F486384

General Info

Members Datasets Scaffolds Average Seq Length
943 392 937 193

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10192474|Ga0111539_101924745
Length 202
Sequence MSTKVTDGPKITEGAKQPEEVVQTISHHTGRKDRVFVRGIQGAYSLKEELARLRSMPRVRKGHLIRFADGPQTFSRHYIEPKDGLTQTFEYAPGSRSQKHGHVNEAAFYILDGEGYEIHDGIRYDWKAGDIAIVHNNCVHQHFNASPTKPARAVVIKTKPMFMFMNMLFQKQVVPRPTEPAPGAEGFKVREFEENYNYEDQE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
3 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
4 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
5 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
6 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
124 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
125 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
126 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
127 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
128 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
129 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
195 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
204 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
205 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
206 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
207 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
208 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
209 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
210 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
211 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
212 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
214 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
216 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
217 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
218 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
219 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
220 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
221 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
222 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
223 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
224 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
225 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
226 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
227 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
228 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
230 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
231 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
237 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
240 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
241 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
242 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
243 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
244 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
245 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
246 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
247 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
248 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
249 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
250 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
251 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
252 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
253 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
254 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
255 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
256 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
257 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
258 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
259 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
260 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
261 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
262 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
263 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
264 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
265 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
266 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
267 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
268 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
269 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
270 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
271 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
272 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
273 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
274 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
275 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
276 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
277 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
278 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
279 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
280 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
281 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
282 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
283 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
284 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
285 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
286 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
287 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
288 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
289 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
290 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
291 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
292 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
293 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
294 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
295 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
296 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
297 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
298 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
299 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
300 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
301 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
302 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
303 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
304 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
305 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
306 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
307 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
308 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
309 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
310 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
311 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
312 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
313 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
314 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
315 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
316 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
317 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
318 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
319 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
320 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
321 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
322 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
323 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
324 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
325 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
326 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
327 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
328 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
329 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
330 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
331 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
332 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
333 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
334 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
335 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
336 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
337 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
338 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
339 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
340 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
341 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
342 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
343 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
344 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
345 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
346 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
347 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
348 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
359 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
360 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
361 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
362 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
363 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
364 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
365 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
366 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
367 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
368 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
369 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
371 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
372 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
373 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
374 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
375 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
376 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
377 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
378 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
379 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
380 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
381 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
382 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
383 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
384 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
385 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
386 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
387 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
388 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
389 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
390 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
391 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
392 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0.21
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 1.17
Rhizosphere 95.12
Stem 0
Stem Tuber 0
Unclassified 2.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3191446 2162886007 Bacteria 1459
2 LJQas_1001792 3300000549 Bacteria 3146
3 JGI25406J46586_10025474 3300003203 Bacteria 2296
4 Ga0058859_11536937 3300004798 Bacteria 1725
5 Ga0065704_10006314 3300005289 Bacteria 4295
6 Ga0065707_10119894 3300005295 Bacteria 2147
7 Ga0065707_10124404 3300005295 Bacteria 2045
8 Ga0065707_10170922 3300005295 Bacteria 1485
9 Ga0070658_10265790 3300005327 Bacteria 1458
10 Ga0070676_10041159 3300005328 Bacteria 2678
11 Ga0070676_10342262 3300005328 Bacteria 1026
12 Ga0070683_100131398 3300005329 Bacteria 2369
13 Ga0070683_100273845 3300005329 Bacteria 1606
14 Ga0070683_100289352 3300005329 Bacteria 1558
15 Ga0070690_100005091 3300005330 Bacteria 7363
16 Ga0070670_100043454 3300005331 Bacteria 3863
17 Ga0068869_100320743 3300005334 Bacteria 1256
18 Ga0070666_10079909 3300005335 Bacteria 2234
19 Ga0070680_100034909 3300005336 Bacteria 4057
20 Ga0070680_100055204 3300005336 Bacteria 3246
21 Ga0070680_100076410 3300005336 Bacteria 2757
22 Ga0070680_100096124 3300005336 Bacteria 2456
23 Ga0070680_100113526 3300005336 Bacteria 2257
24 Ga0070680_100316045 3300005336 Bacteria 1326
25 Ga0070682_100006531 3300005337 Bacteria 6545
26 Ga0068868_100007387 3300005338 Bacteria 7826
27 Ga0068868_100048250 3300005338 Bacteria 3340
28 Ga0068868_100100382 3300005338 Bacteria 2342
29 Ga0068868_100212370 3300005338 Bacteria 1618
30 Ga0068868_100918156 3300005338 Bacteria 797
31 Ga0070689_100007046 3300005340 Bacteria 7826
32 Ga0070689_100024531 3300005340 Bacteria 4524
33 Ga0070689_100041867 3300005340 Bacteria 3516
34 Ga0070691_10002771 3300005341 Bacteria 7816
35 Ga0070691_10255912 3300005341 Unclassified 941
36 Ga0070687_100001749 3300005343 Bacteria 7826
37 Ga0070687_100086576 3300005343 Bacteria 1723
38 Ga0070687_100251682 3300005343 Bacteria 1098
39 Ga0070687_100378688 3300005343 Bacteria 921
40 Ga0070661_100397186 3300005344 Bacteria 1090
41 Ga0070692_10005868 3300005345 Bacteria 5283
42 Ga0070692_10035875 3300005345 Bacteria 2513
43 Ga0070692_10123101 3300005345 Bacteria 1449
44 Ga0070668_100207349 3300005347 Bacteria 1611
45 Ga0070669_100000739 3300005353 Bacteria 23805
46 Ga0070669_100601921 3300005353 Bacteria 921
47 Ga0070675_100016495 3300005354 Bacteria 5865
48 Ga0070675_100042883 3300005354 Bacteria 3697
49 Ga0070671_100009287 3300005355 Bacteria 7898
50 Ga0070671_100121950 3300005355 Bacteria 2194
51 Ga0070671_100162160 3300005355 Bacteria 1890
52 Ga0070673_100042483 3300005364 Bacteria 3506
53 Ga0070673_100100450 3300005364 Bacteria 2382
54 Ga0070673_100163817 3300005364 Bacteria 1893
55 Ga0070673_100337992 3300005364 Bacteria 1334
56 Ga0070673_100634619 3300005364 Bacteria 976
57 Ga0070688_100209893 3300005365 Bacteria 1367
58 Ga0070688_100261047 3300005365 Bacteria 1237
59 Ga0070688_100320041 3300005365 Bacteria 1127
60 Ga0070688_100680942 3300005365 Bacteria 795
61 Ga0070659_100254578 3300005366 Bacteria 1456
62 Ga0070703_10025931 3300005406 Bacteria 1740
63 Ga0070713_100012279 3300005436 Bacteria 6276
64 Ga0070713_100030251 3300005436 Bacteria 4299
65 Ga0070710_10114141 3300005437 Bacteria 1626
66 Ga0070701_10001946 3300005438 Bacteria 7826
67 Ga0070701_10008555 3300005438 Bacteria 4435
68 Ga0070701_10162217 3300005438 Bacteria 1296
69 Ga0070701_10212840 3300005438 Bacteria 1148
70 Ga0070701_10302306 3300005438 Bacteria 984
71 Ga0070711_100766053 3300005439 Bacteria 816
72 Ga0070705_100000108 3300005440 Bacteria 47179
73 Ga0070705_100003829 3300005440 Bacteria 7358
