F486384
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 943 | 392 | 937 | 193 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10192474|Ga0111539_101924745 |
| Length | 202 |
| Sequence | MSTKVTDGPKITEGAKQPEEVVQTISHHTGRKDRVFVRGIQGAYSLKEELARLRSMPRVRKGHLIRFADGPQTFSRHYIEPKDGLTQTFEYAPGSRSQKHGHVNEAAFYILDGEGYEIHDGIRYDWKAGDIAIVHNNCVHQHFNASPTKPARAVVIKTKPMFMFMNMLFQKQVVPRPTEPAPGAEGFKVREFEENYNYEDQE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2857609550 | Domibacillus sp. R-71929 | Isolate | Unclassified |
| 3 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 4 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 5 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 6 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 96 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 97 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 124 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 125 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 126 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 127 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 128 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 129 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 130 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 195 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 197 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 201 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 202 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 203 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 204 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 205 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 206 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 207 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 208 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 215 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 216 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 220 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 222 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 230 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 231 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 232 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 235 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 236 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 237 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 240 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 241 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 242 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 243 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 244 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 245 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 246 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 247 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 248 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 249 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 250 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 251 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 252 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 253 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 254 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 255 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 256 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 257 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 258 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 259 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 260 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 261 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 262 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 338 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 339 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 340 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 341 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 342 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 343 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 344 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 345 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 346 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 348 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 365 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 369 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 372 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 373 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 385 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 386 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 387 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 388 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 389 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 390 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 392 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.36 |
| Metatranscriptomes | 0.21 |
| Isolates | 0.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.85 |
| Nodule | 0 |
| Rhizoplane | 1.17 |
| Rhizosphere | 95.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3191446 | 2162886007 | Bacteria | 1459 |
| 2 | LJQas_1001792 | 3300000549 | Bacteria | 3146 |
| 3 | JGI25406J46586_10025474 | 3300003203 | Bacteria | 2296 |
| 4 | Ga0058859_11536937 | 3300004798 | Bacteria | 1725 |
| 5 | Ga0065704_10006314 | 3300005289 | Bacteria | 4295 |
| 6 | Ga0065707_10119894 | 3300005295 | Bacteria | 2147 |
| 7 | Ga0065707_10124404 | 3300005295 | Bacteria | 2045 |
| 8 | Ga0065707_10170922 | 3300005295 | Bacteria | 1485 |
| 9 | Ga0070658_10265790 | 3300005327 | Bacteria | 1458 |
| 10 | Ga0070676_10041159 | 3300005328 | Bacteria | 2678 |
| 11 | Ga0070676_10342262 | 3300005328 | Bacteria | 1026 |
| 12 | Ga0070683_100131398 | 3300005329 | Bacteria | 2369 |
| 13 | Ga0070683_100273845 | 3300005329 | Bacteria | 1606 |
| 14 | Ga0070683_100289352 | 3300005329 | Bacteria | 1558 |
| 15 | Ga0070690_100005091 | 3300005330 | Bacteria | 7363 |
| 16 | Ga0070670_100043454 | 3300005331 | Bacteria | 3863 |
| 17 | Ga0068869_100320743 | 3300005334 | Bacteria | 1256 |
| 18 | Ga0070666_10079909 | 3300005335 | Bacteria | 2234 |
| 19 | Ga0070680_100034909 | 3300005336 | Bacteria | 4057 |
| 20 | Ga0070680_100055204 | 3300005336 | Bacteria | 3246 |
| 21 | Ga0070680_100076410 | 3300005336 | Bacteria | 2757 |
| 22 | Ga0070680_100096124 | 3300005336 | Bacteria | 2456 |
| 23 | Ga0070680_100113526 | 3300005336 | Bacteria | 2257 |
| 24 | Ga0070680_100316045 | 3300005336 | Bacteria | 1326 |
| 25 | Ga0070682_100006531 | 3300005337 | Bacteria | 6545 |
| 26 | Ga0068868_100007387 | 3300005338 | Bacteria | 7826 |
| 27 | Ga0068868_100048250 | 3300005338 | Bacteria | 3340 |
| 28 | Ga0068868_100100382 | 3300005338 | Bacteria | 2342 |
| 29 | Ga0068868_100212370 | 3300005338 | Bacteria | 1618 |
| 30 | Ga0068868_100918156 | 3300005338 | Bacteria | 797 |
| 31 | Ga0070689_100007046 | 3300005340 | Bacteria | 7826 |
| 32 | Ga0070689_100024531 | 3300005340 | Bacteria | 4524 |
| 33 | Ga0070689_100041867 | 3300005340 | Bacteria | 3516 |
| 34 | Ga0070691_10002771 | 3300005341 | Bacteria | 7816 |
| 35 | Ga0070691_10255912 | 3300005341 | Unclassified | 941 |
| 36 | Ga0070687_100001749 | 3300005343 | Bacteria | 7826 |
| 37 | Ga0070687_100086576 | 3300005343 | Bacteria | 1723 |
| 38 | Ga0070687_100251682 | 3300005343 | Bacteria | 1098 |
| 39 | Ga0070687_100378688 | 3300005343 | Bacteria | 921 |
| 40 | Ga0070661_100397186 | 3300005344 | Bacteria | 1090 |
| 41 | Ga0070692_10005868 | 3300005345 | Bacteria | 5283 |
| 42 | Ga0070692_10035875 | 3300005345 | Bacteria | 2513 |
| 43 | Ga0070692_10123101 | 3300005345 | Bacteria | 1449 |
| 44 | Ga0070668_100207349 | 3300005347 | Bacteria | 1611 |
| 45 | Ga0070669_100000739 | 3300005353 | Bacteria | 23805 |
| 46 | Ga0070669_100601921 | 3300005353 | Bacteria | 921 |
| 47 | Ga0070675_100016495 | 3300005354 | Bacteria | 5865 |
| 48 | Ga0070675_100042883 | 3300005354 | Bacteria | 3697 |
| 49 | Ga0070671_100009287 | 3300005355 | Bacteria | 7898 |
| 50 | Ga0070671_100121950 | 3300005355 | Bacteria | 2194 |
| 51 | Ga0070671_100162160 | 3300005355 | Bacteria | 1890 |
| 52 | Ga0070673_100042483 | 3300005364 | Bacteria | 3506 |
| 53 | Ga0070673_100100450 | 3300005364 | Bacteria | 2382 |
| 54 | Ga0070673_100163817 | 3300005364 | Bacteria | 1893 |
| 55 | Ga0070673_100337992 | 3300005364 | Bacteria | 1334 |
| 56 | Ga0070673_100634619 | 3300005364 | Bacteria | 976 |
| 57 | Ga0070688_100209893 | 3300005365 | Bacteria | 1367 |
| 58 | Ga0070688_100261047 | 3300005365 | Bacteria | 1237 |
| 59 | Ga0070688_100320041 | 3300005365 | Bacteria | 1127 |
| 60 | Ga0070688_100680942 | 3300005365 | Bacteria | 795 |
| 61 | Ga0070659_100254578 | 3300005366 | Bacteria | 1456 |
| 62 | Ga0070703_10025931 | 3300005406 | Bacteria | 1740 |
| 63 | Ga0070713_100012279 | 3300005436 | Bacteria | 6276 |
| 64 | Ga0070713_100030251 | 3300005436 | Bacteria | 4299 |
| 65 | Ga0070710_10114141 | 3300005437 | Bacteria | 1626 |
| 66 | Ga0070701_10001946 | 3300005438 | Bacteria | 7826 |
| 67 | Ga0070701_10008555 | 3300005438 | Bacteria | 4435 |
| 68 | Ga0070701_10162217 | 3300005438 | Bacteria | 1296 |
| 69 | Ga0070701_10212840 | 3300005438 | Bacteria | 1148 |
| 70 | Ga0070701_10302306 | 3300005438 | Bacteria | 984 |
| 71 | Ga0070711_100766053 | 3300005439 | Bacteria | 816 |
| 72 | Ga0070705_100000108 | 3300005440 | Bacteria | 47179 |
| 73 | Ga0070705_100003829 | 3300005440 | Bacteria | 7358 |
| 74 | Ga0070705_100039722 | 3300005440 | Bacteria | 2671 |
| 75 | Ga0070705_100053822 | 3300005440 | Bacteria | 2357 |
| 76 | Ga0070705_100184420 | 3300005440 | Bacteria | 1416 |
| 77 | Ga0070705_100391067 | 3300005440 | Bacteria | 1027 |
| 78 | Ga0070700_100015124 | 3300005441 | Bacteria | 4369 |
| 79 | Ga0070700_100159230 | 3300005441 | Bacteria | 1552 |
| 80 | Ga0070700_100162458 | 3300005441 | Bacteria | 1539 |
| 81 | Ga0070694_100009114 | 3300005444 | Bacteria | 6086 |
| 82 | Ga0070694_100020944 | 3300005444 | Bacteria | 4173 |
| 83 | Ga0070694_100062119 | 3300005444 | Bacteria | 2551 |
| 84 | Ga0070694_100323463 | 3300005444 | Bacteria | 1187 |
| 85 | Ga0070694_100409187 | 3300005444 | Bacteria | 1064 |
| 86 | Ga0070694_100489977 | 3300005444 | Bacteria | 977 |
| 87 | Ga0070694_100577901 | 3300005444 | Bacteria | 903 |
| 88 | Ga0070708_100103908 | 3300005445 | Bacteria | 2605 |
| 89 | Ga0070708_100934797 | 3300005445 | Bacteria | 814 |
| 90 | Ga0070678_100497830 | 3300005456 | Bacteria | 1075 |
| 91 | Ga0070678_100747013 | 3300005456 | Bacteria | 885 |
| 92 | Ga0070662_100049570 | 3300005457 | Bacteria | 3028 |
| 93 | Ga0070681_10018567 | 3300005458 | Bacteria | 6952 |
| 94 | Ga0070681_10020240 | 3300005458 | Bacteria | 6670 |
| 95 | Ga0070681_10020583 | 3300005458 | Bacteria | 6611 |
| 96 | Ga0070681_10209125 | 3300005458 | Bacteria | 1867 |
| 97 | Ga0070681_10399951 | 3300005458 | Bacteria | 1285 |
| 98 | Ga0068867_100004387 | 3300005459 | Bacteria | 9923 |
| 99 | Ga0068867_100008217 | 3300005459 | Bacteria | 7372 |
| 100 | Ga0070706_100422967 | 3300005467 | Bacteria | 1240 |
| 101 | Ga0070706_100433194 | 3300005467 | Bacteria | 1224 |
| 102 | Ga0070706_100586103 | 3300005467 | Unclassified | 1036 |
| 103 | Ga0070706_101192060 | 3300005467 | Bacteria | 700 |
| 104 | Ga0070707_100167909 | 3300005468 | Bacteria | 2139 |
| 105 | Ga0070707_100280671 | 3300005468 | Bacteria | 1619 |
| 106 | Ga0070707_100292258 | 3300005468 | Bacteria | 1583 |
| 107 | Ga0070707_100345728 | 3300005468 | Bacteria | 1445 |
| 108 | Ga0070698_100002719 | 3300005471 | Bacteria | 19443 |
| 109 | Ga0070698_100047033 | 3300005471 | Bacteria | 4411 |
| 110 | Ga0070698_100288017 | 3300005471 | Bacteria | 1574 |
| 111 | Ga0070698_100355023 | 3300005471 | Bacteria | 1398 |
| 112 | Ga0070699_100010154 | 3300005518 | Bacteria | 8149 |
| 113 | Ga0070699_100028410 | 3300005518 | Bacteria | 4823 |
| 114 | Ga0070699_100028998 | 3300005518 | Bacteria | 4771 |
| 115 | Ga0070699_100093669 | 3300005518 | Bacteria | 2629 |
| 116 | Ga0070699_100216853 | 3300005518 | Bacteria | 1705 |
| 117 | Ga0070699_100370060 | 3300005518 | Bacteria | 1293 |
| 118 | Ga0070679_100001812 | 3300005530 | Bacteria | 19273 |
| 119 | Ga0070679_100074072 | 3300005530 | Bacteria | 3396 |
| 120 | Ga0070679_100078330 | 3300005530 | Bacteria | 3294 |
| 121 | Ga0070684_100137437 | 3300005535 | Bacteria | 2208 |
| 122 | Ga0070684_100145024 | 3300005535 | Bacteria | 2149 |
| 123 | Ga0070684_100967251 | 3300005535 | Bacteria | 799 |
| 124 | Ga0070697_100012632 | 3300005536 | Bacteria | 6615 |
| 125 | Ga0070697_100025846 | 3300005536 | Bacteria | 4683 |
| 126 | Ga0070697_100033676 | 3300005536 | Bacteria | 4127 |
| 127 | Ga0070697_100441580 | 3300005536 | Bacteria | 1133 |
| 128 | Ga0070697_100744669 | 3300005536 | Unclassified | 866 |
| 129 | Ga0068853_100129221 | 3300005539 | Bacteria | 2260 |
| 130 | Ga0068853_100291072 | 3300005539 | Bacteria | 1508 |
| 131 | Ga0070672_100026908 | 3300005543 | Bacteria | 4286 |
| 132 | Ga0070686_100095324 | 3300005544 | Bacteria | 1999 |
| 133 | Ga0070686_100269848 | 3300005544 | Bacteria | 1250 |
| 134 | Ga0070695_100002095 | 3300005545 | Bacteria | 11424 |
| 135 | Ga0070695_100004987 | 3300005545 | Bacteria | 7826 |
| 136 | Ga0070695_100018488 | 3300005545 | Bacteria | 4232 |
| 137 | Ga0070695_100068774 | 3300005545 | Bacteria | 2313 |
| 138 | Ga0070695_100212777 | 3300005545 | Bacteria | 1388 |
| 139 | Ga0070695_100249737 | 3300005545 | Bacteria | 1291 |
| 140 | Ga0070695_100306648 | 3300005545 | Bacteria | 1175 |
| 141 | Ga0070696_100000180 | 3300005546 | Bacteria | 36576 |
| 142 | Ga0070696_100036097 | 3300005546 | Bacteria | 3406 |
| 143 | Ga0070696_100057118 | 3300005546 | Bacteria | 2723 |
| 144 | Ga0070696_100094560 | 3300005546 | Bacteria | 2133 |
| 145 | Ga0070696_100100300 | 3300005546 | Bacteria | 2074 |
| 146 | Ga0070696_100163689 | 3300005546 | Bacteria | 1640 |
| 147 | Ga0070696_100203936 | 3300005546 | Bacteria | 1477 |
| 148 | Ga0070696_100215575 | 3300005546 | Bacteria | 1438 |
| 149 | Ga0070693_100002991 | 3300005547 | Bacteria | 7826 |
| 150 | Ga0070693_100206583 | 3300005547 | Bacteria | 1279 |
| 151 | Ga0070693_100394482 | 3300005547 | Bacteria | 958 |
| 152 | Ga0070704_100001866 | 3300005549 | Bacteria | 11619 |
| 153 | Ga0070704_100009010 | 3300005549 | Bacteria | 6016 |
| 154 | Ga0070704_100010578 | 3300005549 | Bacteria | 5617 |
| 155 | Ga0070704_100047604 | 3300005549 | Bacteria | 2998 |
| 156 | Ga0070704_100065410 | 3300005549 | Bacteria | 2617 |
| 157 | Ga0070704_100095877 | 3300005549 | Bacteria | 2223 |
| 158 | Ga0070704_100104451 | 3300005549 | Bacteria | 2142 |
| 159 | Ga0070704_100216431 | 3300005549 | Bacteria | 1555 |
| 160 | Ga0068855_100001026 | 3300005563 | Bacteria | 34816 |
| 161 | Ga0068855_100049308 | 3300005563 | Bacteria | 4966 |
| 162 | Ga0068855_100067391 | 3300005563 | Bacteria | 4170 |
| 163 | Ga0068855_100151451 | 3300005563 | Bacteria | 2637 |
| 164 | Ga0070664_100017923 | 3300005564 | Bacteria | 5814 |
| 165 | Ga0070664_100018613 | 3300005564 | Bacteria | 5710 |
| 166 | Ga0070664_100073010 | 3300005564 | Bacteria | 2943 |
| 167 | Ga0070664_100184978 | 3300005564 | Bacteria | 1854 |
| 168 | Ga0070664_100195777 | 3300005564 | Bacteria | 1802 |
| 169 | Ga0070664_100259026 | 3300005564 | Bacteria | 1565 |
| 170 | Ga0068857_100158661 | 3300005577 | Bacteria | 2052 |
| 171 | Ga0068857_100181138 | 3300005577 | Bacteria | 1917 |
| 172 | Ga0068857_100233760 | 3300005577 | Bacteria | 1681 |
| 173 | Ga0068856_100319255 | 3300005614 | Bacteria | 1570 |
| 174 | Ga0070702_100018687 | 3300005615 | Bacteria | 3600 |
| 175 | Ga0070702_100452466 | 3300005615 | Bacteria | 932 |
| 176 | Ga0070702_100785834 | 3300005615 | Bacteria | 735 |
| 177 | Ga0068852_100012355 | 3300005616 | Bacteria | 6479 |
| 178 | Ga0068852_100111657 | 3300005616 | Bacteria | 2486 |
| 179 | Ga0068852_100128379 | 3300005616 | Bacteria | 2332 |
| 180 | Ga0068852_100579552 | 3300005616 | Bacteria | 1125 |
| 181 | Ga0068852_100902266 | 3300005616 | Bacteria | 901 |
| 182 | Ga0068859_100001226 | 3300005617 | Bacteria | 26171 |
| 183 | Ga0068859_100016661 | 3300005617 | Bacteria | 7378 |
| 184 | Ga0068859_100024635 | 3300005617 | Bacteria | 6037 |
| 185 | Ga0068859_100032097 | 3300005617 | Bacteria | 5275 |
| 186 | Ga0068859_100889068 | 3300005617 | Bacteria | 976 |
| 187 | Ga0068864_100215501 | 3300005618 | Bacteria | 1770 |
| 188 | Ga0068864_100532627 | 3300005618 | Bacteria | 1134 |
| 189 | Ga0068864_100648760 | 3300005618 | Bacteria | 1028 |
