436361_0272690
1683 Ga0436361_0368868
1684 Ga0436361_0416882
1685 Ga0436361_0422674
1686 Ga0436361_0446619
1687 Ga0436361_0536693
1688 Ga0436361_0597403
1689 Ga0436361_0630139
1690 Ga0436361_0785610
1691 Ga0436361_0819616
1692 Ga0436361_0838894
1693 Ga0436361_0853453
1694 Ga0436361_0868468
1695 Ga0436361_0883425
1696 Ga0436361_0956533
1697 Ga0436361_1047932
1698 Ga0436361_1069074
1699 Ga0436361_1092601
1700 Ga0436361_1170242
1701 Ga0436361_1179758
1702 Ga0436363_0015942
1703 Ga0436363_0508122
1704 Ga0436363_0696908
1705 Ga0436363_1002413
1706 Ga0436363_1684865
1707 Ga0436362_0013501
1708 Ga0436362_0054836
1709 Ga0436362_0430029
1710 Ga0436362_0720445
1711 Ga0436362_0838583
1712 Ga0436362_0858769
1713 Ga0436362_1047880
1714 Ga0436362_1104889
1715 Ga0453683_0309206
1716 Ga0453683_0623229
1717 Ga0453683_1175436
1718 Ga0453684_0164716
1719 Ga0453684_2562475
1720 Ga0466957_0197105
1721 Ga0451576_0375546
1722 Ga0466967_1113382
1723 Ga0495603_0124991
1724 Ga0495641_0037002
1725 Ga0495580_0219701
1726 Ga0495580_0596255
1727 Ga0495582_0634223
1728 Ga0495605_0039929
1729 Ga0495639_0038970
1730 Ga0495584_0076038
1731 Ga0495585_0226826
1732 Ga0495607_0101339
1733 Ga0495628_0282616
1734 Ga0495631_0110898
1735 Ga0495637_0093372
1736 Ga0495644_0299129
1737 Ga0495642_0047885
1738 Ga0495652_0136498
1739 Ga0495598_0442608
1740 Ga0495633_0044226
1741 Ga0495656_0027070
1742 Ga0495668_0390728
1743 Ga0495661_0249272
1744 Ga0495661_0274620
1745 Ga0495588_0148397
1746 Ga0495657_0040397
1747 Ga0495647_0430860
1748 Ga0495658_0591667
1749 Ga0495669_0286068
1750 Ga0495671_0319492
1751 Ga0495589_0188776
1752 Ga0495660_0406902
1753 Ga0495636_0278822
1754 Ga0495674_0311737
1755 Ga0495672_0398566
1756 Ga0495676_0408387
1757 Ga0495676_0710447
1758 Ga0495685_099095
1759 Ga0495684_1018442
1760 Ga0496100_0017594
1761 Ga0496100_0018186
1762 Ga0496101_0088085
1763 Ga0496101_0441485
1764 Ga0496101_0552358
1765 Ga0496101_0585089
1766 Ga0496101_1550066
1767 Ga0496102_0103449
1768 Ga0496102_0112912
1769 Ga0496102_0202914
1770 Ga0496102_0420640
1771 Ga0496103_0007360
1772 Ga0496103_1038977
1773 Ga0496104_0107249
1774 Ga0496104_0114047
1775 Ga0496104_0313164
1776 Ga0496104_0422612
1777 Ga0496105_0702892
1778 Ga0496106_0015163
1779 Ga0496106_0089324
1780 Ga0496106_0253375
1781 Ga0496107_0059782
1782 Ga0496107_0413674
1783 Ga0496108_0002938
1784 Ga0496108_0003444
1785 Ga0496108_0088997
1786 Ga0496108_0139818
1787 Ga0496108_0547489
1788 Ga0496109_0008458
1789 Ga0496109_0035234
1790 Ga0496109_0172249
1791 Ga0496109_0251037
1792 Ga0496110_0108698
1793 Ga0496110_0134398
1794 Ga0496111_0140853
1795 Ga0496111_0195965
1796 Ga0496112_0001512
1797 Ga0496112_0043729
1798 Ga0496112_0148883
1799 Ga0496112_0231872
1800 Ga0496112_0238401
1801 Ga0496112_0504364
1802 Ga0496113_0005693
1803 Ga0496113_0128379
1804 Ga0496114_0156886
1805 Ga0496114_0198631
1806 Ga0496115_0005396
1807 Ga0496115_0077726
1808 Ga0496115_0145638
1809 Ga0496121_0450627
1810 Ga0496124_0207420
1811 Ga0496125_0443666
1812 Ga0496126_0361775
1813 Ga0501047_0001214
1814 Ga0501073_0435418
1815 Ga0501083_0042086
1816 Ga0501083_0823044
1817 nmdc:mga06z11_965178_c1
1818 nmdc:mga05p37_1068214_c1
1819 nmdc:mga05p37_1153151_c1
1820 nmdc:mga05p37_136216_c1
1821 nmdc:mga05p37_139632_c1
1822 nmdc:mga05p37_148091_c1
1823 nmdc:mga05p37_160200_c1
1824 nmdc:mga05p37_20303_c1
1825 nmdc:mga05p37_228009_c1
1826 nmdc:mga05p37_25938_c1
1827 nmdc:mga05p37_362809_c1
1828 nmdc:mga05p37_41911_c1
1829 nmdc:mga05p37_50592_c1
1830 nmdc:mga05p37_573779_c1
1831 nmdc:mga05p37_582558_c1
1832 nmdc:mga05p37_60488_c1
1833 nmdc:mga05p37_778226_c1
1834 nmdc:mga05p37_974355_c1
1835 nmdc:mga09592_29904_c1
1836 nmdc:mga09592_299631_c1
1837 nmdc:mga09592_320177_c1
1838 nmdc:mga0qj67_716043_c1
1839 nmdc:mga06r32_119103_c1
1840 nmdc:mga06r32_174495_c1
1841 nmdc:mga06r32_253646_c1
1842 nmdc:mga06r32_71113_c1
1843 nmdc:mga06r32_819004_c1
1844 nmdc:mga08y16_1154953_c1
1845 nmdc:mga08y16_19584_c1
1846 nmdc:mga08y16_343597_c1
1847 nmdc:mga08y16_501315_c1
1848 nmdc:mga08y16_935855_c1
1849 nmdc:mga0n895_16615_c1
1850 nmdc:mga0n895_18754_c1
1851 nmdc:mga0n895_21399_c1
1852 nmdc:mga0n895_309472_c1
1853 nmdc:mga0n895_31585_c1
1854 nmdc:mga0n895_399278_c1
1855 nmdc:mga0n895_452071_c1
1856 nmdc:mga0n895_68409_c1
1857 nmdc:mga0n895_697249_c1
1858 nmdc:mga0n895_754712_c1
1859 nmdc:mga0n895_887475_c1
1860 nmdc:mga0n895_97665_c1
1861 nmdc:mga0n895_988670_c1
1862 nmdc:mga0rr50_1109246_c1
1863 nmdc:mga0rr50_1688114_c1
1864 nmdc:mga0rr50_189403_c1
1865 nmdc:mga0rr50_313915_c1
1866 nmdc:mga0rr50_407351_c1
1867 nmdc:mga0rr50_464126_c1
1868 nmdc:mga0rr50_505135_c1
1869 nmdc:mga0rr50_706106_c1
1870 nmdc:mga0rr50_7140_c1
1871 nmdc:mga0rr50_80407_c1
1872 nmdc:mga08x19_42175_c1
1873 nmdc:mga08x19_865669_c1
1874 nmdc:mga0a205_115287_c1
1875 nmdc:mga0a205_1314804_c1
1876 nmdc:mga0a205_132826_c1
1877 nmdc:mga0a205_170933_c1
1878 nmdc:mga0a205_193059_c1
1879 nmdc:mga0a205_279700_c1
1880 nmdc:mga0a205_297193_c1
1881 nmdc:mga0a205_30705_c1
1882 nmdc:mga0a205_4690_c1
1883 nmdc:mga0a205_566917_c1
1884 nmdc:mga0a205_633504_c1
1885 nmdc:mga0a205_67816_c1
1886 nmdc:mga0a205_938402_c1
1887 nmdc:mga0sz30_227788_c1
1888 Ga0495655_0149823
1889 Ga0500616_0036024
1890 Ga0587101_140416
1891 2512350767
1892 2513722205
1893 2513893697
1894 2903756630