74 Ga0070705_100039722 3300005440 Bacteria 2671
75 Ga0070705_100053822 3300005440 Bacteria 2357
76 Ga0070705_100184420 3300005440 Bacteria 1416
77 Ga0070705_100391067 3300005440 Bacteria 1027
78 Ga0070700_100015124 3300005441 Bacteria 4369
79 Ga0070700_100159230 3300005441 Bacteria 1552
80 Ga0070700_100162458 3300005441 Bacteria 1539
81 Ga0070694_100009114 3300005444 Bacteria 6086
82 Ga0070694_100020944 3300005444 Bacteria 4173
83 Ga0070694_100062119 3300005444 Bacteria 2551
84 Ga0070694_100323463 3300005444 Bacteria 1187
85 Ga0070694_100409187 3300005444 Bacteria 1064
86 Ga0070694_100489977 3300005444 Bacteria 977
87 Ga0070694_100577901 3300005444 Bacteria 903
88 Ga0070708_100103908 3300005445 Bacteria 2605
89 Ga0070708_100934797 3300005445 Bacteria 814
90 Ga0070678_100497830 3300005456 Bacteria 1075
91 Ga0070678_100747013 3300005456 Bacteria 885
92 Ga0070662_100049570 3300005457 Bacteria 3028
93 Ga0070681_10018567 3300005458 Bacteria 6952
94 Ga0070681_10020240 3300005458 Bacteria 6670
95 Ga0070681_10020583 3300005458 Bacteria 6611
96 Ga0070681_10209125 3300005458 Bacteria 1867
97 Ga0070681_10399951 3300005458 Bacteria 1285
98 Ga0068867_100004387 3300005459 Bacteria 9923
99 Ga0068867_100008217 3300005459 Bacteria 7372
100 Ga0070706_100422967 3300005467 Bacteria 1240
101 Ga0070706_100433194 3300005467 Bacteria 1224
102 Ga0070706_100586103 3300005467 Unclassified 1036
103 Ga0070706_101192060 3300005467 Bacteria 700
104 Ga0070707_100167909 3300005468 Bacteria 2139
105 Ga0070707_100280671 3300005468 Bacteria 1619
106 Ga0070707_100292258 3300005468 Bacteria 1583
107 Ga0070707_100345728 3300005468 Bacteria 1445
108 Ga0070698_100002719 3300005471 Bacteria 19443
109 Ga0070698_100047033 3300005471 Bacteria 4411
110 Ga0070698_100288017 3300005471 Bacteria 1574
111 Ga0070698_100355023 3300005471 Bacteria 1398
112 Ga0070699_100010154 3300005518 Bacteria 8149
113 Ga0070699_100028410 3300005518 Bacteria 4823
114 Ga0070699_100028998 3300005518 Bacteria 4771
115 Ga0070699_100093669 3300005518 Bacteria 2629
116 Ga0070699_100216853 3300005518 Bacteria 1705
117 Ga0070699_100370060 3300005518 Bacteria 1293
118 Ga0070679_100001812 3300005530 Bacteria 19273
119 Ga0070679_100074072 3300005530 Bacteria 3396
120 Ga0070679_100078330 3300005530 Bacteria 3294
121 Ga0070684_100137437 3300005535 Bacteria 2208
122 Ga0070684_100145024 3300005535 Bacteria 2149
123 Ga0070684_100967251 3300005535 Bacteria 799
124 Ga0070697_100012632 3300005536 Bacteria 6615
125 Ga0070697_100025846 3300005536 Bacteria 4683
126 Ga0070697_100033676 3300005536 Bacteria 4127
127 Ga0070697_100441580 3300005536 Bacteria 1133
128 Ga0070697_100744669 3300005536 Unclassified 866
129 Ga0068853_100129221 3300005539 Bacteria 2260
130 Ga0068853_100291072 3300005539 Bacteria 1508
131 Ga0070672_100026908 3300005543 Bacteria 4286
132 Ga0070686_100095324 3300005544 Bacteria 1999
133 Ga0070686_100269848 3300005544 Bacteria 1250
134 Ga0070695_100002095 3300005545 Bacteria 11424
135 Ga0070695_100004987 3300005545 Bacteria 7826
136 Ga0070695_100018488 3300005545 Bacteria 4232
137 Ga0070695_100068774 3300005545 Bacteria 2313
138 Ga0070695_100212777 3300005545 Bacteria 1388
139 Ga0070695_100249737 3300005545 Bacteria 1291
140 Ga0070695_100306648 3300005545 Bacteria 1175
141 Ga0070696_100000180 3300005546 Bacteria 36576
142 Ga0070696_100036097 3300005546 Bacteria 3406
143 Ga0070696_100057118 3300005546 Bacteria 2723
144 Ga0070696_100094560 3300005546 Bacteria 2133
145 Ga0070696_100100300 3300005546 Bacteria 2074
146 Ga0070696_100163689 3300005546 Bacteria 1640
147 Ga0070696_100203936 3300005546 Bacteria 1477
148 Ga0070696_100215575 3300005546 Bacteria 1438
149 Ga0070693_100002991 3300005547 Bacteria 7826
150 Ga0070693_100206583 3300005547 Bacteria 1279
151 Ga0070693_100394482 3300005547 Bacteria 958
152 Ga0070704_100001866 3300005549 Bacteria 11619
153 Ga0070704_100009010 3300005549 Bacteria 6016
154 Ga0070704_100010578 3300005549 Bacteria 5617
155 Ga0070704_100047604 3300005549 Bacteria 2998
156 Ga0070704_100065410 3300005549 Bacteria 2617
157 Ga0070704_100095877 3300005549 Bacteria 2223
158 Ga0070704_100104451 3300005549 Bacteria 2142
159 Ga0070704_100216431 3300005549 Bacteria 1555
160 Ga0068855_100001026 3300005563 Bacteria 34816
161 Ga0068855_100049308 3300005563 Bacteria 4966
162 Ga0068855_100067391 3300005563 Bacteria 4170
163 Ga0068855_100151451 3300005563 Bacteria 2637
164 Ga0070664_100017923 3300005564 Bacteria 5814
165 Ga0070664_100018613 3300005564 Bacteria 5710
166 Ga0070664_100073010 3300005564 Bacteria 2943
167 Ga0070664_100184978 3300005564 Bacteria 1854
168 Ga0070664_100195777 3300005564 Bacteria 1802
169 Ga0070664_100259026 3300005564 Bacteria 1565
170 Ga0068857_100158661 3300005577 Bacteria 2052
171 Ga0068857_100181138 3300005577 Bacteria 1917
172 Ga0068857_100233760 3300005577 Bacteria 1681
173 Ga0068856_100319255 3300005614 Bacteria 1570
174 Ga0070702_100018687 3300005615 Bacteria 3600
175 Ga0070702_100452466 3300005615 Bacteria 932
176 Ga0070702_100785834 3300005615 Bacteria 735
177 Ga0068852_100012355 3300005616 Bacteria 6479
178 Ga0068852_100111657 3300005616 Bacteria 2486
179 Ga0068852_100128379 3300005616 Bacteria 2332
180 Ga0068852_100579552 3300005616 Bacteria 1125
181 Ga0068852_100902266 3300005616 Bacteria 901
182 Ga0068859_100001226 3300005617 Bacteria 26171
183 Ga0068859_100016661 3300005617 Bacteria 7378
184 Ga0068859_100024635 3300005617 Bacteria 6037
185 Ga0068859_100032097 3300005617 Bacteria 5275
186 Ga0068859_100889068 3300005617 Bacteria 976
187 Ga0068864_100215501 3300005618 Bacteria 1770
188 Ga0068864_100532627 3300005618 Bacteria 1134
189 Ga0068864_100648760 3300005618 Bacteria 1028
190 Ga0068866_10147730 3300005718 Bacteria 1357
191 Ga0068861_100006773 3300005719 Bacteria 7826
192 Ga0068861_100063286 3300005719 Bacteria 2844
193 Ga0068861_100486384 3300005719 Bacteria 1113
194 Ga0068851_10001034 3300005834 Bacteria 12085
195 Ga0068851_10158927 3300005834 Bacteria 1240
196 Ga0068870_10025333 3300005840 Bacteria 2943
197 Ga0068870_10036353 3300005840 Bacteria 2533
198 Ga0068870_10075527 3300005840 Bacteria 1848
199 Ga0068863_100120170 3300005841 Bacteria 2505
200 Ga0068863_100334484 3300005841 Bacteria 1472
201 Ga0068863_101051610 3300005841 Bacteria 818
202 Ga0068858_100014725 3300005842 Bacteria 7362
203 Ga0068858_100503947 3300005842 Bacteria 1170
204 Ga0068860_100015796 3300005843 Bacteria 7372
205 Ga0068860_100027637 3300005843 Bacteria 5462
206 Ga0068862_100000936 3300005844 Bacteria 28121
207 Ga0068862_100414622 3300005844 Bacteria 1262
208 Ga0081455_10044130 3300005937 Bacteria 3893
209 Ga0081538_10105034 3300005981 Bacteria 1407
210 Ga0081538_10125762 3300005981 Bacteria 1219
211 Ga0081539_10001417 3300005985 Bacteria 41272
212 Ga0081539_10018413 3300005985 Bacteria 4848
213 Ga0081539_10023062 3300005985 Bacteria 4090
214 Ga0070717_10009247 3300006028 Bacteria 7406
215 Ga0070717_10744967 3300006028 Bacteria 891
216 Ga0070716_100223808 3300006173 Bacteria 1266
217 Ga0070716_100410819 3300006173 Bacteria 976
218 Ga0070712_100380563 3300006175 Unclassified 1162
219 Ga0070712_100546395 3300006175 Bacteria 976
220 Ga0070712_100892948 3300006175 Bacteria 766
221 Ga0097621_100055240 3300006237 Bacteria 3242
222 Ga0097621_100072507 3300006237 Bacteria 2848
223 Ga0097621_100178597 3300006237 Bacteria 1833
224 Ga0097621_100311934 3300006237 Bacteria 1391
225 Ga0097621_100470323 3300006237 Bacteria 1135
226 Ga0075370_10157038 3300006353 Bacteria 1334
227 Ga0068871_100014460 3300006358 Bacteria 5887
228 Ga0068871_100017452 3300006358 Bacteria 5433
229 Ga0068871_100180774 3300006358 Bacteria 1812
230 Ga0075428_100001175 3300006844 Bacteria 28033
231 Ga0075428_100003327 3300006844 Bacteria 17580
232 Ga0075428_100004010 3300006844 Bacteria 16164
233 Ga0075428_100019806 3300006844 Bacteria 7446
234 Ga0075428_100042969 3300006844 Bacteria 4970
235 Ga0075430_100002934 3300006846 Bacteria 14264
236 Ga0075431_100064349 3300006847 Bacteria 3787
237 Ga0075433_10028232 3300006852 Bacteria 4769
238 Ga0075433_10207385 3300006852 Bacteria 1742
239 Ga0075434_100001205 3300006871 Bacteria 21511
240 Ga0075434_100031867 3300006871 Bacteria 5198
241 Ga0075434_100110147 3300006871 Bacteria 2764
242 Ga0075434_100149851 3300006871 Bacteria 2353
243 Ga0075434_100365214 3300006871 Bacteria 1464
244 Ga0075434_101083707 3300006871 Bacteria 814
245 Ga0075434_101552982 3300006871 Bacteria 671
246 Ga0075429_100001637 3300006880 Bacteria 18510
247 Ga0075429_100010090 3300006880 Bacteria 8184
248 Ga0075429_100011040 3300006880 Bacteria 7817
249 Ga0075429_100371127 3300006880 Bacteria 1253
250 Ga0068865_100006045 3300006881 Bacteria 7378
251 Ga0075436_100060217 3300006914 Bacteria 2622
252 Ga0075436_100112760 3300006914 Bacteria 1899
253 Ga0075436_100180993 3300006914 Bacteria 1490
254 Ga0075436_100219010 3300006914 Bacteria 1350
255 Ga0075436_100219945 3300006914 Bacteria 1347
256 Ga0097620_100001226 3300006931 Bacteria 26171
257 Ga0097620_100016661 3300006931 Bacteria 7378
258 Ga0097620_100024635 3300006931 Bacteria 6037
259 Ga0097620_100032097 3300006931 Bacteria 5275
260 Ga0097620_100889226 3300006931 Bacteria 976
261 Ga0097620_100916332 3300006931 Bacteria 961
262 Ga0075435_100083564 3300007076 Bacteria 2625
263 Ga0075435_100127432 3300007076 Bacteria 2128
264 Ga0075435_100141742 3300007076 Bacteria 2017
265 Ga0075435_100343288 3300007076 Bacteria 1279
266 Ga0075435_100512445 3300007076 Bacteria 1037
267 Ga0075435_100515873 3300007076 Bacteria 1034
268 Ga0075435_100720077 3300007076 Bacteria 868
269 Ga0099794_10026206 3300007265 Bacteria 2693
270 Ga0099794_10042411 3300007265 Bacteria 2169
271 Ga0099795_10264331 3300007788 Bacteria 746
272 Ga0105250_10023435 3300009092 Bacteria 2486
273 Ga0105240_10017393 3300009093 Bacteria 9692
274 Ga0105240_10040202 3300009093 Bacteria 5985
275 Ga0105240_10065260 3300009093 Bacteria 4520
276 Ga0111539_10000829 3300009094 Bacteria 40191
277 Ga0111539_10001620 3300009094 Bacteria 30065
278 Ga0111539_10058846 3300009094 Bacteria 4558
279 Ga0111539_10064868 3300009094 Bacteria 4318
280 Ga0111539_10157774 3300009094 Bacteria 2655
281 Ga0111539_10192474 3300009094 Bacteria 2380
282 Ga0111539_10252812 3300009094 Bacteria 2052
283 Ga0111539_10263141 3300009094 Bacteria 2008
284 Ga0111539_10538569 3300009094 Bacteria 1360
285 Ga0111539_10591943 3300009094 Bacteria 1292
286 Ga0111539_10690325 3300009094 Bacteria 1188
287 Ga0111539_10837248 3300009094 Bacteria 1070
288 Ga0105245_10012615 3300009098 Bacteria 7358
289 Ga0105245_10234186 3300009098 Bacteria 1777
290 Ga0105245_10429248 3300009098 Bacteria 1326
291 Ga0105245_11466143 3300009098 Bacteria 733
292 Ga0114129_10007142 3300009147 Bacteria 15892
293 Ga0114129_10031869 3300009147 Bacteria 7452
294 Ga0114129_10042478 3300009147 Bacteria 6402
295 Ga0114129_10086663 3300009147 Bacteria 4343
296 Ga0114129_10090544 3300009147 Bacteria 4240
297 Ga0114129_10659587 3300009147 Bacteria 1349
298 Ga0105243_10009573 3300009148 Bacteria 7378
299 Ga0105243_10208469 3300009148 Bacteria 1719
300 Ga0105243_10245147 3300009148 Bacteria 1596
301 Ga0105241_10074350 3300009174 Bacteria 2646
302 Ga0105241_10825868 3300009174 Bacteria 855
303 Ga0105242_10107916 3300009176 Bacteria 2369
304 Ga0105242_10615638 3300009176 Bacteria 1051
305 Ga0105248_10126896 3300009177 Bacteria 2878
306 Ga0105248_10158379 3300009177 Bacteria 2555
307 Ga0105248_10736861 3300009177 Bacteria 1112
308 Ga0105237_10000625 3300009545 Bacteria 49435
309 Ga0105237_10019788 3300009545 Bacteria 6950
310 Ga0105238_10013604 3300009551 Bacteria 8217
311 Ga0105238_10014032 3300009551 Bacteria 8100
312 Ga0105238_10103045 3300009551 Bacteria 2835
313 Ga0105238_10114073 3300009551 Bacteria 2681
314 Ga0105238_10793592 3300009551 Bacteria 962
315 Ga0105249_10137269 3300009553 Bacteria 2342
316 Ga0105239_10000051 3300010375 Bacteria 169036
317 Ga0105239_10001816 3300010375 Bacteria 27990
318 Ga0105239_10447392 3300010375 Bacteria 1465
319 Ga0105239_10515150 3300010375 Bacteria 1361
320 Ga0157371_10415875 3300013102 Bacteria 985
321 Ga0157369_10043732 3300013105 Bacteria 4881
322 Ga0157369_10481760 3300013105 Bacteria 1284
323 Ga0157369_11584414 3300013105 Bacteria 666
324 Ga0157374_10147160 3300013296 Bacteria 2288
325 Ga0157374_10316608 3300013296 Bacteria 1546
326 Ga0157374_11027975 3300013296 Bacteria 843
327 Ga0157378_10012667 3300013297 Bacteria 7378
328 Ga0157378_10050050 3300013297 Bacteria 3718
329 Ga0163162_10276181 3300013306 Bacteria 1812
330 Ga0163162_10326290 3300013306 Bacteria 1667
331 Ga0163162_11043492 3300013306 Bacteria 925
332 Ga0157372_10012175 3300013307 Bacteria 9164
333 Ga0157372_10054137 3300013307 Bacteria 4475
334 Ga0157372_10285706 3300013307 Bacteria 1918
335 Ga0157372_10531163 3300013307 Bacteria 1371
336 Ga0157375_10295397 3300013308 Bacteria 1783
337 Ga0163163_10274853 3300014325 Bacteria 1736
338 Ga0163163_10919835 3300014325 Bacteria 938
339 Ga0157380_10106642 3300014326 Bacteria 2345
340 Ga0157380_10238914 3300014326 Bacteria 1637
341 Ga0157380_10353419 3300014326 Bacteria 1376
342 Ga0157380_10410699 3300014326 Bacteria 1288
343 Ga0157380_10430553 3300014326 Bacteria 1261
344 Ga0157377_10024992 3300014745 Bacteria 3181
345 Ga0157379_10127673 3300014968 Bacteria 2288
346 Ga0157376_10032882 3300014969 Bacteria 4169
347 Ga0206350_11216696 3300020080 Unclassified 930
348 Ga0213873_10029316 3300021358 Bacteria 1356
349 Ga0213873_10073477 3300021358 Bacteria 946
350 Ga0213873_10087883 3300021358 Bacteria 879
351 Ga0213872_10080904 3300021361 Bacteria 1460
352 Ga0213874_10014196 3300021377 Bacteria 2078
353 Ga0213875_10000825 3300021388 Bacteria 23073
354 Ga0213875_10066103 3300021388 Bacteria 1690
355 Ga0213875_10176529 3300021388 Bacteria 1003
356 Ga0213875_10259246 3300021388 Bacteria 820
357 Ga0213871_10050971 3300021441 Bacteria 1134
358 Ga0224572_1013070 3300024225 Bacteria 1583
359 Ga0228598_1006731 3300024227 Bacteria 2369
360 Ga0207653_10161829 3300025885 Bacteria 829
361 Ga0207682_10089870 3300025893 Bacteria 1330
362 Ga0207642_10000795 3300025899 Bacteria 9803
363 Ga0207688_10032513 3300025901 Bacteria 2884
364 Ga0207688_10157069 3300025901 Bacteria 1346
365 Ga0207680_10073954 3300025903 Bacteria 2120
366 Ga0207680_10128616 3300025903 Bacteria 1666
367 Ga0207647_10343128 3300025904 Bacteria 846
368 Ga0207699_10208349 3300025906 Unclassified 1328
369 Ga0207699_10294152 3300025906 Bacteria 1132
370 Ga0207645_10062098 3300025907 Bacteria 2387