| 190 | Ga0068866_10147730 | 3300005718 | Bacteria | 1357 |
| 191 | Ga0068861_100006773 | 3300005719 | Bacteria | 7826 |
| 192 | Ga0068861_100063286 | 3300005719 | Bacteria | 2844 |
| 193 | Ga0068861_100486384 | 3300005719 | Bacteria | 1113 |
| 194 | Ga0068851_10001034 | 3300005834 | Bacteria | 12085 |
| 195 | Ga0068851_10158927 | 3300005834 | Bacteria | 1240 |
| 196 | Ga0068870_10025333 | 3300005840 | Bacteria | 2943 |
| 197 | Ga0068870_10036353 | 3300005840 | Bacteria | 2533 |
| 198 | Ga0068870_10075527 | 3300005840 | Bacteria | 1848 |
| 199 | Ga0068863_100120170 | 3300005841 | Bacteria | 2505 |
| 200 | Ga0068863_100334484 | 3300005841 | Bacteria | 1472 |
| 201 | Ga0068863_101051610 | 3300005841 | Bacteria | 818 |
| 202 | Ga0068858_100014725 | 3300005842 | Bacteria | 7362 |
| 203 | Ga0068858_100503947 | 3300005842 | Bacteria | 1170 |
| 204 | Ga0068860_100015796 | 3300005843 | Bacteria | 7372 |
| 205 | Ga0068860_100027637 | 3300005843 | Bacteria | 5462 |
| 206 | Ga0068862_100000936 | 3300005844 | Bacteria | 28121 |
| 207 | Ga0068862_100414622 | 3300005844 | Bacteria | 1262 |
| 208 | Ga0081455_10044130 | 3300005937 | Bacteria | 3893 |
| 209 | Ga0081538_10105034 | 3300005981 | Bacteria | 1407 |
| 210 | Ga0081538_10125762 | 3300005981 | Bacteria | 1219 |
| 211 | Ga0081539_10001417 | 3300005985 | Bacteria | 41272 |
| 212 | Ga0081539_10018413 | 3300005985 | Bacteria | 4848 |
| 213 | Ga0081539_10023062 | 3300005985 | Bacteria | 4090 |
| 214 | Ga0070717_10009247 | 3300006028 | Bacteria | 7406 |
| 215 | Ga0070717_10744967 | 3300006028 | Bacteria | 891 |
| 216 | Ga0070716_100223808 | 3300006173 | Bacteria | 1266 |
| 217 | Ga0070716_100410819 | 3300006173 | Bacteria | 976 |
| 218 | Ga0070712_100380563 | 3300006175 | Unclassified | 1162 |
| 219 | Ga0070712_100546395 | 3300006175 | Bacteria | 976 |
| 220 | Ga0070712_100892948 | 3300006175 | Bacteria | 766 |
| 221 | Ga0097621_100055240 | 3300006237 | Bacteria | 3242 |
| 222 | Ga0097621_100072507 | 3300006237 | Bacteria | 2848 |
| 223 | Ga0097621_100178597 | 3300006237 | Bacteria | 1833 |
| 224 | Ga0097621_100311934 | 3300006237 | Bacteria | 1391 |
| 225 | Ga0097621_100470323 | 3300006237 | Bacteria | 1135 |
| 226 | Ga0075370_10157038 | 3300006353 | Bacteria | 1334 |
| 227 | Ga0068871_100014460 | 3300006358 | Bacteria | 5887 |
| 228 | Ga0068871_100017452 | 3300006358 | Bacteria | 5433 |
| 229 | Ga0068871_100180774 | 3300006358 | Bacteria | 1812 |
| 230 | Ga0075428_100001175 | 3300006844 | Bacteria | 28033 |
| 231 | Ga0075428_100003327 | 3300006844 | Bacteria | 17580 |
| 232 | Ga0075428_100004010 | 3300006844 | Bacteria | 16164 |
| 233 | Ga0075428_100019806 | 3300006844 | Bacteria | 7446 |
| 234 | Ga0075428_100042969 | 3300006844 | Bacteria | 4970 |
| 235 | Ga0075430_100002934 | 3300006846 | Bacteria | 14264 |
| 236 | Ga0075431_100064349 | 3300006847 | Bacteria | 3787 |
| 237 | Ga0075433_10028232 | 3300006852 | Bacteria | 4769 |
| 238 | Ga0075433_10207385 | 3300006852 | Bacteria | 1742 |
| 239 | Ga0075434_100001205 | 3300006871 | Bacteria | 21511 |
| 240 | Ga0075434_100031867 | 3300006871 | Bacteria | 5198 |
| 241 | Ga0075434_100110147 | 3300006871 | Bacteria | 2764 |
| 242 | Ga0075434_100149851 | 3300006871 | Bacteria | 2353 |
| 243 | Ga0075434_100365214 | 3300006871 | Bacteria | 1464 |
| 244 | Ga0075434_101083707 | 3300006871 | Bacteria | 814 |
| 245 | Ga0075434_101552982 | 3300006871 | Bacteria | 671 |
| 246 | Ga0075429_100001637 | 3300006880 | Bacteria | 18510 |
| 247 | Ga0075429_100010090 | 3300006880 | Bacteria | 8184 |
| 248 | Ga0075429_100011040 | 3300006880 | Bacteria | 7817 |
| 249 | Ga0075429_100371127 | 3300006880 | Bacteria | 1253 |
| 250 | Ga0068865_100006045 | 3300006881 | Bacteria | 7378 |
| 251 | Ga0075436_100060217 | 3300006914 | Bacteria | 2622 |
| 252 | Ga0075436_100112760 | 3300006914 | Bacteria | 1899 |
| 253 | Ga0075436_100180993 | 3300006914 | Bacteria | 1490 |
| 254 | Ga0075436_100219010 | 3300006914 | Bacteria | 1350 |
| 255 | Ga0075436_100219945 | 3300006914 | Bacteria | 1347 |
| 256 | Ga0097620_100001226 | 3300006931 | Bacteria | 26171 |
| 257 | Ga0097620_100016661 | 3300006931 | Bacteria | 7378 |
| 258 | Ga0097620_100024635 | 3300006931 | Bacteria | 6037 |
| 259 | Ga0097620_100032097 | 3300006931 | Bacteria | 5275 |
| 260 | Ga0097620_100889226 | 3300006931 | Bacteria | 976 |
| 261 | Ga0097620_100916332 | 3300006931 | Bacteria | 961 |
| 262 | Ga0075435_100083564 | 3300007076 | Bacteria | 2625 |
| 263 | Ga0075435_100127432 | 3300007076 | Bacteria | 2128 |
| 264 | Ga0075435_100141742 | 3300007076 | Bacteria | 2017 |
| 265 | Ga0075435_100343288 | 3300007076 | Bacteria | 1279 |
| 266 | Ga0075435_100512445 | 3300007076 | Bacteria | 1037 |
| 267 | Ga0075435_100515873 | 3300007076 | Bacteria | 1034 |
| 268 | Ga0075435_100720077 | 3300007076 | Bacteria | 868 |
| 269 | Ga0099794_10026206 | 3300007265 | Bacteria | 2693 |
| 270 | Ga0099794_10042411 | 3300007265 | Bacteria | 2169 |
| 271 | Ga0099795_10264331 | 3300007788 | Bacteria | 746 |
| 272 | Ga0105250_10023435 | 3300009092 | Bacteria | 2486 |
| 273 | Ga0105240_10017393 | 3300009093 | Bacteria | 9692 |
| 274 | Ga0105240_10040202 | 3300009093 | Bacteria | 5985 |
| 275 | Ga0105240_10065260 | 3300009093 | Bacteria | 4520 |
| 276 | Ga0111539_10000829 | 3300009094 | Bacteria | 40191 |
| 277 | Ga0111539_10001620 | 3300009094 | Bacteria | 30065 |
| 278 | Ga0111539_10058846 | 3300009094 | Bacteria | 4558 |
| 279 | Ga0111539_10064868 | 3300009094 | Bacteria | 4318 |
| 280 | Ga0111539_10157774 | 3300009094 | Bacteria | 2655 |
| 281 | Ga0111539_10192474 | 3300009094 | Bacteria | 2380 |
| 282 | Ga0111539_10252812 | 3300009094 | Bacteria | 2052 |
| 283 | Ga0111539_10263141 | 3300009094 | Bacteria | 2008 |
| 284 | Ga0111539_10538569 | 3300009094 | Bacteria | 1360 |
| 285 | Ga0111539_10591943 | 3300009094 | Bacteria | 1292 |
| 286 | Ga0111539_10690325 | 3300009094 | Bacteria | 1188 |
| 287 | Ga0111539_10837248 | 3300009094 | Bacteria | 1070 |
| 288 | Ga0105245_10012615 | 3300009098 | Bacteria | 7358 |
| 289 | Ga0105245_10234186 | 3300009098 | Bacteria | 1777 |
| 290 | Ga0105245_10429248 | 3300009098 | Bacteria | 1326 |
| 291 | Ga0105245_11466143 | 3300009098 | Bacteria | 733 |
| 292 | Ga0114129_10007142 | 3300009147 | Bacteria | 15892 |
| 293 | Ga0114129_10031869 | 3300009147 | Bacteria | 7452 |
| 294 | Ga0114129_10042478 | 3300009147 | Bacteria | 6402 |
| 295 | Ga0114129_10086663 | 3300009147 | Bacteria | 4343 |
| 296 | Ga0114129_10090544 | 3300009147 | Bacteria | 4240 |
| 297 | Ga0114129_10659587 | 3300009147 | Bacteria | 1349 |
| 298 | Ga0105243_10009573 | 3300009148 | Bacteria | 7378 |
| 299 | Ga0105243_10208469 | 3300009148 | Bacteria | 1719 |
| 300 | Ga0105243_10245147 | 3300009148 | Bacteria | 1596 |
| 301 | Ga0105241_10074350 | 3300009174 | Bacteria | 2646 |
| 302 | Ga0105241_10825868 | 3300009174 | Bacteria | 855 |
| 303 | Ga0105242_10107916 | 3300009176 | Bacteria | 2369 |
| 304 | Ga0105242_10615638 | 3300009176 | Bacteria | 1051 |
| 305 | Ga0105248_10126896 | 3300009177 | Bacteria | 2878 |
| 306 | Ga0105248_10158379 | 3300009177 | Bacteria | 2555 |
| 307 | Ga0105248_10736861 | 3300009177 | Bacteria | 1112 |
| 308 | Ga0105237_10000625 | 3300009545 | Bacteria | 49435 |
| 309 | Ga0105237_10019788 | 3300009545 | Bacteria | 6950 |
| 310 | Ga0105238_10013604 | 3300009551 | Bacteria | 8217 |
| 311 | Ga0105238_10014032 | 3300009551 | Bacteria | 8100 |
| 312 | Ga0105238_10103045 | 3300009551 | Bacteria | 2835 |
| 313 | Ga0105238_10114073 | 3300009551 | Bacteria | 2681 |
| 314 | Ga0105238_10793592 | 3300009551 | Bacteria | 962 |
| 315 | Ga0105249_10137269 | 3300009553 | Bacteria | 2342 |
| 316 | Ga0105239_10000051 | 3300010375 | Bacteria | 169036 |
| 317 | Ga0105239_10001816 | 3300010375 | Bacteria | 27990 |
| 318 | Ga0105239_10447392 | 3300010375 | Bacteria | 1465 |
| 319 | Ga0105239_10515150 | 3300010375 | Bacteria | 1361 |
| 320 | Ga0157371_10415875 | 3300013102 | Bacteria | 985 |
| 321 | Ga0157369_10043732 | 3300013105 | Bacteria | 4881 |
| 322 | Ga0157369_10481760 | 3300013105 | Bacteria | 1284 |
| 323 | Ga0157369_11584414 | 3300013105 | Bacteria | 666 |
| 324 | Ga0157374_10147160 | 3300013296 | Bacteria | 2288 |
| 325 | Ga0157374_10316608 | 3300013296 | Bacteria | 1546 |
| 326 | Ga0157374_11027975 | 3300013296 | Bacteria | 843 |
| 327 | Ga0157378_10012667 | 3300013297 | Bacteria | 7378 |
| 328 | Ga0157378_10050050 | 3300013297 | Bacteria | 3718 |
| 329 | Ga0163162_10276181 | 3300013306 | Bacteria | 1812 |
| 330 | Ga0163162_10326290 | 3300013306 | Bacteria | 1667 |
| 331 | Ga0163162_11043492 | 3300013306 | Bacteria | 925 |
| 332 | Ga0157372_10012175 | 3300013307 | Bacteria | 9164 |
| 333 | Ga0157372_10054137 | 3300013307 | Bacteria | 4475 |
| 334 | Ga0157372_10285706 | 3300013307 | Bacteria | 1918 |
| 335 | Ga0157372_10531163 | 3300013307 | Bacteria | 1371 |
| 336 | Ga0157375_10295397 | 3300013308 | Bacteria | 1783 |
| 337 | Ga0163163_10274853 | 3300014325 | Bacteria | 1736 |
| 338 | Ga0163163_10919835 | 3300014325 | Bacteria | 938 |
| 339 | Ga0157380_10106642 | 3300014326 | Bacteria | 2345 |
| 340 | Ga0157380_10238914 | 3300014326 | Bacteria | 1637 |
| 341 | Ga0157380_10353419 | 3300014326 | Bacteria | 1376 |
| 342 | Ga0157380_10410699 | 3300014326 | Bacteria | 1288 |
| 343 | Ga0157380_10430553 | 3300014326 | Bacteria | 1261 |
| 344 | Ga0157377_10024992 | 3300014745 | Bacteria | 3181 |
| 345 | Ga0157379_10127673 | 3300014968 | Bacteria | 2288 |
| 346 | Ga0157376_10032882 | 3300014969 | Bacteria | 4169 |
| 347 | Ga0206350_11216696 | 3300020080 | Unclassified | 930 |
| 348 | Ga0213873_10029316 | 3300021358 | Bacteria | 1356 |
| 349 | Ga0213873_10073477 | 3300021358 | Bacteria | 946 |
| 350 | Ga0213873_10087883 | 3300021358 | Bacteria | 879 |
| 351 | Ga0213872_10080904 | 3300021361 | Bacteria | 1460 |
| 352 | Ga0213874_10014196 | 3300021377 | Bacteria | 2078 |
| 353 | Ga0213875_10000825 | 3300021388 | Bacteria | 23073 |
| 354 | Ga0213875_10066103 | 3300021388 | Bacteria | 1690 |
| 355 | Ga0213875_10176529 | 3300021388 | Bacteria | 1003 |
| 356 | Ga0213875_10259246 | 3300021388 | Bacteria | 820 |
| 357 | Ga0213871_10050971 | 3300021441 | Bacteria | 1134 |
| 358 | Ga0224572_1013070 | 3300024225 | Bacteria | 1583 |
| 359 | Ga0228598_1006731 | 3300024227 | Bacteria | 2369 |
| 360 | Ga0207653_10161829 | 3300025885 | Bacteria | 829 |
| 361 | Ga0207682_10089870 | 3300025893 | Bacteria | 1330 |
| 362 | Ga0207642_10000795 | 3300025899 | Bacteria | 9803 |
| 363 | Ga0207688_10032513 | 3300025901 | Bacteria | 2884 |
| 364 | Ga0207688_10157069 | 3300025901 | Bacteria | 1346 |
| 365 | Ga0207680_10073954 | 3300025903 | Bacteria | 2120 |
| 366 | Ga0207680_10128616 | 3300025903 | Bacteria | 1666 |
| 367 | Ga0207647_10343128 | 3300025904 | Bacteria | 846 |
| 368 | Ga0207699_10208349 | 3300025906 | Unclassified | 1328 |
| 369 | Ga0207699_10294152 | 3300025906 | Bacteria | 1132 |
| 370 | Ga0207645_10062098 | 3300025907 | Bacteria | 2387 |
| 371 | Ga0207643_10005979 | 3300025908 | Bacteria | 6505 |
| 372 | Ga0207643_10079325 | 3300025908 | Bacteria | 1900 |
| 373 | Ga0207643_10082475 | 3300025908 | Bacteria | 1864 |
| 374 | Ga0207684_10120761 | 3300025910 | Bacteria | 2247 |
| 375 | Ga0207684_10152293 | 3300025910 | Bacteria | 1990 |
| 376 | Ga0207684_10250360 | 3300025910 | Bacteria | 1528 |
| 377 | Ga0207684_10511862 | 3300025910 | Bacteria | 1028 |
| 378 | Ga0207654_10002438 | 3300025911 | Bacteria | 9499 |
| 379 | Ga0207654_10156188 | 3300025911 | Bacteria | 1469 |
| 380 | Ga0207654_10517648 | 3300025911 | Bacteria | 844 |
| 381 | Ga0207707_10003497 | 3300025912 | Bacteria | 13902 |
| 382 | Ga0207707_10034663 | 3300025912 | Bacteria | 4416 |
| 383 | Ga0207707_10172913 | 3300025912 | Bacteria | 1887 |
| 384 | Ga0207707_10332418 | 3300025912 | Bacteria | 1311 |
| 385 | Ga0207707_10598905 | 3300025912 | Bacteria | 933 |
| 386 | Ga0207695_10005372 | 3300025913 | Bacteria | 17034 |
| 387 | Ga0207695_10009849 | 3300025913 | Bacteria | 11745 |
| 388 | Ga0207695_10066308 | 3300025913 | Bacteria | 3708 |
| 389 | Ga0207695_10142311 | 3300025913 | Bacteria | 2346 |
| 390 | Ga0207695_10357886 | 3300025913 | Bacteria | 1346 |
| 391 | Ga0207671_10009150 | 3300025914 | Bacteria | 8312 |
| 392 | Ga0207671_10010577 | 3300025914 | Bacteria | 7595 |
| 393 | Ga0207693_10193786 | 3300025915 | Bacteria | 1599 |
| 394 | Ga0207693_10336899 | 3300025915 | Unclassified | 1181 |
| 395 | Ga0207693_10623876 | 3300025915 | Bacteria | 838 |
| 396 | Ga0207663_10396087 | 3300025916 | Bacteria | 1055 |
| 397 | Ga0207660_10072454 | 3300025917 | Bacteria | 2509 |
| 398 | Ga0207660_10151811 | 3300025917 | Bacteria | 1780 |
| 399 | Ga0207660_10427887 | 3300025917 | Bacteria | 1068 |
| 400 | Ga0207660_10557949 | 3300025917 | Bacteria | 932 |
| 401 | Ga0207662_10003842 | 3300025918 | Bacteria | 7805 |
| 402 | Ga0207662_10005398 | 3300025918 | Bacteria | 6809 |
| 403 | Ga0207662_10054606 | 3300025918 | Bacteria | 2382 |
| 404 | Ga0207662_10186669 | 3300025918 | Bacteria | 1336 |
| 405 | Ga0207662_10249342 | 3300025918 | Bacteria | 1165 |
| 406 | Ga0207662_10256929 | 3300025918 | Bacteria | 1149 |
| 407 | Ga0207657_10075804 | 3300025919 | Bacteria | 2838 |
| 408 | Ga0207657_10222137 | 3300025919 | Bacteria | 1513 |
| 409 | Ga0207649_10605005 | 3300025920 | Bacteria | 843 |
| 410 | Ga0207652_10056144 | 3300025921 | Bacteria | 3389 |
| 411 | Ga0207652_10057906 | 3300025921 | Bacteria | 3338 |
| 412 | Ga0207652_10199222 | 3300025921 | Bacteria | 1802 |
| 413 | Ga0207652_10433309 | 3300025921 | Bacteria | 1185 |
| 414 | Ga0207652_10559855 | 3300025921 | Bacteria | 1027 |
| 415 | Ga0207652_10943957 | 3300025921 | Bacteria | 760 |
| 416 | Ga0207646_10107048 | 3300025922 | Bacteria | 2508 |
| 417 | Ga0207646_10204119 | 3300025922 | Bacteria | 1785 |
| 418 | Ga0207646_10699518 | 3300025922 | Bacteria | 906 |
| 419 | Ga0207681_10013395 | 3300025923 | Bacteria | 5075 |
| 420 | Ga0207681_10308696 | 3300025923 | Bacteria | 1254 |
| 421 | Ga0207681_10565111 | 3300025923 | Bacteria | 937 |
| 422 | Ga0207694_10011571 | 3300025924 | Bacteria | 6657 |
| 423 | Ga0207694_10070565 | 3300025924 | Bacteria | 2729 |
| 424 | Ga0207694_10083769 | 3300025924 | Bacteria | 2508 |
| 425 | Ga0207694_10100547 | 3300025924 | Bacteria | 2291 |
| 426 | Ga0207650_10027881 | 3300025925 | Bacteria | 4045 |
| 427 | Ga0207650_10057766 | 3300025925 | Bacteria | 2887 |
| 428 | Ga0207659_10000497 | 3300025926 | Bacteria | 23633 |
| 429 | Ga0207659_10220900 | 3300025926 | Bacteria | 1523 |
| 430 | Ga0207687_10049529 | 3300025927 | Bacteria | 2921 |
| 431 | Ga0207687_10135712 | 3300025927 | Bacteria | 1861 |
| 432 | Ga0207700_10821603 | 3300025928 | Bacteria | 831 |
| 433 | Ga0207664_10061928 | 3300025929 | Bacteria | 2987 |
| 434 | Ga0207664_10200486 | 3300025929 | Bacteria | 1722 |
| 435 | Ga0207644_10206425 | 3300025931 | Bacteria | 1552 |
| 436 | Ga0207644_10238897 | 3300025931 | Bacteria | 1446 |
| 437 | Ga0207644_10299538 | 3300025931 | Bacteria | 1295 |
| 438 | Ga0207690_10032081 | 3300025932 | Bacteria | 3368 |
| 439 | Ga0207690_10314710 | 3300025932 | Bacteria | 1229 |
| 440 | Ga0207690_10640772 | 3300025932 | Bacteria | 870 |
| 441 | Ga0207706_10020119 | 3300025933 | Bacteria | 5997 |
| 442 | Ga0207706_10563027 | 3300025933 | Bacteria | 980 |
| 443 | Ga0207686_10004090 | 3300025934 | Bacteria | 7824 |
| 444 | Ga0207686_10070734 | 3300025934 | Bacteria | 2243 |
| 445 | Ga0207709_10002925 | 3300025935 | Bacteria | 10430 |
| 446 | Ga0207709_10120339 | 3300025935 | Bacteria | 1771 |
| 447 | Ga0207709_10803295 | 3300025935 | Unclassified | 759 |
| 448 | Ga0207670_10011914 | 3300025936 | Bacteria | 5063 |
| 449 | Ga0207670_10016160 | 3300025936 | Bacteria | 4478 |
| 450 | Ga0207670_10114076 | 3300025936 | Bacteria | 1952 |
| 451 | Ga0207670_10129865 | 3300025936 | Bacteria | 1844 |
| 452 | Ga0207670_10245363 | 3300025936 | Bacteria | 1382 |
| 453 | Ga0207670_10383102 | 3300025936 | Bacteria | 1120 |
| 454 | Ga0207704_10001762 | 3300025938 | Bacteria | 9683 |
| 455 | Ga0207704_10056227 | 3300025938 | Bacteria | 2409 |
| 456 | Ga0207665_10538333 | 3300025939 | Bacteria | 906 |
| 457 | Ga0207691_10036125 | 3300025940 | Bacteria | 4579 |
| 458 | Ga0207691_10058161 | 3300025940 | Bacteria | 3517 |
| 459 | Ga0207691_10193737 | 3300025940 | Bacteria | 1772 |
| 460 | Ga0207711_10078696 | 3300025941 | Bacteria | 2876 |
| 461 | Ga0207711_10648249 | 3300025941 | Bacteria | 985 |
| 462 | Ga0207689_10012264 | 3300025942 | Bacteria | 7330 |
| 463 | Ga0207689_10193235 | 3300025942 | Bacteria | 1679 |