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

36

159

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ab5-assembly2.cif.gz_B structure of chey mutant f14n, v21t 0.9337 6 132
1ab6-assembly2.cif.gz_B structure of chey mutant f14n, v86t 0.9186 3 132
5brj-assembly1.cif.gz_A-2 structure of the bacteriophytochrome response regulator atbrr 0.9161 3 141
1ymv-assembly1.cif.gz_A signal transduction protein chey mutant with phe 14 replaced by gly, ser 15 replaced by gly, and met 17 replaced by gly 0.9157 6 133
2b1j-assembly1.cif.gz_A crystal structure of unphosphorylated chey bound to the n-terminus of flim 0.9129 2 133
ID Description Score Start End Superfamily
af_P0AFJ5_1_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9171 4 96 3.40.50.2300
5brjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9161 3 141 3.40.50.2300
af_Q2FY79_1_81_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9127 4 96 3.40.50.2300
af_P08368_2_83_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9092 3 96 3.40.50.2300
af_I1N9Y5_1_108_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9092 4 119 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2G4E2G8-F1-model_v4 Chemotaxis protein CheY 0.9718 4 108 GO:0000160
AF-A0A7Y3I9N0-F1-model_v4 Response regulator 0.9495 3 126 GO:0000160
AF-A0A2G4E2G8-F1-model_v4 Chemotaxis protein CheY 0.9453 4 108 GO:0000160
AF-A0A6P0EN07-F1-model_v4 deleted 0.9438 40 133
AF-A0A516SB63-F1-model_v4 Response regulator 0.943 3 130 GO:0000160

Map