371 Ga0207643_10005979 3300025908 Bacteria 6505
372 Ga0207643_10079325 3300025908 Bacteria 1900
373 Ga0207643_10082475 3300025908 Bacteria 1864
374 Ga0207684_10120761 3300025910 Bacteria 2247
375 Ga0207684_10152293 3300025910 Bacteria 1990
376 Ga0207684_10250360 3300025910 Bacteria 1528
377 Ga0207684_10511862 3300025910 Bacteria 1028
378 Ga0207654_10002438 3300025911 Bacteria 9499
379 Ga0207654_10156188 3300025911 Bacteria 1469
380 Ga0207654_10517648 3300025911 Bacteria 844
381 Ga0207707_10003497 3300025912 Bacteria 13902
382 Ga0207707_10034663 3300025912 Bacteria 4416
383 Ga0207707_10172913 3300025912 Bacteria 1887
384 Ga0207707_10332418 3300025912 Bacteria 1311
385 Ga0207707_10598905 3300025912 Bacteria 933
386 Ga0207695_10005372 3300025913 Bacteria 17034
387 Ga0207695_10009849 3300025913 Bacteria 11745
388 Ga0207695_10066308 3300025913 Bacteria 3708
389 Ga0207695_10142311 3300025913 Bacteria 2346
390 Ga0207695_10357886 3300025913 Bacteria 1346
391 Ga0207671_10009150 3300025914 Bacteria 8312
392 Ga0207671_10010577 3300025914 Bacteria 7595
393 Ga0207693_10193786 3300025915 Bacteria 1599
394 Ga0207693_10336899 3300025915 Unclassified 1181
395 Ga0207693_10623876 3300025915 Bacteria 838
396 Ga0207663_10396087 3300025916 Bacteria 1055
397 Ga0207660_10072454 3300025917 Bacteria 2509
398 Ga0207660_10151811 3300025917 Bacteria 1780
399 Ga0207660_10427887 3300025917 Bacteria 1068
400 Ga0207660_10557949 3300025917 Bacteria 932
401 Ga0207662_10003842 3300025918 Bacteria 7805
402 Ga0207662_10005398 3300025918 Bacteria 6809
403 Ga0207662_10054606 3300025918 Bacteria 2382
404 Ga0207662_10186669 3300025918 Bacteria 1336
405 Ga0207662_10249342 3300025918 Bacteria 1165
406 Ga0207662_10256929 3300025918 Bacteria 1149
407 Ga0207657_10075804 3300025919 Bacteria 2838
408 Ga0207657_10222137 3300025919 Bacteria 1513
409 Ga0207649_10605005 3300025920 Bacteria 843
410 Ga0207652_10056144 3300025921 Bacteria 3389
411 Ga0207652_10057906 3300025921 Bacteria 3338
412 Ga0207652_10199222 3300025921 Bacteria 1802
413 Ga0207652_10433309 3300025921 Bacteria 1185
414 Ga0207652_10559855 3300025921 Bacteria 1027
415 Ga0207652_10943957 3300025921 Bacteria 760
416 Ga0207646_10107048 3300025922 Bacteria 2508
417 Ga0207646_10204119 3300025922 Bacteria 1785
418 Ga0207646_10699518 3300025922 Bacteria 906
419 Ga0207681_10013395 3300025923 Bacteria 5075
420 Ga0207681_10308696 3300025923 Bacteria 1254
421 Ga0207681_10565111 3300025923 Bacteria 937
422 Ga0207694_10011571 3300025924 Bacteria 6657
423 Ga0207694_10070565 3300025924 Bacteria 2729
424 Ga0207694_10083769 3300025924 Bacteria 2508
425 Ga0207694_10100547 3300025924 Bacteria 2291
426 Ga0207650_10027881 3300025925 Bacteria 4045
427 Ga0207650_10057766 3300025925 Bacteria 2887
428 Ga0207659_10000497 3300025926 Bacteria 23633
429 Ga0207659_10220900 3300025926 Bacteria 1523
430 Ga0207687_10049529 3300025927 Bacteria 2921
431 Ga0207687_10135712 3300025927 Bacteria 1861
432 Ga0207700_10821603 3300025928 Bacteria 831
433 Ga0207664_10061928 3300025929 Bacteria 2987
434 Ga0207664_10200486 3300025929 Bacteria 1722
435 Ga0207644_10206425 3300025931 Bacteria 1552
436 Ga0207644_10238897 3300025931 Bacteria 1446
437 Ga0207644_10299538 3300025931 Bacteria 1295
438 Ga0207690_10032081 3300025932 Bacteria 3368
439 Ga0207690_10314710 3300025932 Bacteria 1229
440 Ga0207690_10640772 3300025932 Bacteria 870
441 Ga0207706_10020119 3300025933 Bacteria 5997
442 Ga0207706_10563027 3300025933 Bacteria 980
443 Ga0207686_10004090 3300025934 Bacteria 7824
444 Ga0207686_10070734 3300025934 Bacteria 2243
445 Ga0207709_10002925 3300025935 Bacteria 10430
446 Ga0207709_10120339 3300025935 Bacteria 1771
447 Ga0207709_10803295 3300025935 Unclassified 759
448 Ga0207670_10011914 3300025936 Bacteria 5063
449 Ga0207670_10016160 3300025936 Bacteria 4478
450 Ga0207670_10114076 3300025936 Bacteria 1952
451 Ga0207670_10129865 3300025936 Bacteria 1844
452 Ga0207670_10245363 3300025936 Bacteria 1382
453 Ga0207670_10383102 3300025936 Bacteria 1120
454 Ga0207704_10001762 3300025938 Bacteria 9683
455 Ga0207704_10056227 3300025938 Bacteria 2409
456 Ga0207665_10538333 3300025939 Bacteria 906
457 Ga0207691_10036125 3300025940 Bacteria 4579
458 Ga0207691_10058161 3300025940 Bacteria 3517
459 Ga0207691_10193737 3300025940 Bacteria 1772
460 Ga0207711_10078696 3300025941 Bacteria 2876
461 Ga0207711_10648249 3300025941 Bacteria 985
462 Ga0207689_10012264 3300025942 Bacteria 7330
463 Ga0207689_10193235 3300025942 Bacteria 1679
464 Ga0207689_10479048 3300025942 Bacteria 1042
465 Ga0207661_10185605 3300025944 Bacteria 1820
466 Ga0207661_10311469 3300025944 Bacteria 1413
467 Ga0207679_10049021 3300025945 Bacteria 3078
468 Ga0207679_10077749 3300025945 Bacteria 2526
469 Ga0207679_10171460 3300025945 Bacteria 1787
470 Ga0207679_10229517 3300025945 Bacteria 1566
471 Ga0207667_10012992 3300025949 Bacteria 9558
472 Ga0207667_10025639 3300025949 Bacteria 6451
473 Ga0207667_10046656 3300025949 Bacteria 4588
474 Ga0207651_10056533 3300025960 Bacteria 2701
475 Ga0207651_10089913 3300025960 Bacteria 2243
476 Ga0207651_10126165 3300025960 Bacteria 1950
477 Ga0207651_10355018 3300025960 Bacteria 1236
478 Ga0207712_10065482 3300025961 Bacteria 2594
479 Ga0207712_10400141 3300025961 Bacteria 1154
480 Ga0207712_10420068 3300025961 Bacteria 1128
481 Ga0207640_10016745 3300025981 Bacteria 4272
482 Ga0207640_10053345 3300025981 Unclassified 2639
483 Ga0207640_10381779 3300025981 Bacteria 1142
484 Ga0207658_10632374 3300025986 Bacteria 964
485 Ga0207677_10003975 3300026023 Bacteria 7883
486 Ga0207677_10153715 3300026023 Bacteria 1779
487 Ga0207677_10236452 3300026023 Bacteria 1475
488 Ga0207677_10419556 3300026023 Bacteria 1139
489 Ga0207677_11445044 3300026023 Bacteria 634
490 Ga0207703_10010213 3300026035 Bacteria 7358
491 Ga0207703_10049396 3300026035 Bacteria 3401
492 Ga0207639_10047688 3300026041 Bacteria 3239
493 Ga0207639_10089627 3300026041 Bacteria 2458
494 Ga0207639_10264118 3300026041 Bacteria 1507
495 Ga0207708_10008062 3300026075 Bacteria 7805
496 Ga0207708_10011323 3300026075 Bacteria 6641
497 Ga0207708_10043409 3300026075 Bacteria 3427
498 Ga0207708_10164159 3300026075 Bacteria 1755
499 Ga0207702_10796898 3300026078 Bacteria 934
500 Ga0207641_10058519 3300026088 Bacteria 3280
501 Ga0207641_10077479 3300026088 Bacteria 2877
502 Ga0207641_10097219 3300026088 Bacteria 2588
503 Ga0207648_10004952 3300026089 Bacteria 13550
504 Ga0207648_10014322 3300026089 Bacteria 7330
505 Ga0207648_11166595 3300026089 Bacteria 723
506 Ga0207676_10195036 3300026095 Bacteria 1785
507 Ga0207676_10398149 3300026095 Bacteria 1286
508 Ga0207674_10032849 3300026116 Bacteria 5440
509 Ga0207674_10094210 3300026116 Bacteria 2981
510 Ga0207674_10268535 3300026116 Bacteria 1653
511 Ga0207675_100014544 3300026118 Bacteria 7336
512 Ga0207675_100084083 3300026118 Bacteria 2986
513 Ga0207675_100090295 3300026118 Bacteria 2880
514 Ga0207675_100515545 3300026118 Bacteria 1191
515 Ga0207683_10401211 3300026121 Bacteria 1262
516 Ga0207698_10000418 3300026142 Bacteria 24481
517 Ga0207698_10096282 3300026142 Bacteria 2439
518 Ga0209179_1022397 3300027512 Bacteria 1240
519 Ga0207428_10002123 3300027907 Bacteria 19965
520 Ga0207428_10005694 3300027907 Bacteria 11582
521 Ga0207428_10009987 3300027907 Bacteria 8496
522 Ga0207428_10621878 3300027907 Bacteria 777
523 Ga0265357_1004223 3300028023 Bacteria 1285
524 Ga0268265_10000768 3300028380 Bacteria 31006
525 Ga0268265_10006681 3300028380 Bacteria 7809
526 Ga0268264_10010052 3300028381 Bacteria 7833
527 Ga0268264_10032877 3300028381 Bacteria 4257
528 Ga0265325_10048933 3300031241 Bacteria 2183
529 Ga0265339_10000323 3300031249 Bacteria 38406
530 Ga0307408_100534397 3300031548 Bacteria 1032
531 Ga0265313_10001589 3300031595 Bacteria 21087
532 Ga0307413_10209650 3300031824 Bacteria 1414
533 Ga0307406_10616230 3300031901 Bacteria 897
534 Ga0307412_10145957 3300031911 Bacteria 1739
535 Ga0307412_10318434 3300031911 Bacteria 1237
536 Ga0307416_100020661 3300032002 Bacteria 4705
537 Ga0307416_100255960 3300032002 Bacteria 1707
538 Ga0307411_10539823 3300032005 Bacteria 993
539 Ga0373930_0073807 3300034816 Bacteria 779
540 Ga0373948_0065466 3300034817 Bacteria 806
541 Ga0373948_0075578 3300034817 Bacteria 761
542 Ga0373938_0002374 3300034957 Bacteria 3035
543 Ga0373926_0212043 3300035083 Bacteria 747
544 Ga0373929_0073281 3300035085 Bacteria 823
545 Ga0373929_0113796 3300035085 Bacteria 694
546 Ga0373934_0086483 3300035086 Bacteria 1261
547 Ga0373934_0130576 3300035086 Bacteria 1024
548 Ga0373940_0011535 3300035088 Bacteria 2100
549 Ga0373949_0015149 3300035090 Bacteria 1720
550 Ga0373949_0062784 3300035090 Bacteria 959
551 Ga0373951_0007192 3300035091 Bacteria 2532
552 Ga0373923_0157488 3300035111 Bacteria 1034
553 Ga0373932_0025353 3300035112 Bacteria 1604
554 Ga0373932_0054115 3300035112 Bacteria 1200
555 Ga0373932_0078699 3300035112 Bacteria 1037
556 Ga0373932_0096999 3300035112 Bacteria 954
557 Ga0373936_0014321 3300035113 Bacteria 3028
558 Ga0373936_0118784 3300035113 Bacteria 1128
559 Ga0373936_0119286 3300035113 Bacteria 1125
560 Ga0373939_0118998 3300035114 Bacteria 929
561 Ga0373939_0174765 3300035114 Bacteria 797
562 Ga0373941_0019206 3300035115 Bacteria 1899
563 Ga0373941_0063080 3300035115 Bacteria 1211
564 Ga0373941_0303060 3300035115 Bacteria 638
565 Ga0373945_0056986 3300035116 Bacteria 1450
566 Ga0373945_0150938 3300035116 Bacteria 942
567 Ga0373945_0200436 3300035116 Bacteria 828
568 Ga0373953_0220546 3300035117 Bacteria 821
569 Ga0373954_0000511 3300035118 Bacteria 14523
570 Ga0373954_0012477 3300035118 Bacteria 3777
571 Ga0373954_0321770 3300035118 Bacteria 763
572 Ga0373956_0219978 3300035119 Bacteria 901
573 Ga0373956_0313801 3300035119 Bacteria 747
574 Ga0373957_0059787 3300035120 Bacteria 1474
575 Ga0373943_0058736 3300035170 Bacteria 1915
576 Ga0373946_0004572 3300035171 Bacteria 4959
577 Ga0373946_0012587 3300035171 Bacteria 3169
578 Ga0373955_0448188 3300035172 Bacteria 786
579 Ga0373942_0008660 3300035207 Bacteria 2374
580 Ga0373942_0049354 3300035207 Bacteria 1175
581 Ga0373961_0048850 3300035241 Bacteria 1248
582 Ga0373961_0125354 3300035241 Bacteria 855
583 Ga0373931_0001370 3300035691 Bacteria 10416
584 Ga0373931_0016572 3300035691 Bacteria 3629
585 Ga0373931_0177914 3300035691 Bacteria 1258
586 Ga0373931_0198465 3300035691 Bacteria 1197
587 Ga0373935_0013594 3300035692 Bacteria 4914
588 Ga0373935_0078759 3300035692 Bacteria 2138
589 Ga0373935_0211732 3300035692 Bacteria 1343
590 Ga0373927_0004154 3300035695 Bacteria 10175
591 Ga0373927_0020293 3300035695 Bacteria 4358
592 Ga0373927_0028738 3300035695 Bacteria 3627
593 Ga0373927_0260200 3300035695 Bacteria 1141
594 Ga0373927_0519708 3300035695 Bacteria 787
595 Ga0373927_0635729 3300035695 Unclassified 705
596 Ga0373933_0161322 3300035724 Bacteria 1423
597 Ga0373947_0005577 3300035725 Bacteria 7336
598 Ga0373947_0153678 3300035725 Unclassified 1484
599 Ga0373947_0345763 3300035725 Bacteria 997
600 Ga0373937_0088704 3300036401 Bacteria 2863
601 Ga0373937_0102121 3300036401 Bacteria 2662
602 Ga0373937_0139655 3300036401 Bacteria 2266
603 Ga0373937_0194409 3300036401 Bacteria 1906
604 Ga0373925_0057775 3300037068 Bacteria 2907
605 Ga0373925_0163458 3300037068 Bacteria 1754
606 Ga0373925_0214501 3300037068 Bacteria 1534
607 Ga0373925_0711148 3300037068 Bacteria 828
608 Ga0395899_0319187 3300037312 Bacteria 1047
609 Ga0395900_0080357 3300037418 Bacteria 3350
610 Ga0395905_0021133 3300037471 Bacteria 6162
611 Ga0395905_0026213 3300037471 Bacteria 5497
612 Ga0436364_0029308 3300037853 Bacteria 1189
613 Ga0436364_0685835 3300037853 Bacteria 964
614 Ga0436364_0734767 3300037853 Bacteria 8451
615 Ga0436364_0798454 3300037853 Unclassified 1686
616 Ga0436364_0937935 3300037853 Bacteria 2357
617 Ga0436364_0953789 3300037853 Bacteria 5220
618 Ga0436364_1104137 3300037853 Bacteria 965
619 Ga0436364_1433936 3300037853 Bacteria 1757
620 Ga0395901_0207803 3300038443 Bacteria 2050
621 Ga0436365_0560582 3300039437 Bacteria 7725
622 Ga0436365_1727819 3300039437 Bacteria 3270
623 Ga0436365_1911354 3300039437 Bacteria 2182
624 Ga0436360_0016934 3300039438 Bacteria 4815
625 Ga0436360_0392294 3300039438 Bacteria 1641
626 Ga0436360_0574300 3300039438 Bacteria 11535
627 Ga0436360_1108102 3300039438 Bacteria 1218
628 Ga0436360_1286715 3300039438 Bacteria 1569
629 Ga0436361_0213384 3300039447 Bacteria 3792
630 Ga0436361_0945327 3300039447 Bacteria 3240
631 Ga0436363_1223183 3300039450 Bacteria 1873
632 Ga0436362_0077617 3300039453 Bacteria 1067
633 Ga0436362_0497172 3300039453 Bacteria 1386
634 Ga0436362_0507543 3300039453 Bacteria 1663
635 Ga0436362_0811667 3300039453 Bacteria 1287
636 Ga0436362_0841797 3300039453 Bacteria 799
637 Ga0436362_1028381 3300039453 Bacteria 852
638 Ga0439453_0007188 3300041408 Bacteria 1758
639 Ga0439437_039435 3300042000 Bacteria 610
640 Ga0439441_000308 3300042001 Bacteria 4915
641 Ga0439441_002417 3300042001 Bacteria 2630
642 Ga0439443_001185 3300042003 Bacteria 2779
643 Ga0439451_033541 3300042009 Bacteria 1032
644 Ga0439456_007993 3300042013 Bacteria 2181
645 Ga0439435_0001860 3300042436 Bacteria 4037
646 Ga0439435_0002925 3300042436 Bacteria 3472
647 Ga0439444_0000098 3300042437 Bacteria 6882
648 Ga0439444_0004416 3300042437 Bacteria 2043
649 Ga0439460_0000132 3300042461 Bacteria 13295
650 Ga0453683_0283746 3300044673 Bacteria 1058
651 Ga0466965_0390459 3300044683 Bacteria 768
652 Ga0466961_0406063 3300044693 Bacteria 826
653 Ga0466963_0116796 3300044694 Bacteria 1834
654 Ga0466964_0174316 3300044706 Bacteria 1015
655 Ga0466957_0013848 3300044842 Bacteria 4688
656 Ga0466957_0076598 3300044842 Bacteria 2077
657 Ga0466959_0107877 3300045049 Bacteria 1990
658 Ga0466959_0247373 3300045049 Bacteria 1230
659 Ga0451576_0039474 3300045051 Bacteria 4996
660 Ga0451576_0048796 3300045051 Bacteria 4444
661 Ga0451576_0087590 3300045051 Bacteria 3238
662 Ga0451576_0260075 3300045051 Bacteria 1814
663 Ga0451576_0890880 3300045051 Bacteria 934
664 Ga0466958_0036036 3300045836 Bacteria 2959
665 Ga0466958_0038400 3300045836 Bacteria 2873
666 Ga0466958_0125679 3300045836 Bacteria 1608
667 Ga0495617_126682 3300046452 Bacteria 821
668 Ga0495592_0022552 3300046454 Bacteria 4789
669 Ga0495592_0051211 3300046454 Bacteria 3067
670 Ga0495592_0096631 3300046454 Bacteria 2111
671 Ga0495603_0018093 3300046455 Bacteria 4263
672 Ga0495629_0015797 3300046459 Bacteria 5421
673 Ga0495629_0371740 3300046459 Bacteria 973
674 Ga0495641_0013868 3300046461 Bacteria 4393