| 464 | Ga0207689_10479048 | 3300025942 | Bacteria | 1042 |
| 465 | Ga0207661_10185605 | 3300025944 | Bacteria | 1820 |
| 466 | Ga0207661_10311469 | 3300025944 | Bacteria | 1413 |
| 467 | Ga0207679_10049021 | 3300025945 | Bacteria | 3078 |
| 468 | Ga0207679_10077749 | 3300025945 | Bacteria | 2526 |
| 469 | Ga0207679_10171460 | 3300025945 | Bacteria | 1787 |
| 470 | Ga0207679_10229517 | 3300025945 | Bacteria | 1566 |
| 471 | Ga0207667_10012992 | 3300025949 | Bacteria | 9558 |
| 472 | Ga0207667_10025639 | 3300025949 | Bacteria | 6451 |
| 473 | Ga0207667_10046656 | 3300025949 | Bacteria | 4588 |
| 474 | Ga0207651_10056533 | 3300025960 | Bacteria | 2701 |
| 475 | Ga0207651_10089913 | 3300025960 | Bacteria | 2243 |
| 476 | Ga0207651_10126165 | 3300025960 | Bacteria | 1950 |
| 477 | Ga0207651_10355018 | 3300025960 | Bacteria | 1236 |
| 478 | Ga0207712_10065482 | 3300025961 | Bacteria | 2594 |
| 479 | Ga0207712_10400141 | 3300025961 | Bacteria | 1154 |
| 480 | Ga0207712_10420068 | 3300025961 | Bacteria | 1128 |
| 481 | Ga0207640_10016745 | 3300025981 | Bacteria | 4272 |
| 482 | Ga0207640_10053345 | 3300025981 | Unclassified | 2639 |
| 483 | Ga0207640_10381779 | 3300025981 | Bacteria | 1142 |
| 484 | Ga0207658_10632374 | 3300025986 | Bacteria | 964 |
| 485 | Ga0207677_10003975 | 3300026023 | Bacteria | 7883 |
| 486 | Ga0207677_10153715 | 3300026023 | Bacteria | 1779 |
| 487 | Ga0207677_10236452 | 3300026023 | Bacteria | 1475 |
| 488 | Ga0207677_10419556 | 3300026023 | Bacteria | 1139 |
| 489 | Ga0207677_11445044 | 3300026023 | Bacteria | 634 |
| 490 | Ga0207703_10010213 | 3300026035 | Bacteria | 7358 |
| 491 | Ga0207703_10049396 | 3300026035 | Bacteria | 3401 |
| 492 | Ga0207639_10047688 | 3300026041 | Bacteria | 3239 |
| 493 | Ga0207639_10089627 | 3300026041 | Bacteria | 2458 |
| 494 | Ga0207639_10264118 | 3300026041 | Bacteria | 1507 |
| 495 | Ga0207708_10008062 | 3300026075 | Bacteria | 7805 |
| 496 | Ga0207708_10011323 | 3300026075 | Bacteria | 6641 |
| 497 | Ga0207708_10043409 | 3300026075 | Bacteria | 3427 |
| 498 | Ga0207708_10164159 | 3300026075 | Bacteria | 1755 |
| 499 | Ga0207702_10796898 | 3300026078 | Bacteria | 934 |
| 500 | Ga0207641_10058519 | 3300026088 | Bacteria | 3280 |
| 501 | Ga0207641_10077479 | 3300026088 | Bacteria | 2877 |
| 502 | Ga0207641_10097219 | 3300026088 | Bacteria | 2588 |
| 503 | Ga0207648_10004952 | 3300026089 | Bacteria | 13550 |
| 504 | Ga0207648_10014322 | 3300026089 | Bacteria | 7330 |
| 505 | Ga0207648_11166595 | 3300026089 | Bacteria | 723 |
| 506 | Ga0207676_10195036 | 3300026095 | Bacteria | 1785 |
| 507 | Ga0207676_10398149 | 3300026095 | Bacteria | 1286 |
| 508 | Ga0207674_10032849 | 3300026116 | Bacteria | 5440 |
| 509 | Ga0207674_10094210 | 3300026116 | Bacteria | 2981 |
| 510 | Ga0207674_10268535 | 3300026116 | Bacteria | 1653 |
| 511 | Ga0207675_100014544 | 3300026118 | Bacteria | 7336 |
| 512 | Ga0207675_100084083 | 3300026118 | Bacteria | 2986 |
| 513 | Ga0207675_100090295 | 3300026118 | Bacteria | 2880 |
| 514 | Ga0207675_100515545 | 3300026118 | Bacteria | 1191 |
| 515 | Ga0207683_10401211 | 3300026121 | Bacteria | 1262 |
| 516 | Ga0207698_10000418 | 3300026142 | Bacteria | 24481 |
| 517 | Ga0207698_10096282 | 3300026142 | Bacteria | 2439 |
| 518 | Ga0209179_1022397 | 3300027512 | Bacteria | 1240 |
| 519 | Ga0207428_10002123 | 3300027907 | Bacteria | 19965 |
| 520 | Ga0207428_10005694 | 3300027907 | Bacteria | 11582 |
| 521 | Ga0207428_10009987 | 3300027907 | Bacteria | 8496 |
| 522 | Ga0207428_10621878 | 3300027907 | Bacteria | 777 |
| 523 | Ga0265357_1004223 | 3300028023 | Bacteria | 1285 |
| 524 | Ga0268265_10000768 | 3300028380 | Bacteria | 31006 |
| 525 | Ga0268265_10006681 | 3300028380 | Bacteria | 7809 |
| 526 | Ga0268264_10010052 | 3300028381 | Bacteria | 7833 |
| 527 | Ga0268264_10032877 | 3300028381 | Bacteria | 4257 |
| 528 | Ga0265325_10048933 | 3300031241 | Bacteria | 2183 |
| 529 | Ga0265339_10000323 | 3300031249 | Bacteria | 38406 |
| 530 | Ga0307408_100534397 | 3300031548 | Bacteria | 1032 |
| 531 | Ga0265313_10001589 | 3300031595 | Bacteria | 21087 |
| 532 | Ga0307413_10209650 | 3300031824 | Bacteria | 1414 |
| 533 | Ga0307406_10616230 | 3300031901 | Bacteria | 897 |
| 534 | Ga0307412_10145957 | 3300031911 | Bacteria | 1739 |
| 535 | Ga0307412_10318434 | 3300031911 | Bacteria | 1237 |
| 536 | Ga0307416_100020661 | 3300032002 | Bacteria | 4705 |
| 537 | Ga0307416_100255960 | 3300032002 | Bacteria | 1707 |
| 538 | Ga0307411_10539823 | 3300032005 | Bacteria | 993 |
| 539 | Ga0373930_0073807 | 3300034816 | Bacteria | 779 |
| 540 | Ga0373948_0065466 | 3300034817 | Bacteria | 806 |
| 541 | Ga0373948_0075578 | 3300034817 | Bacteria | 761 |
| 542 | Ga0373938_0002374 | 3300034957 | Bacteria | 3035 |
| 543 | Ga0373926_0212043 | 3300035083 | Bacteria | 747 |
| 544 | Ga0373929_0073281 | 3300035085 | Bacteria | 823 |
| 545 | Ga0373929_0113796 | 3300035085 | Bacteria | 694 |
| 546 | Ga0373934_0086483 | 3300035086 | Bacteria | 1261 |
| 547 | Ga0373934_0130576 | 3300035086 | Bacteria | 1024 |
| 548 | Ga0373940_0011535 | 3300035088 | Bacteria | 2100 |
| 549 | Ga0373949_0015149 | 3300035090 | Bacteria | 1720 |
| 550 | Ga0373949_0062784 | 3300035090 | Bacteria | 959 |
| 551 | Ga0373951_0007192 | 3300035091 | Bacteria | 2532 |
| 552 | Ga0373923_0157488 | 3300035111 | Bacteria | 1034 |
| 553 | Ga0373932_0025353 | 3300035112 | Bacteria | 1604 |
| 554 | Ga0373932_0054115 | 3300035112 | Bacteria | 1200 |
| 555 | Ga0373932_0078699 | 3300035112 | Bacteria | 1037 |
| 556 | Ga0373932_0096999 | 3300035112 | Bacteria | 954 |
| 557 | Ga0373936_0014321 | 3300035113 | Bacteria | 3028 |
| 558 | Ga0373936_0118784 | 3300035113 | Bacteria | 1128 |
| 559 | Ga0373936_0119286 | 3300035113 | Bacteria | 1125 |
| 560 | Ga0373939_0118998 | 3300035114 | Bacteria | 929 |
| 561 | Ga0373939_0174765 | 3300035114 | Bacteria | 797 |
| 562 | Ga0373941_0019206 | 3300035115 | Bacteria | 1899 |
| 563 | Ga0373941_0063080 | 3300035115 | Bacteria | 1211 |
| 564 | Ga0373941_0303060 | 3300035115 | Bacteria | 638 |
| 565 | Ga0373945_0056986 | 3300035116 | Bacteria | 1450 |
| 566 | Ga0373945_0150938 | 3300035116 | Bacteria | 942 |
| 567 | Ga0373945_0200436 | 3300035116 | Bacteria | 828 |
| 568 | Ga0373953_0220546 | 3300035117 | Bacteria | 821 |
| 569 | Ga0373954_0000511 | 3300035118 | Bacteria | 14523 |
| 570 | Ga0373954_0012477 | 3300035118 | Bacteria | 3777 |
| 571 | Ga0373954_0321770 | 3300035118 | Bacteria | 763 |
| 572 | Ga0373956_0219978 | 3300035119 | Bacteria | 901 |
| 573 | Ga0373956_0313801 | 3300035119 | Bacteria | 747 |
| 574 | Ga0373957_0059787 | 3300035120 | Bacteria | 1474 |
| 575 | Ga0373943_0058736 | 3300035170 | Bacteria | 1915 |
| 576 | Ga0373946_0004572 | 3300035171 | Bacteria | 4959 |
| 577 | Ga0373946_0012587 | 3300035171 | Bacteria | 3169 |
| 578 | Ga0373955_0448188 | 3300035172 | Bacteria | 786 |
| 579 | Ga0373942_0008660 | 3300035207 | Bacteria | 2374 |
| 580 | Ga0373942_0049354 | 3300035207 | Bacteria | 1175 |
| 581 | Ga0373961_0048850 | 3300035241 | Bacteria | 1248 |
| 582 | Ga0373961_0125354 | 3300035241 | Bacteria | 855 |
| 583 | Ga0373931_0001370 | 3300035691 | Bacteria | 10416 |
| 584 | Ga0373931_0016572 | 3300035691 | Bacteria | 3629 |
| 585 | Ga0373931_0177914 | 3300035691 | Bacteria | 1258 |
| 586 | Ga0373931_0198465 | 3300035691 | Bacteria | 1197 |
| 587 | Ga0373935_0013594 | 3300035692 | Bacteria | 4914 |
| 588 | Ga0373935_0078759 | 3300035692 | Bacteria | 2138 |
| 589 | Ga0373935_0211732 | 3300035692 | Bacteria | 1343 |
| 590 | Ga0373927_0004154 | 3300035695 | Bacteria | 10175 |
| 591 | Ga0373927_0020293 | 3300035695 | Bacteria | 4358 |
| 592 | Ga0373927_0028738 | 3300035695 | Bacteria | 3627 |
| 593 | Ga0373927_0260200 | 3300035695 | Bacteria | 1141 |
| 594 | Ga0373927_0519708 | 3300035695 | Bacteria | 787 |
| 595 | Ga0373927_0635729 | 3300035695 | Unclassified | 705 |
| 596 | Ga0373933_0161322 | 3300035724 | Bacteria | 1423 |
| 597 | Ga0373947_0005577 | 3300035725 | Bacteria | 7336 |
| 598 | Ga0373947_0153678 | 3300035725 | Unclassified | 1484 |
| 599 | Ga0373947_0345763 | 3300035725 | Bacteria | 997 |
| 600 | Ga0373937_0088704 | 3300036401 | Bacteria | 2863 |
| 601 | Ga0373937_0102121 | 3300036401 | Bacteria | 2662 |
| 602 | Ga0373937_0139655 | 3300036401 | Bacteria | 2266 |
| 603 | Ga0373937_0194409 | 3300036401 | Bacteria | 1906 |
| 604 | Ga0373925_0057775 | 3300037068 | Bacteria | 2907 |
| 605 | Ga0373925_0163458 | 3300037068 | Bacteria | 1754 |
| 606 | Ga0373925_0214501 | 3300037068 | Bacteria | 1534 |
| 607 | Ga0373925_0711148 | 3300037068 | Bacteria | 828 |
| 608 | Ga0395899_0319187 | 3300037312 | Bacteria | 1047 |
| 609 | Ga0395900_0080357 | 3300037418 | Bacteria | 3350 |
| 610 | Ga0395905_0021133 | 3300037471 | Bacteria | 6162 |
| 611 | Ga0395905_0026213 | 3300037471 | Bacteria | 5497 |
| 612 | Ga0436364_0029308 | 3300037853 | Bacteria | 1189 |
| 613 | Ga0436364_0685835 | 3300037853 | Bacteria | 964 |
| 614 | Ga0436364_0734767 | 3300037853 | Bacteria | 8451 |
| 615 | Ga0436364_0798454 | 3300037853 | Unclassified | 1686 |
| 616 | Ga0436364_0937935 | 3300037853 | Bacteria | 2357 |
| 617 | Ga0436364_0953789 | 3300037853 | Bacteria | 5220 |
| 618 | Ga0436364_1104137 | 3300037853 | Bacteria | 965 |
| 619 | Ga0436364_1433936 | 3300037853 | Bacteria | 1757 |
| 620 | Ga0395901_0207803 | 3300038443 | Bacteria | 2050 |
| 621 | Ga0436365_0560582 | 3300039437 | Bacteria | 7725 |
| 622 | Ga0436365_1727819 | 3300039437 | Bacteria | 3270 |
| 623 | Ga0436365_1911354 | 3300039437 | Bacteria | 2182 |
| 624 | Ga0436360_0016934 | 3300039438 | Bacteria | 4815 |
| 625 | Ga0436360_0392294 | 3300039438 | Bacteria | 1641 |
| 626 | Ga0436360_0574300 | 3300039438 | Bacteria | 11535 |
| 627 | Ga0436360_1108102 | 3300039438 | Bacteria | 1218 |
| 628 | Ga0436360_1286715 | 3300039438 | Bacteria | 1569 |
| 629 | Ga0436361_0213384 | 3300039447 | Bacteria | 3792 |
| 630 | Ga0436361_0945327 | 3300039447 | Bacteria | 3240 |
| 631 | Ga0436363_1223183 | 3300039450 | Bacteria | 1873 |
| 632 | Ga0436362_0077617 | 3300039453 | Bacteria | 1067 |
| 633 | Ga0436362_0497172 | 3300039453 | Bacteria | 1386 |
| 634 | Ga0436362_0507543 | 3300039453 | Bacteria | 1663 |
| 635 | Ga0436362_0811667 | 3300039453 | Bacteria | 1287 |
| 636 | Ga0436362_0841797 | 3300039453 | Bacteria | 799 |
| 637 | Ga0436362_1028381 | 3300039453 | Bacteria | 852 |
| 638 | Ga0439453_0007188 | 3300041408 | Bacteria | 1758 |
| 639 | Ga0439437_039435 | 3300042000 | Bacteria | 610 |
| 640 | Ga0439441_000308 | 3300042001 | Bacteria | 4915 |
| 641 | Ga0439441_002417 | 3300042001 | Bacteria | 2630 |
| 642 | Ga0439443_001185 | 3300042003 | Bacteria | 2779 |
| 643 | Ga0439451_033541 | 3300042009 | Bacteria | 1032 |
| 644 | Ga0439456_007993 | 3300042013 | Bacteria | 2181 |
| 645 | Ga0439435_0001860 | 3300042436 | Bacteria | 4037 |
| 646 | Ga0439435_0002925 | 3300042436 | Bacteria | 3472 |
| 647 | Ga0439444_0000098 | 3300042437 | Bacteria | 6882 |
| 648 | Ga0439444_0004416 | 3300042437 | Bacteria | 2043 |
| 649 | Ga0439460_0000132 | 3300042461 | Bacteria | 13295 |
| 650 | Ga0453683_0283746 | 3300044673 | Bacteria | 1058 |
| 651 | Ga0466965_0390459 | 3300044683 | Bacteria | 768 |
| 652 | Ga0466961_0406063 | 3300044693 | Bacteria | 826 |
| 653 | Ga0466963_0116796 | 3300044694 | Bacteria | 1834 |
| 654 | Ga0466964_0174316 | 3300044706 | Bacteria | 1015 |
| 655 | Ga0466957_0013848 | 3300044842 | Bacteria | 4688 |
| 656 | Ga0466957_0076598 | 3300044842 | Bacteria | 2077 |
| 657 | Ga0466959_0107877 | 3300045049 | Bacteria | 1990 |
| 658 | Ga0466959_0247373 | 3300045049 | Bacteria | 1230 |
| 659 | Ga0451576_0039474 | 3300045051 | Bacteria | 4996 |
| 660 | Ga0451576_0048796 | 3300045051 | Bacteria | 4444 |
| 661 | Ga0451576_0087590 | 3300045051 | Bacteria | 3238 |
| 662 | Ga0451576_0260075 | 3300045051 | Bacteria | 1814 |
| 663 | Ga0451576_0890880 | 3300045051 | Bacteria | 934 |
| 664 | Ga0466958_0036036 | 3300045836 | Bacteria | 2959 |
| 665 | Ga0466958_0038400 | 3300045836 | Bacteria | 2873 |
| 666 | Ga0466958_0125679 | 3300045836 | Bacteria | 1608 |
| 667 | Ga0495617_126682 | 3300046452 | Bacteria | 821 |
| 668 | Ga0495592_0022552 | 3300046454 | Bacteria | 4789 |
| 669 | Ga0495592_0051211 | 3300046454 | Bacteria | 3067 |
| 670 | Ga0495592_0096631 | 3300046454 | Bacteria | 2111 |
| 671 | Ga0495603_0018093 | 3300046455 | Bacteria | 4263 |
| 672 | Ga0495629_0015797 | 3300046459 | Bacteria | 5421 |
| 673 | Ga0495629_0371740 | 3300046459 | Bacteria | 973 |
| 674 | Ga0495641_0013868 | 3300046461 | Bacteria | 4393 |
| 675 | Ga0495641_0070180 | 3300046461 | Bacteria | 1574 |
| 676 | Ga0495651_0261448 | 3300046462 | Bacteria | 1177 |
| 677 | Ga0495653_0031607 | 3300046463 | Bacteria | 4207 |
| 678 | Ga0495650_0025193 | 3300046471 | Bacteria | 2793 |
| 679 | Ga0495580_0010156 | 3300046472 | Bacteria | 7354 |
| 680 | Ga0495580_0045495 | 3300046472 | Bacteria | 3117 |
| 681 | Ga0495605_0020617 | 3300046474 | Bacteria | 3501 |
| 682 | Ga0495639_0016874 | 3300046475 | Bacteria | 3171 |
| 683 | Ga0495639_0125139 | 3300046475 | Bacteria | 1228 |
| 684 | Ga0495639_0173572 | 3300046475 | Bacteria | 1047 |
| 685 | Ga0495662_0012118 | 3300046476 | Bacteria | 4213 |
| 686 | Ga0495662_0012796 | 3300046476 | Bacteria | 4091 |
| 687 | Ga0495584_0202124 | 3300046491 | Bacteria | 1010 |
| 688 | Ga0495585_0000287 | 3300046492 | Bacteria | 50518 |
| 689 | Ga0495585_0171718 | 3300046492 | Bacteria | 1120 |
| 690 | Ga0495585_0195871 | 3300046492 | Bacteria | 1031 |
| 691 | Ga0495594_0036571 | 3300046499 | Bacteria | 2677 |
| 692 | Ga0495594_0059689 | 3300046499 | Bacteria | 2110 |
| 693 | Ga0495594_0171783 | 3300046499 | Bacteria | 1233 |
| 694 | Ga0495596_0001186 | 3300046500 | Bacteria | 15241 |
| 695 | Ga0495596_0021535 | 3300046500 | Bacteria | 2631 |
| 696 | Ga0495607_0135354 | 3300046501 | Bacteria | 1277 |
| 697 | Ga0495583_0035664 | 3300046506 | Bacteria | 2372 |
| 698 | Ga0495608_0010985 | 3300046511 | Bacteria | 6311 |
| 699 | Ga0495608_0052853 | 3300046511 | Bacteria | 2688 |
| 700 | Ga0495616_0032489 | 3300046513 | Bacteria | 2726 |
| 701 | Ga0495618_0045131 | 3300046514 | Bacteria | 2779 |
| 702 | Ga0495618_0156188 | 3300046514 | Bacteria | 1456 |
| 703 | Ga0495628_0205094 | 3300046516 | Bacteria | 1484 |
| 704 | Ga0495630_0023570 | 3300046517 | Bacteria | 4550 |
| 705 | Ga0495630_0078289 | 3300046517 | Bacteria | 2492 |
| 706 | Ga0495631_0009622 | 3300046518 | Bacteria | 4820 |
| 707 | Ga0495631_0020727 | 3300046518 | Bacteria | 3068 |
| 708 | Ga0495643_0028181 | 3300046522 | Bacteria | 3151 |
| 709 | Ga0495643_0046436 | 3300046522 | Bacteria | 2354 |
| 710 | Ga0495644_0027452 | 3300046523 | Bacteria | 2156 |
| 711 | Ga0495644_0064411 | 3300046523 | Bacteria | 1378 |
| 712 | Ga0495644_0096612 | 3300046523 | Bacteria | 1116 |
| 713 | Ga0495648_0071142 | 3300046524 | Bacteria | 2018 |
| 714 | Ga0495648_0084944 | 3300046524 | Bacteria | 1790 |
| 715 | Ga0495648_0113398 | 3300046524 | Bacteria | 1470 |
| 716 | Ga0495648_0149643 | 3300046524 | Bacteria | 1219 |
| 717 | Ga0495663_0010629 | 3300046525 | Bacteria | 2561 |
| 718 | Ga0495666_0025550 | 3300046526 | Bacteria | 2916 |
| 719 | Ga0495666_0061321 | 3300046526 | Bacteria | 1797 |
| 720 | Ga0495642_0038728 | 3300046528 | Bacteria | 1932 |
| 721 | Ga0495652_0094204 | 3300046529 | Bacteria | 2443 |
| 722 | Ga0495665_0032907 | 3300046531 | Bacteria | 2774 |
| 723 | Ga0495640_0017848 | 3300046533 | Bacteria | 5278 |
| 724 | Ga0495640_0043549 | 3300046533 | Bacteria | 3125 |
| 725 | Ga0495640_0203586 | 3300046533 | Bacteria | 1253 |
| 726 | Ga0495586_0009349 | 3300046535 | Bacteria | 5214 |
| 727 | Ga0495586_0031541 | 3300046535 | Bacteria | 2839 |
| 728 | Ga0495586_0378899 | 3300046535 | Bacteria | 813 |
| 729 | Ga0495587_0014866 | 3300046536 | Bacteria | 4870 |
| 730 | Ga0495598_0077462 | 3300046537 | Bacteria | 1060 |
| 731 | Ga0495598_0091776 | 3300046537 | Bacteria | 992 |
| 732 | Ga0495609_0011309 | 3300046538 | Bacteria | 4254 |
| 733 | Ga0495609_0045100 | 3300046538 | Bacteria | 1976 |
| 734 | Ga0495609_0179783 | 3300046538 | Bacteria | 891 |
| 735 | Ga0495621_0007990 | 3300046539 | Bacteria | 3152 |
| 736 | Ga0495621_0072735 | 3300046539 | Bacteria | 1269 |
| 737 | Ga0495621_0093208 | 3300046539 | Bacteria | 1137 |
| 738 | Ga0495621_0151082 | 3300046539 | Bacteria | 914 |
| 739 | Ga0495597_0018871 | 3300046542 | Bacteria | 3232 |
| 740 | Ga0495645_0358318 | 3300046543 | Bacteria | 938 |
| 741 | Ga0495622_0031565 | 3300046557 | Bacteria | 2475 |
| 742 | Ga0495622_0036405 | 3300046557 | Bacteria | 2295 |
| 743 | Ga0495622_0081566 | 3300046557 | Bacteria | 1488 |
| 744 | Ga0495633_0131984 | 3300046558 | Bacteria | 1156 |
| 745 | Ga0495667_0025855 | 3300046559 | Bacteria | 3954 |
| 746 | Ga0495667_0071968 | 3300046559 | Bacteria | 2254 |
| 747 | Ga0495667_0283637 | 3300046559 | Bacteria | 1051 |
| 748 | Ga0495656_0067782 | 3300046615 | Bacteria | 1576 |
| 749 | Ga0495656_0130941 | 3300046615 | Bacteria | 1194 |
| 750 | Ga0495668_0038655 | 3300046616 | Bacteria | 2666 |
| 751 | Ga0495634_0033792 | 3300046642 | Bacteria | 3512 |
| 752 | Ga0495634_0116594 | 3300046642 | Bacteria | 1713 |
| 753 | Ga0495634_0126144 | 3300046642 | Bacteria | 1635 |
| 754 | Ga0495611_0053960 | 3300046648 | Bacteria | 1815 |
| 755 | Ga0495635_0094248 | 3300046663 | Bacteria | 2047 |
| 756 | Ga0495635_0233293 | 3300046663 | Bacteria | 1243 |
| 757 | Ga0495659_0011488 | 3300046664 | Bacteria | 2853 |
| 758 | Ga0495659_0018068 | 3300046664 | Bacteria | 2345 |
| 759 | Ga0495659_0026177 | 3300046664 | Bacteria | 2002 |
| 760 | Ga0495659_0086521 | 3300046664 | Bacteria | 1197 |
| 761 | Ga0495659_0097492 | 3300046664 | Bacteria | 1135 |
| 762 | Ga0495661_0036014 | 3300046665 | Bacteria | 3102 |
| 763 | Ga0495588_0003424 | 3300046674 | Bacteria | 6894 |
| 764 | Ga0495588_0006205 | 3300046674 | Bacteria | 5372 |
| 765 | Ga0495657_0051824 | 3300046675 | Bacteria | 2755 |
| 766 | Ga0495599_0009378 | 3300046678 | Bacteria | 5980 |
| 767 | Ga0495599_0025668 | 3300046678 | Bacteria | 3690 |
| 768 | Ga0495647_0001466 | 3300046681 | Bacteria | 7317 |
| 769 | Ga0495647_0012487 | 3300046681 | Bacteria | 2926 |
| 770 | Ga0495647_0280158 | 3300046681 | Unclassified | 748 |
| 771 | Ga0495658_0190664 | 3300046683 | Bacteria | 1274 |
| 772 | Ga0495658_0219495 | 3300046683 | Bacteria | 1190 |
| 773 | Ga0495658_0452429 | 3300046683 | Bacteria | 820 |
| 774 | Ga0495658_0489386 | 3300046683 | Bacteria | 786 |
| 775 | Ga0495669_0040245 | 3300046684 | Bacteria | 2072 |
| 776 | Ga0495669_0049257 | 3300046684 | Bacteria | 1886 |
| 777 | Ga0495669_0053312 | 3300046684 | Bacteria | 1819 |
| 778 | Ga0495613_0498716 | 3300046689 | Bacteria | 820 |
| 779 | Ga0495624_0053347 | 3300046690 | Bacteria | 2553 |
| 780 | Ga0495624_0435521 | 3300046690 | Bacteria | 786 |
| 781 | Ga0495600_0005383 | 3300046809 | Bacteria | 7715 |
| 782 | Ga0495600_0286202 | 3300046809 | Bacteria | 1042 |
| 783 | Ga0495581_0301604 | 3300047315 | Bacteria | 936 |
| 784 | Ga0495581_0351917 | 3300047315 | Bacteria | 860 |
| 785 | Ga0495604_0066910 | 3300047317 | Bacteria | 2731 |
| 786 | Ga0495604_0081829 | 3300047317 | Bacteria | 2416 |
| 787 | Ga0495636_0045399 | 3300047318 | Bacteria | 1831 |
| 788 | Ga0495636_0046260 | 3300047318 | Bacteria | 1814 |
| 789 | Ga0495636_0059994 | 3300047318 | Unclassified | 1607 |
| 790 | Ga0495636_0121196 | 3300047318 | Bacteria | 1157 |
| 791 | Ga0495636_0232715 | 3300047318 | Unclassified | 848 |
| 792 | Ga0495674_0058934 | 3300047319 | Bacteria | 3355 |
| 793 | Ga0495674_0136209 | 3300047319 | Bacteria | 2066 |
| 794 | Ga0495672_0037083 | 3300047320 | Bacteria | 2987 |
| 795 | Ga0495672_0099404 | 3300047320 | Bacteria | 1581 |
| 796 | Ga0495672_0111948 | 3300047320 | Bacteria | 1463 |
| 797 | Ga0495676_0015250 | 3300047321 | Bacteria | 6851 |
| 798 | Ga0495676_0039356 | 3300047321 | Bacteria | 3916 |
| 799 | Ga0495680_0009272 | 3300047322 | Bacteria | 8865 |
| 800 | Ga0495683_0096614 | 3300047323 | Bacteria | 1425 |
| 801 | Ga0495683_0164866 | 3300047323 | Bacteria | 1022 |
| 802 | Ga0495675_0056042 | 3300047444 | Bacteria | 2499 |
| 803 | Ga0495677_0049783 | 3300047445 | Bacteria | 1541 |
| 804 | Ga0495677_0058045 | 3300047445 | Unclassified | 1431 |
| 805 | Ga0495677_0070702 | 3300047445 | Bacteria | 1300 |
| 806 | Ga0495677_0122412 | 3300047445 | Bacteria | 993 |
| 807 | Ga0495673_0022925 | 3300047469 | Bacteria | 3050 |
| 808 | Ga0495681_0043408 | 3300047470 | Bacteria | 2168 |
| 809 | Ga0495684_0407861 | 3300047471 | Bacteria | 952 |
| 810 | Ga0495686_0517556 | 3300047472 | Unclassified | 626 |
| 811 | Ga0495626_0009050 | 3300048091 | Bacteria | 5399 |
| 812 | Ga0495626_0071387 | 3300048091 | Bacteria | 1560 |
| 813 | Ga0496100_0565306 | 3300048903 | Unclassified | 881 |
| 814 | Ga0496104_0020113 | 3300048907 | Bacteria | 6117 |
| 815 | Ga0496104_0026791 | 3300048907 | Bacteria | 5328 |
| 816 | Ga0496106_0000002 | 3300048909 | Bacteria | 377020 |
| 817 | Ga0496106_0191994 | 3300048909 | Bacteria | 1624 |
| 818 | Ga0496106_0658870 | 3300048909 | Bacteria | 836 |
| 819 | Ga0496107_0040768 | 3300048910 | Bacteria | 3334 |
| 820 | Ga0496110_0232968 | 3300048913 | Bacteria | 1675 |
| 821 | Ga0496110_0534462 | 3300048913 | Unclassified | 1066 |
| 822 | Ga0496114_0071661 | 3300048917 | Bacteria | 2913 |
| 823 | Ga0496114_0589033 | 3300048917 | Bacteria | 981 |
| 824 | Ga0496117_0026401 | 3300048920 | Bacteria | 4545 |
| 825 | Ga0496118_0036898 | 3300048921 | Bacteria | 3943 |
| 826 | Ga0496121_0000188 | 3300048924 | Bacteria | 138221 |
| 827 | Ga0496121_0002262 | 3300048924 | Bacteria | 29972 |
| 828 | Ga0496121_0004978 | 3300048924 | Bacteria | 17407 |
| 829 | Ga0496126_0000783 | 3300048929 | Bacteria | 57293 |
| 830 | Ga0496126_0386095 | 3300048929 | Bacteria | 1139 |
| 831 | Ga0495682_0053774 | 3300049460 | Bacteria | 1462 |
| 832 | Ga0501298_044908 | 3300049521 | Bacteria | 903 |
| 833 | Ga0501298_051249 | 3300049521 | Bacteria | 857 |
| 834 | Ga0501033_0003162 | 3300049570 | Bacteria | 13681 |
| 835 | Ga0501033_0441570 | 3300049570 | Bacteria | 905 |
| 836 | Ga0501037_0483972 | 3300049573 | Bacteria | 841 |
| 837 | Ga0501039_0011740 | 3300049575 | Bacteria | 6672 |
| 838 | Ga0501039_0056564 | 3300049575 | Bacteria | 3039 |
| 839 | Ga0501039_0535035 | 3300049575 | Bacteria | 920 |
| 840 | Ga0501040_0299361 | 3300049576 | Bacteria | 1150 |
| 841 | Ga0501041_0067913 | 3300049577 | Bacteria | 2185 |
| 842 | Ga0501041_0073191 | 3300049577 | Bacteria | 2106 |
| 843 | Ga0501042_0045076 | 3300049578 | Bacteria | 3143 |
| 844 | Ga0501042_0165180 | 3300049578 | Bacteria | 1597 |
| 845 | Ga0501043_0118389 | 3300049579 | Bacteria | 2077 |
| 846 | Ga0501043_0210105 | 3300049579 | Bacteria | 1509 |
| 847 | Ga0501043_0282023 | 3300049579 | Bacteria | 1273 |
| 848 | Ga0501046_0000583 | 3300049580 | Bacteria | 35953 |
| 849 | Ga0501046_0010778 | 3300049580 | Bacteria | 7839 |
| 850 | Ga0501047_0253615 | 3300049581 | Bacteria | 1608 |
| 851 | Ga0501048_0260692 | 3300049582 | Bacteria | 1231 |
| 852 | Ga0501068_0107806 | 3300049584 | Bacteria | 1730 |
| 853 | Ga0501071_0031872 | 3300049587 | Bacteria | 3740 |
| 854 | Ga0501072_0024394 | 3300049588 | Bacteria | 4704 |
| 855 | Ga0501075_0002898 | 3300049591 | Bacteria | 11507 |
| 856 | Ga0501076_0000718 | 3300049592 | Bacteria | 21378 |
| 857 | Ga0501076_0007717 | 3300049592 | Bacteria | 7839 |
| 858 | Ga0501077_0126640 | 3300049593 | Bacteria | 1619 |
| 859 | Ga0501250_019263 | 3300049680 | Bacteria | 871 |
| 860 | Ga0501079_0008196 | 3300049741 | Bacteria | 7919 |
| 861 | Ga0501079_0078937 | 3300049741 | Bacteria | 2546 |
| 862 | Ga0501080_0541140 | 3300049742 | Bacteria | 1038 |
| 863 | Ga0501081_0001411 | 3300049743 | Bacteria | 14690 |
| 864 | Ga0501081_0326044 | 3300049743 | Bacteria | 1129 |
| 865 | Ga0501081_0638671 | 3300049743 | Bacteria | 798 |
| 866 | Ga0501268_030937 | 3300049765 | Bacteria | 968 |
| 867 | Ga0501044_0718462 | 3300049823 | Unclassified | 883 |
| 868 | Ga0501045_0009931 | 3300049824 | Bacteria | 6660 |
| 869 | Ga0501045_0016854 | 3300049824 | Bacteria | 5190 |
| 870 | nmdc:mga0k408_34802_c1 | 3300050493 | Bacteria | 2885 |
| 871 | nmdc:mga07m45_100556_c1 | 3300050496 | Bacteria | 1660 |
| 872 | nmdc:mga05p37_1369951_c1 | 3300050507 | Unclassified | 715 |
| 873 | nmdc:mga05p37_29455_c1 | 3300050507 | Bacteria | 6699 |
| 874 | nmdc:mga05p37_31057_c1 | 3300050507 | Bacteria | 6523 |
| 875 | nmdc:mga05p37_3200_c1 | 3300050507 | Bacteria | 19051 |
| 876 | nmdc:mga05p37_331_c1 | 3300050507 | Bacteria | 50709 |
| 877 | nmdc:mga05p37_53342_c1 | 3300050507 | Bacteria | 3973 |
| 878 | nmdc:mga05p37_573131_c1 | 3300050507 | Bacteria | 1280 |
| 879 | nmdc:mga05p37_762130_c1 | 3300050507 | Bacteria | 1065 |
| 880 | nmdc:mga05p37_974689_c1 | 3300050507 | Bacteria | 904 |
| 881 | nmdc:mga09592_118522_c1 | 3300050508 | Bacteria | 2272 |
| 882 | nmdc:mga09592_314338_c1 | 3300050508 | Bacteria | 1357 |
| 883 | nmdc:mga09592_3807_c1 | 3300050508 | Bacteria | 12145 |
| 884 | nmdc:mga09592_4034_c1 | 3300050508 | Bacteria | 11848 |
| 885 | nmdc:mga09592_53166_c1 | 3300050508 | Bacteria | 3419 |
| 886 | nmdc:mga09592_65193_c1 | 3300050508 | Bacteria | 3085 |
| 887 | nmdc:mga0qj67_180152_c1 | 3300050509 | Bacteria | 1716 |
| 888 | nmdc:mga0qj67_53781_c1 | 3300050509 | Bacteria | 3188 |
| 889 | nmdc:mga06r32_15222_c1 | 3300050510 | Bacteria | 6987 |
| 890 | nmdc:mga06r32_970685_c1 | 3300050510 | Bacteria | 803 |
| 891 | nmdc:mga06r32_982662_c1 | 3300050510 | Unclassified | 797 |
| 892 | nmdc:mga08y16_105182_c1 | 3300050511 | Bacteria | 2939 |
| 893 | nmdc:mga08y16_16773_c1 | 3300050511 | Bacteria | 7710 |
| 894 | nmdc:mga08y16_169957_c1 | 3300050511 | Bacteria | 2264 |
| 895 | nmdc:mga08y16_223451_c1 | 3300050511 | Bacteria | 1949 |
| 896 | nmdc:mga08y16_26107_c1 | 3300050511 | Bacteria | 6161 |
| 897 | nmdc:mga08y16_357825_c1 | 3300050511 | Bacteria | 1499 |
| 898 | nmdc:mga08y16_464144_c1 | 3300050511 | Bacteria | 1290 |
| 899 | nmdc:mga08y16_476131_c1 | 3300050511 | Bacteria | 1271 |
| 900 | nmdc:mga08y16_936191_c1 | 3300050511 | Bacteria | 850 |
| 901 | nmdc:mga0n895_124172_c1 | 3300050512 | Bacteria | 2604 |
| 902 | nmdc:mga0n895_12827_c1 | 3300050512 | Bacteria | 7530 |
| 903 | nmdc:mga0n895_189577_c1 | 3300050512 | Bacteria | 2087 |
| 904 | nmdc:mga0n895_353756_c1 | 3300050512 | Bacteria | 1488 |
| 905 | nmdc:mga0n895_58375_c1 | 3300050512 | Bacteria | 3804 |
| 906 | nmdc:mga0n895_68393_c1 | 3300050512 | Bacteria | 3519 |
| 907 | nmdc:mga0n895_79858_c1 | 3300050512 | Bacteria | 3258 |
| 908 | nmdc:mga0n895_83290_c1 | 3300050512 | Bacteria | 3190 |
| 909 | nmdc:mga0n895_94392_c1 | 3300050512 | Bacteria | 2995 |
| 910 | nmdc:mga0rr50_198712_c1 | 3300050513 | Bacteria | 1647 |
| 911 | nmdc:mga0rr50_304312_c1 | 3300050513 | Bacteria | 1334 |
| 912 | nmdc:mga0rr50_40872_c1 | 3300050513 | Bacteria | 3374 |
| 913 | nmdc:mga0rr50_455586_c1 | 3300050513 | Bacteria | 1085 |
| 914 | nmdc:mga0rr50_68676_c1 | 3300050513 | Bacteria | 2696 |
| 915 | nmdc:mga08x19_13853_c1 | 3300050514 | Bacteria | 4885 |
| 916 | nmdc:mga08x19_226369_c1 | 3300050514 | Bacteria | 1286 |
| 917 | nmdc:mga08x19_28100_c1 | 3300050514 | Bacteria | 3521 |
| 918 | nmdc:mga08x19_42987_c1 | 3300050514 | Bacteria | 2882 |
| 919 | nmdc:mga08x19_52337_c1 | 3300050514 | Bacteria | 2626 |
| 920 | nmdc:mga08x19_5578_c1 | 3300050514 | Bacteria | 7441 |
| 921 | nmdc:mga0a205_263306_c1 | 3300050515 | Bacteria | 1602 |
| 922 | nmdc:mga0a205_36607_c1 | 3300050515 | Bacteria | 4716 |
| 923 | nmdc:mga0a205_374715_c1 | 3300050515 | Bacteria | 1289 |
| 924 | nmdc:mga0a205_388685_c1 | 3300050515 | Bacteria | 1260 |
| 925 | Ga0495601_0079478 | 3300053077 | Bacteria | 2103 |
| 926 | Ga0495619_0093192 | 3300053085 | Bacteria | 2041 |
| 927 | Ga0500651_0401240 | 3300053093 | Bacteria | 770 |
| 928 | Ga0500621_070050 | 3300053126 | Bacteria | 1414 |
| 929 | Ga0500590_001674 | 3300053148 | Bacteria | 9274 |
| 930 | Ga0500619_000126 | 3300053154 | Bacteria | 20001 |
| 931 | Ga0500622_0019734 | 3300053156 | Plasmid | 3579 |
| 932 | Ga0590075_043931 | 3300059424 | Bacteria | 1144 |
| 933 | Ga0501082_0025096 | 3300060353 | Bacteria | 5135 |
| 934 | Ga0501082_0876661 | 3300060353 | Unclassified | 785 |
| 935 | Ga0466962_0122025 | 3300061719 | Bacteria | 1258 |
| 936 | Ga0530510_0003565 | 3300061734 | Bacteria | 10727 |
| 937 | Ga0530510_0004356 | 3300061734 | Bacteria | 9801 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046459 | Ga0495629_0015797 | Ga0495629_0015797_2519_3097 | 172 |
| 2 | 3300046461 | Ga0495641_0070180 | Ga0495641_0070180_859_1437 | 172 |
| 3 | 3300046499 | Ga0495594_0059689 | Ga0495594_0059689_1412_1990 | 172 |
| 4 | 3300046683 | Ga0495658_0190664 | Ga0495658_0190664_403_981 | 172 |
| 5 | iso_pu_bacteria | 2857609550 | 2857613712 | 174 |
| 6 | 3300049823 | Ga0501044_0718462 | Ga0501044_0718462_216_848 | 175 |
| 7 | 3300053156 | Ga0500622_0019734 | Ga0500622_0019734_125_757 | 175 |
| 8 | 3300060353 | Ga0501082_0876661 | Ga0501082_0876661_112_744 | 175 |
| 9 | 3300009551 | Ga0105238_10114073 | Ga0105238_101140733 | 176 |
| 10 | 3300021358 | Ga0213873_10029316 | Ga0213873_100293162 | 177 |
| 11 | 3300039453 | Ga0436362_0811667 | Ga0436362_0811667_45_632 | 177 |
| 12 | 3300005329 | Ga0070683_100273845 | Ga0070683_1002738452 | 178 |
| 13 | 3300005344 | Ga0070661_100397186 | Ga0070661_1003971862 | 178 |
| 14 | 3300005564 | Ga0070664_100073010 | Ga0070664_1000730102 | 178 |
| 15 | 3300005616 | Ga0068852_100111657 | Ga0068852_1001116573 | 178 |
| 16 | 3300009177 | Ga0105248_10126896 | Ga0105248_101268962 | 178 |
| 17 | 3300013105 | Ga0157369_11584414 | Ga0157369_115844141 | 178 |
| 18 | 3300013296 | Ga0157374_10316608 | Ga0157374_103166082 | 178 |
| 19 | 3300025920 | Ga0207649_10605005 | Ga0207649_106050052 | 178 |
| 20 | 3300025931 | Ga0207644_10238897 | Ga0207644_102388972 | 178 |
| 21 | 3300025941 | Ga0207711_10078696 | Ga0207711_100786964 | 178 |
| 22 | 3300025944 | Ga0207661_10185605 | Ga0207661_101856052 | 178 |
| 23 | 3300025981 | Ga0207640_10381779 | Ga0207640_103817792 | 178 |
| 24 | 3300025986 | Ga0207658_10632374 | Ga0207658_106323742 | 178 |
| 25 | 3300021361 | Ga0213872_10080904 | Ga0213872_100809042 | 179 |
| 26 | 3300021441 | Ga0213871_10050971 | Ga0213871_100509712 | 179 |
| 27 | 3300034957 | Ga0373938_0002374 | Ga0373938_0002374_977_1567 | 179 |
| 28 | 3300035112 | Ga0373932_0096999 | Ga0373932_0096999_131_721 | 179 |
| 29 | 3300037312 | Ga0395899_0319187 | Ga0395899_0319187_13_567 | 179 |
| 30 | 3300039438 | Ga0436360_1286715 | Ga0436360_1286715_429_1016 | 179 |
| 31 | 3300039447 | Ga0436361_0213384 | Ga0436361_0213384_2068_2655 | 179 |
| 32 | 3300061719 | Ga0466962_0122025 | Ga0466962_0122025_30_584 | 179 |
| 33 | 3300031911 | Ga0307412_10318434 | Ga0307412_103184342 | 181 |
| 34 | 3300039450 | Ga0436363_1223183 | Ga0436363_1223183_1218_1778 | 181 |
| 35 | 3300005336 | Ga0070680_100076410 | Ga0070680_1000764104 | 182 |
| 36 | 3300005458 | Ga0070681_10018567 | Ga0070681_100185674 | 182 |
| 37 | 3300005458 | Ga0070681_10399951 | Ga0070681_103999511 | 182 |
| 38 | 3300005530 | Ga0070679_100078330 | Ga0070679_1000783302 | 182 |
| 39 | 3300005564 | Ga0070664_100018613 | Ga0070664_1000186136 | 182 |
| 40 | 3300013307 | Ga0157372_10531163 | Ga0157372_105311632 | 182 |
| 41 | 3300025912 | Ga0207707_10003497 | Ga0207707_100034975 | 182 |
| 42 | 3300025912 | Ga0207707_10332418 | Ga0207707_103324182 | 182 |
| 43 | 3300025921 | Ga0207652_10057906 | Ga0207652_100579062 | 182 |
| 44 | 3300025945 | Ga0207679_10077749 | Ga0207679_100777492 | 182 |
| 45 | 3300045836 | Ga0466958_0125679 | Ga0466958_0125679_94_705 | 182 |
| 46 | 3300005981 | Ga0081538_10105034 | Ga0081538_101050341 | 183 |
| 47 | 3300021358 | Ga0213873_10073477 | Ga0213873_100734772 | 183 |
| 48 | 3300025904 | Ga0207647_10343128 | Ga0207647_103431281 | 183 |
| 49 | 3300025921 | Ga0207652_10559855 | Ga0207652_105598552 | 183 |
| 50 | 3300025923 | Ga0207681_10308696 | Ga0207681_103086962 | 183 |
| 51 | 3300037853 | Ga0436364_0953789 | Ga0436364_0953789_3070_3639 | 183 |
| 52 | 3300039437 | Ga0436365_1911354 | Ga0436365_1911354_1538_2137 | 183 |
| 53 | 3300039438 | Ga0436360_0574300 | Ga0436360_0574300_157_777 | 183 |
| 54 | 3300039453 | Ga0436362_0497172 | Ga0436362_0497172_703_1323 | 183 |
| 55 | 3300042000 | Ga0439437_039435 | Ga0439437_039435_47_598 | 183 |
| 56 | 3300042001 | Ga0439441_002417 | Ga0439441_002417_1384_1938 | 183 |
| 57 | 3300042003 | Ga0439443_001185 | Ga0439443_001185_1179_1733 | 183 |
| 58 | 3300042009 | Ga0439451_033541 | Ga0439451_033541_393_947 | 183 |
| 59 | 3300042013 | Ga0439456_007993 | Ga0439456_007993_379_933 | 183 |
| 60 | 3300042436 | Ga0439435_0001860 | Ga0439435_0001860_13_567 | 183 |
| 61 | 3300042437 | Ga0439444_0000098 | Ga0439444_0000098_3457_4011 | 183 |
| 62 | 3300042461 | Ga0439460_0000132 | Ga0439460_0000132_9118_9672 | 183 |
| 63 | 3300047472 | Ga0495686_0517556 | Ga0495686_0517556_48_599 | 183 |
| 64 | 3300049575 | Ga0501039_0011740 | Ga0501039_0011740_3858_4412 | 183 |
| 65 | 3300049575 | Ga0501039_0056564 | Ga0501039_0056564_64_618 | 183 |
| 66 | 3300049577 | Ga0501041_0073191 | Ga0501041_0073191_1263_1817 | 183 |