675 Ga0495641_0070180 3300046461 Bacteria 1574
676 Ga0495651_0261448 3300046462 Bacteria 1177
677 Ga0495653_0031607 3300046463 Bacteria 4207
678 Ga0495650_0025193 3300046471 Bacteria 2793
679 Ga0495580_0010156 3300046472 Bacteria 7354
680 Ga0495580_0045495 3300046472 Bacteria 3117
681 Ga0495605_0020617 3300046474 Bacteria 3501
682 Ga0495639_0016874 3300046475 Bacteria 3171
683 Ga0495639_0125139 3300046475 Bacteria 1228
684 Ga0495639_0173572 3300046475 Bacteria 1047
685 Ga0495662_0012118 3300046476 Bacteria 4213
686 Ga0495662_0012796 3300046476 Bacteria 4091
687 Ga0495584_0202124 3300046491 Bacteria 1010
688 Ga0495585_0000287 3300046492 Bacteria 50518
689 Ga0495585_0171718 3300046492 Bacteria 1120
690 Ga0495585_0195871 3300046492 Bacteria 1031
691 Ga0495594_0036571 3300046499 Bacteria 2677
692 Ga0495594_0059689 3300046499 Bacteria 2110
693 Ga0495594_0171783 3300046499 Bacteria 1233
694 Ga0495596_0001186 3300046500 Bacteria 15241
695 Ga0495596_0021535 3300046500 Bacteria 2631
696 Ga0495607_0135354 3300046501 Bacteria 1277
697 Ga0495583_0035664 3300046506 Bacteria 2372
698 Ga0495608_0010985 3300046511 Bacteria 6311
699 Ga0495608_0052853 3300046511 Bacteria 2688
700 Ga0495616_0032489 3300046513 Bacteria 2726
701 Ga0495618_0045131 3300046514 Bacteria 2779
702 Ga0495618_0156188 3300046514 Bacteria 1456
703 Ga0495628_0205094 3300046516 Bacteria 1484
704 Ga0495630_0023570 3300046517 Bacteria 4550
705 Ga0495630_0078289 3300046517 Bacteria 2492
706 Ga0495631_0009622 3300046518 Bacteria 4820
707 Ga0495631_0020727 3300046518 Bacteria 3068
708 Ga0495643_0028181 3300046522 Bacteria 3151
709 Ga0495643_0046436 3300046522 Bacteria 2354
710 Ga0495644_0027452 3300046523 Bacteria 2156
711 Ga0495644_0064411 3300046523 Bacteria 1378
712 Ga0495644_0096612 3300046523 Bacteria 1116
713 Ga0495648_0071142 3300046524 Bacteria 2018
714 Ga0495648_0084944 3300046524 Bacteria 1790
715 Ga0495648_0113398 3300046524 Bacteria 1470
716 Ga0495648_0149643 3300046524 Bacteria 1219
717 Ga0495663_0010629 3300046525 Bacteria 2561
718 Ga0495666_0025550 3300046526 Bacteria 2916
719 Ga0495666_0061321 3300046526 Bacteria 1797
720 Ga0495642_0038728 3300046528 Bacteria 1932
721 Ga0495652_0094204 3300046529 Bacteria 2443
722 Ga0495665_0032907 3300046531 Bacteria 2774
723 Ga0495640_0017848 3300046533 Bacteria 5278
724 Ga0495640_0043549 3300046533 Bacteria 3125
725 Ga0495640_0203586 3300046533 Bacteria 1253
726 Ga0495586_0009349 3300046535 Bacteria 5214
727 Ga0495586_0031541 3300046535 Bacteria 2839
728 Ga0495586_0378899 3300046535 Bacteria 813
729 Ga0495587_0014866 3300046536 Bacteria 4870
730 Ga0495598_0077462 3300046537 Bacteria 1060
731 Ga0495598_0091776 3300046537 Bacteria 992
732 Ga0495609_0011309 3300046538 Bacteria 4254
733 Ga0495609_0045100 3300046538 Bacteria 1976
734 Ga0495609_0179783 3300046538 Bacteria 891
735 Ga0495621_0007990 3300046539 Bacteria 3152
736 Ga0495621_0072735 3300046539 Bacteria 1269
737 Ga0495621_0093208 3300046539 Bacteria 1137
738 Ga0495621_0151082 3300046539 Bacteria 914
739 Ga0495597_0018871 3300046542 Bacteria 3232
740 Ga0495645_0358318 3300046543 Bacteria 938
741 Ga0495622_0031565 3300046557 Bacteria 2475
742 Ga0495622_0036405 3300046557 Bacteria 2295
743 Ga0495622_0081566 3300046557 Bacteria 1488
744 Ga0495633_0131984 3300046558 Bacteria 1156
745 Ga0495667_0025855 3300046559 Bacteria 3954
746 Ga0495667_0071968 3300046559 Bacteria 2254
747 Ga0495667_0283637 3300046559 Bacteria 1051
748 Ga0495656_0067782 3300046615 Bacteria 1576
749 Ga0495656_0130941 3300046615 Bacteria 1194
750 Ga0495668_0038655 3300046616 Bacteria 2666
751 Ga0495634_0033792 3300046642 Bacteria 3512
752 Ga0495634_0116594 3300046642 Bacteria 1713
753 Ga0495634_0126144 3300046642 Bacteria 1635
754 Ga0495611_0053960 3300046648 Bacteria 1815
755 Ga0495635_0094248 3300046663 Bacteria 2047
756 Ga0495635_0233293 3300046663 Bacteria 1243
757 Ga0495659_0011488 3300046664 Bacteria 2853
758 Ga0495659_0018068 3300046664 Bacteria 2345
759 Ga0495659_0026177 3300046664 Bacteria 2002
760 Ga0495659_0086521 3300046664 Bacteria 1197
761 Ga0495659_0097492 3300046664 Bacteria 1135
762 Ga0495661_0036014 3300046665 Bacteria 3102
763 Ga0495588_0003424 3300046674 Bacteria 6894
764 Ga0495588_0006205 3300046674 Bacteria 5372
765 Ga0495657_0051824 3300046675 Bacteria 2755
766 Ga0495599_0009378 3300046678 Bacteria 5980
767 Ga0495599_0025668 3300046678 Bacteria 3690
768 Ga0495647_0001466 3300046681 Bacteria 7317
769 Ga0495647_0012487 3300046681 Bacteria 2926
770 Ga0495647_0280158 3300046681 Unclassified 748
771 Ga0495658_0190664 3300046683 Bacteria 1274
772 Ga0495658_0219495 3300046683 Bacteria 1190
773 Ga0495658_0452429 3300046683 Bacteria 820
774 Ga0495658_0489386 3300046683 Bacteria 786
775 Ga0495669_0040245 3300046684 Bacteria 2072
776 Ga0495669_0049257 3300046684 Bacteria 1886
777 Ga0495669_0053312 3300046684 Bacteria 1819
778 Ga0495613_0498716 3300046689 Bacteria 820
779 Ga0495624_0053347 3300046690 Bacteria 2553
780 Ga0495624_0435521 3300046690 Bacteria 786
781 Ga0495600_0005383 3300046809 Bacteria 7715
782 Ga0495600_0286202 3300046809 Bacteria 1042
783 Ga0495581_0301604 3300047315 Bacteria 936
784 Ga0495581_0351917 3300047315 Bacteria 860
785 Ga0495604_0066910 3300047317 Bacteria 2731
786 Ga0495604_0081829 3300047317 Bacteria 2416
787 Ga0495636_0045399 3300047318 Bacteria 1831
788 Ga0495636_0046260 3300047318 Bacteria 1814
789 Ga0495636_0059994 3300047318 Unclassified 1607
790 Ga0495636_0121196 3300047318 Bacteria 1157
791 Ga0495636_0232715 3300047318 Unclassified 848
792 Ga0495674_0058934 3300047319 Bacteria 3355
793 Ga0495674_0136209 3300047319 Bacteria 2066
794 Ga0495672_0037083 3300047320 Bacteria 2987
795 Ga0495672_0099404 3300047320 Bacteria 1581
796 Ga0495672_0111948 3300047320 Bacteria 1463
797 Ga0495676_0015250 3300047321 Bacteria 6851
798 Ga0495676_0039356 3300047321 Bacteria 3916
799 Ga0495680_0009272 3300047322 Bacteria 8865
800 Ga0495683_0096614 3300047323 Bacteria 1425
801 Ga0495683_0164866 3300047323 Bacteria 1022
802 Ga0495675_0056042 3300047444 Bacteria 2499
803 Ga0495677_0049783 3300047445 Bacteria 1541
804 Ga0495677_0058045 3300047445 Unclassified 1431
805 Ga0495677_0070702 3300047445 Bacteria 1300
806 Ga0495677_0122412 3300047445 Bacteria 993
807 Ga0495673_0022925 3300047469 Bacteria 3050
808 Ga0495681_0043408 3300047470 Bacteria 2168
809 Ga0495684_0407861 3300047471 Bacteria 952
810 Ga0495686_0517556 3300047472 Unclassified 626
811 Ga0495626_0009050 3300048091 Bacteria 5399
812 Ga0495626_0071387 3300048091 Bacteria 1560
813 Ga0496100_0565306 3300048903 Unclassified 881
814 Ga0496104_0020113 3300048907 Bacteria 6117
815 Ga0496104_0026791 3300048907 Bacteria 5328
816 Ga0496106_0000002 3300048909 Bacteria 377020
817 Ga0496106_0191994 3300048909 Bacteria 1624
818 Ga0496106_0658870 3300048909 Bacteria 836
819 Ga0496107_0040768 3300048910 Bacteria 3334
820 Ga0496110_0232968 3300048913 Bacteria 1675
821 Ga0496110_0534462 3300048913 Unclassified 1066
822 Ga0496114_0071661 3300048917 Bacteria 2913
823 Ga0496114_0589033 3300048917 Bacteria 981
824 Ga0496117_0026401 3300048920 Bacteria 4545
825 Ga0496118_0036898 3300048921 Bacteria 3943
826 Ga0496121_0000188 3300048924 Bacteria 138221
827 Ga0496121_0002262 3300048924 Bacteria 29972
828 Ga0496121_0004978 3300048924 Bacteria 17407
829 Ga0496126_0000783 3300048929 Bacteria 57293
830 Ga0496126_0386095 3300048929 Bacteria 1139
831 Ga0495682_0053774 3300049460 Bacteria 1462
832 Ga0501298_044908 3300049521 Bacteria 903
833 Ga0501298_051249 3300049521 Bacteria 857
834 Ga0501033_0003162 3300049570 Bacteria 13681
835 Ga0501033_0441570 3300049570 Bacteria 905
836 Ga0501037_0483972 3300049573 Bacteria 841
837 Ga0501039_0011740 3300049575 Bacteria 6672
838 Ga0501039_0056564 3300049575 Bacteria 3039
839 Ga0501039_0535035 3300049575 Bacteria 920
840 Ga0501040_0299361 3300049576 Bacteria 1150
841 Ga0501041_0067913 3300049577 Bacteria 2185
842 Ga0501041_0073191 3300049577 Bacteria 2106
843 Ga0501042_0045076 3300049578 Bacteria 3143
844 Ga0501042_0165180 3300049578 Bacteria 1597
845 Ga0501043_0118389 3300049579 Bacteria 2077
846 Ga0501043_0210105 3300049579 Bacteria 1509
847 Ga0501043_0282023 3300049579 Bacteria 1273
848 Ga0501046_0000583 3300049580 Bacteria 35953
849 Ga0501046_0010778 3300049580 Bacteria 7839
850 Ga0501047_0253615 3300049581 Bacteria 1608
851 Ga0501048_0260692 3300049582 Bacteria 1231
852 Ga0501068_0107806 3300049584 Bacteria 1730
853 Ga0501071_0031872 3300049587 Bacteria 3740
854 Ga0501072_0024394 3300049588 Bacteria 4704
855 Ga0501075_0002898 3300049591 Bacteria 11507
856 Ga0501076_0000718 3300049592 Bacteria 21378
857 Ga0501076_0007717 3300049592 Bacteria 7839
858 Ga0501077_0126640 3300049593 Bacteria 1619
859 Ga0501250_019263 3300049680 Bacteria 871
860 Ga0501079_0008196 3300049741 Bacteria 7919
861 Ga0501079_0078937 3300049741 Bacteria 2546
862 Ga0501080_0541140 3300049742 Bacteria 1038
863 Ga0501081_0001411 3300049743 Bacteria 14690
864 Ga0501081_0326044 3300049743 Bacteria 1129
865 Ga0501081_0638671 3300049743 Bacteria 798
866 Ga0501268_030937 3300049765 Bacteria 968
867 Ga0501044_0718462 3300049823 Unclassified 883
868 Ga0501045_0009931 3300049824 Bacteria 6660
869 Ga0501045_0016854 3300049824 Bacteria 5190
870 nmdc:mga0k408_34802_c1 3300050493 Bacteria 2885
871 nmdc:mga07m45_100556_c1 3300050496 Bacteria 1660
872 nmdc:mga05p37_1369951_c1 3300050507 Unclassified 715
873 nmdc:mga05p37_29455_c1 3300050507 Bacteria 6699
874 nmdc:mga05p37_31057_c1 3300050507 Bacteria 6523
875 nmdc:mga05p37_3200_c1 3300050507 Bacteria 19051
876 nmdc:mga05p37_331_c1 3300050507 Bacteria 50709
877 nmdc:mga05p37_53342_c1 3300050507 Bacteria 3973
878 nmdc:mga05p37_573131_c1 3300050507 Bacteria 1280
879 nmdc:mga05p37_762130_c1 3300050507 Bacteria 1065
880 nmdc:mga05p37_974689_c1 3300050507 Bacteria 904
881 nmdc:mga09592_118522_c1 3300050508 Bacteria 2272
882 nmdc:mga09592_314338_c1 3300050508 Bacteria 1357
883 nmdc:mga09592_3807_c1 3300050508 Bacteria 12145
884 nmdc:mga09592_4034_c1 3300050508 Bacteria 11848
885 nmdc:mga09592_53166_c1 3300050508 Bacteria 3419
886 nmdc:mga09592_65193_c1 3300050508 Bacteria 3085
887 nmdc:mga0qj67_180152_c1 3300050509 Bacteria 1716
888 nmdc:mga0qj67_53781_c1 3300050509 Bacteria 3188
889 nmdc:mga06r32_15222_c1 3300050510 Bacteria 6987
890 nmdc:mga06r32_970685_c1 3300050510 Bacteria 803
891 nmdc:mga06r32_982662_c1 3300050510 Unclassified 797
892 nmdc:mga08y16_105182_c1 3300050511 Bacteria 2939
893 nmdc:mga08y16_16773_c1 3300050511 Bacteria 7710
894 nmdc:mga08y16_169957_c1 3300050511 Bacteria 2264
895 nmdc:mga08y16_223451_c1 3300050511 Bacteria 1949
896 nmdc:mga08y16_26107_c1 3300050511 Bacteria 6161
897 nmdc:mga08y16_357825_c1 3300050511 Bacteria 1499
898 nmdc:mga08y16_464144_c1 3300050511 Bacteria 1290
899 nmdc:mga08y16_476131_c1 3300050511 Bacteria 1271
900 nmdc:mga08y16_936191_c1 3300050511 Bacteria 850
901 nmdc:mga0n895_124172_c1 3300050512 Bacteria 2604
902 nmdc:mga0n895_12827_c1 3300050512 Bacteria 7530
903 nmdc:mga0n895_189577_c1 3300050512 Bacteria 2087
904 nmdc:mga0n895_353756_c1 3300050512 Bacteria 1488
905 nmdc:mga0n895_58375_c1 3300050512 Bacteria 3804
906 nmdc:mga0n895_68393_c1 3300050512 Bacteria 3519
907 nmdc:mga0n895_79858_c1 3300050512 Bacteria 3258
908 nmdc:mga0n895_83290_c1 3300050512 Bacteria 3190
909 nmdc:mga0n895_94392_c1 3300050512 Bacteria 2995
910 nmdc:mga0rr50_198712_c1 3300050513 Bacteria 1647
911 nmdc:mga0rr50_304312_c1 3300050513 Bacteria 1334
912 nmdc:mga0rr50_40872_c1 3300050513 Bacteria 3374
913 nmdc:mga0rr50_455586_c1 3300050513 Bacteria 1085
914 nmdc:mga0rr50_68676_c1 3300050513 Bacteria 2696
915 nmdc:mga08x19_13853_c1 3300050514 Bacteria 4885
916 nmdc:mga08x19_226369_c1 3300050514 Bacteria 1286
917 nmdc:mga08x19_28100_c1 3300050514 Bacteria 3521
918 nmdc:mga08x19_42987_c1 3300050514 Bacteria 2882
919 nmdc:mga08x19_52337_c1 3300050514 Bacteria 2626
920 nmdc:mga08x19_5578_c1 3300050514 Bacteria 7441
921 nmdc:mga0a205_263306_c1 3300050515 Bacteria 1602
922 nmdc:mga0a205_36607_c1 3300050515 Bacteria 4716
923 nmdc:mga0a205_374715_c1 3300050515 Bacteria 1289
924 nmdc:mga0a205_388685_c1 3300050515 Bacteria 1260
925 Ga0495601_0079478 3300053077 Bacteria 2103
926 Ga0495619_0093192 3300053085 Bacteria 2041
927 Ga0500651_0401240 3300053093 Bacteria 770
928 Ga0500621_070050 3300053126 Bacteria 1414
929 Ga0500590_001674 3300053148 Bacteria 9274
930 Ga0500619_000126 3300053154 Bacteria 20001
931 Ga0500622_0019734 3300053156 Plasmid 3579
932 Ga0590075_043931 3300059424 Bacteria 1144
933 Ga0501082_0025096 3300060353 Bacteria 5135
934 Ga0501082_0876661 3300060353 Unclassified 785
935 Ga0466962_0122025 3300061719 Bacteria 1258
936 Ga0530510_0003565 3300061734 Bacteria 10727
937 Ga0530510_0004356 3300061734 Bacteria 9801

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046459 Ga0495629_0015797 Ga0495629_0015797_2519_3097 172
2 3300046461 Ga0495641_0070180 Ga0495641_0070180_859_1437 172
3 3300046499 Ga0495594_0059689 Ga0495594_0059689_1412_1990 172
4 3300046683 Ga0495658_0190664 Ga0495658_0190664_403_981 172
5 iso_pu_bacteria 2857609550 2857613712 174
6 3300049823 Ga0501044_0718462 Ga0501044_0718462_216_848 175
7 3300053156 Ga0500622_0019734 Ga0500622_0019734_125_757 175
8 3300060353 Ga0501082_0876661 Ga0501082_0876661_112_744 175
9 3300009551 Ga0105238_10114073 Ga0105238_101140733 176
10 3300021358 Ga0213873_10029316 Ga0213873_100293162 177
11 3300039453 Ga0436362_0811667 Ga0436362_0811667_45_632 177
12 3300005329 Ga0070683_100273845 Ga0070683_1002738452 178
13 3300005344 Ga0070661_100397186 Ga0070661_1003971862 178
14 3300005564 Ga0070664_100073010 Ga0070664_1000730102 178
15 3300005616 Ga0068852_100111657 Ga0068852_1001116573 178
16 3300009177 Ga0105248_10126896 Ga0105248_101268962 178
17 3300013105 Ga0157369_11584414 Ga0157369_115844141 178
18 3300013296 Ga0157374_10316608 Ga0157374_103166082 178
19 3300025920 Ga0207649_10605005 Ga0207649_106050052 178
20 3300025931 Ga0207644_10238897 Ga0207644_102388972 178
21 3300025941 Ga0207711_10078696 Ga0207711_100786964 178
22 3300025944 Ga0207661_10185605 Ga0207661_101856052 178
23 3300025981 Ga0207640_10381779 Ga0207640_103817792 178
24 3300025986 Ga0207658_10632374 Ga0207658_106323742 178
25 3300021361 Ga0213872_10080904 Ga0213872_100809042 179
26 3300021441 Ga0213871_10050971 Ga0213871_100509712 179
27 3300034957 Ga0373938_0002374 Ga0373938_0002374_977_1567 179
28 3300035112 Ga0373932_0096999 Ga0373932_0096999_131_721 179
29 3300037312 Ga0395899_0319187 Ga0395899_0319187_13_567 179