| 67 | 3300049578 | Ga0501042_0045076 | Ga0501042_0045076_2118_2672 | 183 |
| 68 | 3300049579 | Ga0501043_0282023 | Ga0501043_0282023_384_938 | 183 |
| 69 | 3300049584 | Ga0501068_0107806 | Ga0501068_0107806_97_651 | 183 |
| 70 | 3300049587 | Ga0501071_0031872 | Ga0501071_0031872_464_1018 | 183 |
| 71 | 3300049591 | Ga0501075_0002898 | Ga0501075_0002898_3748_4302 | 183 |
| 72 | 3300049592 | Ga0501076_0000718 | Ga0501076_0000718_5030_5584 | 183 |
| 73 | 3300049741 | Ga0501079_0008196 | Ga0501079_0008196_6597_7151 | 183 |
| 74 | 3300049741 | Ga0501079_0078937 | Ga0501079_0078937_1956_2510 | 183 |
| 75 | 3300049742 | Ga0501080_0541140 | Ga0501080_0541140_321_875 | 183 |
| 76 | 3300049743 | Ga0501081_0001411 | Ga0501081_0001411_11507_12061 | 183 |
| 77 | 3300049824 | Ga0501045_0009931 | Ga0501045_0009931_3542_4096 | 183 |
| 78 | 3300050515 | nmdc:mga0a205_374715_c1 | nmdc:mga0a205_374715_c1_504_1121 | 183 |
| 79 | 3300050515 | nmdc:mga0a205_388685_c1 | nmdc:mga0a205_388685_c1_114_671 | 183 |
| 80 | 3300060353 | Ga0501082_0025096 | Ga0501082_0025096_399_953 | 183 |
| 81 | 3300061734 | Ga0530510_0003565 | Ga0530510_0003565_3296_3850 | 183 |
| 82 | 3300003203 | JGI25406J46586_10025474 | JGI25406J46586_100254743 | 184 |
| 83 | 3300005295 | Ga0065707_10119894 | Ga0065707_101198942 | 184 |
| 84 | 3300005328 | Ga0070676_10342262 | Ga0070676_103422621 | 184 |
| 85 | 3300005336 | Ga0070680_100096124 | Ga0070680_1000961242 | 184 |
| 86 | 3300005336 | Ga0070680_100113526 | Ga0070680_1001135262 | 184 |
| 87 | 3300005355 | Ga0070671_100162160 | Ga0070671_1001621603 | 184 |
| 88 | 3300005436 | Ga0070713_100030251 | Ga0070713_1000302513 | 184 |
| 89 | 3300005444 | Ga0070694_100062119 | Ga0070694_1000621192 | 184 |
| 90 | 3300005467 | Ga0070706_100586103 | Ga0070706_1005861032 | 184 |
| 91 | 3300005467 | Ga0070706_101192060 | Ga0070706_1011920601 | 184 |
| 92 | 3300005536 | Ga0070697_100025846 | Ga0070697_1000258464 | 184 |
| 93 | 3300005536 | Ga0070697_100744669 | Ga0070697_1007446692 | 184 |
| 94 | 3300005544 | Ga0070686_100095324 | Ga0070686_1000953243 | 184 |
| 95 | 3300005545 | Ga0070695_100018488 | Ga0070695_1000184882 | 184 |
| 96 | 3300005546 | Ga0070696_100036097 | Ga0070696_1000360972 | 184 |
| 97 | 3300005546 | Ga0070696_100215575 | Ga0070696_1002155752 | 184 |
| 98 | 3300005549 | Ga0070704_100216431 | Ga0070704_1002164313 | 184 |
| 99 | 3300005577 | Ga0068857_100158661 | Ga0068857_1001586613 | 184 |
| 100 | 3300005719 | Ga0068861_100486384 | Ga0068861_1004863842 | 184 |
| 101 | 3300005841 | Ga0068863_101051610 | Ga0068863_1010516102 | 184 |
| 102 | 3300005937 | Ga0081455_10044130 | Ga0081455_100441304 | 184 |
| 103 | 3300005985 | Ga0081539_10001417 | Ga0081539_1000141719 | 184 |
| 104 | 3300005985 | Ga0081539_10018413 | Ga0081539_100184133 | 184 |
| 105 | 3300006028 | Ga0070717_10744967 | Ga0070717_107449672 | 184 |
| 106 | 3300006173 | Ga0070716_100410819 | Ga0070716_1004108192 | 184 |
| 107 | 3300006175 | Ga0070712_100380563 | Ga0070712_1003805632 | 184 |
| 108 | 3300006175 | Ga0070712_100546395 | Ga0070712_1005463952 | 184 |
| 109 | 3300006844 | Ga0075428_100001175 | Ga0075428_1000011756 | 184 |
| 110 | 3300006880 | Ga0075429_100011040 | Ga0075429_1000110405 | 184 |
| 111 | 3300007265 | Ga0099794_10042411 | Ga0099794_100424112 | 184 |
| 112 | 3300007788 | Ga0099795_10264331 | Ga0099795_102643311 | 184 |
| 113 | 3300009094 | Ga0111539_10001620 | Ga0111539_100016208 | 184 |
| 114 | 3300009094 | Ga0111539_10064868 | Ga0111539_100648686 | 184 |
| 115 | 3300009094 | Ga0111539_10252812 | Ga0111539_102528123 | 184 |
| 116 | 3300009094 | Ga0111539_10263141 | Ga0111539_102631412 | 184 |
| 117 | 3300009094 | Ga0111539_10538569 | Ga0111539_105385691 | 184 |
| 118 | 3300010375 | Ga0105239_10447392 | Ga0105239_104473923 | 184 |
| 119 | 3300020080 | Ga0206350_11216696 | Ga0206350_112166962 | 184 |
| 120 | 3300021358 | Ga0213873_10087883 | Ga0213873_100878831 | 184 |
| 121 | 3300021377 | Ga0213874_10014196 | Ga0213874_100141962 | 184 |
| 122 | 3300021388 | Ga0213875_10066103 | Ga0213875_100661031 | 184 |
| 123 | 3300021388 | Ga0213875_10176529 | Ga0213875_101765292 | 184 |
| 124 | 3300024225 | Ga0224572_1013070 | Ga0224572_10130702 | 184 |
| 125 | 3300024227 | Ga0228598_1006731 | Ga0228598_10067313 | 184 |
| 126 | 3300025906 | Ga0207699_10208349 | Ga0207699_102083492 | 184 |
| 127 | 3300025910 | Ga0207684_10250360 | Ga0207684_102503602 | 184 |
| 128 | 3300025915 | Ga0207693_10193786 | Ga0207693_101937862 | 184 |
| 129 | 3300025915 | Ga0207693_10336899 | Ga0207693_103368992 | 184 |
| 130 | 3300025915 | Ga0207693_10623876 | Ga0207693_106238761 | 184 |
| 131 | 3300025916 | Ga0207663_10396087 | Ga0207663_103960872 | 184 |
| 132 | 3300025917 | Ga0207660_10072454 | Ga0207660_100724543 | 184 |
| 133 | 3300025917 | Ga0207660_10427887 | Ga0207660_104278872 | 184 |
| 134 | 3300025928 | Ga0207700_10821603 | Ga0207700_108216032 | 184 |
| 135 | 3300025939 | Ga0207665_10538333 | Ga0207665_105383332 | 184 |
| 136 | 3300026118 | Ga0207675_100515545 | Ga0207675_1005155452 | 184 |
| 137 | 3300027512 | Ga0209179_1022397 | Ga0209179_10223971 | 184 |
| 138 | 3300028023 | Ga0265357_1004223 | Ga0265357_10042232 | 184 |
| 139 | 3300031241 | Ga0265325_10048933 | Ga0265325_100489334 | 184 |
| 140 | 3300031249 | Ga0265339_10000323 | Ga0265339_1000032313 | 184 |
| 141 | 3300031595 | Ga0265313_10001589 | Ga0265313_1000158921 | 184 |
| 142 | 3300035083 | Ga0373926_0212043 | Ga0373926_0212043_77_646 | 184 |
| 143 | 3300035086 | Ga0373934_0086483 | Ga0373934_0086483_514_1068 | 184 |
| 144 | 3300035086 | Ga0373934_0130576 | Ga0373934_0130576_25_579 | 184 |
| 145 | 3300035111 | Ga0373923_0157488 | Ga0373923_0157488_193_747 | 184 |
| 146 | 3300035113 | Ga0373936_0014321 | Ga0373936_0014321_1935_2489 | 184 |
| 147 | 3300035116 | Ga0373945_0150938 | Ga0373945_0150938_377_931 | 184 |
| 148 | 3300035116 | Ga0373945_0200436 | Ga0373945_0200436_59_613 | 184 |
| 149 | 3300035117 | Ga0373953_0220546 | Ga0373953_0220546_76_630 | 184 |
| 150 | 3300035118 | Ga0373954_0000511 | Ga0373954_0000511_290_844 | 184 |
| 151 | 3300035118 | Ga0373954_0012477 | Ga0373954_0012477_1821_2375 | 184 |
| 152 | 3300035118 | Ga0373954_0321770 | Ga0373954_0321770_13_567 | 184 |
| 153 | 3300035119 | Ga0373956_0219978 | Ga0373956_0219978_155_709 | 184 |
| 154 | 3300035119 | Ga0373956_0313801 | Ga0373956_0313801_66_620 | 184 |
| 155 | 3300035120 | Ga0373957_0059787 | Ga0373957_0059787_197_751 | 184 |
| 156 | 3300035171 | Ga0373946_0012587 | Ga0373946_0012587_1764_2318 | 184 |
| 157 | 3300035172 | Ga0373955_0448188 | Ga0373955_0448188_179_733 | 184 |
| 158 | 3300035691 | Ga0373931_0198465 | Ga0373931_0198465_523_1095 | 184 |
| 159 | 3300035692 | Ga0373935_0078759 | Ga0373935_0078759_1427_1981 | 184 |
| 160 | 3300035692 | Ga0373935_0211732 | Ga0373935_0211732_631_1185 | 184 |
| 161 | 3300035695 | Ga0373927_0020293 | Ga0373927_0020293_318_872 | 184 |
| 162 | 3300035695 | Ga0373927_0028738 | Ga0373927_0028738_2597_3151 | 184 |
| 163 | 3300035695 | Ga0373927_0260200 | Ga0373927_0260200_59_613 | 184 |
| 164 | 3300035695 | Ga0373927_0519708 | Ga0373927_0519708_41_616 | 184 |
| 165 | 3300035724 | Ga0373933_0161322 | Ga0373933_0161322_23_577 | 184 |
| 166 | 3300035725 | Ga0373947_0345763 | Ga0373947_0345763_186_740 | 184 |
| 167 | 3300036401 | Ga0373937_0088704 | Ga0373937_0088704_198_752 | 184 |
| 168 | 3300036401 | Ga0373937_0194409 | Ga0373937_0194409_847_1401 | 184 |
| 169 | 3300037853 | Ga0436364_0029308 | Ga0436364_0029308_178_747 | 184 |
| 170 | 3300037853 | Ga0436364_0685835 | Ga0436364_0685835_127_804 | 184 |
| 171 | 3300037853 | Ga0436364_0798454 | Ga0436364_0798454_838_1461 | 184 |
| 172 | 3300037853 | Ga0436364_0937935 | Ga0436364_0937935_566_1135 | 184 |
| 173 | 3300037853 | Ga0436364_1433936 | Ga0436364_1433936_1043_1612 | 184 |
| 174 | 3300039438 | Ga0436360_0392294 | Ga0436360_0392294_499_1143 | 184 |
| 175 | 3300039438 | Ga0436360_1108102 | Ga0436360_1108102_463_1119 | 184 |
| 176 | 3300039447 | Ga0436361_0945327 | Ga0436361_0945327_1224_1859 | 184 |
| 177 | 3300039453 | Ga0436362_0077617 | Ga0436362_0077617_208_891 | 184 |
| 178 | 3300039453 | Ga0436362_1028381 | Ga0436362_1028381_47_724 | 184 |
| 179 | 3300044694 | Ga0466963_0116796 | Ga0466963_0116796_581_1153 | 184 |
| 180 | 3300045049 | Ga0466959_0107877 | Ga0466959_0107877_931_1545 | 184 |
| 181 | 3300045836 | Ga0466958_0036036 | Ga0466958_0036036_1398_1970 | 184 |
| 182 | 3300046454 | Ga0495592_0096631 | Ga0495592_0096631_872_1426 | 184 |
| 183 | 3300046459 | Ga0495629_0371740 | Ga0495629_0371740_70_624 | 184 |
| 184 | 3300046461 | Ga0495641_0013868 | Ga0495641_0013868_1814_2368 | 184 |
| 185 | 3300046462 | Ga0495651_0261448 | Ga0495651_0261448_76_630 | 184 |
| 186 | 3300046463 | Ga0495653_0031607 | Ga0495653_0031607_3342_3896 | 184 |
| 187 | 3300046472 | Ga0495580_0045495 | Ga0495580_0045495_2024_2578 | 184 |
| 188 | 3300046475 | Ga0495639_0016874 | Ga0495639_0016874_2428_2982 | 184 |
| 189 | 3300046476 | Ga0495662_0012118 | Ga0495662_0012118_2190_2744 | 184 |
| 190 | 3300046499 | Ga0495594_0171783 | Ga0495594_0171783_175_729 | 184 |
| 191 | 3300046511 | Ga0495608_0052853 | Ga0495608_0052853_2107_2661 | 184 |
| 192 | 3300046514 | Ga0495618_0045131 | Ga0495618_0045131_2173_2727 | 184 |
| 193 | 3300046517 | Ga0495630_0078289 | Ga0495630_0078289_540_1094 | 184 |
| 194 | 3300046524 | Ga0495648_0071142 | Ga0495648_0071142_1293_1847 | 184 |
| 195 | 3300046526 | Ga0495666_0025550 | Ga0495666_0025550_117_671 | 184 |
| 196 | 3300046533 | Ga0495640_0017848 | Ga0495640_0017848_4267_4821 | 184 |
| 197 | 3300046533 | Ga0495640_0203586 | Ga0495640_0203586_28_582 | 184 |
| 198 | 3300046535 | Ga0495586_0031541 | Ga0495586_0031541_167_721 | 184 |
| 199 | 3300046536 | Ga0495587_0014866 | Ga0495587_0014866_540_1094 | 184 |
| 200 | 3300046538 | Ga0495609_0179783 | Ga0495609_0179783_246_803 | 184 |
| 201 | 3300046539 | Ga0495621_0151082 | Ga0495621_0151082_41_598 | 184 |
| 202 | 3300046557 | Ga0495622_0081566 | Ga0495622_0081566_600_1154 | 184 |
| 203 | 3300046559 | Ga0495667_0025855 | Ga0495667_0025855_3186_3740 | 184 |
| 204 | 3300046559 | Ga0495667_0071968 | Ga0495667_0071968_1456_2010 | 184 |
| 205 | 3300046615 | Ga0495656_0130941 | Ga0495656_0130941_173_727 | 184 |
| 206 | 3300046642 | Ga0495634_0116594 | Ga0495634_0116594_958_1512 | 184 |
| 207 | 3300046642 | Ga0495634_0126144 | Ga0495634_0126144_62_616 | 184 |
| 208 | 3300046663 | Ga0495635_0233293 | Ga0495635_0233293_59_613 | 184 |
| 209 | 3300046675 | Ga0495657_0051824 | Ga0495657_0051824_1746_2300 | 184 |
| 210 | 3300046678 | Ga0495599_0009378 | Ga0495599_0009378_4543_5097 | 184 |
| 211 | 3300046681 | Ga0495647_0012487 | Ga0495647_0012487_539_1093 | 184 |
| 212 | 3300046681 | Ga0495647_0280158 | Ga0495647_0280158_159_731 | 184 |
| 213 | 3300046683 | Ga0495658_0219495 | Ga0495658_0219495_595_1149 | 184 |
| 214 | 3300046683 | Ga0495658_0489386 | Ga0495658_0489386_77_631 | 184 |
| 215 | 3300046690 | Ga0495624_0053347 | Ga0495624_0053347_1706_2260 | 184 |
| 216 | 3300046690 | Ga0495624_0435521 | Ga0495624_0435521_89_643 | 184 |
| 217 | 3300046809 | Ga0495600_0005383 | Ga0495600_0005383_1386_1940 | 184 |
| 218 | 3300047315 | Ga0495581_0351917 | Ga0495581_0351917_293_847 | 184 |
| 219 | 3300047317 | Ga0495604_0066910 | Ga0495604_0066910_198_752 | 184 |
| 220 | 3300047319 | Ga0495674_0058934 | Ga0495674_0058934_1910_2464 | 184 |
| 221 | 3300047444 | Ga0495675_0056042 | Ga0495675_0056042_406_960 | 184 |
| 222 | 3300047471 | Ga0495684_0407861 | Ga0495684_0407861_193_747 | 184 |
| 223 | 3300048903 | Ga0496100_0565306 | Ga0496100_0565306_52_621 | 184 |
| 224 | 3300048907 | Ga0496104_0020113 | Ga0496104_0020113_43_612 | 184 |
| 225 | 3300048910 | Ga0496107_0040768 | Ga0496107_0040768_52_621 | 184 |
| 226 | 3300048913 | Ga0496110_0534462 | Ga0496110_0534462_23_592 | 184 |
| 227 | 3300048917 | Ga0496114_0071661 | Ga0496114_0071661_1258_1827 | 184 |
| 228 | 3300048929 | Ga0496126_0386095 | Ga0496126_0386095_201_770 | 184 |
| 229 | 3300050507 | nmdc:mga05p37_1369951_c1 | nmdc:mga05p37_1369951_c1_139_693 | 184 |
| 230 | 3300050508 | nmdc:mga09592_3807_c1 | nmdc:mga09592_3807_c1_1836_2390 | 184 |
| 231 | 3300050510 | nmdc:mga06r32_982662_c1 | nmdc:mga06r32_982662_c1_68_622 | 184 |
| 232 | 3300050511 | nmdc:mga08y16_105182_c1 | nmdc:mga08y16_105182_c1_49_603 | 184 |
| 233 | 3300050511 | nmdc:mga08y16_223451_c1 | nmdc:mga08y16_223451_c1_1244_1798 | 184 |
| 234 | 3300050511 | nmdc:mga08y16_26107_c1 | nmdc:mga08y16_26107_c1_1792_2364 | 184 |
| 235 | 3300053085 | Ga0495619_0093192 | Ga0495619_0093192_1411_1965 | 184 |
| 236 | 3300005295 | Ga0065707_10124404 | Ga0065707_101244043 | 185 |
| 237 | 3300005330 | Ga0070690_100005091 | Ga0070690_1000050918 | 185 |
| 238 | 3300005334 | Ga0068869_100320743 | Ga0068869_1003207432 | 185 |
| 239 | 3300005335 | Ga0070666_10079909 | Ga0070666_100799092 | 185 |
| 240 | 3300005336 | Ga0070680_100034909 | Ga0070680_1000349095 | 185 |
| 241 | 3300005337 | Ga0070682_100006531 | Ga0070682_1000065313 | 185 |
| 242 | 3300005338 | Ga0068868_100007387 | Ga0068868_1000073878 | 185 |
| 243 | 3300005340 | Ga0070689_100007046 | Ga0070689_1000070468 | 185 |
| 244 | 3300005341 | Ga0070691_10002771 | Ga0070691_100027713 | 185 |
| 245 | 3300005343 | Ga0070687_100001749 | Ga0070687_1000017498 | 185 |
| 246 | 3300005345 | Ga0070692_10005868 | Ga0070692_100058686 | 185 |
| 247 | 3300005355 | Ga0070671_100121950 | Ga0070671_1001219503 | 185 |
| 248 | 3300005364 | Ga0070673_100163817 | Ga0070673_1001638172 | 185 |
| 249 | 3300005406 | Ga0070703_10025931 | Ga0070703_100259313 | 185 |
| 250 | 3300005438 | Ga0070701_10001946 | Ga0070701_100019468 | 185 |
| 251 | 3300005440 | Ga0070705_100003829 | Ga0070705_1000038291 | 185 |
| 252 | 3300005441 | Ga0070700_100015124 | Ga0070700_1000151241 | 185 |
| 253 | 3300005444 | Ga0070694_100009114 | Ga0070694_1000091142 | 185 |
| 254 | 3300005444 | Ga0070694_100323463 | Ga0070694_1003234632 | 185 |
| 255 | 3300005458 | Ga0070681_10020583 | Ga0070681_100205834 | 185 |
| 256 | 3300005458 | Ga0070681_10209125 | Ga0070681_102091251 | 185 |
| 257 | 3300005459 | Ga0068867_100008217 | Ga0068867_1000082178 | 185 |
| 258 | 3300005518 | Ga0070699_100216853 | Ga0070699_1002168532 | 185 |
| 259 | 3300005530 | Ga0070679_100074072 | Ga0070679_1000740723 | 185 |
| 260 | 3300005536 | Ga0070697_100441580 | Ga0070697_1004415802 | 185 |
| 261 | 3300005544 | Ga0070686_100269848 | Ga0070686_1002698482 | 185 |
| 262 | 3300005545 | Ga0070695_100004987 | Ga0070695_1000049878 | 185 |
| 263 | 3300005545 | Ga0070695_100212777 | Ga0070695_1002127772 | 185 |
| 264 | 3300005545 | Ga0070695_100249737 | Ga0070695_1002497372 | 185 |
| 265 | 3300005546 | Ga0070696_100163689 | Ga0070696_1001636892 | 185 |
| 266 | 3300005547 | Ga0070693_100002991 | Ga0070693_1000029918 | 185 |
| 267 | 3300005549 | Ga0070704_100001866 | Ga0070704_1000018667 | 185 |
| 268 | 3300005563 | Ga0068855_100067391 | Ga0068855_1000673912 | 185 |
| 269 | 3300005615 | Ga0070702_100018687 | Ga0070702_1000186871 | 185 |
| 270 | 3300005616 | Ga0068852_100579552 | Ga0068852_1005795522 | 185 |
| 271 | 3300005617 | Ga0068859_100016661 | Ga0068859_1000166612 | 185 |
| 272 | 3300005617 | Ga0068859_100889068 | Ga0068859_1008890682 | 185 |
| 273 | 3300005618 | Ga0068864_100215501 | Ga0068864_1002155013 | 185 |
| 274 | 3300005718 | Ga0068866_10147730 | Ga0068866_101477303 | 185 |
| 275 | 3300005719 | Ga0068861_100006773 | Ga0068861_1000067738 | 185 |
| 276 | 3300005834 | Ga0068851_10158927 | Ga0068851_101589272 | 185 |
| 277 | 3300005840 | Ga0068870_10075527 | Ga0068870_100755273 | 185 |
| 278 | 3300005841 | Ga0068863_100334484 | Ga0068863_1003344842 | 185 |
| 279 | 3300005842 | Ga0068858_100014725 | Ga0068858_1000147258 | 185 |
| 280 | 3300005843 | Ga0068860_100015796 | Ga0068860_1000157968 | 185 |
| 281 | 3300005844 | Ga0068862_100414622 | Ga0068862_1004146222 | 185 |
| 282 | 3300006237 | Ga0097621_100178597 | Ga0097621_1001785972 | 185 |
| 283 | 3300006237 | Ga0097621_100311934 | Ga0097621_1003119342 | 185 |
| 284 | 3300006237 | Ga0097621_100470323 | Ga0097621_1004703232 | 185 |
| 285 | 3300006358 | Ga0068871_100014460 | Ga0068871_1000144602 | 185 |
| 286 | 3300006844 | Ga0075428_100019806 | Ga0075428_1000198062 | 185 |
| 287 | 3300006852 | Ga0075433_10028232 | Ga0075433_100282324 | 185 |
| 288 | 3300006871 | Ga0075434_100365214 | Ga0075434_1003652143 | 185 |
| 289 | 3300006871 | Ga0075434_101552982 | Ga0075434_1015529822 | 185 |
| 290 | 3300006881 | Ga0068865_100006045 | Ga0068865_1000060458 | 185 |
| 291 | 3300006914 | Ga0075436_100060217 | Ga0075436_1000602172 | 185 |
| 292 | 3300006914 | Ga0075436_100180993 | Ga0075436_1001809932 | 185 |
| 293 | 3300006931 | Ga0097620_100016661 | Ga0097620_1000166612 | 185 |
| 294 | 3300006931 | Ga0097620_100889226 | Ga0097620_1008892262 | 185 |
| 295 | 3300007076 | Ga0075435_100083564 | Ga0075435_1000835644 | 185 |
| 296 | 3300009092 | Ga0105250_10023435 | Ga0105250_100234351 | 185 |
| 297 | 3300009094 | Ga0111539_10058846 | Ga0111539_100588462 | 185 |
| 298 | 3300009094 | Ga0111539_10157774 | Ga0111539_101577744 | 185 |
| 299 | 3300009098 | Ga0105245_10012615 | Ga0105245_100126152 | 185 |
| 300 | 3300009147 | Ga0114129_10031869 | Ga0114129_100318698 | 185 |
| 301 | 3300009148 | Ga0105243_10009573 | Ga0105243_100095738 | 185 |
| 302 | 3300009174 | Ga0105241_10825868 | Ga0105241_108258682 | 185 |
| 303 | 3300009177 | Ga0105248_10158379 | Ga0105248_101583794 | 185 |
| 304 | 3300009177 | Ga0105248_10736861 | Ga0105248_107368612 | 185 |
| 305 | 3300013297 | Ga0157378_10012667 | Ga0157378_100126678 | 185 |
| 306 | 3300013306 | Ga0163162_10326290 | Ga0163162_103262903 | 185 |
| 307 | 3300013308 | Ga0157375_10295397 | Ga0157375_102953973 | 185 |
| 308 | 3300014326 | Ga0157380_10238914 | Ga0157380_102389143 | 185 |
| 309 | 3300014326 | Ga0157380_10410699 | Ga0157380_104106992 | 185 |
| 310 | 3300014968 | Ga0157379_10127673 | Ga0157379_101276733 | 185 |
| 311 | 3300014969 | Ga0157376_10032882 | Ga0157376_100328825 | 185 |
| 312 | 3300025885 | Ga0207653_10161829 | Ga0207653_101618292 | 185 |
| 313 | 3300025899 | Ga0207642_10000795 | Ga0207642_1000079511 | 185 |
| 314 | 3300025901 | Ga0207688_10032513 | Ga0207688_100325133 | 185 |
| 315 | 3300025903 | Ga0207680_10128616 | Ga0207680_101286163 | 185 |
| 316 | 3300025908 | Ga0207643_10082475 | Ga0207643_100824753 | 185 |
| 317 | 3300025910 | Ga0207684_10152293 | Ga0207684_101522933 | 185 |
| 318 | 3300025911 | Ga0207654_10517648 | Ga0207654_105176482 | 185 |
| 319 | 3300025912 | Ga0207707_10172913 | Ga0207707_101729133 | 185 |
| 320 | 3300025912 | Ga0207707_10598905 | Ga0207707_105989052 | 185 |
| 321 | 3300025917 | Ga0207660_10151811 | Ga0207660_101518112 | 185 |
| 322 | 3300025917 | Ga0207660_10557949 | Ga0207660_105579492 | 185 |
| 323 | 3300025918 | Ga0207662_10003842 | Ga0207662_100038428 | 185 |
| 324 | 3300025918 | Ga0207662_10054606 | Ga0207662_100546063 | 185 |
| 325 | 3300025921 | Ga0207652_10056144 | Ga0207652_100561443 | 185 |
| 326 | 3300025922 | Ga0207646_10699518 | Ga0207646_106995182 | 185 |
| 327 | 3300025927 | Ga0207687_10135712 | Ga0207687_101357121 | 185 |
| 328 | 3300025934 | Ga0207686_10004090 | Ga0207686_100040902 | 185 |
| 329 | 3300025935 | Ga0207709_10002925 | Ga0207709_1000292511 | 185 |
| 330 | 3300025936 | Ga0207670_10129865 | Ga0207670_101298652 | 185 |
| 331 | 3300025938 | Ga0207704_10001762 | Ga0207704_100017628 | 185 |
| 332 | 3300025941 | Ga0207711_10648249 | Ga0207711_106482492 | 185 |
| 333 | 3300025942 | Ga0207689_10012264 | Ga0207689_100122642 | 185 |
| 334 | 3300025949 | Ga0207667_10012992 | Ga0207667_100129928 | 185 |
| 335 | 3300025960 | Ga0207651_10126165 | Ga0207651_101261652 | 185 |
| 336 | 3300025961 | Ga0207712_10065482 | Ga0207712_100654823 | 185 |
| 337 | 3300025981 | Ga0207640_10016745 | Ga0207640_100167453 | 185 |
| 338 | 3300026023 | Ga0207677_10003975 | Ga0207677_100039758 | 185 |
| 339 | 3300026035 | Ga0207703_10010213 | Ga0207703_100102138 | 185 |
| 340 | 3300026075 | Ga0207708_10008062 | Ga0207708_100080622 | 185 |
| 341 | 3300026075 | Ga0207708_10164159 | Ga0207708_101641592 | 185 |
| 342 | 3300026088 | Ga0207641_10077479 | Ga0207641_100774792 | 185 |
| 343 | 3300026089 | Ga0207648_10014322 | Ga0207648_100143228 | 185 |
| 344 | 3300026095 | Ga0207676_10195036 | Ga0207676_101950363 | 185 |
| 345 | 3300026118 | Ga0207675_100014544 | Ga0207675_1000145442 | 185 |
| 346 | 3300027907 | Ga0207428_10002123 | Ga0207428_1000212312 | 185 |
| 347 | 3300028380 | Ga0268265_10006681 | Ga0268265_100066818 | 185 |
| 348 | 3300028381 | Ga0268264_10010052 | Ga0268264_100100527 | 185 |
| 349 | 3300031824 | Ga0307413_10209650 | Ga0307413_102096502 | 185 |
| 350 | 3300031911 | Ga0307412_10145957 | Ga0307412_101459572 | 185 |
| 351 | 3300032002 | Ga0307416_100020661 | Ga0307416_1000206615 | 185 |
| 352 | 3300032002 | Ga0307416_100255960 | Ga0307416_1002559601 | 185 |
| 353 | 3300034816 | Ga0373930_0073807 | Ga0373930_0073807_174_734 | 185 |
| 354 | 3300035085 | Ga0373929_0113796 | Ga0373929_0113796_52_612 | 185 |
| 355 | 3300035088 | Ga0373940_0011535 | Ga0373940_0011535_183_743 | 185 |
| 356 | 3300035091 | Ga0373951_0007192 | Ga0373951_0007192_561_1121 | 185 |
| 357 | 3300035112 | Ga0373932_0025353 | Ga0373932_0025353_106_666 | 185 |
| 358 | 3300035112 | Ga0373932_0054115 | Ga0373932_0054115_427_987 | 185 |
| 359 | 3300035112 | Ga0373932_0078699 | Ga0373932_0078699_342_902 | 185 |
| 360 | 3300035113 | Ga0373936_0119286 | Ga0373936_0119286_103_663 | 185 |
| 361 | 3300035114 | Ga0373939_0118998 | Ga0373939_0118998_61_621 | 185 |
| 362 | 3300035115 | Ga0373941_0303060 | Ga0373941_0303060_13_573 | 185 |
| 363 | 3300035116 | Ga0373945_0056986 | Ga0373945_0056986_188_748 | 185 |
| 364 | 3300035170 | Ga0373943_0058736 | Ga0373943_0058736_229_789 | 185 |
| 365 | 3300035171 | Ga0373946_0004572 | Ga0373946_0004572_124_684 | 185 |
| 366 | 3300035207 | Ga0373942_0008660 | Ga0373942_0008660_589_1149 | 185 |
| 367 | 3300035241 | Ga0373961_0048850 | Ga0373961_0048850_135_695 | 185 |
| 368 | 3300035691 | Ga0373931_0001370 | Ga0373931_0001370_3140_3700 | 185 |
| 369 | 3300035691 | Ga0373931_0016572 | Ga0373931_0016572_2484_3044 | 185 |
| 370 | 3300035692 | Ga0373935_0013594 | Ga0373935_0013594_273_833 | 185 |
| 371 | 3300035695 | Ga0373927_0004154 | Ga0373927_0004154_6869_7429 | 185 |
| 372 | 3300035725 | Ga0373947_0005577 | Ga0373947_0005577_5367_5927 | 185 |
| 373 | 3300036401 | Ga0373937_0139655 | Ga0373937_0139655_212_769 | 185 |
| 374 | 3300037068 | Ga0373925_0163458 | Ga0373925_0163458_879_1439 | 185 |
| 375 | 3300039453 | Ga0436362_0507543 | Ga0436362_0507543_928_1518 | 185 |
| 376 | 3300039453 | Ga0436362_0841797 | Ga0436362_0841797_205_777 | 185 |
| 377 | 3300042001 | Ga0439441_000308 | Ga0439441_000308_1284_1841 | 185 |
| 378 | 3300042436 | Ga0439435_0002925 | Ga0439435_0002925_1574_2131 | 185 |
| 379 | 3300042437 | Ga0439444_0004416 | Ga0439444_0004416_711_1268 | 185 |
| 380 | 3300042461 | Ga0439460_0000132 | Ga0439460_0000132_2824_3381 | 185 |
| 381 | 3300045051 | Ga0451576_0039474 | Ga0451576_0039474_4188_4748 | 185 |
| 382 | 3300045051 | Ga0451576_0087590 | Ga0451576_0087590_69_629 | 185 |
| 383 | 3300045051 | Ga0451576_0260075 | Ga0451576_0260075_553_1110 | 185 |
| 384 | 3300046452 | Ga0495617_126682 | Ga0495617_126682_210_782 | 185 |
| 385 | 3300046454 | Ga0495592_0022552 | Ga0495592_0022552_2349_2906 | 185 |
| 386 | 3300046472 | Ga0495580_0010156 | Ga0495580_0010156_6698_7258 | 185 |
| 387 | 3300046474 | Ga0495605_0020617 | Ga0495605_0020617_507_1079 | 185 |
| 388 | 3300046475 | Ga0495639_0173572 | Ga0495639_0173572_385_942 | 185 |
| 389 | 3300046476 | Ga0495662_0012796 | Ga0495662_0012796_2797_3354 | 185 |
| 390 | 3300046492 | Ga0495585_0000287 | Ga0495585_0000287_49527_50099 | 185 |
| 391 | 3300046492 | Ga0495585_0195871 | Ga0495585_0195871_285_869 | 185 |
| 392 | 3300046500 | Ga0495596_0001186 | Ga0495596_0001186_3760_4344 | 185 |
| 393 | 3300046500 | Ga0495596_0001186 | Ga0495596_0001186_9872_10444 | 185 |
| 394 | 3300046501 | Ga0495607_0135354 | Ga0495607_0135354_437_1021 | 185 |
| 395 | 3300046506 | Ga0495583_0035664 | Ga0495583_0035664_158_715 | 185 |
| 396 | 3300046511 | Ga0495608_0010985 | Ga0495608_0010985_5128_5685 | 185 |
| 397 | 3300046513 | Ga0495616_0032489 | Ga0495616_0032489_1034_1591 | 185 |
| 398 | 3300046514 | Ga0495618_0156188 | Ga0495618_0156188_32_589 | 185 |
| 399 | 3300046516 | Ga0495628_0205094 | Ga0495628_0205094_364_921 | 185 |
| 400 | 3300046517 | Ga0495630_0023570 | Ga0495630_0023570_2640_3197 | 185 |
| 401 | 3300046518 | Ga0495631_0009622 | Ga0495631_0009622_204_776 | 185 |
| 402 | 3300046518 | Ga0495631_0020727 | Ga0495631_0020727_145_729 | 185 |
| 403 | 3300046522 | Ga0495643_0028181 | Ga0495643_0028181_250_834 | 185 |
| 404 | 3300046522 | Ga0495643_0046436 | Ga0495643_0046436_578_1150 | 185 |
| 405 | 3300046523 | Ga0495644_0027452 | Ga0495644_0027452_745_1329 | 185 |
| 406 | 3300046523 | Ga0495644_0096612 | Ga0495644_0096612_43_615 | 185 |
| 407 | 3300046524 | Ga0495648_0084944 | Ga0495648_0084944_974_1531 | 185 |
| 408 | 3300046524 | Ga0495648_0113398 | Ga0495648_0113398_440_1024 | 185 |
| 409 | 3300046524 | Ga0495648_0149643 | Ga0495648_0149643_175_747 | 185 |
| 410 | 3300046526 | Ga0495666_0061321 | Ga0495666_0061321_669_1226 | 185 |
| 411 | 3300046529 | Ga0495652_0094204 | Ga0495652_0094204_1777_2334 | 185 |
| 412 | 3300046533 | Ga0495640_0043549 | Ga0495640_0043549_1694_2251 | 185 |
| 413 | 3300046535 | Ga0495586_0009349 | Ga0495586_0009349_3882_4439 | 185 |
| 414 | 3300046535 | Ga0495586_0378899 | Ga0495586_0378899_179_739 | 185 |
| 415 | 3300046537 | Ga0495598_0077462 | Ga0495598_0077462_404_970 | 185 |
| 416 | 3300046542 | Ga0495597_0018871 | Ga0495597_0018871_1024_1581 | 185 |
| 417 | 3300046543 | Ga0495645_0358318 | Ga0495645_0358318_355_912 | 185 |
| 418 | 3300046557 | Ga0495622_0031565 | Ga0495622_0031565_1580_2164 | 185 |
| 419 | 3300046557 | Ga0495622_0036405 | Ga0495622_0036405_103_663 | 185 |
| 420 | 3300046559 | Ga0495667_0283637 | Ga0495667_0283637_297_854 | 185 |
| 421 | 3300046616 | Ga0495668_0038655 | Ga0495668_0038655_418_990 | 185 |
| 422 | 3300046642 | Ga0495634_0033792 | Ga0495634_0033792_878_1435 | 185 |
| 423 | 3300046648 | Ga0495611_0053960 | Ga0495611_0053960_1068_1652 | 185 |
| 424 | 3300046663 | Ga0495635_0094248 | Ga0495635_0094248_492_1049 | 185 |
| 425 | 3300046664 | Ga0495659_0026177 | Ga0495659_0026177_1294_1851 | 185 |
| 426 | 3300046665 | Ga0495661_0036014 | Ga0495661_0036014_324_881 | 185 |
| 427 | 3300046674 | Ga0495588_0006205 | Ga0495588_0006205_4245_4805 | 185 |
| 428 | 3300046678 | Ga0495599_0025668 | Ga0495599_0025668_920_1477 | 185 |
| 429 | 3300046681 | Ga0495647_0001466 | Ga0495647_0001466_6633_7193 | 185 |
| 430 | 3300046683 | Ga0495658_0452429 | Ga0495658_0452429_31_591 | 185 |
| 431 | 3300046809 | Ga0495600_0286202 | Ga0495600_0286202_392_949 | 185 |
| 432 | 3300047317 | Ga0495604_0081829 | Ga0495604_0081829_398_955 | 185 |
| 433 | 3300047318 | Ga0495636_0045399 | Ga0495636_0045399_386_943 | 185 |
| 434 | 3300047318 | Ga0495636_0059994 | Ga0495636_0059994_877_1461 | 185 |
| 435 | 3300047318 | Ga0495636_0121196 | Ga0495636_0121196_278_838 | 185 |
| 436 | 3300047318 | Ga0495636_0232715 | Ga0495636_0232715_119_676 | 185 |
| 437 | 3300047320 | Ga0495672_0099404 | Ga0495672_0099404_924_1496 | 185 |
| 438 | 3300047320 | Ga0495672_0111948 | Ga0495672_0111948_720_1304 | 185 |
| 439 | 3300047321 | Ga0495676_0015250 | Ga0495676_0015250_2411_2992 | 185 |
| 440 | 3300047321 | Ga0495676_0039356 | Ga0495676_0039356_3108_3680 | 185 |
| 441 | 3300047322 | Ga0495680_0009272 | Ga0495680_0009272_4814_5371 | 185 |
| 442 | 3300047323 | Ga0495683_0096614 | Ga0495683_0096614_603_1187 | 185 |
| 443 | 3300047323 | Ga0495683_0164866 | Ga0495683_0164866_278_862 | 185 |
| 444 | 3300047445 | Ga0495677_0058045 | Ga0495677_0058045_649_1233 | 185 |
| 445 | 3300047445 | Ga0495677_0070702 | Ga0495677_0070702_448_1020 | 185 |
| 446 | 3300047469 | Ga0495673_0022925 | Ga0495673_0022925_267_851 | 185 |
| 447 | 3300047470 | Ga0495681_0043408 | Ga0495681_0043408_854_1411 | 185 |
| 448 | 3300048091 | Ga0495626_0009050 | Ga0495626_0009050_484_1041 | 185 |
| 449 | 3300048091 | Ga0495626_0071387 | Ga0495626_0071387_806_1378 | 185 |
| 450 | 3300048909 | Ga0496106_0658870 | Ga0496106_0658870_152_712 | 185 |
| 451 | 3300048917 | Ga0496114_0589033 | Ga0496114_0589033_401_961 | 185 |
| 452 | 3300048920 | Ga0496117_0026401 | Ga0496117_0026401_29_604 | 185 |
| 453 | 3300049460 | Ga0495682_0053774 | Ga0495682_0053774_267_839 | 185 |
| 454 | 3300049521 | Ga0501298_044908 | Ga0501298_044908_299_856 | 185 |
| 455 | 3300049575 | Ga0501039_0535035 | Ga0501039_0535035_316_879 | 185 |
| 456 | 3300049576 | Ga0501040_0299361 | Ga0501040_0299361_270_827 | 185 |
| 457 | 3300049577 | Ga0501041_0067913 | Ga0501041_0067913_46_702 | 185 |
| 458 | 3300049578 | Ga0501042_0165180 | Ga0501042_0165180_54_710 | 185 |
| 459 | 3300049579 | Ga0501043_0210105 | Ga0501043_0210105_475_1131 | 185 |
| 460 | 3300049580 | Ga0501046_0010778 | Ga0501046_0010778_7109_7765 | 185 |
| 461 | 3300049743 | Ga0501081_0326044 | Ga0501081_0326044_340_996 | 185 |
| 462 | 3300049824 | Ga0501045_0016854 | Ga0501045_0016854_810_1466 | 185 |
| 463 | 3300050507 | nmdc:mga05p37_331_c1 | nmdc:mga05p37_331_c1_39107_39667 | 185 |
| 464 | 3300050507 | nmdc:mga05p37_974689_c1 | nmdc:mga05p37_974689_c1_224_781 | 185 |
| 465 | 3300050508 | nmdc:mga09592_4034_c1 | nmdc:mga09592_4034_c1_2621_3181 | 185 |
| 466 | 3300050509 | nmdc:mga0qj67_180152_c1 | nmdc:mga0qj67_180152_c1_1138_1698 | 185 |
| 467 | 3300050511 | nmdc:mga08y16_16773_c1 | nmdc:mga08y16_16773_c1_6773_7333 | 185 |
| 468 | 3300050511 | nmdc:mga08y16_357825_c1 | nmdc:mga08y16_357825_c1_166_726 | 185 |
| 469 | 3300050511 | nmdc:mga08y16_464144_c1 | nmdc:mga08y16_464144_c1_296_901 | 185 |
| 470 | 3300050512 | nmdc:mga0n895_189577_c1 | nmdc:mga0n895_189577_c1_392_952 | 185 |
| 471 | 3300053077 | Ga0495601_0079478 | Ga0495601_0079478_246_803 | 185 |
| 472 | 3300005444 | Ga0070694_100577901 | Ga0070694_1005779012 | 186 |
| 473 | 3300031548 | Ga0307408_100534397 | Ga0307408_1005343971 | 186 |
| 474 | 3300035241 | Ga0373961_0125354 | Ga0373961_0125354_253_816 | 186 |
| 475 | 3300037471 | Ga0395905_0021133 | Ga0395905_0021133_408_974 | 186 |
| 476 | 3300045051 | Ga0451576_0048796 | Ga0451576_0048796_3757_4320 | 186 |
| 477 | 3300050512 | nmdc:mga0n895_68393_c1 | nmdc:mga0n895_68393_c1_165_728 | 186 |
| 478 | 3300050513 | nmdc:mga0rr50_68676_c1 | nmdc:mga0rr50_68676_c1_1913_2476 | 186 |
| 479 | 3300050514 | nmdc:mga08x19_5578_c1 | nmdc:mga08x19_5578_c1_588_1151 | 186 |
| 480 | 3300050515 | nmdc:mga0a205_36607_c1 | nmdc:mga0a205_36607_c1_1930_2493 | 186 |
| 481 | 3300053126 | Ga0500621_070050 | Ga0500621_070050_745_1314 | 186 |
| 482 | 3300000549 | LJQas_1001792 | LJQas_10017923 | 187 |
| 483 | 3300005549 | Ga0070704_100095877 | Ga0070704_1000958772 | 187 |
| 484 | 3300005981 | Ga0081538_10125762 | Ga0081538_101257622 | 187 |
| 485 | 3300006844 | Ga0075428_100003327 | Ga0075428_10000332714 | 187 |
| 486 | 3300006846 | Ga0075430_100002934 | Ga0075430_1000029345 | 187 |
| 487 | 3300006847 | Ga0075431_100064349 | Ga0075431_1000643493 | 187 |
| 488 | 3300006880 | Ga0075429_100001637 | Ga0075429_10000163712 | 187 |
| 489 | 3300009147 | Ga0114129_10042478 | Ga0114129_100424783 | 187 |
| 490 | 3300035090 | Ga0373949_0015149 | Ga0373949_0015149_1010_1597 | 187 |
| 491 | 3300039438 | Ga0436360_0016934 | Ga0436360_0016934_360_1037 | 187 |
| 492 | 3300041408 | Ga0439453_0007188 | Ga0439453_0007188_57_626 | 187 |
| 493 | 3300049521 | Ga0501298_051249 | Ga0501298_051249_141_704 | 187 |
| 494 | 3300049680 | Ga0501250_019263 | Ga0501250_019263_297_860 | 187 |
| 495 | 3300050507 | nmdc:mga05p37_31057_c1 | nmdc:mga05p37_31057_c1_4230_4799 | 187 |
| 496 | 3300050508 | nmdc:mga09592_65193_c1 | nmdc:mga09592_65193_c1_2043_2612 | 187 |
| 497 | 3300050509 | nmdc:mga0qj67_53781_c1 | nmdc:mga0qj67_53781_c1_383_946 | 187 |
| 498 | 3300050511 | nmdc:mga08y16_169957_c1 | nmdc:mga08y16_169957_c1_374_937 | 187 |
| 499 | 3300005546 | Ga0070696_100203936 | Ga0070696_1002039362 | 188 |
| 500 | 3300005549 | Ga0070704_100104451 | Ga0070704_1001044512 | 188 |
| 501 | 3300005985 | Ga0081539_10023062 | Ga0081539_100230622 | 188 |
| 502 | 3300049579 | Ga0501043_0118389 | Ga0501043_0118389_587_1243 | 188 |
| 503 | 3300049580 | Ga0501046_0000583 | Ga0501046_0000583_19531_20187 | 188 |
| 504 | 3300049593 | Ga0501077_0126640 | Ga0501077_0126640_450_1025 | 188 |
| 505 | 3300049743 | Ga0501081_0638671 | Ga0501081_0638671_95_688 | 188 |
| 506 | 3300050507 | nmdc:mga05p37_573131_c1 | nmdc:mga05p37_573131_c1_165_740 | 188 |
| 507 | iso_pu_bacteria | 2895511927 | 2895513564 | 188 |
| 508 | 3300005618 | Ga0068864_100648760 | Ga0068864_1006487601 | 190 |
| 509 | 3300025918 | Ga0207662_10256929 | Ga0207662_102569292 | 190 |
| 510 | 3300025936 | Ga0207670_10383102 | Ga0207670_103831022 | 190 |
| 511 | 3300026095 | Ga0207676_10398149 | Ga0207676_103981491 | 190 |
| 512 | 3300034817 | Ga0373948_0075578 | Ga0373948_0075578_164_739 | 190 |
| 513 | 3300046500 | Ga0495596_0021535 | Ga0495596_0021535_1237_1863 | 190 |