30 3300039438 Ga0436360_1286715 Ga0436360_1286715_429_1016 179
31 3300039447 Ga0436361_0213384 Ga0436361_0213384_2068_2655 179
32 3300061719 Ga0466962_0122025 Ga0466962_0122025_30_584 179
33 3300031911 Ga0307412_10318434 Ga0307412_103184342 181
34 3300039450 Ga0436363_1223183 Ga0436363_1223183_1218_1778 181
35 3300005336 Ga0070680_100076410 Ga0070680_1000764104 182
36 3300005458 Ga0070681_10018567 Ga0070681_100185674 182
37 3300005458 Ga0070681_10399951 Ga0070681_103999511 182
38 3300005530 Ga0070679_100078330 Ga0070679_1000783302 182
39 3300005564 Ga0070664_100018613 Ga0070664_1000186136 182
40 3300013307 Ga0157372_10531163 Ga0157372_105311632 182
41 3300025912 Ga0207707_10003497 Ga0207707_100034975 182
42 3300025912 Ga0207707_10332418 Ga0207707_103324182 182
43 3300025921 Ga0207652_10057906 Ga0207652_100579062 182
44 3300025945 Ga0207679_10077749 Ga0207679_100777492 182
45 3300045836 Ga0466958_0125679 Ga0466958_0125679_94_705 182
46 3300005981 Ga0081538_10105034 Ga0081538_101050341 183
47 3300021358 Ga0213873_10073477 Ga0213873_100734772 183
48 3300025904 Ga0207647_10343128 Ga0207647_103431281 183
49 3300025921 Ga0207652_10559855 Ga0207652_105598552 183
50 3300025923 Ga0207681_10308696 Ga0207681_103086962 183
51 3300037853 Ga0436364_0953789 Ga0436364_0953789_3070_3639 183
52 3300039437 Ga0436365_1911354 Ga0436365_1911354_1538_2137 183
53 3300039438 Ga0436360_0574300 Ga0436360_0574300_157_777 183
54 3300039453 Ga0436362_0497172 Ga0436362_0497172_703_1323 183
55 3300042000 Ga0439437_039435 Ga0439437_039435_47_598 183
56 3300042001 Ga0439441_002417 Ga0439441_002417_1384_1938 183
57 3300042003 Ga0439443_001185 Ga0439443_001185_1179_1733 183
58 3300042009 Ga0439451_033541 Ga0439451_033541_393_947 183
59 3300042013 Ga0439456_007993 Ga0439456_007993_379_933 183
60 3300042436 Ga0439435_0001860 Ga0439435_0001860_13_567 183
61 3300042437 Ga0439444_0000098 Ga0439444_0000098_3457_4011 183
62 3300042461 Ga0439460_0000132 Ga0439460_0000132_9118_9672 183
63 3300047472 Ga0495686_0517556 Ga0495686_0517556_48_599 183
64 3300049575 Ga0501039_0011740 Ga0501039_0011740_3858_4412 183
65 3300049575 Ga0501039_0056564 Ga0501039_0056564_64_618 183
66 3300049577 Ga0501041_0073191 Ga0501041_0073191_1263_1817 183
67 3300049578 Ga0501042_0045076 Ga0501042_0045076_2118_2672 183
68 3300049579 Ga0501043_0282023 Ga0501043_0282023_384_938 183
69 3300049584 Ga0501068_0107806 Ga0501068_0107806_97_651 183
70 3300049587 Ga0501071_0031872 Ga0501071_0031872_464_1018 183
71 3300049591 Ga0501075_0002898 Ga0501075_0002898_3748_4302 183
72 3300049592 Ga0501076_0000718 Ga0501076_0000718_5030_5584 183
73 3300049741 Ga0501079_0008196 Ga0501079_0008196_6597_7151 183
74 3300049741 Ga0501079_0078937 Ga0501079_0078937_1956_2510 183
75 3300049742 Ga0501080_0541140 Ga0501080_0541140_321_875 183
76 3300049743 Ga0501081_0001411 Ga0501081_0001411_11507_12061 183
77 3300049824 Ga0501045_0009931 Ga0501045_0009931_3542_4096 183
78 3300050515 nmdc:mga0a205_374715_c1 nmdc:mga0a205_374715_c1_504_1121 183
79 3300050515 nmdc:mga0a205_388685_c1 nmdc:mga0a205_388685_c1_114_671 183
80 3300060353 Ga0501082_0025096 Ga0501082_0025096_399_953 183
81 3300061734 Ga0530510_0003565 Ga0530510_0003565_3296_3850 183
82 3300003203 JGI25406J46586_10025474 JGI25406J46586_100254743 184
83 3300005295 Ga0065707_10119894 Ga0065707_101198942 184
84 3300005328 Ga0070676_10342262 Ga0070676_103422621 184
85 3300005336 Ga0070680_100096124 Ga0070680_1000961242 184
86 3300005336 Ga0070680_100113526 Ga0070680_1001135262 184
87 3300005355 Ga0070671_100162160 Ga0070671_1001621603 184
88 3300005436 Ga0070713_100030251 Ga0070713_1000302513 184
89 3300005444 Ga0070694_100062119 Ga0070694_1000621192 184
90 3300005467 Ga0070706_100586103 Ga0070706_1005861032 184
91 3300005467 Ga0070706_101192060 Ga0070706_1011920601 184
92 3300005536 Ga0070697_100025846 Ga0070697_1000258464 184
93 3300005536 Ga0070697_100744669 Ga0070697_1007446692 184
94 3300005544 Ga0070686_100095324 Ga0070686_1000953243 184
95 3300005545 Ga0070695_100018488 Ga0070695_1000184882 184
96 3300005546 Ga0070696_100036097 Ga0070696_1000360972 184
97 3300005546 Ga0070696_100215575 Ga0070696_1002155752 184
98 3300005549 Ga0070704_100216431 Ga0070704_1002164313 184
99 3300005577 Ga0068857_100158661 Ga0068857_1001586613 184
100 3300005719 Ga0068861_100486384 Ga0068861_1004863842 184
101 3300005841 Ga0068863_101051610 Ga0068863_1010516102 184
102 3300005937 Ga0081455_10044130 Ga0081455_100441304 184
103 3300005985 Ga0081539_10001417 Ga0081539_1000141719 184
104 3300005985 Ga0081539_10018413 Ga0081539_100184133 184
105 3300006028 Ga0070717_10744967 Ga0070717_107449672 184
106 3300006173 Ga0070716_100410819 Ga0070716_1004108192 184
107 3300006175 Ga0070712_100380563 Ga0070712_1003805632 184
108 3300006175 Ga0070712_100546395 Ga0070712_1005463952 184
109 3300006844 Ga0075428_100001175 Ga0075428_1000011756 184
110 3300006880 Ga0075429_100011040 Ga0075429_1000110405 184
111 3300007265 Ga0099794_10042411 Ga0099794_100424112 184
112 3300007788 Ga0099795_10264331 Ga0099795_102643311 184
113 3300009094 Ga0111539_10001620 Ga0111539_100016208 184
114 3300009094 Ga0111539_10064868 Ga0111539_100648686 184
115 3300009094 Ga0111539_10252812 Ga0111539_102528123 184
116 3300009094 Ga0111539_10263141 Ga0111539_102631412 184
117 3300009094 Ga0111539_10538569 Ga0111539_105385691 184
118 3300010375 Ga0105239_10447392 Ga0105239_104473923 184
119 3300020080 Ga0206350_11216696 Ga0206350_112166962 184
120 3300021358 Ga0213873_10087883 Ga0213873_100878831 184
121 3300021377 Ga0213874_10014196 Ga0213874_100141962 184
122 3300021388 Ga0213875_10066103 Ga0213875_100661031 184
123 3300021388 Ga0213875_10176529 Ga0213875_101765292 184
124 3300024225 Ga0224572_1013070 Ga0224572_10130702 184
125 3300024227 Ga0228598_1006731 Ga0228598_10067313 184
126 3300025906 Ga0207699_10208349 Ga0207699_102083492 184
127 3300025910 Ga0207684_10250360 Ga0207684_102503602 184
128 3300025915 Ga0207693_10193786 Ga0207693_101937862 184
129 3300025915 Ga0207693_10336899 Ga0207693_103368992 184
130 3300025915 Ga0207693_10623876 Ga0207693_106238761 184
131 3300025916 Ga0207663_10396087 Ga0207663_103960872 184
132 3300025917 Ga0207660_10072454 Ga0207660_100724543 184
133 3300025917 Ga0207660_10427887 Ga0207660_104278872 184
134 3300025928 Ga0207700_10821603 Ga0207700_108216032 184
135 3300025939 Ga0207665_10538333 Ga0207665_105383332 184
136 3300026118 Ga0207675_100515545 Ga0207675_1005155452 184
137 3300027512 Ga0209179_1022397 Ga0209179_10223971 184
138 3300028023 Ga0265357_1004223 Ga0265357_10042232 184
139 3300031241 Ga0265325_10048933 Ga0265325_100489334 184
140 3300031249 Ga0265339_10000323 Ga0265339_1000032313 184
141 3300031595 Ga0265313_10001589 Ga0265313_1000158921 184
142 3300035083 Ga0373926_0212043 Ga0373926_0212043_77_646 184
143 3300035086 Ga0373934_0086483 Ga0373934_0086483_514_1068 184
144 3300035086 Ga0373934_0130576 Ga0373934_0130576_25_579 184
145 3300035111 Ga0373923_0157488 Ga0373923_0157488_193_747 184
146 3300035113 Ga0373936_0014321 Ga0373936_0014321_1935_2489 184
147 3300035116 Ga0373945_0150938 Ga0373945_0150938_377_931 184
148 3300035116 Ga0373945_0200436 Ga0373945_0200436_59_613 184
149 3300035117 Ga0373953_0220546 Ga0373953_0220546_76_630 184
150 3300035118 Ga0373954_0000511 Ga0373954_0000511_290_844 184
151 3300035118 Ga0373954_0012477 Ga0373954_0012477_1821_2375 184
152 3300035118 Ga0373954_0321770 Ga0373954_0321770_13_567 184
153 3300035119 Ga0373956_0219978 Ga0373956_0219978_155_709 184
154 3300035119 Ga0373956_0313801 Ga0373956_0313801_66_620 184
155 3300035120 Ga0373957_0059787 Ga0373957_0059787_197_751 184
156 3300035171 Ga0373946_0012587 Ga0373946_0012587_1764_2318 184
157 3300035172 Ga0373955_0448188 Ga0373955_0448188_179_733 184
158 3300035691 Ga0373931_0198465 Ga0373931_0198465_523_1095 184
159 3300035692 Ga0373935_0078759 Ga0373935_0078759_1427_1981 184
160 3300035692 Ga0373935_0211732 Ga0373935_0211732_631_1185 184
161 3300035695 Ga0373927_0020293 Ga0373927_0020293_318_872 184
162 3300035695 Ga0373927_0028738 Ga0373927_0028738_2597_3151 184
163 3300035695 Ga0373927_0260200 Ga0373927_0260200_59_613 184
164 3300035695 Ga0373927_0519708 Ga0373927_0519708_41_616 184
165 3300035724 Ga0373933_0161322 Ga0373933_0161322_23_577 184
166 3300035725 Ga0373947_0345763 Ga0373947_0345763_186_740 184
167 3300036401 Ga0373937_0088704 Ga0373937_0088704_198_752 184
168 3300036401 Ga0373937_0194409 Ga0373937_0194409_847_1401 184
169 3300037853 Ga0436364_0029308 Ga0436364_0029308_178_747 184
170 3300037853 Ga0436364_0685835 Ga0436364_0685835_127_804 184
171 3300037853 Ga0436364_0798454 Ga0436364_0798454_838_1461 184
172 3300037853 Ga0436364_0937935 Ga0436364_0937935_566_1135 184
173 3300037853 Ga0436364_1433936 Ga0436364_1433936_1043_1612 184
174 3300039438 Ga0436360_0392294 Ga0436360_0392294_499_1143 184
175 3300039438 Ga0436360_1108102 Ga0436360_1108102_463_1119 184
176 3300039447 Ga0436361_0945327 Ga0436361_0945327_1224_1859 184
177 3300039453 Ga0436362_0077617 Ga0436362_0077617_208_891 184
178 3300039453 Ga0436362_1028381 Ga0436362_1028381_47_724 184
179 3300044694 Ga0466963_0116796 Ga0466963_0116796_581_1153 184
180 3300045049 Ga0466959_0107877 Ga0466959_0107877_931_1545 184
181 3300045836 Ga0466958_0036036 Ga0466958_0036036_1398_1970 184
182 3300046454 Ga0495592_0096631 Ga0495592_0096631_872_1426 184
183 3300046459 Ga0495629_0371740 Ga0495629_0371740_70_624 184
184 3300046461 Ga0495641_0013868 Ga0495641_0013868_1814_2368 184
185 3300046462 Ga0495651_0261448 Ga0495651_0261448_76_630 184
186 3300046463 Ga0495653_0031607 Ga0495653_0031607_3342_3896 184
187 3300046472 Ga0495580_0045495 Ga0495580_0045495_2024_2578 184
188 3300046475 Ga0495639_0016874 Ga0495639_0016874_2428_2982 184
189 3300046476 Ga0495662_0012118 Ga0495662_0012118_2190_2744 184
190 3300046499 Ga0495594_0171783 Ga0495594_0171783_175_729 184
191 3300046511 Ga0495608_0052853 Ga0495608_0052853_2107_2661 184
192 3300046514 Ga0495618_0045131 Ga0495618_0045131_2173_2727 184
193 3300046517 Ga0495630_0078289 Ga0495630_0078289_540_1094 184
194 3300046524 Ga0495648_0071142 Ga0495648_0071142_1293_1847 184
195 3300046526 Ga0495666_0025550 Ga0495666_0025550_117_671 184
196 3300046533 Ga0495640_0017848 Ga0495640_0017848_4267_4821 184
197 3300046533 Ga0495640_0203586 Ga0495640_0203586_28_582 184
198 3300046535 Ga0495586_0031541 Ga0495586_0031541_167_721 184
199 3300046536 Ga0495587_0014866 Ga0495587_0014866_540_1094 184
200 3300046538 Ga0495609_0179783 Ga0495609_0179783_246_803 184
201 3300046539 Ga0495621_0151082 Ga0495621_0151082_41_598 184
202 3300046557 Ga0495622_0081566 Ga0495622_0081566_600_1154 184
203 3300046559 Ga0495667_0025855 Ga0495667_0025855_3186_3740 184
204 3300046559 Ga0495667_0071968 Ga0495667_0071968_1456_2010 184
205 3300046615 Ga0495656_0130941 Ga0495656_0130941_173_727 184
206 3300046642 Ga0495634_0116594 Ga0495634_0116594_958_1512 184
207 3300046642 Ga0495634_0126144 Ga0495634_0126144_62_616 184
208 3300046663 Ga0495635_0233293 Ga0495635_0233293_59_613 184
209 3300046675 Ga0495657_0051824 Ga0495657_0051824_1746_2300 184
210 3300046678 Ga0495599_0009378 Ga0495599_0009378_4543_5097 184
211 3300046681 Ga0495647_0012487 Ga0495647_0012487_539_1093 184
212 3300046681 Ga0495647_0280158 Ga0495647_0280158_159_731 184
213 3300046683 Ga0495658_0219495 Ga0495658_0219495_595_1149 184
214 3300046683 Ga0495658_0489386 Ga0495658_0489386_77_631 184
215 3300046690 Ga0495624_0053347 Ga0495624_0053347_1706_2260 184
216 3300046690 Ga0495624_0435521 Ga0495624_0435521_89_643 184
217 3300046809 Ga0495600_0005383 Ga0495600_0005383_1386_1940 184
218 3300047315 Ga0495581_0351917 Ga0495581_0351917_293_847 184
219 3300047317 Ga0495604_0066910 Ga0495604_0066910_198_752 184
220 3300047319 Ga0495674_0058934 Ga0495674_0058934_1910_2464 184
221 3300047444 Ga0495675_0056042 Ga0495675_0056042_406_960 184
222 3300047471 Ga0495684_0407861 Ga0495684_0407861_193_747 184
223 3300048903 Ga0496100_0565306 Ga0496100_0565306_52_621 184
224 3300048907 Ga0496104_0020113 Ga0496104_0020113_43_612 184
225 3300048910 Ga0496107_0040768 Ga0496107_0040768_52_621 184
226 3300048913 Ga0496110_0534462 Ga0496110_0534462_23_592 184
227 3300048917 Ga0496114_0071661 Ga0496114_0071661_1258_1827 184
228 3300048929 Ga0496126_0386095 Ga0496126_0386095_201_770 184
229 3300050507 nmdc:mga05p37_1369951_c1 nmdc:mga05p37_1369951_c1_139_693 184
230 3300050508 nmdc:mga09592_3807_c1 nmdc:mga09592_3807_c1_1836_2390 184
231 3300050510 nmdc:mga06r32_982662_c1 nmdc:mga06r32_982662_c1_68_622 184
232 3300050511 nmdc:mga08y16_105182_c1 nmdc:mga08y16_105182_c1_49_603 184
233 3300050511 nmdc:mga08y16_223451_c1 nmdc:mga08y16_223451_c1_1244_1798 184
234 3300050511 nmdc:mga08y16_26107_c1 nmdc:mga08y16_26107_c1_1792_2364 184
235 3300053085 Ga0495619_0093192 Ga0495619_0093192_1411_1965 184
236 3300005295 Ga0065707_10124404 Ga0065707_101244043 185
237 3300005330 Ga0070690_100005091 Ga0070690_1000050918 185
238 3300005334 Ga0068869_100320743 Ga0068869_1003207432 185
239 3300005335 Ga0070666_10079909 Ga0070666_100799092 185
240 3300005336 Ga0070680_100034909 Ga0070680_1000349095 185
241 3300005337 Ga0070682_100006531 Ga0070682_1000065313 185
242 3300005338 Ga0068868_100007387 Ga0068868_1000073878 185
243 3300005340 Ga0070689_100007046 Ga0070689_1000070468 185
244 3300005341 Ga0070691_10002771 Ga0070691_100027713 185
245 3300005343 Ga0070687_100001749 Ga0070687_1000017498 185
246 3300005345 Ga0070692_10005868 Ga0070692_100058686 185
247 3300005355 Ga0070671_100121950 Ga0070671_1001219503 185
248 3300005364 Ga0070673_100163817 Ga0070673_1001638172 185
249 3300005406 Ga0070703_10025931 Ga0070703_100259313 185
250 3300005438 Ga0070701_10001946 Ga0070701_100019468 185
251 3300005440 Ga0070705_100003829 Ga0070705_1000038291 185
252 3300005441 Ga0070700_100015124 Ga0070700_1000151241 185
253 3300005444 Ga0070694_100009114 Ga0070694_1000091142 185
254 3300005444 Ga0070694_100323463 Ga0070694_1003234632 185
255 3300005458 Ga0070681_10020583 Ga0070681_100205834 185
256 3300005458 Ga0070681_10209125 Ga0070681_102091251 185
257 3300005459 Ga0068867_100008217 Ga0068867_1000082178 185
258 3300005518 Ga0070699_100216853 Ga0070699_1002168532 185
259 3300005530 Ga0070679_100074072 Ga0070679_1000740723 185
260 3300005536 Ga0070697_100441580 Ga0070697_1004415802 185
261 3300005544 Ga0070686_100269848 Ga0070686_1002698482 185
262 3300005545 Ga0070695_100004987 Ga0070695_1000049878 185
263 3300005545 Ga0070695_100212777 Ga0070695_1002127772 185
264 3300005545 Ga0070695_100249737 Ga0070695_1002497372 185
265 3300005546 Ga0070696_100163689 Ga0070696_1001636892 185
266 3300005547 Ga0070693_100002991 Ga0070693_1000029918 185
267 3300005549 Ga0070704_100001866 Ga0070704_1000018667 185
268 3300005563 Ga0068855_100067391 Ga0068855_1000673912 185
269 3300005615 Ga0070702_100018687 Ga0070702_1000186871 185
270 3300005616 Ga0068852_100579552 Ga0068852_1005795522 185
271 3300005617 Ga0068859_100016661 Ga0068859_1000166612 185
272 3300005617 Ga0068859_100889068 Ga0068859_1008890682 185
273 3300005618 Ga0068864_100215501 Ga0068864_1002155013 185
274 3300005718 Ga0068866_10147730 Ga0068866_101477303 185
275 3300005719 Ga0068861_100006773 Ga0068861_1000067738 185
276 3300005834 Ga0068851_10158927 Ga0068851_101589272 185
277 3300005840 Ga0068870_10075527 Ga0068870_100755273 185
278 3300005841 Ga0068863_100334484 Ga0068863_1003344842 185
279 3300005842 Ga0068858_100014725 Ga0068858_1000147258 185
280 3300005843 Ga0068860_100015796 Ga0068860_1000157968 185
281 3300005844 Ga0068862_100414622 Ga0068862_1004146222 185
282 3300006237 Ga0097621_100178597 Ga0097621_1001785972 185
283 3300006237 Ga0097621_100311934 Ga0097621_1003119342 185
284 3300006237 Ga0097621_100470323 Ga0097621_1004703232 185
285 3300006358 Ga0068871_100014460 Ga0068871_1000144602 185
286 3300006844 Ga0075428_100019806 Ga0075428_1000198062 185
287 3300006852 Ga0075433_10028232 Ga0075433_100282324 185
288 3300006871 Ga0075434_100365214 Ga0075434_1003652143 185
289 3300006871 Ga0075434_101552982 Ga0075434_1015529822 185
290 3300006881 Ga0068865_100006045 Ga0068865_1000060458 185
291 3300006914 Ga0075436_100060217 Ga0075436_1000602172 185
292 3300006914 Ga0075436_100180993 Ga0075436_1001809932 185
293 3300006931 Ga0097620_100016661 Ga0097620_1000166612 185
294 3300006931 Ga0097620_100889226 Ga0097620_1008892262 185
295 3300007076 Ga0075435_100083564 Ga0075435_1000835644 185
296 3300009092 Ga0105250_10023435 Ga0105250_100234351 185
297 3300009094 Ga0111539_10058846 Ga0111539_100588462 185
298 3300009094 Ga0111539_10157774 Ga0111539_101577744 185
299 3300009098 Ga0105245_10012615 Ga0105245_100126152 185
300 3300009147 Ga0114129_10031869 Ga0114129_100318698 185
301 3300009148 Ga0105243_10009573 Ga0105243_100095738 185
302 3300009174 Ga0105241_10825868 Ga0105241_108258682 185
303 3300009177 Ga0105248_10158379 Ga0105248_101583794 185
304 3300009177 Ga0105248_10736861 Ga0105248_107368612 185
305 3300013297 Ga0157378_10012667 Ga0157378_100126678 185
306 3300013306 Ga0163162_10326290 Ga0163162_103262903 185
307 3300013308 Ga0157375_10295397 Ga0157375_102953973 185
308 3300014326 Ga0157380_10238914 Ga0157380_102389143 185
309 3300014326 Ga0157380_10410699 Ga0157380_104106992 185
310 3300014968 Ga0157379_10127673 Ga0157379_101276733 185
311 3300014969 Ga0157376_10032882 Ga0157376_100328825 185
312 3300025885 Ga0207653_10161829 Ga0207653_101618292 185
313 3300025899 Ga0207642_10000795 Ga0207642_1000079511 185
314 3300025901 Ga0207688_10032513 Ga0207688_100325133 185
315 3300025903 Ga0207680_10128616 Ga0207680_101286163 185
316 3300025908 Ga0207643_10082475 Ga0207643_100824753 185
317 3300025910 Ga0207684_10152293 Ga0207684_101522933 185
318 3300025911 Ga0207654_10517648 Ga0207654_105176482 185
319 3300025912 Ga0207707_10172913 Ga0207707_101729133 185
320 3300025912 Ga0207707_10598905 Ga0207707_105989052 185
321 3300025917 Ga0207660_10151811 Ga0207660_101518112 185
322 3300025917 Ga0207660_10557949 Ga0207660_105579492 185
323 3300025918 Ga0207662_10003842 Ga0207662_100038428 185
324 3300025918 Ga0207662_10054606 Ga0207662_100546063 185
325 3300025921 Ga0207652_10056144 Ga0207652_100561443 185
326 3300025922 Ga0207646_10699518 Ga0207646_106995182 185
327 3300025927 Ga0207687_10135712 Ga0207687_101357121 185
328 3300025934 Ga0207686_10004090 Ga0207686_100040902 185
329 3300025935 Ga0207709_10002925 Ga0207709_1000292511 185
330 3300025936 Ga0207670_10129865 Ga0207670_101298652 185
331 3300025938 Ga0207704_10001762 Ga0207704_100017628 185
332 3300025941 Ga0207711_10648249 Ga0207711_106482492 185
333 3300025942 Ga0207689_10012264 Ga0207689_100122642 185
334 3300025949 Ga0207667_10012992 Ga0207667_100129928 185
335 3300025960 Ga0207651_10126165 Ga0207651_101261652 185
336 3300025961 Ga0207712_10065482 Ga0207712_100654823 185
337 3300025981 Ga0207640_10016745 Ga0207640_100167453 185
338 3300026023 Ga0207677_10003975 Ga0207677_100039758 185
339 3300026035 Ga0207703_10010213 Ga0207703_100102138 185
340 3300026075 Ga0207708_10008062 Ga0207708_100080622 185
341 3300026075 Ga0207708_10164159 Ga0207708_101641592 185
342 3300026088 Ga0207641_10077479 Ga0207641_100774792 185
343 3300026089 Ga0207648_10014322 Ga0207648_100143228 185
344 3300026095 Ga0207676_10195036 Ga0207676_101950363 185
345 3300026118 Ga0207675_100014544 Ga0207675_1000145442 185
346 3300027907 Ga0207428_10002123 Ga0207428_1000212312 185
347 3300028380 Ga0268265_10006681 Ga0268265_100066818 185
348 3300028381 Ga0268264_10010052 Ga0268264_100100527 185
349 3300031824 Ga0307413_10209650 Ga0307413_102096502 185
350 3300031911 Ga0307412_10145957 Ga0307412_101459572 185
351 3300032002 Ga0307416_100020661 Ga0307416_1000206615 185
352 3300032002 Ga0307416_100255960 Ga0307416_1002559601 185
353 3300034816 Ga0373930_0073807 Ga0373930_0073807_174_734 185
354 3300035085 Ga0373929_0113796 Ga0373929_0113796_52_612 185
355 3300035088 Ga0373940_0011535 Ga0373940_0011535_183_743 185
356 3300035091 Ga0373951_0007192 Ga0373951_0007192_561_1121 185
357 3300035112 Ga0373932_0025353 Ga0373932_0025353_106_666 185
358 3300035112 Ga0373932_0054115 Ga0373932_0054115_427_987 185
359 3300035112 Ga0373932_0078699 Ga0373932_0078699_342_902 185
360 3300035113 Ga0373936_0119286 Ga0373936_0119286_103_663 185
361 3300035114 Ga0373939_0118998 Ga0373939_0118998_61_621 185
362 3300035115 Ga0373941_0303060 Ga0373941_0303060_13_573 185
363 3300035116 Ga0373945_0056986 Ga0373945_0056986_188_748 185
364 3300035170 Ga0373943_0058736 Ga0373943_0058736_229_789 185
365 3300035171 Ga0373946_0004572 Ga0373946_0004572_124_684 185
366 3300035207 Ga0373942_0008660 Ga0373942_0008660_589_1149 185
367 3300035241 Ga0373961_0048850 Ga0373961_0048850_135_695 185
368 3300035691 Ga0373931_0001370 Ga0373931_0001370_3140_3700 185
369 3300035691 Ga0373931_0016572 Ga0373931_0016572_2484_3044 185
370 3300035692 Ga0373935_0013594 Ga0373935_0013594_273_833 185
371 3300035695 Ga0373927_0004154 Ga0373927_0004154_6869_7429 185
372 3300035725 Ga0373947_0005577 Ga0373947_0005577_5367_5927 185
373 3300036401 Ga0373937_0139655 Ga0373937_0139655_212_769 185
374 3300037068 Ga0373925_0163458 Ga0373925_0163458_879_1439 185
375 3300039453 Ga0436362_0507543 Ga0436362_0507543_928_1518 185
376 3300039453 Ga0436362_0841797 Ga0436362_0841797_205_777 185
377 3300042001 Ga0439441_000308 Ga0439441_000308_1284_1841 185
378 3300042436 Ga0439435_0002925 Ga0439435_0002925_1574_2131 185
379 3300042437 Ga0439444_0004416 Ga0439444_0004416_711_1268 185
380 3300042461 Ga0439460_0000132 Ga0439460_0000132_2824_3381 185
381 3300045051 Ga0451576_0039474 Ga0451576_0039474_4188_4748 185
382 3300045051 Ga0451576_0087590 Ga0451576_0087590_69_629 185
383 3300045051 Ga0451576_0260075 Ga0451576_0260075_553_1110 185
384 3300046452 Ga0495617_126682 Ga0495617_126682_210_782 185
385 3300046454 Ga0495592_0022552 Ga0495592_0022552_2349_2906 185
386 3300046472 Ga0495580_0010156 Ga0495580_0010156_6698_7258 185
387 3300046474 Ga0495605_0020617 Ga0495605_0020617_507_1079 185
388 3300046475 Ga0495639_0173572 Ga0495639_0173572_385_942 185
389 3300046476 Ga0495662_0012796 Ga0495662_0012796_2797_3354 185
390 3300046492 Ga0495585_0000287 Ga0495585_0000287_49527_50099 185
391 3300046492 Ga0495585_0195871 Ga0495585_0195871_285_869 185
392 3300046500 Ga0495596_0001186 Ga0495596_0001186_3760_4344 185
393 3300046500 Ga0495596_0001186 Ga0495596_0001186_9872_10444 185
394 3300046501 Ga0495607_0135354 Ga0495607_0135354_437_1021 185
395 3300046506 Ga0495583_0035664 Ga0495583_0035664_158_715 185
396 3300046511 Ga0495608_0010985 Ga0495608_0010985_5128_5685 185
397 3300046513 Ga0495616_0032489 Ga0495616_0032489_1034_1591 185
398 3300046514 Ga0495618_0156188 Ga0495618_0156188_32_589 185
399 3300046516 Ga0495628_0205094 Ga0495628_0205094_364_921 185
400 3300046517 Ga0495630_0023570 Ga0495630_0023570_2640_3197 185
401 3300046518 Ga0495631_0009622 Ga0495631_0009622_204_776 185
402 3300046518 Ga0495631_0020727 Ga0495631_0020727_145_729 185
403 3300046522 Ga0495643_0028181 Ga0495643_0028181_250_834 185
404 3300046522 Ga0495643_0046436 Ga0495643_0046436_578_1150 185
405 3300046523 Ga0495644_0027452 Ga0495644_0027452_745_1329 185
406 3300046523 Ga0495644_0096612 Ga0495644_0096612_43_615 185
407 3300046524 Ga0495648_0084944 Ga0495648_0084944_974_1531 185
408 3300046524 Ga0495648_0113398 Ga0495648_0113398_440_1024 185
409 3300046524 Ga0495648_0149643 Ga0495648_0149643_175_747 185
410 3300046526 Ga0495666_0061321 Ga0495666_0061321_669_1226 185
411 3300046529 Ga0495652_0094204 Ga0495652_0094204_1777_2334 185
412 3300046533 Ga0495640_0043549 Ga0495640_0043549_1694_2251 185
413 3300046535 Ga0495586_0009349 Ga0495586_0009349_3882_4439 185
414 3300046535 Ga0495586_0378899 Ga0495586_0378899_179_739 185
415 3300046537 Ga0495598_0077462 Ga0495598_0077462_404_970 185
416 3300046542 Ga0495597_0018871 Ga0495597_0018871_1024_1581 185
417 3300046543 Ga0495645_0358318 Ga0495645_0358318_355_912 185
418 3300046557 Ga0495622_0031565 Ga0495622_0031565_1580_2164 185
419 3300046557 Ga0495622_0036405 Ga0495622_0036405_103_663 185
420 3300046559 Ga0495667_0283637 Ga0495667_0283637_297_854 185
421 3300046616 Ga0495668_0038655 Ga0495668_0038655_418_990 185
422 3300046642 Ga0495634_0033792 Ga0495634_0033792_878_1435 185
423 3300046648 Ga0495611_0053960 Ga0495611_0053960_1068_1652 185
424 3300046663 Ga0495635_0094248 Ga0495635_0094248_492_1049 185
425 3300046664 Ga0495659_0026177 Ga0495659_0026177_1294_1851 185
426 3300046665 Ga0495661_0036014 Ga0495661_0036014_324_881 185
427 3300046674 Ga0495588_0006205 Ga0495588_0006205_4245_4805 185
428 3300046678 Ga0495599_0025668 Ga0495599_0025668_920_1477 185
429 3300046681 Ga0495647_0001466 Ga0495647_0001466_6633_7193 185
430 3300046683 Ga0495658_0452429 Ga0495658_0452429_31_591 185
431 3300046809 Ga0495600_0286202 Ga0495600_0286202_392_949 185
432 3300047317 Ga0495604_0081829 Ga0495604_0081829_398_955 185
433 3300047318 Ga0495636_0045399 Ga0495636_0045399_386_943 185
434 3300047318 Ga0495636_0059994 Ga0495636_0059994_877_1461 185
435 3300047318 Ga0495636_0121196 Ga0495636_0121196_278_838 185
436 3300047318 Ga0495636_0232715 Ga0495636_0232715_119_676 185
437 3300047320 Ga0495672_0099404 Ga0495672_0099404_924_1496 185
438 3300047320 Ga0495672_0111948 Ga0495672_0111948_720_1304 185
439 3300047321 Ga0495676_0015250 Ga0495676_0015250_2411_2992 185
440 3300047321 Ga0495676_0039356 Ga0495676_0039356_3108_3680 185
441 3300047322 Ga0495680_0009272 Ga0495680_0009272_4814_5371 185
442 3300047323 Ga0495683_0096614 Ga0495683_0096614_603_1187 185
443 3300047323 Ga0495683_0164866 Ga0495683_0164866_278_862 185
444 3300047445 Ga0495677_0058045 Ga0495677_0058045_649_1233 185
445 3300047445 Ga0495677_0070702 Ga0495677_0070702_448_1020 185
446 3300047469 Ga0495673_0022925 Ga0495673_0022925_267_851 185
447 3300047470 Ga0495681_0043408 Ga0495681_0043408_854_1411 185
448 3300048091 Ga0495626_0009050 Ga0495626_0009050_484_1041 185
449 3300048091 Ga0495626_0071387 Ga0495626_0071387_806_1378 185
450 3300048909 Ga0496106_0658870 Ga0496106_0658870_152_712 185
451 3300048917 Ga0496114_0589033 Ga0496114_0589033_401_961 185
452 3300048920 Ga0496117_0026401 Ga0496117_0026401_29_604 185
453 3300049460 Ga0495682_0053774 Ga0495682_0053774_267_839 185
454 3300049521 Ga0501298_044908 Ga0501298_044908_299_856 185
455 3300049575 Ga0501039_0535035 Ga0501039_0535035_316_879 185
456 3300049576 Ga0501040_0299361 Ga0501040_0299361_270_827 185
457 3300049577 Ga0501041_0067913 Ga0501041_0067913_46_702 185
458 3300049578 Ga0501042_0165180 Ga0501042_0165180_54_710 185
459 3300049579 Ga0501043_0210105 Ga0501043_0210105_475_1131 185
460 3300049580 Ga0501046_0010778 Ga0501046_0010778_7109_7765 185
461 3300049743 Ga0501081_0326044 Ga0501081_0326044_340_996 185
462 3300049824 Ga0501045_0016854 Ga0501045_0016854_810_1466 185
463 3300050507 nmdc:mga05p37_331_c1 nmdc:mga05p37_331_c1_39107_39667 185
464 3300050507 nmdc:mga05p37_974689_c1 nmdc:mga05p37_974689_c1_224_781 185
465 3300050508 nmdc:mga09592_4034_c1 nmdc:mga09592_4034_c1_2621_3181 185
466 3300050509 nmdc:mga0qj67_180152_c1 nmdc:mga0qj67_180152_c1_1138_1698 185
467 3300050511 nmdc:mga08y16_16773_c1 nmdc:mga08y16_16773_c1_6773_7333 185
468 3300050511 nmdc:mga08y16_357825_c1 nmdc:mga08y16_357825_c1_166_726 185
469 3300050511 nmdc:mga08y16_464144_c1 nmdc:mga08y16_464144_c1_296_901 185
470 3300050512 nmdc:mga0n895_189577_c1 nmdc:mga0n895_189577_c1_392_952 185
471 3300053077 Ga0495601_0079478 Ga0495601_0079478_246_803 185
472 3300005444 Ga0070694_100577901 Ga0070694_1005779012 186
473 3300031548 Ga0307408_100534397 Ga0307408_1005343971 186
474 3300035241 Ga0373961_0125354 Ga0373961_0125354_253_816 186
475 3300037471 Ga0395905_0021133 Ga0395905_0021133_408_974 186
476 3300045051 Ga0451576_0048796 Ga0451576_0048796_3757_4320 186
477 3300050512 nmdc:mga0n895_68393_c1 nmdc:mga0n895_68393_c1_165_728 186
478 3300050513 nmdc:mga0rr50_68676_c1 nmdc:mga0rr50_68676_c1_1913_2476 186
479 3300050514 nmdc:mga08x19_5578_c1 nmdc:mga08x19_5578_c1_588_1151 186
480 3300050515 nmdc:mga0a205_36607_c1 nmdc:mga0a205_36607_c1_1930_2493 186
481 3300053126 Ga0500621_070050 Ga0500621_070050_745_1314 186
482 3300000549 LJQas_1001792 LJQas_10017923 187
483 3300005549 Ga0070704_100095877 Ga0070704_1000958772 187
484 3300005981 Ga0081538_10125762 Ga0081538_101257622 187
485 3300006844 Ga0075428_100003327 Ga0075428_10000332714 187
486 3300006846 Ga0075430_100002934 Ga0075430_1000029345 187
487 3300006847 Ga0075431_100064349 Ga0075431_1000643493 187
488 3300006880 Ga0075429_100001637 Ga0075429_10000163712 187
489 3300009147 Ga0114129_10042478 Ga0114129_100424783 187
490 3300035090 Ga0373949_0015149 Ga0373949_0015149_1010_1597 187
491 3300039438 Ga0436360_0016934 Ga0436360_0016934_360_1037 187
492 3300041408 Ga0439453_0007188 Ga0439453_0007188_57_626 187
493 3300049521 Ga0501298_051249 Ga0501298_051249_141_704 187
494 3300049680 Ga0501250_019263 Ga0501250_019263_297_860 187
495 3300050507 nmdc:mga05p37_31057_c1 nmdc:mga05p37_31057_c1_4230_4799 187
496 3300050508 nmdc:mga09592_65193_c1 nmdc:mga09592_65193_c1_2043_2612 187
497 3300050509 nmdc:mga0qj67_53781_c1 nmdc:mga0qj67_53781_c1_383_946 187
498 3300050511 nmdc:mga08y16_169957_c1 nmdc:mga08y16_169957_c1_374_937 187
499 3300005546 Ga0070696_100203936 Ga0070696_1002039362 188
500 3300005549 Ga0070704_100104451 Ga0070704_1001044512 188
501 3300005985 Ga0081539_10023062 Ga0081539_100230622 188
502 3300049579 Ga0501043_0118389 Ga0501043_0118389_587_1243 188
503 3300049580 Ga0501046_0000583 Ga0501046_0000583_19531_20187 188
504 3300049593 Ga0501077_0126640 Ga0501077_0126640_450_1025 188
505 3300049743 Ga0501081_0638671 Ga0501081_0638671_95_688 188
506 3300050507 nmdc:mga05p37_573131_c1 nmdc:mga05p37_573131_c1_165_740 188
507 iso_pu_bacteria 2895511927 2895513564 188
508 3300005618 Ga0068864_100648760 Ga0068864_1006487601 190
509 3300025918 Ga0207662_10256929 Ga0207662_102569292 190
510 3300025936 Ga0207670_10383102 Ga0207670_103831022 190
511 3300026095 Ga0207676_10398149 Ga0207676_103981491 190
512 3300034817 Ga0373948_0075578 Ga0373948_0075578_164_739 190
513 3300046500 Ga0495596_0021535 Ga0495596_0021535_1237_1863 190
514 3300046539 Ga0495621_0093208 Ga0495621_0093208_284_877 190
515 3300049570 Ga0501033_0441570 Ga0501033_0441570_284_859 190
516 3300053154 Ga0500619_000126 Ga0500619_000126_9983_10567 190
517 3300005338 Ga0068868_100100382 Ga0068868_1001003822 191
518 3300014325 Ga0163163_10919835 Ga0163163_109198351 191
519 3300025911 Ga0207654_10156188 Ga0207654_101561882 191
520 3300035113 Ga0373936_0118784 Ga0373936_0118784_451_1047 191
521 3300035695 Ga0373927_0635729 Ga0373927_0635729_15_611 191
522 3300035725 Ga0373947_0153678 Ga0373947_0153678_501_1097 191
523 3300039437 Ga0436365_1727819 Ga0436365_1727819_1600_2202 191
524 iso_pu_bacteria 2885270888 2885277872 191
525 3300005338 Ga0068868_100212370 Ga0068868_1002123702 192
526 3300005340 Ga0070689_100041867 Ga0070689_1000418673 192
527 3300005440 Ga0070705_100184420 Ga0070705_1001844202 192
528 3300005456 Ga0070678_100747013 Ga0070678_1007470131 192
529 3300005546 Ga0070696_100100300 Ga0070696_1001003001 192
530 3300006175 Ga0070712_100892948 Ga0070712_1008929481 192
531 3300006237 Ga0097621_100055240 Ga0097621_1000552403 192
532 3300009176 Ga0105242_10615638 Ga0105242_106156382 192
533 3300025927 Ga0207687_10049529 Ga0207687_100495293 192
534 3300025936 Ga0207670_10114076 Ga0207670_101140761 192
535 3300025942 Ga0207689_10193235 Ga0207689_101932352 192
536 3300026023 Ga0207677_10419556 Ga0207677_104195562 192
537 3300026089 Ga0207648_11166595 Ga0207648_111665951 192
538 3300026142 Ga0207698_10096282 Ga0207698_100962823 192
539 3300050514 nmdc:mga08x19_28100_c1 nmdc:mga08x19_28100_c1_2022_2600 192
540 3300005437 Ga0070710_10114141 Ga0070710_101141413 193
541 3300005539 Ga0068853_100129221 Ga0068853_1001292213 193
542 3300006028 Ga0070717_10009247 Ga0070717_100092479 193
543 3300007265 Ga0099794_10026206 Ga0099794_100262063 193
544 3300009545 Ga0105237_10019788 Ga0105237_100197886 193
545 3300009551 Ga0105238_10013604 Ga0105238_100136045 193
546 3300010375 Ga0105239_10001816 Ga0105239_100018163 193
547 3300014325 Ga0163163_10274853 Ga0163163_102748533 193
548 3300021388 Ga0213875_10000825 Ga0213875_1000082520 193
549 3300021388 Ga0213875_10259246 Ga0213875_102592462 193
550 3300025906 Ga0207699_10294152 Ga0207699_102941522 193
551 3300025913 Ga0207695_10009849 Ga0207695_1000984910 193
552 3300025914 Ga0207671_10010577 Ga0207671_100105773 193
553 3300025924 Ga0207694_10011571 Ga0207694_100115716 193
554 3300026041 Ga0207639_10047688 Ga0207639_100476882 193
555 3300035207 Ga0373942_0049354 Ga0373942_0049354_106_705 193
556 3300037853 Ga0436364_0734767 Ga0436364_0734767_4607_5197 193
557 3300037853 Ga0436364_1104137 Ga0436364_1104137_93_686 193
558 3300044683 Ga0466965_0390459 Ga0466965_0390459_77_697 193
559 3300044706 Ga0466964_0174316 Ga0466964_0174316_273_893 193
560 3300044842 Ga0466957_0076598 Ga0466957_0076598_260_880 193
561 3300045049 Ga0466959_0247373 Ga0466959_0247373_347_967 193
562 3300046471 Ga0495650_0025193 Ga0495650_0025193_1857_2477 193
563 3300047319 Ga0495674_0136209 Ga0495674_0136209_1067_1687 193
564 3300047320 Ga0495672_0037083 Ga0495672_0037083_2094_2714 193
565 3300048909 Ga0496106_0000002 Ga0496106_0000002_43337_43957 193
566 3300048924 Ga0496121_0000188 Ga0496121_0000188_70394_71014 193
567 3300048924 Ga0496121_0004978 Ga0496121_0004978_13691_14311 193
568 3300048929 Ga0496126_0000783 Ga0496126_0000783_50534_51154 193
569 3300005343 Ga0070687_100251682 Ga0070687_1002516822 194
570 3300005436 Ga0070713_100012279 Ga0070713_1000122792 194
571 3300005439 Ga0070711_100766053 Ga0070711_1007660532 194
572 3300005467 Ga0070706_100422967 Ga0070706_1004229672 194
573 3300005471 Ga0070698_100288017 Ga0070698_1002880172 194
574 3300005545 Ga0070695_100306648 Ga0070695_1003066482 194
575 3300005547 Ga0070693_100394482 Ga0070693_1003944821 194
576 3300007076 Ga0075435_100127432 Ga0075435_1001274322 194
577 3300009094 Ga0111539_10192474 Ga0111539_101924745 194
578 3300025918 Ga0207662_10249342 Ga0207662_102493422 194
579 3300025921 Ga0207652_10943957 Ga0207652_109439571 194
580 3300025942 Ga0207689_10479048 Ga0207689_104790482 194
581 3300027907 Ga0207428_10621878 Ga0207428_106218781 194
582 3300032005 Ga0307411_10539823 Ga0307411_105398231 194
583 3300035115 Ga0373941_0063080 Ga0373941_0063080_258_848 194
584 3300037418 Ga0395900_0080357 Ga0395900_0080357_690_1295 194
585 3300037471 Ga0395905_0026213 Ga0395905_0026213_174_779 194
586 3300044693 Ga0466961_0406063 Ga0466961_0406063_191_796 194
587 3300044842 Ga0466957_0013848 Ga0466957_0013848_2374_2979 194
588 3300045836 Ga0466958_0038400 Ga0466958_0038400_1368_1973 194
589 3300005338 Ga0068868_100918156 Ga0068868_1009181561 195
590 3300005365 Ga0070688_100261047 Ga0070688_1002610471 195
591 3300005438 Ga0070701_10212840 Ga0070701_102128402 195
592 3300005438 Ga0070701_10302306 Ga0070701_103023062 195
593 3300005444 Ga0070694_100489977 Ga0070694_1004899772 195
594 3300005617 Ga0068859_100032097 Ga0068859_1000320974 195
595 3300006844 Ga0075428_100042969 Ga0075428_1000429693 195
596 3300006880 Ga0075429_100371127 Ga0075429_1003711272 195
597 3300006931 Ga0097620_100032097 Ga0097620_1000320974 195
598 3300007076 Ga0075435_100343288 Ga0075435_1003432882 195
599 3300007076 Ga0075435_100720077 Ga0075435_1007200772 195
600 3300009094 Ga0111539_10000829 Ga0111539_1000082936 195
601 3300009098 Ga0105245_10429248 Ga0105245_104292482 195
602 3300009148 Ga0105243_10208469 Ga0105243_102084693 195
603 3300013306 Ga0163162_11043492 Ga0163162_110434921 195
604 3300025913 Ga0207695_10357886 Ga0207695_103578861 195
605 3300025932 Ga0207690_10640772 Ga0207690_106407721 195
606 3300025933 Ga0207706_10563027 Ga0207706_105630272 195
607 3300025940 Ga0207691_10193737 Ga0207691_101937372 195
608 3300025961 Ga0207712_10400141 Ga0207712_104001411 195
609 3300027907 Ga0207428_10005694 Ga0207428_1000569411 195
610 3300039437 Ga0436365_0560582 Ga0436365_0560582_6316_6930 195
611 3300044673 Ga0453683_0283746 Ga0453683_0283746_388_987 195
612 3300046684 Ga0495669_0040245 Ga0495669_0040245_378_986 195
613 3300050508 nmdc:mga09592_314338_c1 nmdc:mga09592_314338_c1_677_1282 195
614 3300059424 Ga0590075_043931 Ga0590075_043931_46_651 195
615 iso_pu_bacteria 3005409236 3005409931 195
616 3300005327 Ga0070658_10265790 Ga0070658_102657902 196
617 3300005329 Ga0070683_100289352 Ga0070683_1002893522 196
618 3300005336 Ga0070680_100055204 Ga0070680_1000552043 196
619 3300005336 Ga0070680_100316045 Ga0070680_1003160452 196
620 3300005343 Ga0070687_100378688 Ga0070687_1003786882 196
621 3300005440 Ga0070705_100039722 Ga0070705_1000397223 196
622 3300005444 Ga0070694_100409187 Ga0070694_1004091872 196
623 3300005468 Ga0070707_100345728 Ga0070707_1003457281 196
624 3300005530 Ga0070679_100001812 Ga0070679_1000018122 196
625 3300005535 Ga0070684_100137437 Ga0070684_1001374372 196
626 3300005536 Ga0070697_100033676 Ga0070697_1000336763 196
627 3300005539 Ga0068853_100291072 Ga0068853_1002910722 196
628 3300005545 Ga0070695_100068774 Ga0070695_1000687743 196
629 3300005549 Ga0070704_100065410 Ga0070704_1000654103 196
630 3300005563 Ga0068855_100001026 Ga0068855_1000010264 196
631 3300005563 Ga0068855_100151451 Ga0068855_1001514512 196
632 3300005564 Ga0070664_100259026 Ga0070664_1002590262 196
633 3300005614 Ga0068856_100319255 Ga0068856_1003192552 196
634 3300005616 Ga0068852_100012355 Ga0068852_1000123553 196
635 3300005616 Ga0068852_100128379 Ga0068852_1001283792 196
636 3300005834 Ga0068851_10001034 Ga0068851_100010348 196
637 3300006353 Ga0075370_10157038 Ga0075370_101570382 196
638 3300006358 Ga0068871_100017452 Ga0068871_1000174523 196
639 3300006871 Ga0075434_100149851 Ga0075434_1001498512 196
640 3300006914 Ga0075436_100219945 Ga0075436_1002199452 196
641 3300007076 Ga0075435_100141742 Ga0075435_1001417422 196
642 3300009093 Ga0105240_10017393 Ga0105240_100173937 196
643 3300009093 Ga0105240_10040202 Ga0105240_100402023 196
644 3300009093 Ga0105240_10065260 Ga0105240_100652603 196
645 3300009174 Ga0105241_10074350 Ga0105241_100743503 196
646 3300009551 Ga0105238_10014032 Ga0105238_100140327 196
647 3300009551 Ga0105238_10103045 Ga0105238_101030453 196
648 3300010375 Ga0105239_10515150 Ga0105239_105151502 196
649 3300013105 Ga0157369_10043732 Ga0157369_100437323 196
650 3300013105 Ga0157369_10481760 Ga0157369_104817602 196
651 3300013296 Ga0157374_10147160 Ga0157374_101471603 196
652 3300013307 Ga0157372_10012175 Ga0157372_100121752 196
653 3300013307 Ga0157372_10054137 Ga0157372_100541373 196
654 3300025911 Ga0207654_10002438 Ga0207654_100024388 196
655 3300025913 Ga0207695_10066308 Ga0207695_100663083 196
656 3300025913 Ga0207695_10142311 Ga0207695_101423112 196
657 3300025918 Ga0207662_10186669 Ga0207662_101866692 196
658 3300025919 Ga0207657_10075804 Ga0207657_100758043 196
659 3300025919 Ga0207657_10222137 Ga0207657_102221372 196
660 3300025921 Ga0207652_10199222 Ga0207652_101992222 196
661 3300025921 Ga0207652_10433309 Ga0207652_104333092 196
662 3300025924 Ga0207694_10070565 Ga0207694_100705651 196
663 3300025924 Ga0207694_10083769 Ga0207694_100837692 196
664 3300025929 Ga0207664_10200486 Ga0207664_102004861 196
665 3300025932 Ga0207690_10032081 Ga0207690_100320812 196
666 3300025949 Ga0207667_10025639 Ga0207667_100256395 196
667 3300026023 Ga0207677_10153715 Ga0207677_101537152 196
668 3300026023 Ga0207677_11445044 Ga0207677_114450441 196
669 3300026041 Ga0207639_10089627 Ga0207639_100896272 196
670 3300026041 Ga0207639_10264118 Ga0207639_102641182 196
671 3300026078 Ga0207702_10796898 Ga0207702_107968982 196
672 3300026116 Ga0207674_10268535 Ga0207674_102685351 196
673 3300026142 Ga0207698_10000418 Ga0207698_1000041813 196
674 3300031901 Ga0307406_10616230 Ga0307406_106162302 196
675 3300037068 Ga0373925_0214501 Ga0373925_0214501_241_849 196
676 3300038443 Ga0395901_0207803 Ga0395901_0207803_169_771 196
677 3300048907 Ga0496104_0026791 Ga0496104_0026791_3573_4181 196
678 3300048913 Ga0496110_0232968 Ga0496110_0232968_629_1237 196
679 3300049573 Ga0501037_0483972 Ga0501037_0483972_104_697 196
680 3300049582 Ga0501048_0260692 Ga0501048_0260692_626_1219 196
681 3300049588 Ga0501072_0024394 Ga0501072_0024394_3113_3706 196
682 3300049592 Ga0501076_0007717 Ga0501076_0007717_4417_5010 196
683 3300049765 Ga0501268_030937 Ga0501268_030937_38_640 196
684 3300050493 nmdc:mga0k408_34802_c1 nmdc:mga0k408_34802_c1_1042_1650 196
685 3300050496 nmdc:mga07m45_100556_c1 nmdc:mga07m45_100556_c1_490_1098 196
686 3300050512 nmdc:mga0n895_94392_c1 nmdc:mga0n895_94392_c1_1494_2090 196
687 3300050513 nmdc:mga0rr50_198712_c1 nmdc:mga0rr50_198712_c1_515_1111 196
688 3300050514 nmdc:mga08x19_13853_c1 nmdc:mga08x19_13853_c1_399_989 196
689 3300050514 nmdc:mga08x19_42987_c1 nmdc:mga08x19_42987_c1_1582_2193 196
690 3300050514 nmdc:mga08x19_52337_c1 nmdc:mga08x19_52337_c1_819_1415 196
691 3300061734 Ga0530510_0004356 Ga0530510_0004356_3850_4443 196
692 3300005440 Ga0070705_100391067 Ga0070705_1003910672 197
693 3300005467 Ga0070706_100433194 Ga0070706_1004331942 197
694 3300005468 Ga0070707_100167909 Ga0070707_1001679092 197
695 3300005471 Ga0070698_100002719 Ga0070698_1000027196 197
696 3300005518 Ga0070699_100028410 Ga0070699_1000284103 197
697 3300005546 Ga0070696_100094560 Ga0070696_1000945602 197
698 3300005549 Ga0070704_100047604 Ga0070704_1000476043 197
699 3300005563 Ga0068855_100049308 Ga0068855_1000493084 197
700 3300006871 Ga0075434_101083707 Ga0075434_1010837072 197
701 3300006914 Ga0075436_100219010 Ga0075436_1002190102 197
702 3300007076 Ga0075435_100515873 Ga0075435_1005158732 197
703 3300009094 Ga0111539_10591943 Ga0111539_105919432 197
704 3300009094 Ga0111539_10690325 Ga0111539_106903252 197
705 3300013307 Ga0157372_10285706 Ga0157372_102857062 197
706 3300014326 Ga0157380_10353419 Ga0157380_103534192 197
707 3300014326 Ga0157380_10430553 Ga0157380_104305531 197
708 3300025910 Ga0207684_10120761 Ga0207684_101207612 197
709 3300025936 Ga0207670_10245363 Ga0207670_102453632 197
710 3300025949 Ga0207667_10046656 Ga0207667_100466563 197
711 3300035691 Ga0373931_0177914 Ga0373931_0177914_186_800 197
712 3300046615 Ga0495656_0067782 Ga0495656_0067782_632_1240 197
713 3300046664 Ga0495659_0086521 Ga0495659_0086521_564_1172 197
714 3300049570 Ga0501033_0003162 Ga0501033_0003162_1442_2086 197
715 3300049581 Ga0501047_0253615 Ga0501047_0253615_481_1125 197
716 3300050507 nmdc:mga05p37_53342_c1 nmdc:mga05p37_53342_c1_1972_2568 197
717 3300050507 nmdc:mga05p37_762130_c1 nmdc:mga05p37_762130_c1_217_810 197
718 3300050510 nmdc:mga06r32_15222_c1 nmdc:mga06r32_15222_c1_5970_6566 197
719 3300050510 nmdc:mga06r32_970685_c1 nmdc:mga06r32_970685_c1_69_665 197
720 3300050511 nmdc:mga08y16_476131_c1 nmdc:mga08y16_476131_c1_121_717 197
721 3300050511 nmdc:mga08y16_936191_c1 nmdc:mga08y16_936191_c1_113_712 197
722 3300050512 nmdc:mga0n895_353756_c1 nmdc:mga0n895_353756_c1_310_921 197
723 3300050513 nmdc:mga0rr50_455586_c1 nmdc:mga0rr50_455586_c1_298_909 197
724 3300005331 Ga0070670_100043454 Ga0070670_1000434544 198
725 3300005341 Ga0070691_10255912 Ga0070691_102559122 198
726 3300005345 Ga0070692_10035875 Ga0070692_100358752 198
727 3300005353 Ga0070669_100601921 Ga0070669_1006019212 198
728 3300005364 Ga0070673_100634619 Ga0070673_1006346192 198
729 3300005365 Ga0070688_100680942 Ga0070688_1006809422 198
730 3300005438 Ga0070701_10008555 Ga0070701_100085555 198
731 3300005440 Ga0070705_100000108 Ga0070705_1000001085 198
732 3300005440 Ga0070705_100053822 Ga0070705_1000538223 198
733 3300005445 Ga0070708_100934797 Ga0070708_1009347971 198
734 3300005458 Ga0070681_10020240 Ga0070681_100202402 198
735 3300005468 Ga0070707_100280671 Ga0070707_1002806712 198
736 3300005471 Ga0070698_100047033 Ga0070698_1000470332 198
737 3300005471 Ga0070698_100355023 Ga0070698_1003550232 198
738 3300005518 Ga0070699_100028998 Ga0070699_1000289984 198
739 3300005518 Ga0070699_100370060 Ga0070699_1003700602 198
740 3300005536 Ga0070697_100012632 Ga0070697_1000126322 198
741 3300005545 Ga0070695_100002095 Ga0070695_1000020951 198
742 3300005546 Ga0070696_100000180 Ga0070696_10000018019 198
743 3300005546 Ga0070696_100057118 Ga0070696_1000571182 198
744 3300005549 Ga0070704_100010578 Ga0070704_1000105783 198
745 3300005564 Ga0070664_100184978 Ga0070664_1001849783 198
746 3300005577 Ga0068857_100233760 Ga0068857_1002337602 198
747 3300005615 Ga0070702_100452466 Ga0070702_1004524661 198
748 3300005840 Ga0068870_10036353 Ga0068870_100363532 198
749 3300006173 Ga0070716_100223808 Ga0070716_1002238082 198
750 3300006844 Ga0075428_100004010 Ga0075428_10000401018 198
751 3300006852 Ga0075433_10207385 Ga0075433_102073852 198
752 3300006871 Ga0075434_100001205 Ga0075434_1000012055 198
753 3300006871 Ga0075434_100031867 Ga0075434_1000318673 198
754 3300006880 Ga0075429_100010090 Ga0075429_1000100905 198
755 3300006914 Ga0075436_100112760 Ga0075436_1001127602 198
756 3300007076 Ga0075435_100512445 Ga0075435_1005124451 198
757 3300009098 Ga0105245_11466143 Ga0105245_114661431 198
758 3300009147 Ga0114129_10007142 Ga0114129_100071427 198
759 3300009147 Ga0114129_10086663 Ga0114129_100866632 198
760 3300009147 Ga0114129_10090544 Ga0114129_100905443 198
761 3300009147 Ga0114129_10659587 Ga0114129_106595872 198
762 3300009176 Ga0105242_10107916 Ga0105242_101079163 198
763 3300025908 Ga0207643_10005979 Ga0207643_100059795 198
764 3300025912 Ga0207707_10034663 Ga0207707_100346635 198
765 3300025922 Ga0207646_10107048 Ga0207646_101070483 198
766 3300025922 Ga0207646_10204119 Ga0207646_102041192 198
767 3300025923 Ga0207681_10565111 Ga0207681_105651112 198
768 3300025925 Ga0207650_10027881 Ga0207650_100278814 198
769 3300025929 Ga0207664_10061928 Ga0207664_100619283 198
770 3300025934 Ga0207686_10070734 Ga0207686_100707343 198
771 3300025935 Ga0207709_10803295 Ga0207709_108032951 198
772 3300025945 Ga0207679_10229517 Ga0207679_102295172 198
773 3300026116 Ga0207674_10032849 Ga0207674_100328492 198
774 3300034817 Ga0373948_0065466 Ga0373948_0065466_13_633 198
775 3300037068 Ga0373925_0057775 Ga0373925_0057775_1087_1743 198
776 3300045051 Ga0451576_0890880 Ga0451576_0890880_100_702 198
777 3300046455 Ga0495603_0018093 Ga0495603_0018093_393_989 198
778 3300046475 Ga0495639_0125139 Ga0495639_0125139_339_935 198
779 3300046491 Ga0495584_0202124 Ga0495584_0202124_385_984 198
780 3300046499 Ga0495594_0036571 Ga0495594_0036571_275_871 198
781 3300046523 Ga0495644_0064411 Ga0495644_0064411_13_609 198
782 3300046525 Ga0495663_0010629 Ga0495663_0010629_1600_2196 198
783 3300046528 Ga0495642_0038728 Ga0495642_0038728_267_863 198
784 3300046538 Ga0495609_0011309 Ga0495609_0011309_525_1121 198
785 3300046538 Ga0495609_0045100 Ga0495609_0045100_619_1215 198
786 3300046539 Ga0495621_0007990 Ga0495621_0007990_988_1584 198
787 3300046664 Ga0495659_0011488 Ga0495659_0011488_1806_2405 198
788 3300046664 Ga0495659_0018068 Ga0495659_0018068_691_1287 198
789 3300046674 Ga0495588_0003424 Ga0495588_0003424_2096_2692 198
790 3300046684 Ga0495669_0053312 Ga0495669_0053312_637_1233 198
791 3300047315 Ga0495581_0301604 Ga0495581_0301604_51_647 198
792 3300047318 Ga0495636_0046260 Ga0495636_0046260_932_1528 198
793 3300047445 Ga0495677_0122412 Ga0495677_0122412_14_610 198
794 3300050507 nmdc:mga05p37_29455_c1 nmdc:mga05p37_29455_c1_995_1591 198
795 3300050507 nmdc:mga05p37_3200_c1 nmdc:mga05p37_3200_c1_16370_16966 198
796 3300050508 nmdc:mga09592_53166_c1 nmdc:mga09592_53166_c1_1452_2048 198
797 3300050512 nmdc:mga0n895_124172_c1 nmdc:mga0n895_124172_c1_1611_2213 198
798 3300050512 nmdc:mga0n895_12827_c1 nmdc:mga0n895_12827_c1_5275_5874 198
799 3300050512 nmdc:mga0n895_79858_c1 nmdc:mga0n895_79858_c1_820_1416 198
800 3300050512 nmdc:mga0n895_83290_c1 nmdc:mga0n895_83290_c1_1953_2549 198
801 3300050513 nmdc:mga0rr50_40872_c1 nmdc:mga0rr50_40872_c1_1832_2428 198
802 3300050514 nmdc:mga08x19_226369_c1 nmdc:mga08x19_226369_c1_369_968 198
803 3300050515 nmdc:mga0a205_263306_c1 nmdc:mga0a205_263306_c1_806_1402 198
804 3300053093 Ga0500651_0401240 Ga0500651_0401240_96_743 198
805 2162886007 SwRhRL2b_contig_3191446 SwRhRL2b_0728.00001230 199
806 3300004798 Ga0058859_11536937 Ga0058859_115369372 199
807 3300005289 Ga0065704_10006314 Ga0065704_100063142 199
808 3300005295 Ga0065707_10170922 Ga0065707_101709222 199
809 3300005328 Ga0070676_10041159 Ga0070676_100411592 199
810 3300005329 Ga0070683_100131398 Ga0070683_1001313983 199
811 3300005338 Ga0068868_100048250 Ga0068868_1000482504 199
812 3300005340 Ga0070689_100024531 Ga0070689_1000245314 199
813 3300005343 Ga0070687_100086576 Ga0070687_1000865762 199
814 3300005345 Ga0070692_10123101 Ga0070692_101231012 199
815 3300005347 Ga0070668_100207349 Ga0070668_1002073492 199
816 3300005353 Ga0070669_100000739 Ga0070669_1000007394 199
817 3300005354 Ga0070675_100016495 Ga0070675_1000164953 199
818 3300005354 Ga0070675_100042883 Ga0070675_1000428833 199
819 3300005355 Ga0070671_100009287 Ga0070671_1000092876 199
820 3300005364 Ga0070673_100042483 Ga0070673_1000424834 199
821 3300005364 Ga0070673_100100450 Ga0070673_1001004502 199
822 3300005364 Ga0070673_100337992 Ga0070673_1003379921 199
823 3300005365 Ga0070688_100209893 Ga0070688_1002098932 199
824 3300005365 Ga0070688_100320041 Ga0070688_1003200411 199
825 3300005366 Ga0070659_100254578 Ga0070659_1002545782 199
826 3300005438 Ga0070701_10162217 Ga0070701_101622172 199
827 3300005441 Ga0070700_100159230 Ga0070700_1001592302 199
828 3300005441 Ga0070700_100162458 Ga0070700_1001624582 199
829 3300005444 Ga0070694_100020944 Ga0070694_1000209442 199
830 3300005445 Ga0070708_100103908 Ga0070708_1001039082 199
831 3300005456 Ga0070678_100497830 Ga0070678_1004978302 199
832 3300005457 Ga0070662_100049570 Ga0070662_1000495703 199
833 3300005459 Ga0068867_100004387 Ga0068867_1000043873 199
834 3300005468 Ga0070707_100292258 Ga0070707_1002922582 199
835 3300005518 Ga0070699_100010154 Ga0070699_1000101545 199
836 3300005518 Ga0070699_100093669 Ga0070699_1000936692 199
837 3300005535 Ga0070684_100145024 Ga0070684_1001450242 199
838 3300005535 Ga0070684_100967251 Ga0070684_1009672511 199
839 3300005543 Ga0070672_100026908 Ga0070672_1000269082 199
840 3300005547 Ga0070693_100206583 Ga0070693_1002065832 199
841 3300005549 Ga0070704_100009010 Ga0070704_1000090104 199
842 3300005564 Ga0070664_100017923 Ga0070664_1000179235 199
843 3300005564 Ga0070664_100195777 Ga0070664_1001957773 199
844 3300005577 Ga0068857_100181138 Ga0068857_1001811383 199
845 3300005615 Ga0070702_100785834 Ga0070702_1007858341 199
846 3300005616 Ga0068852_100902266 Ga0068852_1009022662 199
847 3300005617 Ga0068859_100001226 Ga0068859_10000122621 199
848 3300005617 Ga0068859_100024635 Ga0068859_1000246355 199
849 3300005618 Ga0068864_100532627 Ga0068864_1005326272 199
850 3300005719 Ga0068861_100063286 Ga0068861_1000632863 199
851 3300005840 Ga0068870_10025333 Ga0068870_100253334 199
852 3300005841 Ga0068863_100120170 Ga0068863_1001201703 199
853 3300005842 Ga0068858_100503947 Ga0068858_1005039472 199
854 3300005843 Ga0068860_100027637 Ga0068860_1000276373 199
855 3300005844 Ga0068862_100000936 Ga0068862_10000093619 199
856 3300006237 Ga0097621_100072507 Ga0097621_1000725074 199
857 3300006358 Ga0068871_100180774 Ga0068871_1001807742 199
858 3300006871 Ga0075434_100110147 Ga0075434_1001101473 199
859 3300006931 Ga0097620_100001226 Ga0097620_10000122621 199
860 3300006931 Ga0097620_100024635 Ga0097620_1000246355 199
861 3300006931 Ga0097620_100916332 Ga0097620_1009163322 199
862 3300009094 Ga0111539_10837248 Ga0111539_108372482 199
863 3300009098 Ga0105245_10234186 Ga0105245_102341863 199
864 3300009148 Ga0105243_10245147 Ga0105243_102451472 199
865 3300009545 Ga0105237_10000625 Ga0105237_100006258 199
866 3300009551 Ga0105238_10793592 Ga0105238_107935922 199
867 3300009553 Ga0105249_10137269 Ga0105249_101372693 199
868 3300010375 Ga0105239_10000051 Ga0105239_1000005199 199
869 3300013102 Ga0157371_10415875 Ga0157371_104158752 199
870 3300013296 Ga0157374_11027975 Ga0157374_110279752 199
871 3300013297 Ga0157378_10050050 Ga0157378_100500502 199
872 3300013306 Ga0163162_10276181 Ga0163162_102761813 199
873 3300014326 Ga0157380_10106642 Ga0157380_101066422 199
874 3300014745 Ga0157377_10024992 Ga0157377_100249924 199
875 3300025893 Ga0207682_10089870 Ga0207682_100898702 199
876 3300025901 Ga0207688_10157069 Ga0207688_101570692 199
877 3300025903 Ga0207680_10073954 Ga0207680_100739543 199
878 3300025907 Ga0207645_10062098 Ga0207645_100620983 199
879 3300025908 Ga0207643_10079325 Ga0207643_100793252 199
880 3300025910 Ga0207684_10511862 Ga0207684_105118622 199
881 3300025913 Ga0207695_10005372 Ga0207695_1000537214 199
882 3300025914 Ga0207671_10009150 Ga0207671_100091508 199
883 3300025918 Ga0207662_10005398 Ga0207662_100053984 199
884 3300025923 Ga0207681_10013395 Ga0207681_100133955 199
885 3300025924 Ga0207694_10100547 Ga0207694_101005472 199
886 3300025925 Ga0207650_10057766 Ga0207650_100577663 199
887 3300025926 Ga0207659_10000497 Ga0207659_100004975 199
888 3300025926 Ga0207659_10220900 Ga0207659_102209002 199
889 3300025931 Ga0207644_10206425 Ga0207644_102064252 199
890 3300025931 Ga0207644_10299538 Ga0207644_102995382 199
891 3300025932 Ga0207690_10314710 Ga0207690_103147102 199
892 3300025933 Ga0207706_10020119 Ga0207706_100201195 199
893 3300025935 Ga0207709_10120339 Ga0207709_101203392 199
894 3300025936 Ga0207670_10011914 Ga0207670_100119143 199
895 3300025936 Ga0207670_10016160 Ga0207670_100161603 199
896 3300025938 Ga0207704_10056227 Ga0207704_100562273 199
897 3300025940 Ga0207691_10036125 Ga0207691_100361254 199
898 3300025940 Ga0207691_10058161 Ga0207691_100581614 199
899 3300025944 Ga0207661_10311469 Ga0207661_103114692 199
900 3300025945 Ga0207679_10049021 Ga0207679_100490212 199
901 3300025945 Ga0207679_10171460 Ga0207679_101714602 199
902 3300025960 Ga0207651_10056533 Ga0207651_100565333 199
903 3300025960 Ga0207651_10089913 Ga0207651_100899133 199
904 3300025960 Ga0207651_10355018 Ga0207651_103550182 199
905 3300025961 Ga0207712_10420068 Ga0207712_104200682 199
906 3300025981 Ga0207640_10053345 Ga0207640_100533452 199
907 3300026023 Ga0207677_10236452 Ga0207677_102364521 199
908 3300026035 Ga0207703_10049396 Ga0207703_100493963 199
909 3300026075 Ga0207708_10011323 Ga0207708_100113233 199
910 3300026075 Ga0207708_10043409 Ga0207708_100434093 199
911 3300026088 Ga0207641_10058519 Ga0207641_100585193 199
912 3300026088 Ga0207641_10097219 Ga0207641_100972193 199
913 3300026089 Ga0207648_10004952 Ga0207648_100049525 199
914 3300026116 Ga0207674_10094210 Ga0207674_100942103 199
915 3300026118 Ga0207675_100084083 Ga0207675_1000840834 199
916 3300026118 Ga0207675_100090295 Ga0207675_1000902952 199
917 3300026121 Ga0207683_10401211 Ga0207683_104012112 199
918 3300027907 Ga0207428_10009987 Ga0207428_100099874 199
919 3300028380 Ga0268265_10000768 Ga0268265_1000076830 199
920 3300028381 Ga0268264_10032877 Ga0268264_100328774 199
921 3300035085 Ga0373929_0073281 Ga0373929_0073281_199_813 199
922 3300035090 Ga0373949_0062784 Ga0373949_0062784_77_676 199
923 3300035114 Ga0373939_0174765 Ga0373939_0174765_122_721 199
924 3300035115 Ga0373941_0019206 Ga0373941_0019206_1244_1843 199
925 3300036401 Ga0373937_0102121 Ga0373937_0102121_1689_2288 199
926 3300037068 Ga0373925_0711148 Ga0373925_0711148_211_810 199
927 3300046454 Ga0495592_0051211 Ga0495592_0051211_1643_2323 199
928 3300046492 Ga0495585_0171718 Ga0495585_0171718_459_1058 199
929 3300046531 Ga0495665_0032907 Ga0495665_0032907_1098_1697 199
930 3300046537 Ga0495598_0091776 Ga0495598_0091776_13_612 199
931 3300046539 Ga0495621_0072735 Ga0495621_0072735_95_694 199
932 3300046558 Ga0495633_0131984 Ga0495633_0131984_205_804 199
933 3300046664 Ga0495659_0097492 Ga0495659_0097492_509_1108 199
934 3300046684 Ga0495669_0049257 Ga0495669_0049257_984_1583 199
935 3300046689 Ga0495613_0498716 Ga0495613_0498716_55_654 199
936 3300047445 Ga0495677_0049783 Ga0495677_0049783_213_812 199
937 3300048909 Ga0496106_0191994 Ga0496106_0191994_955_1554 199
938 3300048921 Ga0496118_0036898 Ga0496118_0036898_2231_2881 199
939 3300048924 Ga0496121_0002262 Ga0496121_0002262_3561_4211 199
940 3300050508 nmdc:mga09592_118522_c1 nmdc:mga09592_118522_c1_315_914 199
941 3300050512 nmdc:mga0n895_58375_c1 nmdc:mga0n895_58375_c1_2485_3084 199
942 3300050513 nmdc:mga0rr50_304312_c1 nmdc:mga0rr50_304312_c1_541_1143 199
943 3300053148 Ga0500590_001674 Ga0500590_001674_6531_7211 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

87

157

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lr5-assembly2.cif.gz_B crystal structure of auxin binding protein 0.9122 52 158
6a55-assembly1.cif.gz_B crystal structure of dddk mutant y122a 0.8946 60 155
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.8887 68 156
6a54-assembly1.cif.gz_A crystal structure of dddk mutant y64a 0.8871 60 155
2vqa-assembly1.cif.gz_C protein-folding location can regulate mn versus cu- or zn-binding. crystal structure of mnca. 0.887 62 155
ID Description Score Start End Superfamily
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9361 66 157 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9232 82 155 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.916 66 157 2.60.120.10
3es1A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9083 82 156 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9069 62 157 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A074MAW6-F1-model_v4 Cupin type-2 domain-containing protein 0.9511 79 156 GO:0016020
AF-A0A6L5FBW2-F1-model_v4 Cupin domain-containing protein 0.9461 66 156
AF-A6EYW0-F1-model_v4 Gentisate 1,2-dioxygenase 0.9414 46 189 GO:0051213
AF-A0A4Y6KTB6-F1-model_v4 Auxin-binding protein 1 0.9378 52 156 GO:0009734
GO:0009826
GO:0010011
GO:0032877
GO:0045793
GO:0051781
AF-A0A7C3NJF9-F1-model_v4 Cupin domain-containing protein 0.9365 49 191

Feature Viewer

pLDDT pTM Quality
79.87 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map