| 514 | 3300046539 | Ga0495621_0093208 | Ga0495621_0093208_284_877 | 190 |
| 515 | 3300049570 | Ga0501033_0441570 | Ga0501033_0441570_284_859 | 190 |
| 516 | 3300053154 | Ga0500619_000126 | Ga0500619_000126_9983_10567 | 190 |
| 517 | 3300005338 | Ga0068868_100100382 | Ga0068868_1001003822 | 191 |
| 518 | 3300014325 | Ga0163163_10919835 | Ga0163163_109198351 | 191 |
| 519 | 3300025911 | Ga0207654_10156188 | Ga0207654_101561882 | 191 |
| 520 | 3300035113 | Ga0373936_0118784 | Ga0373936_0118784_451_1047 | 191 |
| 521 | 3300035695 | Ga0373927_0635729 | Ga0373927_0635729_15_611 | 191 |
| 522 | 3300035725 | Ga0373947_0153678 | Ga0373947_0153678_501_1097 | 191 |
| 523 | 3300039437 | Ga0436365_1727819 | Ga0436365_1727819_1600_2202 | 191 |
| 524 | iso_pu_bacteria | 2885270888 | 2885277872 | 191 |
| 525 | 3300005338 | Ga0068868_100212370 | Ga0068868_1002123702 | 192 |
| 526 | 3300005340 | Ga0070689_100041867 | Ga0070689_1000418673 | 192 |
| 527 | 3300005440 | Ga0070705_100184420 | Ga0070705_1001844202 | 192 |
| 528 | 3300005456 | Ga0070678_100747013 | Ga0070678_1007470131 | 192 |
| 529 | 3300005546 | Ga0070696_100100300 | Ga0070696_1001003001 | 192 |
| 530 | 3300006175 | Ga0070712_100892948 | Ga0070712_1008929481 | 192 |
| 531 | 3300006237 | Ga0097621_100055240 | Ga0097621_1000552403 | 192 |
| 532 | 3300009176 | Ga0105242_10615638 | Ga0105242_106156382 | 192 |
| 533 | 3300025927 | Ga0207687_10049529 | Ga0207687_100495293 | 192 |
| 534 | 3300025936 | Ga0207670_10114076 | Ga0207670_101140761 | 192 |
| 535 | 3300025942 | Ga0207689_10193235 | Ga0207689_101932352 | 192 |
| 536 | 3300026023 | Ga0207677_10419556 | Ga0207677_104195562 | 192 |
| 537 | 3300026089 | Ga0207648_11166595 | Ga0207648_111665951 | 192 |
| 538 | 3300026142 | Ga0207698_10096282 | Ga0207698_100962823 | 192 |
| 539 | 3300050514 | nmdc:mga08x19_28100_c1 | nmdc:mga08x19_28100_c1_2022_2600 | 192 |
| 540 | 3300005437 | Ga0070710_10114141 | Ga0070710_101141413 | 193 |
| 541 | 3300005539 | Ga0068853_100129221 | Ga0068853_1001292213 | 193 |
| 542 | 3300006028 | Ga0070717_10009247 | Ga0070717_100092479 | 193 |
| 543 | 3300007265 | Ga0099794_10026206 | Ga0099794_100262063 | 193 |
| 544 | 3300009545 | Ga0105237_10019788 | Ga0105237_100197886 | 193 |
| 545 | 3300009551 | Ga0105238_10013604 | Ga0105238_100136045 | 193 |
| 546 | 3300010375 | Ga0105239_10001816 | Ga0105239_100018163 | 193 |
| 547 | 3300014325 | Ga0163163_10274853 | Ga0163163_102748533 | 193 |
| 548 | 3300021388 | Ga0213875_10000825 | Ga0213875_1000082520 | 193 |
| 549 | 3300021388 | Ga0213875_10259246 | Ga0213875_102592462 | 193 |
| 550 | 3300025906 | Ga0207699_10294152 | Ga0207699_102941522 | 193 |
| 551 | 3300025913 | Ga0207695_10009849 | Ga0207695_1000984910 | 193 |
| 552 | 3300025914 | Ga0207671_10010577 | Ga0207671_100105773 | 193 |
| 553 | 3300025924 | Ga0207694_10011571 | Ga0207694_100115716 | 193 |
| 554 | 3300026041 | Ga0207639_10047688 | Ga0207639_100476882 | 193 |
| 555 | 3300035207 | Ga0373942_0049354 | Ga0373942_0049354_106_705 | 193 |
| 556 | 3300037853 | Ga0436364_0734767 | Ga0436364_0734767_4607_5197 | 193 |
| 557 | 3300037853 | Ga0436364_1104137 | Ga0436364_1104137_93_686 | 193 |
| 558 | 3300044683 | Ga0466965_0390459 | Ga0466965_0390459_77_697 | 193 |
| 559 | 3300044706 | Ga0466964_0174316 | Ga0466964_0174316_273_893 | 193 |
| 560 | 3300044842 | Ga0466957_0076598 | Ga0466957_0076598_260_880 | 193 |
| 561 | 3300045049 | Ga0466959_0247373 | Ga0466959_0247373_347_967 | 193 |
| 562 | 3300046471 | Ga0495650_0025193 | Ga0495650_0025193_1857_2477 | 193 |
| 563 | 3300047319 | Ga0495674_0136209 | Ga0495674_0136209_1067_1687 | 193 |
| 564 | 3300047320 | Ga0495672_0037083 | Ga0495672_0037083_2094_2714 | 193 |
| 565 | 3300048909 | Ga0496106_0000002 | Ga0496106_0000002_43337_43957 | 193 |
| 566 | 3300048924 | Ga0496121_0000188 | Ga0496121_0000188_70394_71014 | 193 |
| 567 | 3300048924 | Ga0496121_0004978 | Ga0496121_0004978_13691_14311 | 193 |
| 568 | 3300048929 | Ga0496126_0000783 | Ga0496126_0000783_50534_51154 | 193 |
| 569 | 3300005343 | Ga0070687_100251682 | Ga0070687_1002516822 | 194 |
| 570 | 3300005436 | Ga0070713_100012279 | Ga0070713_1000122792 | 194 |
| 571 | 3300005439 | Ga0070711_100766053 | Ga0070711_1007660532 | 194 |
| 572 | 3300005467 | Ga0070706_100422967 | Ga0070706_1004229672 | 194 |
| 573 | 3300005471 | Ga0070698_100288017 | Ga0070698_1002880172 | 194 |
| 574 | 3300005545 | Ga0070695_100306648 | Ga0070695_1003066482 | 194 |
| 575 | 3300005547 | Ga0070693_100394482 | Ga0070693_1003944821 | 194 |
| 576 | 3300007076 | Ga0075435_100127432 | Ga0075435_1001274322 | 194 |
| 577 | 3300009094 | Ga0111539_10192474 | Ga0111539_101924745 | 194 |
| 578 | 3300025918 | Ga0207662_10249342 | Ga0207662_102493422 | 194 |
| 579 | 3300025921 | Ga0207652_10943957 | Ga0207652_109439571 | 194 |
| 580 | 3300025942 | Ga0207689_10479048 | Ga0207689_104790482 | 194 |
| 581 | 3300027907 | Ga0207428_10621878 | Ga0207428_106218781 | 194 |
| 582 | 3300032005 | Ga0307411_10539823 | Ga0307411_105398231 | 194 |
| 583 | 3300035115 | Ga0373941_0063080 | Ga0373941_0063080_258_848 | 194 |
| 584 | 3300037418 | Ga0395900_0080357 | Ga0395900_0080357_690_1295 | 194 |
| 585 | 3300037471 | Ga0395905_0026213 | Ga0395905_0026213_174_779 | 194 |
| 586 | 3300044693 | Ga0466961_0406063 | Ga0466961_0406063_191_796 | 194 |
| 587 | 3300044842 | Ga0466957_0013848 | Ga0466957_0013848_2374_2979 | 194 |
| 588 | 3300045836 | Ga0466958_0038400 | Ga0466958_0038400_1368_1973 | 194 |
| 589 | 3300005338 | Ga0068868_100918156 | Ga0068868_1009181561 | 195 |
| 590 | 3300005365 | Ga0070688_100261047 | Ga0070688_1002610471 | 195 |
| 591 | 3300005438 | Ga0070701_10212840 | Ga0070701_102128402 | 195 |
| 592 | 3300005438 | Ga0070701_10302306 | Ga0070701_103023062 | 195 |
| 593 | 3300005444 | Ga0070694_100489977 | Ga0070694_1004899772 | 195 |
| 594 | 3300005617 | Ga0068859_100032097 | Ga0068859_1000320974 | 195 |
| 595 | 3300006844 | Ga0075428_100042969 | Ga0075428_1000429693 | 195 |
| 596 | 3300006880 | Ga0075429_100371127 | Ga0075429_1003711272 | 195 |
| 597 | 3300006931 | Ga0097620_100032097 | Ga0097620_1000320974 | 195 |
| 598 | 3300007076 | Ga0075435_100343288 | Ga0075435_1003432882 | 195 |
| 599 | 3300007076 | Ga0075435_100720077 | Ga0075435_1007200772 | 195 |
| 600 | 3300009094 | Ga0111539_10000829 | Ga0111539_1000082936 | 195 |
| 601 | 3300009098 | Ga0105245_10429248 | Ga0105245_104292482 | 195 |
| 602 | 3300009148 | Ga0105243_10208469 | Ga0105243_102084693 | 195 |
| 603 | 3300013306 | Ga0163162_11043492 | Ga0163162_110434921 | 195 |
| 604 | 3300025913 | Ga0207695_10357886 | Ga0207695_103578861 | 195 |
| 605 | 3300025932 | Ga0207690_10640772 | Ga0207690_106407721 | 195 |
| 606 | 3300025933 | Ga0207706_10563027 | Ga0207706_105630272 | 195 |
| 607 | 3300025940 | Ga0207691_10193737 | Ga0207691_101937372 | 195 |
| 608 | 3300025961 | Ga0207712_10400141 | Ga0207712_104001411 | 195 |
| 609 | 3300027907 | Ga0207428_10005694 | Ga0207428_1000569411 | 195 |
| 610 | 3300039437 | Ga0436365_0560582 | Ga0436365_0560582_6316_6930 | 195 |
| 611 | 3300044673 | Ga0453683_0283746 | Ga0453683_0283746_388_987 | 195 |
| 612 | 3300046684 | Ga0495669_0040245 | Ga0495669_0040245_378_986 | 195 |
| 613 | 3300050508 | nmdc:mga09592_314338_c1 | nmdc:mga09592_314338_c1_677_1282 | 195 |
| 614 | 3300059424 | Ga0590075_043931 | Ga0590075_043931_46_651 | 195 |
| 615 | iso_pu_bacteria | 3005409236 | 3005409931 | 195 |
| 616 | 3300005327 | Ga0070658_10265790 | Ga0070658_102657902 | 196 |
| 617 | 3300005329 | Ga0070683_100289352 | Ga0070683_1002893522 | 196 |
| 618 | 3300005336 | Ga0070680_100055204 | Ga0070680_1000552043 | 196 |
| 619 | 3300005336 | Ga0070680_100316045 | Ga0070680_1003160452 | 196 |
| 620 | 3300005343 | Ga0070687_100378688 | Ga0070687_1003786882 | 196 |
| 621 | 3300005440 | Ga0070705_100039722 | Ga0070705_1000397223 | 196 |
| 622 | 3300005444 | Ga0070694_100409187 | Ga0070694_1004091872 | 196 |
| 623 | 3300005468 | Ga0070707_100345728 | Ga0070707_1003457281 | 196 |
| 624 | 3300005530 | Ga0070679_100001812 | Ga0070679_1000018122 | 196 |
| 625 | 3300005535 | Ga0070684_100137437 | Ga0070684_1001374372 | 196 |
| 626 | 3300005536 | Ga0070697_100033676 | Ga0070697_1000336763 | 196 |
| 627 | 3300005539 | Ga0068853_100291072 | Ga0068853_1002910722 | 196 |
| 628 | 3300005545 | Ga0070695_100068774 | Ga0070695_1000687743 | 196 |
| 629 | 3300005549 | Ga0070704_100065410 | Ga0070704_1000654103 | 196 |
| 630 | 3300005563 | Ga0068855_100001026 | Ga0068855_1000010264 | 196 |
| 631 | 3300005563 | Ga0068855_100151451 | Ga0068855_1001514512 | 196 |
| 632 | 3300005564 | Ga0070664_100259026 | Ga0070664_1002590262 | 196 |
| 633 | 3300005614 | Ga0068856_100319255 | Ga0068856_1003192552 | 196 |
| 634 | 3300005616 | Ga0068852_100012355 | Ga0068852_1000123553 | 196 |
| 635 | 3300005616 | Ga0068852_100128379 | Ga0068852_1001283792 | 196 |
| 636 | 3300005834 | Ga0068851_10001034 | Ga0068851_100010348 | 196 |
| 637 | 3300006353 | Ga0075370_10157038 | Ga0075370_101570382 | 196 |
| 638 | 3300006358 | Ga0068871_100017452 | Ga0068871_1000174523 | 196 |
| 639 | 3300006871 | Ga0075434_100149851 | Ga0075434_1001498512 | 196 |
| 640 | 3300006914 | Ga0075436_100219945 | Ga0075436_1002199452 | 196 |
| 641 | 3300007076 | Ga0075435_100141742 | Ga0075435_1001417422 | 196 |
| 642 | 3300009093 | Ga0105240_10017393 | Ga0105240_100173937 | 196 |
| 643 | 3300009093 | Ga0105240_10040202 | Ga0105240_100402023 | 196 |
| 644 | 3300009093 | Ga0105240_10065260 | Ga0105240_100652603 | 196 |
| 645 | 3300009174 | Ga0105241_10074350 | Ga0105241_100743503 | 196 |
| 646 | 3300009551 | Ga0105238_10014032 | Ga0105238_100140327 | 196 |
| 647 | 3300009551 | Ga0105238_10103045 | Ga0105238_101030453 | 196 |
| 648 | 3300010375 | Ga0105239_10515150 | Ga0105239_105151502 | 196 |
| 649 | 3300013105 | Ga0157369_10043732 | Ga0157369_100437323 | 196 |
| 650 | 3300013105 | Ga0157369_10481760 | Ga0157369_104817602 | 196 |
| 651 | 3300013296 | Ga0157374_10147160 | Ga0157374_101471603 | 196 |
| 652 | 3300013307 | Ga0157372_10012175 | Ga0157372_100121752 | 196 |
| 653 | 3300013307 | Ga0157372_10054137 | Ga0157372_100541373 | 196 |
| 654 | 3300025911 | Ga0207654_10002438 | Ga0207654_100024388 | 196 |
| 655 | 3300025913 | Ga0207695_10066308 | Ga0207695_100663083 | 196 |
| 656 | 3300025913 | Ga0207695_10142311 | Ga0207695_101423112 | 196 |
| 657 | 3300025918 | Ga0207662_10186669 | Ga0207662_101866692 | 196 |
| 658 | 3300025919 | Ga0207657_10075804 | Ga0207657_100758043 | 196 |
| 659 | 3300025919 | Ga0207657_10222137 | Ga0207657_102221372 | 196 |
| 660 | 3300025921 | Ga0207652_10199222 | Ga0207652_101992222 | 196 |
| 661 | 3300025921 | Ga0207652_10433309 | Ga0207652_104333092 | 196 |
| 662 | 3300025924 | Ga0207694_10070565 | Ga0207694_100705651 | 196 |
| 663 | 3300025924 | Ga0207694_10083769 | Ga0207694_100837692 | 196 |
| 664 | 3300025929 | Ga0207664_10200486 | Ga0207664_102004861 | 196 |
| 665 | 3300025932 | Ga0207690_10032081 | Ga0207690_100320812 | 196 |
| 666 | 3300025949 | Ga0207667_10025639 | Ga0207667_100256395 | 196 |
| 667 | 3300026023 | Ga0207677_10153715 | Ga0207677_101537152 | 196 |
| 668 | 3300026023 | Ga0207677_11445044 | Ga0207677_114450441 | 196 |
| 669 | 3300026041 | Ga0207639_10089627 | Ga0207639_100896272 | 196 |
| 670 | 3300026041 | Ga0207639_10264118 | Ga0207639_102641182 | 196 |
| 671 | 3300026078 | Ga0207702_10796898 | Ga0207702_107968982 | 196 |
| 672 | 3300026116 | Ga0207674_10268535 | Ga0207674_102685351 | 196 |
| 673 | 3300026142 | Ga0207698_10000418 | Ga0207698_1000041813 | 196 |
| 674 | 3300031901 | Ga0307406_10616230 | Ga0307406_106162302 | 196 |
| 675 | 3300037068 | Ga0373925_0214501 | Ga0373925_0214501_241_849 | 196 |
| 676 | 3300038443 | Ga0395901_0207803 | Ga0395901_0207803_169_771 | 196 |
| 677 | 3300048907 | Ga0496104_0026791 | Ga0496104_0026791_3573_4181 | 196 |
| 678 | 3300048913 | Ga0496110_0232968 | Ga0496110_0232968_629_1237 | 196 |
| 679 | 3300049573 | Ga0501037_0483972 | Ga0501037_0483972_104_697 | 196 |
| 680 | 3300049582 | Ga0501048_0260692 | Ga0501048_0260692_626_1219 | 196 |
| 681 | 3300049588 | Ga0501072_0024394 | Ga0501072_0024394_3113_3706 | 196 |
| 682 | 3300049592 | Ga0501076_0007717 | Ga0501076_0007717_4417_5010 | 196 |
| 683 | 3300049765 | Ga0501268_030937 | Ga0501268_030937_38_640 | 196 |
| 684 | 3300050493 | nmdc:mga0k408_34802_c1 | nmdc:mga0k408_34802_c1_1042_1650 | 196 |
| 685 | 3300050496 | nmdc:mga07m45_100556_c1 | nmdc:mga07m45_100556_c1_490_1098 | 196 |
| 686 | 3300050512 | nmdc:mga0n895_94392_c1 | nmdc:mga0n895_94392_c1_1494_2090 | 196 |
| 687 | 3300050513 | nmdc:mga0rr50_198712_c1 | nmdc:mga0rr50_198712_c1_515_1111 | 196 |
| 688 | 3300050514 | nmdc:mga08x19_13853_c1 | nmdc:mga08x19_13853_c1_399_989 | 196 |
| 689 | 3300050514 | nmdc:mga08x19_42987_c1 | nmdc:mga08x19_42987_c1_1582_2193 | 196 |
| 690 | 3300050514 | nmdc:mga08x19_52337_c1 | nmdc:mga08x19_52337_c1_819_1415 | 196 |
| 691 | 3300061734 | Ga0530510_0004356 | Ga0530510_0004356_3850_4443 | 196 |
| 692 | 3300005440 | Ga0070705_100391067 | Ga0070705_1003910672 | 197 |
| 693 | 3300005467 | Ga0070706_100433194 | Ga0070706_1004331942 | 197 |
| 694 | 3300005468 | Ga0070707_100167909 | Ga0070707_1001679092 | 197 |
| 695 | 3300005471 | Ga0070698_100002719 | Ga0070698_1000027196 | 197 |
| 696 | 3300005518 | Ga0070699_100028410 | Ga0070699_1000284103 | 197 |
| 697 | 3300005546 | Ga0070696_100094560 | Ga0070696_1000945602 | 197 |
| 698 | 3300005549 | Ga0070704_100047604 | Ga0070704_1000476043 | 197 |
| 699 | 3300005563 | Ga0068855_100049308 | Ga0068855_1000493084 | 197 |
| 700 | 3300006871 | Ga0075434_101083707 | Ga0075434_1010837072 | 197 |
| 701 | 3300006914 | Ga0075436_100219010 | Ga0075436_1002190102 | 197 |
| 702 | 3300007076 | Ga0075435_100515873 | Ga0075435_1005158732 | 197 |
| 703 | 3300009094 | Ga0111539_10591943 | Ga0111539_105919432 | 197 |
| 704 | 3300009094 | Ga0111539_10690325 | Ga0111539_106903252 | 197 |
| 705 | 3300013307 | Ga0157372_10285706 | Ga0157372_102857062 | 197 |
| 706 | 3300014326 | Ga0157380_10353419 | Ga0157380_103534192 | 197 |
| 707 | 3300014326 | Ga0157380_10430553 | Ga0157380_104305531 | 197 |
| 708 | 3300025910 | Ga0207684_10120761 | Ga0207684_101207612 | 197 |
| 709 | 3300025936 | Ga0207670_10245363 | Ga0207670_102453632 | 197 |
| 710 | 3300025949 | Ga0207667_10046656 | Ga0207667_100466563 | 197 |
| 711 | 3300035691 | Ga0373931_0177914 | Ga0373931_0177914_186_800 | 197 |
| 712 | 3300046615 | Ga0495656_0067782 | Ga0495656_0067782_632_1240 | 197 |
| 713 | 3300046664 | Ga0495659_0086521 | Ga0495659_0086521_564_1172 | 197 |
| 714 | 3300049570 | Ga0501033_0003162 | Ga0501033_0003162_1442_2086 | 197 |
| 715 | 3300049581 | Ga0501047_0253615 | Ga0501047_0253615_481_1125 | 197 |
| 716 | 3300050507 | nmdc:mga05p37_53342_c1 | nmdc:mga05p37_53342_c1_1972_2568 | 197 |
| 717 | 3300050507 | nmdc:mga05p37_762130_c1 | nmdc:mga05p37_762130_c1_217_810 | 197 |
| 718 | 3300050510 | nmdc:mga06r32_15222_c1 | nmdc:mga06r32_15222_c1_5970_6566 | 197 |
| 719 | 3300050510 | nmdc:mga06r32_970685_c1 | nmdc:mga06r32_970685_c1_69_665 | 197 |
| 720 | 3300050511 | nmdc:mga08y16_476131_c1 | nmdc:mga08y16_476131_c1_121_717 | 197 |
| 721 | 3300050511 | nmdc:mga08y16_936191_c1 | nmdc:mga08y16_936191_c1_113_712 | 197 |
| 722 | 3300050512 | nmdc:mga0n895_353756_c1 | nmdc:mga0n895_353756_c1_310_921 | 197 |
| 723 | 3300050513 | nmdc:mga0rr50_455586_c1 | nmdc:mga0rr50_455586_c1_298_909 | 197 |
| 724 | 3300005331 | Ga0070670_100043454 | Ga0070670_1000434544 | 198 |
| 725 | 3300005341 | Ga0070691_10255912 | Ga0070691_102559122 | 198 |
| 726 | 3300005345 | Ga0070692_10035875 | Ga0070692_100358752 | 198 |
| 727 | 3300005353 | Ga0070669_100601921 | Ga0070669_1006019212 | 198 |
| 728 | 3300005364 | Ga0070673_100634619 | Ga0070673_1006346192 | 198 |
| 729 | 3300005365 | Ga0070688_100680942 | Ga0070688_1006809422 | 198 |
| 730 | 3300005438 | Ga0070701_10008555 | Ga0070701_100085555 | 198 |
| 731 | 3300005440 | Ga0070705_100000108 | Ga0070705_1000001085 | 198 |
| 732 | 3300005440 | Ga0070705_100053822 | Ga0070705_1000538223 | 198 |
| 733 | 3300005445 | Ga0070708_100934797 | Ga0070708_1009347971 | 198 |
| 734 | 3300005458 | Ga0070681_10020240 | Ga0070681_100202402 | 198 |
| 735 | 3300005468 | Ga0070707_100280671 | Ga0070707_1002806712 | 198 |
| 736 | 3300005471 | Ga0070698_100047033 | Ga0070698_1000470332 | 198 |
| 737 | 3300005471 | Ga0070698_100355023 | Ga0070698_1003550232 | 198 |
| 738 | 3300005518 | Ga0070699_100028998 | Ga0070699_1000289984 | 198 |
| 739 | 3300005518 | Ga0070699_100370060 | Ga0070699_1003700602 | 198 |
| 740 | 3300005536 | Ga0070697_100012632 | Ga0070697_1000126322 | 198 |
| 741 | 3300005545 | Ga0070695_100002095 | Ga0070695_1000020951 | 198 |
| 742 | 3300005546 | Ga0070696_100000180 | Ga0070696_10000018019 | 198 |
| 743 | 3300005546 | Ga0070696_100057118 | Ga0070696_1000571182 | 198 |
| 744 | 3300005549 | Ga0070704_100010578 | Ga0070704_1000105783 | 198 |
| 745 | 3300005564 | Ga0070664_100184978 | Ga0070664_1001849783 | 198 |
| 746 | 3300005577 | Ga0068857_100233760 | Ga0068857_1002337602 | 198 |
| 747 | 3300005615 | Ga0070702_100452466 | Ga0070702_1004524661 | 198 |
| 748 | 3300005840 | Ga0068870_10036353 | Ga0068870_100363532 | 198 |
| 749 | 3300006173 | Ga0070716_100223808 | Ga0070716_1002238082 | 198 |
| 750 | 3300006844 | Ga0075428_100004010 | Ga0075428_10000401018 | 198 |
| 751 | 3300006852 | Ga0075433_10207385 | Ga0075433_102073852 | 198 |
| 752 | 3300006871 | Ga0075434_100001205 | Ga0075434_1000012055 | 198 |
| 753 | 3300006871 | Ga0075434_100031867 | Ga0075434_1000318673 | 198 |
| 754 | 3300006880 | Ga0075429_100010090 | Ga0075429_1000100905 | 198 |
| 755 | 3300006914 | Ga0075436_100112760 | Ga0075436_1001127602 | 198 |
| 756 | 3300007076 | Ga0075435_100512445 | Ga0075435_1005124451 | 198 |
| 757 | 3300009098 | Ga0105245_11466143 | Ga0105245_114661431 | 198 |
| 758 | 3300009147 | Ga0114129_10007142 | Ga0114129_100071427 | 198 |
| 759 | 3300009147 | Ga0114129_10086663 | Ga0114129_100866632 | 198 |
| 760 | 3300009147 | Ga0114129_10090544 | Ga0114129_100905443 | 198 |
| 761 | 3300009147 | Ga0114129_10659587 | Ga0114129_106595872 | 198 |
| 762 | 3300009176 | Ga0105242_10107916 | Ga0105242_101079163 | 198 |
| 763 | 3300025908 | Ga0207643_10005979 | Ga0207643_100059795 | 198 |
| 764 | 3300025912 | Ga0207707_10034663 | Ga0207707_100346635 | 198 |
| 765 | 3300025922 | Ga0207646_10107048 | Ga0207646_101070483 | 198 |
| 766 | 3300025922 | Ga0207646_10204119 | Ga0207646_102041192 | 198 |
| 767 | 3300025923 | Ga0207681_10565111 | Ga0207681_105651112 | 198 |
| 768 | 3300025925 | Ga0207650_10027881 | Ga0207650_100278814 | 198 |
| 769 | 3300025929 | Ga0207664_10061928 | Ga0207664_100619283 | 198 |
| 770 | 3300025934 | Ga0207686_10070734 | Ga0207686_100707343 | 198 |
| 771 | 3300025935 | Ga0207709_10803295 | Ga0207709_108032951 | 198 |
| 772 | 3300025945 | Ga0207679_10229517 | Ga0207679_102295172 | 198 |
| 773 | 3300026116 | Ga0207674_10032849 | Ga0207674_100328492 | 198 |
| 774 | 3300034817 | Ga0373948_0065466 | Ga0373948_0065466_13_633 | 198 |
| 775 | 3300037068 | Ga0373925_0057775 | Ga0373925_0057775_1087_1743 | 198 |
| 776 | 3300045051 | Ga0451576_0890880 | Ga0451576_0890880_100_702 | 198 |
| 777 | 3300046455 | Ga0495603_0018093 | Ga0495603_0018093_393_989 | 198 |
| 778 | 3300046475 | Ga0495639_0125139 | Ga0495639_0125139_339_935 | 198 |
| 779 | 3300046491 | Ga0495584_0202124 | Ga0495584_0202124_385_984 | 198 |
| 780 | 3300046499 | Ga0495594_0036571 | Ga0495594_0036571_275_871 | 198 |
| 781 | 3300046523 | Ga0495644_0064411 | Ga0495644_0064411_13_609 | 198 |
| 782 | 3300046525 | Ga0495663_0010629 | Ga0495663_0010629_1600_2196 | 198 |
| 783 | 3300046528 | Ga0495642_0038728 | Ga0495642_0038728_267_863 | 198 |
| 784 | 3300046538 | Ga0495609_0011309 | Ga0495609_0011309_525_1121 | 198 |
| 785 | 3300046538 | Ga0495609_0045100 | Ga0495609_0045100_619_1215 | 198 |
| 786 | 3300046539 | Ga0495621_0007990 | Ga0495621_0007990_988_1584 | 198 |
| 787 | 3300046664 | Ga0495659_0011488 | Ga0495659_0011488_1806_2405 | 198 |
| 788 | 3300046664 | Ga0495659_0018068 | Ga0495659_0018068_691_1287 | 198 |
| 789 | 3300046674 | Ga0495588_0003424 | Ga0495588_0003424_2096_2692 | 198 |
| 790 | 3300046684 | Ga0495669_0053312 | Ga0495669_0053312_637_1233 | 198 |
| 791 | 3300047315 | Ga0495581_0301604 | Ga0495581_0301604_51_647 | 198 |
| 792 | 3300047318 | Ga0495636_0046260 | Ga0495636_0046260_932_1528 | 198 |
| 793 | 3300047445 | Ga0495677_0122412 | Ga0495677_0122412_14_610 | 198 |
| 794 | 3300050507 | nmdc:mga05p37_29455_c1 | nmdc:mga05p37_29455_c1_995_1591 | 198 |
| 795 | 3300050507 | nmdc:mga05p37_3200_c1 | nmdc:mga05p37_3200_c1_16370_16966 | 198 |
| 796 | 3300050508 | nmdc:mga09592_53166_c1 | nmdc:mga09592_53166_c1_1452_2048 | 198 |
| 797 | 3300050512 | nmdc:mga0n895_124172_c1 | nmdc:mga0n895_124172_c1_1611_2213 | 198 |
| 798 | 3300050512 | nmdc:mga0n895_12827_c1 | nmdc:mga0n895_12827_c1_5275_5874 | 198 |
| 799 | 3300050512 | nmdc:mga0n895_79858_c1 | nmdc:mga0n895_79858_c1_820_1416 | 198 |
| 800 | 3300050512 | nmdc:mga0n895_83290_c1 | nmdc:mga0n895_83290_c1_1953_2549 | 198 |
| 801 | 3300050513 | nmdc:mga0rr50_40872_c1 | nmdc:mga0rr50_40872_c1_1832_2428 | 198 |
| 802 | 3300050514 | nmdc:mga08x19_226369_c1 | nmdc:mga08x19_226369_c1_369_968 | 198 |
| 803 | 3300050515 | nmdc:mga0a205_263306_c1 | nmdc:mga0a205_263306_c1_806_1402 | 198 |
| 804 | 3300053093 | Ga0500651_0401240 | Ga0500651_0401240_96_743 | 198 |
| 805 | 2162886007 | SwRhRL2b_contig_3191446 | SwRhRL2b_0728.00001230 | 199 |
| 806 | 3300004798 | Ga0058859_11536937 | Ga0058859_115369372 | 199 |
| 807 | 3300005289 | Ga0065704_10006314 | Ga0065704_100063142 | 199 |
| 808 | 3300005295 | Ga0065707_10170922 | Ga0065707_101709222 | 199 |
| 809 | 3300005328 | Ga0070676_10041159 | Ga0070676_100411592 | 199 |
| 810 | 3300005329 | Ga0070683_100131398 | Ga0070683_1001313983 | 199 |
| 811 | 3300005338 | Ga0068868_100048250 | Ga0068868_1000482504 | 199 |
| 812 | 3300005340 | Ga0070689_100024531 | Ga0070689_1000245314 | 199 |
| 813 | 3300005343 | Ga0070687_100086576 | Ga0070687_1000865762 | 199 |
| 814 | 3300005345 | Ga0070692_10123101 | Ga0070692_101231012 | 199 |
| 815 | 3300005347 | Ga0070668_100207349 | Ga0070668_1002073492 | 199 |
| 816 | 3300005353 | Ga0070669_100000739 | Ga0070669_1000007394 | 199 |
| 817 | 3300005354 | Ga0070675_100016495 | Ga0070675_1000164953 | 199 |
| 818 | 3300005354 | Ga0070675_100042883 | Ga0070675_1000428833 | 199 |
| 819 | 3300005355 | Ga0070671_100009287 | Ga0070671_1000092876 | 199 |
| 820 | 3300005364 | Ga0070673_100042483 | Ga0070673_1000424834 | 199 |
| 821 | 3300005364 | Ga0070673_100100450 | Ga0070673_1001004502 | 199 |
| 822 | 3300005364 | Ga0070673_100337992 | Ga0070673_1003379921 | 199 |
| 823 | 3300005365 | Ga0070688_100209893 | Ga0070688_1002098932 | 199 |
| 824 | 3300005365 | Ga0070688_100320041 | Ga0070688_1003200411 | 199 |
| 825 | 3300005366 | Ga0070659_100254578 | Ga0070659_1002545782 | 199 |
| 826 | 3300005438 | Ga0070701_10162217 | Ga0070701_101622172 | 199 |
| 827 | 3300005441 | Ga0070700_100159230 | Ga0070700_1001592302 | 199 |
| 828 | 3300005441 | Ga0070700_100162458 | Ga0070700_1001624582 | 199 |
| 829 | 3300005444 | Ga0070694_100020944 | Ga0070694_1000209442 | 199 |
| 830 | 3300005445 | Ga0070708_100103908 | Ga0070708_1001039082 | 199 |
| 831 | 3300005456 | Ga0070678_100497830 | Ga0070678_1004978302 | 199 |
| 832 | 3300005457 | Ga0070662_100049570 | Ga0070662_1000495703 | 199 |
| 833 | 3300005459 | Ga0068867_100004387 | Ga0068867_1000043873 | 199 |
| 834 | 3300005468 | Ga0070707_100292258 | Ga0070707_1002922582 | 199 |
| 835 | 3300005518 | Ga0070699_100010154 | Ga0070699_1000101545 | 199 |
| 836 | 3300005518 | Ga0070699_100093669 | Ga0070699_1000936692 | 199 |
| 837 | 3300005535 | Ga0070684_100145024 | Ga0070684_1001450242 | 199 |
| 838 | 3300005535 | Ga0070684_100967251 | Ga0070684_1009672511 | 199 |
| 839 | 3300005543 | Ga0070672_100026908 | Ga0070672_1000269082 | 199 |
| 840 | 3300005547 | Ga0070693_100206583 | Ga0070693_1002065832 | 199 |
| 841 | 3300005549 | Ga0070704_100009010 | Ga0070704_1000090104 | 199 |
| 842 | 3300005564 | Ga0070664_100017923 | Ga0070664_1000179235 | 199 |
| 843 | 3300005564 | Ga0070664_100195777 | Ga0070664_1001957773 | 199 |
| 844 | 3300005577 | Ga0068857_100181138 | Ga0068857_1001811383 | 199 |
| 845 | 3300005615 | Ga0070702_100785834 | Ga0070702_1007858341 | 199 |
| 846 | 3300005616 | Ga0068852_100902266 | Ga0068852_1009022662 | 199 |
| 847 | 3300005617 | Ga0068859_100001226 | Ga0068859_10000122621 | 199 |
| 848 | 3300005617 | Ga0068859_100024635 | Ga0068859_1000246355 | 199 |
| 849 | 3300005618 | Ga0068864_100532627 | Ga0068864_1005326272 | 199 |
| 850 | 3300005719 | Ga0068861_100063286 | Ga0068861_1000632863 | 199 |
| 851 | 3300005840 | Ga0068870_10025333 | Ga0068870_100253334 | 199 |
| 852 | 3300005841 | Ga0068863_100120170 | Ga0068863_1001201703 | 199 |
| 853 | 3300005842 | Ga0068858_100503947 | Ga0068858_1005039472 | 199 |
| 854 | 3300005843 | Ga0068860_100027637 | Ga0068860_1000276373 | 199 |
| 855 | 3300005844 | Ga0068862_100000936 | Ga0068862_10000093619 | 199 |
| 856 | 3300006237 | Ga0097621_100072507 | Ga0097621_1000725074 | 199 |
| 857 | 3300006358 | Ga0068871_100180774 | Ga0068871_1001807742 | 199 |
| 858 | 3300006871 | Ga0075434_100110147 | Ga0075434_1001101473 | 199 |
| 859 | 3300006931 | Ga0097620_100001226 | Ga0097620_10000122621 | 199 |
| 860 | 3300006931 | Ga0097620_100024635 | Ga0097620_1000246355 | 199 |
| 861 | 3300006931 | Ga0097620_100916332 | Ga0097620_1009163322 | 199 |
| 862 | 3300009094 | Ga0111539_10837248 | Ga0111539_108372482 | 199 |
| 863 | 3300009098 | Ga0105245_10234186 | Ga0105245_102341863 | 199 |
| 864 | 3300009148 | Ga0105243_10245147 | Ga0105243_102451472 | 199 |
| 865 | 3300009545 | Ga0105237_10000625 | Ga0105237_100006258 | 199 |
| 866 | 3300009551 | Ga0105238_10793592 | Ga0105238_107935922 | 199 |
| 867 | 3300009553 | Ga0105249_10137269 | Ga0105249_101372693 | 199 |
| 868 | 3300010375 | Ga0105239_10000051 | Ga0105239_1000005199 | 199 |
| 869 | 3300013102 | Ga0157371_10415875 | Ga0157371_104158752 | 199 |
| 870 | 3300013296 | Ga0157374_11027975 | Ga0157374_110279752 | 199 |
| 871 | 3300013297 | Ga0157378_10050050 | Ga0157378_100500502 | 199 |
| 872 | 3300013306 | Ga0163162_10276181 | Ga0163162_102761813 | 199 |
| 873 | 3300014326 | Ga0157380_10106642 | Ga0157380_101066422 | 199 |
| 874 | 3300014745 | Ga0157377_10024992 | Ga0157377_100249924 | 199 |
| 875 | 3300025893 | Ga0207682_10089870 | Ga0207682_100898702 | 199 |
| 876 | 3300025901 | Ga0207688_10157069 | Ga0207688_101570692 | 199 |
| 877 | 3300025903 | Ga0207680_10073954 | Ga0207680_100739543 | 199 |
| 878 | 3300025907 | Ga0207645_10062098 | Ga0207645_100620983 | 199 |
| 879 | 3300025908 | Ga0207643_10079325 | Ga0207643_100793252 | 199 |
| 880 | 3300025910 | Ga0207684_10511862 | Ga0207684_105118622 | 199 |
| 881 | 3300025913 | Ga0207695_10005372 | Ga0207695_1000537214 | 199 |
| 882 | 3300025914 | Ga0207671_10009150 | Ga0207671_100091508 | 199 |
| 883 | 3300025918 | Ga0207662_10005398 | Ga0207662_100053984 | 199 |
| 884 | 3300025923 | Ga0207681_10013395 | Ga0207681_100133955 | 199 |
| 885 | 3300025924 | Ga0207694_10100547 | Ga0207694_101005472 | 199 |
| 886 | 3300025925 | Ga0207650_10057766 | Ga0207650_100577663 | 199 |
| 887 | 3300025926 | Ga0207659_10000497 | Ga0207659_100004975 | 199 |
| 888 | 3300025926 | Ga0207659_10220900 | Ga0207659_102209002 | 199 |
| 889 | 3300025931 | Ga0207644_10206425 | Ga0207644_102064252 | 199 |
| 890 | 3300025931 | Ga0207644_10299538 | Ga0207644_102995382 | 199 |
| 891 | 3300025932 | Ga0207690_10314710 | Ga0207690_103147102 | 199 |
| 892 | 3300025933 | Ga0207706_10020119 | Ga0207706_100201195 | 199 |
| 893 | 3300025935 | Ga0207709_10120339 | Ga0207709_101203392 | 199 |
| 894 | 3300025936 | Ga0207670_10011914 | Ga0207670_100119143 | 199 |
| 895 | 3300025936 | Ga0207670_10016160 | Ga0207670_100161603 | 199 |
| 896 | 3300025938 | Ga0207704_10056227 | Ga0207704_100562273 | 199 |
| 897 | 3300025940 | Ga0207691_10036125 | Ga0207691_100361254 | 199 |
| 898 | 3300025940 | Ga0207691_10058161 | Ga0207691_100581614 | 199 |
| 899 | 3300025944 | Ga0207661_10311469 | Ga0207661_103114692 | 199 |
| 900 | 3300025945 | Ga0207679_10049021 | Ga0207679_100490212 | 199 |
| 901 | 3300025945 | Ga0207679_10171460 | Ga0207679_101714602 | 199 |
| 902 | 3300025960 | Ga0207651_10056533 | Ga0207651_100565333 | 199 |
| 903 | 3300025960 | Ga0207651_10089913 | Ga0207651_100899133 | 199 |
| 904 | 3300025960 | Ga0207651_10355018 | Ga0207651_103550182 | 199 |
| 905 | 3300025961 | Ga0207712_10420068 | Ga0207712_104200682 | 199 |
| 906 | 3300025981 | Ga0207640_10053345 | Ga0207640_100533452 | 199 |
| 907 | 3300026023 | Ga0207677_10236452 | Ga0207677_102364521 | 199 |
| 908 | 3300026035 | Ga0207703_10049396 | Ga0207703_100493963 | 199 |
| 909 | 3300026075 | Ga0207708_10011323 | Ga0207708_100113233 | 199 |
| 910 | 3300026075 | Ga0207708_10043409 | Ga0207708_100434093 | 199 |
| 911 | 3300026088 | Ga0207641_10058519 | Ga0207641_100585193 | 199 |
| 912 | 3300026088 | Ga0207641_10097219 | Ga0207641_100972193 | 199 |
| 913 | 3300026089 | Ga0207648_10004952 | Ga0207648_100049525 | 199 |
| 914 | 3300026116 | Ga0207674_10094210 | Ga0207674_100942103 | 199 |
| 915 | 3300026118 | Ga0207675_100084083 | Ga0207675_1000840834 | 199 |
| 916 | 3300026118 | Ga0207675_100090295 | Ga0207675_1000902952 | 199 |
| 917 | 3300026121 | Ga0207683_10401211 | Ga0207683_104012112 | 199 |
| 918 | 3300027907 | Ga0207428_10009987 | Ga0207428_100099874 | 199 |
| 919 | 3300028380 | Ga0268265_10000768 | Ga0268265_1000076830 | 199 |
| 920 | 3300028381 | Ga0268264_10032877 | Ga0268264_100328774 | 199 |
| 921 | 3300035085 | Ga0373929_0073281 | Ga0373929_0073281_199_813 | 199 |
| 922 | 3300035090 | Ga0373949_0062784 | Ga0373949_0062784_77_676 | 199 |
| 923 | 3300035114 | Ga0373939_0174765 | Ga0373939_0174765_122_721 | 199 |
| 924 | 3300035115 | Ga0373941_0019206 | Ga0373941_0019206_1244_1843 | 199 |
| 925 | 3300036401 | Ga0373937_0102121 | Ga0373937_0102121_1689_2288 | 199 |
| 926 | 3300037068 | Ga0373925_0711148 | Ga0373925_0711148_211_810 | 199 |
| 927 | 3300046454 | Ga0495592_0051211 | Ga0495592_0051211_1643_2323 | 199 |
| 928 | 3300046492 | Ga0495585_0171718 | Ga0495585_0171718_459_1058 | 199 |
| 929 | 3300046531 | Ga0495665_0032907 | Ga0495665_0032907_1098_1697 | 199 |
| 930 | 3300046537 | Ga0495598_0091776 | Ga0495598_0091776_13_612 | 199 |
| 931 | 3300046539 | Ga0495621_0072735 | Ga0495621_0072735_95_694 | 199 |
| 932 | 3300046558 | Ga0495633_0131984 | Ga0495633_0131984_205_804 | 199 |
| 933 | 3300046664 | Ga0495659_0097492 | Ga0495659_0097492_509_1108 | 199 |
| 934 | 3300046684 | Ga0495669_0049257 | Ga0495669_0049257_984_1583 | 199 |
| 935 | 3300046689 | Ga0495613_0498716 | Ga0495613_0498716_55_654 | 199 |
| 936 | 3300047445 | Ga0495677_0049783 | Ga0495677_0049783_213_812 | 199 |
| 937 | 3300048909 | Ga0496106_0191994 | Ga0496106_0191994_955_1554 | 199 |
| 938 | 3300048921 | Ga0496118_0036898 | Ga0496118_0036898_2231_2881 | 199 |
| 939 | 3300048924 | Ga0496121_0002262 | Ga0496121_0002262_3561_4211 | 199 |
| 940 | 3300050508 | nmdc:mga09592_118522_c1 | nmdc:mga09592_118522_c1_315_914 | 199 |
| 941 | 3300050512 | nmdc:mga0n895_58375_c1 | nmdc:mga0n895_58375_c1_2485_3084 | 199 |
| 942 | 3300050513 | nmdc:mga0rr50_304312_c1 | nmdc:mga0rr50_304312_c1_541_1143 | 199 |
| 943 | 3300053148 | Ga0500590_001674 | Ga0500590_001674_6531_7211 | 199 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1lr5-assembly2.cif.gz_B | crystal structure of auxin binding protein | 0.9122 | 52 | 158 |
| 6a55-assembly1.cif.gz_B | crystal structure of dddk mutant y122a | 0.8946 | 60 | 155 |
| 3fjs-assembly2.cif.gz_D | crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution | 0.8887 | 68 | 156 |
| 6a54-assembly1.cif.gz_A | crystal structure of dddk mutant y64a | 0.8871 | 60 | 155 |
| 2vqa-assembly1.cif.gz_C | protein-folding location can regulate mn versus cu- or zn-binding. crystal structure of mnca. | 0.887 | 62 | 155 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_E7FAC3_1039_1126_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9361 | 66 | 157 | 2.60.120.10 |
| af_P17410_9_96_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9232 | 82 | 155 | 2.60.120.10 |
| af_E7FAC3_1039_1126_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.916 | 66 | 157 | 2.60.120.10 |
| 3es1A02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9083 | 82 | 156 | 2.60.120.10 |
| af_Q03188_852_942_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9069 | 62 | 157 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A074MAW6-F1-model_v4 | Cupin type-2 domain-containing protein | 0.9511 | 79 | 156 |
GO:0016020
|
| AF-A0A6L5FBW2-F1-model_v4 | Cupin domain-containing protein | 0.9461 | 66 | 156 |
|
| AF-A6EYW0-F1-model_v4 | Gentisate 1,2-dioxygenase | 0.9414 | 46 | 189 |
GO:0051213
|
| AF-A0A4Y6KTB6-F1-model_v4 | Auxin-binding protein 1 | 0.9378 | 52 | 156 |
GO:0009734
GO:0009826 GO:0010011 GO:0032877 GO:0045793 GO:0051781 |
| AF-A0A7C3NJF9-F1-model_v4 | Cupin domain-containing protein | 0.9365 | 49 | 191 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar