F486362

General Info

Members Datasets Scaffolds Average Seq Length
942 492 868 465

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10246668|Ga0207648_102466682
Length 424
Sequence MAGQYRTEKDTFGPIEVPAGRLWGAQTQRSLEHFRISGERMPAELVRALVEKADAIVAAADEVLAGRWPDEFPLVVWQTGSGTQTNMNANEVLANRASELLGGARGEGRLVHPNDDVNRSQSSNDIFPTAMNVAAVVAMRERVLPALARLRDTLRAKAEASADVVKIGRTHLQDATPLTLGHEISGYVAQLAHELAAGGTAVGTGLNAPVEFGARVAAELASRLGHPFVTAPNKFEALAAHDALTKIANDVRLLSSGPRSGLAEITIPENEPGSSIMPGKVNPTQCEALTMCACQVMGNDAAVNIGGSQGHFELNVFKPVIAHGFLQSVRLLGDGMQSFEEHCVRGIEPNRERIDELVGRSLMLVTALAPKIGYDKSAAIAKKAHKEGTTLREAALALRYVTAAEYDEWVRAEDMVGNSSRKKG

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
4 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
5 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
6 2547132374 Acidovorax radicis N35 Isolate Unclassified
7 2547132512 Azospira oryzae 6a3 Isolate Unclassified
8 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
9 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
10 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
11 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
12 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
13 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
14 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
15 2643221569 Achromobacter sp. Root565 Isolate Unclassified
16 2643221594 Achromobacter sp. Root170 Isolate Unclassified
17 2643221609 Acidovorax sp. Root217 Isolate Unclassified
18 2643221611 Acidovorax sp. Root219 Isolate Unclassified
19 2643221621 Achromobacter sp. Root83 Isolate Unclassified
20 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
21 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
22 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
23 2643221651 Afipia sp. Root123D2 Isolate Unclassified
24 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
25 2643221658 Variovorax sp. Root411 Isolate Unclassified
26 2643221660 Methylibium sp. Root1272 Isolate Unclassified
27 2643221672 Variovorax sp. Root434 Isolate Unclassified
28 2643221717 Acidovorax sp. Root267 Isolate Unclassified
29 2738541277 Variovorax sp. GV051 Isolate Unclassified
30 2738541307 Variovorax sp. GV008 Isolate Unclassified
31 2738541337 Pelomonas sp. BT06 Isolate Unclassified
32 2738543012 Acidovorax sp. CF301 Isolate Unclassified
33 2738543019 Variovorax sp. GV040 Isolate Unclassified
34 2773857925 Microvirga vignae BR3299 Isolate Unclassified
35 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
36 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
37 2816332133 Acidovorax radicis 2721A Isolate Unclassified
38 2818991446 Variovorax sp. 1180 Isolate Unclassified
39 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
40 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
41 2842677519 Variovorax sp. R-72495 Isolate Unclassified
42 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
43 2842733646 Variovorax sp. R-72446 Isolate Unclassified
44 2842747753 Variovorax sp. R-72060 Isolate Unclassified
45 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
46 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
47 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
48 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
49 2885198086 Variovorax sp. 679 Isolate Unclassified
50 2885211737 Variovorax sp. 553 Isolate Unclassified
51 2885266251 Ralstonia sp. SET104 Isolate Nodule
52 2899924645 Variovorax sp. 369 Isolate Unclassified
53 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
54 2904456579 Variovorax sp. 2002 Isolate Unclassified
55 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
56 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
57 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
58 2919476304 Duganella sp. 3397 Isolate Unclassified
59 2928037797 Variovorax sp. 1126 Isolate Unclassified
60 2928044640 Variovorax sp. 1128 Isolate Unclassified
61 2928051484 Variovorax sp. 1133 Isolate Unclassified
62 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
63 2928070936 Variovorax gossypii 1167 Isolate Unclassified
64 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
65 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
66 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
67 2929520902 Variovorax beijingensis 502 Isolate Unclassified
68 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
69 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
70 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
71 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
72 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
73 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
74 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
75 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
76 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
77 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
78 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
79 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
80 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
81 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
82 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
83 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
84 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
85 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
86 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
87 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
88 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
89 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
90 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
91 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
92 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
93 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
94 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
95 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
96 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
97 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
98 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
99 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
100 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
101 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
102 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
103 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
104 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
105 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
106 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
107 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
108 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
109 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
110 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
111 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
112 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
113 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
114 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
115 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
116 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
117 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
118 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
119 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
120 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
121 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
122 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
123 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
124 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
125 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
126 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
127 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
128 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
129 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
130 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
131 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
132 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
133 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
134 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
135 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
136 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
137 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
138 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
139 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
140 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
141 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
142 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
143 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
144 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
145 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
146 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
147 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
148 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
149 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
150 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
151 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
152 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
153 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
154 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
155 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
156 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
157 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
158 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
159 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
160 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
161 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
162 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
163 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
164 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
165 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
166 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
167 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
168 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
169 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
170 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
171 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
172 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
173 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
174 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
175 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
176 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
177 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
178 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
179 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
180 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
181 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
182 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
183 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
184 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
185 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
186 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
187 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
188 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
189 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
190 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
191 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
192 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
193 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
194 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
195 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
196 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
197 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
198 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
199 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
200 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
201 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
202 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
203 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
204 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
205 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
206 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
207 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
208 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
209 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
210 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
211 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
212 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
214 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
215 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
222 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
224 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
225 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
226 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
229 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
230 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
231 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
233 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
234 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
235 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
237 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
238 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
239 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
241 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
242 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
244 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
290 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
292 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
293 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
294 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
295 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
296 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
297 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
298 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
299 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
300 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
301 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
302 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
303 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
304 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
305 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
306 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
307 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
308 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
309 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
310 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
311 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
312 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
313 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
314 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
315 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
316 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
317 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
318 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
319 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
320 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
321 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
322 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
323 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
324 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
325 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
326 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
327 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
328 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
329 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
330 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
331 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
332 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
333 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
334 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
335 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
336 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
337 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
338 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
339 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
340 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
341 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
342 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
343 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
344 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
345 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
346 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
347 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
348 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
349 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
350 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
351 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
352 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
353 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
354 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
355 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
356 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
357 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
358 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
359 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
360 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
361 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
362 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
363 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
364 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
365 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
366 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
367 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
368 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
369 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
370 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
371 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
372 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
373 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
374 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
375 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
376 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
377 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
378 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
379 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
380 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
381 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
382 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
383 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
384 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
385 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
386 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
387 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
388 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
389 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
390 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
391 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
392 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
393 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
394 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
395 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
396 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
397 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
398 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
399 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
400 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
401 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
402 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
403 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
404 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
405 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
406 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
407 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
408 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
409 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
410 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
411 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
412 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
413 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
414 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
415 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
416 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
417 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
418 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
419 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
420 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
421 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
422 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
423 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
424 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
425 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
426 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
427 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
428 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
429 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
430 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
431 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
432 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
433 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
434 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
435 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
436 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
437 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
438 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
439 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
440 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
443 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
444 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
445 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
446 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
447 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
448 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
449 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
450 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
451 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
452 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
453 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
454 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
455 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
456 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
457 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
458 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
459 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
460 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
461 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
462 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
463 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
464 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
465 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
466 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
467 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
468 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
469 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
470 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
471 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
472 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
473 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
474 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
475 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
476 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
477 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
478 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
479 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
480 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
481 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
482 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
483 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
484 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
485 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
486 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
487 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
488 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
489 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
490 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
492 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.93
Metatranscriptomes 0.21
Isolates 7.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.87
Nodule 0.64
Rhizoplane 2.87
Rhizosphere 63.27
Stem 0
Stem Tuber 0
Unclassified 11.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000804 3300001915 Bacteria 9427
2 JGI24740J21852_10000278 3300001979 Bacteria 21674
3 JGI24740J21852_10001064 3300001979 Bacteria 12359
4 JGI25155J39150_1000008 3300002704 Bacteria 236146
5 JGI25156J39149_1000002 3300002705 Bacteria 343501
6 JGI25156J39149_1012444 3300002705 Bacteria 1869
7 JGI25156J39149_1012868 3300002705 Bacteria 1811
8 JGI25154J39366_1000010 3300002738 Bacteria 297985
9 JGI25154J39366_1000110 3300002738 Bacteria 71731
10 JGI25154J39366_1003035 3300002738 Bacteria 3810
11 JGI25157J39369_1000001 3300002741 Bacteria 363277
12 JGI25157J39369_1000015 3300002741 Bacteria 194042
13 JGI25150J39212_1003709 3300002774 Bacteria 3529
14 JGI25159J45721_1001031 3300002987 Bacteria 11936
15 JGI25159J45721_1003729 3300002987 Bacteria 5278
16 JGI25151J46595_10007117 3300003187 Bacteria 5518
17 JGI25160J50197_1000301 3300003354 Bacteria 34898
18 JGI25161J50226_1000043 3300003374 Bacteria 120741
19 JGI25161J50226_1004540 3300003374 Bacteria 2889
20 Ga0055538_1002482 3300003751 Bacteria 2685
21 Ga0055538_1002934 3300003751 Bacteria 2309
22 Ga0055539_1000075 3300003752 Bacteria 130079
23 Ga0055539_1000170 3300003752 Bacteria 57928
24 Ga0055539_1001228 3300003752 Bacteria 5157
25 Ga0055533_1000010 3300003756 Bacteria 491196
26 Ga0055533_1001222 3300003756 Bacteria 7141
27 Ga0055533_1002231 3300003756 Bacteria 4552
28 Ga0055533_1002410 3300003756 Bacteria 4260
29 Ga0055532_1000056 3300003758 Bacteria 158878
30 Ga0055525_1000363 3300003759 Bacteria 30516
31 Ga0055525_1001192 3300003759 Bacteria 5838
32 Ga0055535_1000013 3300003761 Bacteria 299614
33 Ga0055535_1000263 3300003761 Bacteria 55363
34 Ga0055542_1000004 3300003762 Bacteria 553532
35 Ga0055542_1001053 3300003762 Bacteria 17140
36 Ga0055529_1000074 3300003763 Bacteria 158872
37 Ga0055529_1000303 3300003763 Bacteria 56663
38 Ga0055526_1004895 3300003771 Bacteria 7886
39 Ga0055537_1000479 3300003773 Bacteria 25018
40 Ga0055537_1001694 3300003773 Bacteria 8165
41 Ga0055524_1000130 3300003775 Bacteria 88754
42 Ga0055536_1004820 3300003781 Bacteria 6750
43 Ga0055536_1005488 3300003781 Bacteria 6186
44 Ga0055536_1008676 3300003781 Bacteria 4323
45 Ga0055534_1001079 3300003784 Bacteria 11696
46 Ga0055534_1001759 3300003784 Bacteria 8165
47 Ga0055528_1000145 3300003790 Bacteria 58081
48 Ga0055528_1003313 3300003790 Bacteria 8165
49 Ga0055530_10000265 3300003791 Bacteria 47389
50 Ga0055530_10007868 3300003791 Bacteria 4389
51 Ga0055530_10013640 3300003791 Bacteria 2759
52 Ga0055530_10016000 3300003791 Bacteria 2418
53 Ga0055540_1000079 3300003792 Bacteria 112817
54 Ga0055540_1004516 3300003792 Bacteria 6231
55 Ga0055540_1005170 3300003792 Bacteria 5603
56 Ga0055531_10002186 3300003794 Bacteria 13339
57 Ga0055531_10006273 3300003794 Bacteria 6777
58 Ga0055541_1000278 3300003841 Bacteria 17679
59 Ga0055541_1002512 3300003841 Bacteria 3644
60 Ga0055543_1000805 3300004625 Bacteria 15454
61 Ga0065714_10004198 3300005288 Bacteria 5443
62 Ga0070676_10003870 3300005328 Bacteria 7863
63 Ga0070676_10056245 3300005328 Bacteria 2324
64 Ga0070683_100003533 3300005329 Bacteria 12724
65 Ga0070683_100119340 3300005329 Bacteria 2491
66 Ga0070690_100019559 3300005330 Bacteria 4113
67 Ga0070690_100067862 3300005330 Bacteria 2312
68 Ga0070670_100003950 3300005331 Bacteria 12373
69 Ga0070670_100004715 3300005331 Bacteria 11440
70 Ga0070670_100014050 3300005331 Bacteria 6868
71 Ga0070670_100149804 3300005331 Bacteria 2019
72 Ga0068869_100017109 3300005334 Bacteria 4907
73 Ga0068869_100058068 3300005334 Bacteria 2828
74 Ga0068869_100101671 3300005334 Bacteria 2175
75 Ga0070666_10003561 3300005335 Bacteria 9442
76 Ga0070666_10062188 3300005335 Bacteria 2529
77 Ga0070680_100006104 3300005336 Bacteria 9131
78 Ga0068868_100001107 3300005338 Bacteria 18443
79 Ga0068868_100002281 3300005338 Bacteria 13257
80 Ga0068868_100012489 3300005338 Bacteria 6211
81 Ga0068868_100068762 3300005338 Bacteria 2821
82 Ga0070660_100008902 3300005339 Bacteria 7037
83 Ga0070660_100071336 3300005339 Bacteria 2712
84 Ga0070689_100017673 3300005340 Bacteria 5244
85 Ga0070661_100000154 3300005344 Bacteria 56626
86 Ga0070661_100005559 3300005344 Bacteria 8688
87 Ga0070668_100062585 3300005347 Bacteria 2883
88 Ga0070669_100038621 3300005353 Bacteria 3466
89 Ga0070669_100175811 3300005353 Bacteria 1672
90 Ga0070675_100002327 3300005354 Bacteria 14133
91 Ga0070675_100055711 3300005354 Bacteria 3255
92 Ga0070675_100068410 3300005354 Bacteria 2940
93 Ga0070675_100079092 3300005354 Bacteria 2739
94 Ga0070675_100217010 3300005354 Bacteria 1664
95 Ga0070671_100003169 3300005355 Bacteria 12826
96 Ga0070671_100006639 3300005355 Bacteria 9248
97 Ga0070674_100012531 3300005356 Bacteria 5209
98 Ga0070674_100094518 3300005356 Bacteria 2165
99 Ga0070673_100004435 3300005364 Bacteria 8881
100 Ga0070673_100007098 3300005364 Bacteria 7356
101 Ga0070673_100141301 3300005364 Bacteria 2031
102 Ga0070688_100008223 3300005365 Bacteria 5654
103 Ga0070688_100011876 3300005365 Bacteria 4860
104 Ga0070659_100072608 3300005366 Bacteria 2738
105 Ga0070667_100002446 3300005367 Bacteria 16231
106 Ga0070667_100045319 3300005367 Bacteria 3697
107 Ga0070667_100049466 3300005367 Bacteria 3541
108 Ga0070667_100057059 3300005367 Bacteria 3299
109 Ga0070713_100000260 3300005436 Bacteria 34743
110 Ga0070701_10000785 3300005438 Bacteria 11356
111 Ga0070711_100049030 3300005439 Bacteria 2891
112 Ga0070700_100005781 3300005441 Bacteria 6564
113 Ga0070663_100000002 3300005455 Bacteria 298075
114 Ga0070663_100043557 3300005455 Bacteria 3159
115 Ga0070678_100002072 3300005456 Bacteria 10877
116 Ga0070678_100004119 3300005456 Bacteria 8191
117 Ga0070678_100123478 3300005456 Bacteria 2046
118 Ga0070662_100162058 3300005457 Bacteria 1750
119 Ga0070681_10060581 3300005458 Bacteria 3761
120 Ga0068867_100004890 3300005459 Bacteria 9431
121 Ga0068867_100008662 3300005459 Bacteria 7183
122 Ga0068867_100021092 3300005459 Bacteria 4646
123 Ga0068867_100026104 3300005459 Bacteria 4193
124 Ga0068867_100084636 3300005459 Bacteria 2396
125 Ga0070698_100192809 3300005471 Bacteria 1975
126 Ga0070679_100008378 3300005530 Bacteria 9727
127 Ga0070684_100047479 3300005535 Bacteria 3721
128 Ga0070684_100144926 3300005535 Bacteria 2149
129 Ga0068853_100119887 3300005539 Bacteria 2345
130 Ga0070672_100001173 3300005543 Bacteria 16022
131 Ga0070672_100011477 3300005543 Bacteria 6179
132 Ga0070672_100021015 3300005543 Bacteria 4772
133 Ga0070672_100109306 3300005543 Bacteria 2252
134 Ga0070696_100112285 3300005546 Bacteria 1964
135 Ga0070696_100161684 3300005546 Bacteria 1650
136 Ga0070693_100001943 3300005547 Bacteria 9464
137 Ga0070693_100080148 3300005547 Bacteria 1944
138 Ga0070704_100032829 3300005549 Bacteria 3505
139 Ga0068855_100008864 3300005563 Bacteria 12158
140 Ga0068855_100023596 3300005563 Bacteria 7367
141 Ga0068855_100032986 3300005563 Bacteria 6182
142 Ga0068855_100211745 3300005563 Bacteria 2177
143 Ga0070664_100000004 3300005564 Bacteria 298075
144 Ga0070664_100001898 3300005564 Bacteria 16789
145 Ga0070664_100021981 3300005564 Bacteria 5260
146 Ga0070664_100024552 3300005564 Bacteria 4987
147 Ga0070664_100075463 3300005564 Bacteria 2895
148 Ga0068857_100011891 3300005577 Bacteria 7571
149 Ga0068857_100114094 3300005577 Bacteria 2430
150 Ga0068854_100000007 3300005578 Bacteria 182830
151 Ga0068854_100019412 3300005578 Bacteria 4580
152 Ga0068854_100046118 3300005578 Bacteria 3102
153 Ga0068854_100049539 3300005578 Bacteria 3001
154 Ga0068856_100000105 3300005614 Bacteria 81780
155 Ga0068856_100003075 3300005614 Bacteria 17033
156 Ga0068856_100045672 3300005614 Bacteria 4314
157 Ga0068856_100062489 3300005614 Bacteria 3679
158 Ga0070702_100026225 3300005615 Bacteria 3129
159 Ga0068852_100000657 3300005616 Bacteria 22644
160 Ga0068852_100001399 3300005616 Bacteria 16231
161 Ga0068852_100046435 3300005616 Bacteria 3701
162 Ga0068852_100071851 3300005616 Bacteria 3040
163 Ga0068852_100086172 3300005616 Bacteria 2799
164 Ga0068852_100220107 3300005616 Bacteria 1805
165 Ga0068859_100040590 3300005617 Bacteria 4671
166 Ga0068859_100103867 3300005617 Bacteria 2900
167 Ga0068859_100215420 3300005617 Bacteria 2008
168 Ga0068864_100002769 3300005618 Bacteria 14470
169 Ga0068864_100014646 3300005618 Bacteria 6514
170 Ga0068861_100009167 3300005719 Bacteria 6824
171 Ga0068851_10002400 3300005834 Bacteria 8222
172 Ga0068851_10004032 3300005834 Bacteria 6591
173 Ga0068851_10013011 3300005834 Bacteria 3933
174 Ga0068851_10014932 3300005834 Bacteria 3694
175 Ga0068863_100038522 3300005841 Bacteria 4548
176 Ga0068863_100082128 3300005841 Bacteria 3053
177 Ga0068863_100091842 3300005841 Bacteria 2879
178 Ga0068858_100002093 3300005842 Bacteria 20270
179 Ga0068858_100002948 3300005842 Bacteria 17114
180 Ga0068858_100006154 3300005842 Bacteria 11707
181 Ga0068858_100024262 3300005842 Bacteria 5652
182 Ga0068860_100147079 3300005843 Bacteria 2267
183 Ga0081455_10072235 3300005937 Bacteria 2858
184 Ga0081540_1025348 3300005983 Bacteria 3415
185 Ga0081540_1028320 3300005983 Bacteria 3149
186 Ga0075365_10006297 3300006038 Bacteria 6515
187 Ga0075363_100008202 3300006048 Bacteria 4851
188 Ga0075363_100027756 3300006048 Bacteria 2905
189 Ga0075364_10043684 3300006051 Bacteria 2914
190 Ga0075432_10008307 3300006058 Bacteria 3541
191 Ga0075362_10005224 3300006177 Bacteria 4736
192 Ga0075362_10013155 3300006177 Bacteria 3305
193 Ga0075362_10024609 3300006177 Bacteria 2555
194 Ga0075367_10038654 3300006178 Bacteria 2779
195 Ga0075366_10002236 3300006195 Bacteria 9884
196 Ga0075366_10015544 3300006195 Bacteria 4365
197 Ga0075366_10026976 3300006195 Bacteria 3368
198 Ga0075366_10141961 3300006195 Bacteria 1452
199 Ga0097621_100003706 3300006237 Bacteria 10577
200 Ga0097621_100043803 3300006237 Bacteria 3609
201 Ga0075370_10001173 3300006353 Bacteria 11030
202 Ga0075370_10003518 3300006353 Bacteria 7469
203 Ga0075370_10006457 3300006353 Bacteria 5900
204 Ga0075370_10017583 3300006353 Bacteria 3865
205 Ga0075370_10038206 3300006353 Bacteria 2701
206 Ga0075370_10038706 3300006353 Bacteria 2684
207 Ga0075370_10047214 3300006353 Bacteria 2438
208 Ga0075370_10067516 3300006353 Bacteria 2041
209 Ga0075370_10109081 3300006353 Bacteria 1606
210 Ga0068871_100007836 3300006358 Bacteria 7651
211 Ga0068871_100010284 3300006358 Bacteria 6819
212 Ga0068871_100041229 3300006358 Bacteria 3701
213 Ga0068871_100142682 3300006358 Bacteria 2038
214 Ga0075428_100007264 3300006844 Bacteria 12269
215 Ga0075428_100027967 3300006844 Bacteria 6239
216 Ga0075428_100126167 3300006844 Bacteria 2785
217 Ga0075431_100017842 3300006847 Bacteria 7216
218 Ga0075433_10056526 3300006852 Bacteria 3427
219 Ga0075434_100017636 3300006871 Bacteria 6881
220 Ga0075434_100108235 3300006871 Bacteria 2790
221 Ga0068865_100023267 3300006881 Bacteria 4055
222 Ga0068865_100077489 3300006881 Bacteria 2376
223 Ga0075436_100002487 3300006914 Bacteria 12680
224 Ga0097620_100040590 3300006931 Bacteria 4671
225 Ga0097620_100103873 3300006931 Bacteria 2900
226 Ga0097620_100215428 3300006931 Bacteria 2008
227 Ga0099826_10013779 3300006948 Bacteria 6112
228 Ga0075435_100009943 3300007076 Bacteria 6928
229 Ga0075435_100106905 3300007076 Bacteria 2324
230 Ga0099794_10007301 3300007265 Bacteria 4531
231 Ga0105244_10013167 3300009036 Bacteria 4845
232 Ga0105240_10008549 3300009093 Bacteria 14630
233 Ga0105240_10013136 3300009093 Bacteria 11394
234 Ga0105240_10027970 3300009093 Bacteria 7374
235 Ga0105240_10047106 3300009093 Bacteria 5457
236 Ga0105240_10056972 3300009093 Bacteria 4886
237 Ga0105240_10072570 3300009093 Bacteria 4254
238 Ga0105240_10278239 3300009093 Bacteria 1923
239 Ga0111539_10003794 3300009094 Bacteria 19890
240 Ga0111539_10076735 3300009094 Bacteria 3934
241 Ga0105245_10015781 3300009098 Bacteria 6587
242 Ga0105245_10029552 3300009098 Bacteria 4844
243 Ga0114129_10000191 3300009147 Bacteria 69079
244 Ga0105243_10001633 3300009148 Bacteria 19478
245 Ga0105243_10094247 3300009148 Bacteria 2472
246 Ga0105243_10114106 3300009148 Bacteria 2267
247 Ga0105243_10175915 3300009148 Bacteria 1857
248 Ga0105241_10029165 3300009174 Bacteria 4114
249 Ga0105242_10011209 3300009176 Bacteria 6888
250 Ga0105242_10014042 3300009176 Bacteria 6198
251 Ga0105242_10018794 3300009176 Bacteria 5409
252 Ga0105242_10095363 3300009176 Bacteria 2511
253 Ga0105248_10035562 3300009177 Bacteria 5573
254 Ga0105248_10061334 3300009177 Bacteria 4222
255 Ga0105248_10231613 3300009177 Bacteria 2080
256 Ga0105237_10011535 3300009545 Bacteria 9346
257 Ga0105238_10094296 3300009551 Bacteria 2981
258 Ga0105238_10122429 3300009551 Bacteria 2580
259 Ga0105249_10286037 3300009553 Bacteria 1648
260 Ga0105239_10064425 3300010375 Bacteria 4023
261 Ga0105246_10095577 3300011119 Bacteria 2152
262 Ga0157326_1001558 3300012513 Bacteria 2513
263 Ga0157373_10010719 3300013100 Bacteria 6743
264 Ga0157371_10000223 3300013102 Bacteria 82671
265 Ga0157371_10027203 3300013102 Bacteria 4149
266 Ga0157370_10000074 3300013104 Bacteria 108622
267 Ga0157369_10001333 3300013105 Bacteria 30529
268 Ga0157369_10002601 3300013105 Bacteria 21597
269 Ga0157369_10042171 3300013105 Bacteria 4979
270 Ga0157369_10044657 3300013105 Bacteria 4821
271 Ga0157369_10124864 3300013105 Bacteria 2730
272 Ga0157374_10027309 3300013296 Bacteria 5145
273 Ga0157374_10087099 3300013296 Bacteria 2972
274 Ga0157374_10106087 3300013296 Bacteria 2699
275 Ga0157378_10104692 3300013297 Bacteria 2587
276 Ga0163162_10028421 3300013306 Bacteria 5533
277 Ga0163162_10057090 3300013306 Bacteria 3932
278 Ga0163162_10181338 3300013306 Bacteria 2232
279 Ga0157372_10000085 3300013307 Bacteria 96915
280 Ga0157372_10003798 3300013307 Bacteria 16216
281 Ga0157372_10189877 3300013307 Bacteria 2379
282 Ga0157372_10215889 3300013307 Bacteria 2223
283 Ga0157375_10017231 3300013308 Bacteria 6514
284 Ga0157375_10070595 3300013308 Bacteria 3503
285 Ga0157375_10306790 3300013308 Bacteria 1751
286 Ga0163163_10008501 3300014325 Bacteria 9123
287 Ga0157380_10084084 3300014326 Bacteria 2609
288 Ga0182008_10003393 3300014497 Bacteria 9644
289 Ga0182008_10005698 3300014497 Bacteria 7051
290 Ga0157377_10002089 3300014745 Bacteria 8780
291 Ga0157377_10013626 3300014745 Bacteria 4120
292 Ga0157379_10034664 3300014968 Bacteria 4500
293 Ga0157379_10043161 3300014968 Bacteria 4026
294 Ga0157379_10248816 3300014968 Bacteria 1613
295 Ga0157376_10122217 3300014969 Bacteria 2309
296 Ga0182006_1000867 3300015261 Bacteria 20300
297 Ga0182006_1003465 3300015261 Bacteria 8053
298 Ga0182007_10006348 3300015262 Bacteria 5083
299 Ga0182007_10027387 3300015262 Bacteria 1965
300 Ga0183362_10001 3300015683 Bacteria 2046624
301 Ga0163161_10001379 3300017792 Bacteria 18020
302 Ga0163161_10004878 3300017792 Bacteria 9346
303 Ga0154015_1416575 3300020610 Bacteria 9701
304 Ga0213872_10000029 3300021361 Bacteria 145850
305 Ga0213872_10000618 3300021361 Bacteria 26906
306 Ga0209435_100001 3300025206 Bacteria 1424171
307 Ga0209784_100008 3300025224 Bacteria 740293
308 Ga0209784_100500 3300025224 Bacteria 15408
309 Ga0209784_101272 3300025224 Bacteria 3684
310 Ga0209566_100006 3300025225 Bacteria 789272
311 Ga0209566_100280 3300025225 Bacteria 47182
312 Ga0209566_102291 3300025225 Bacteria 3702
313 Ga0209674_100003 3300025226 Bacteria 2196646
314 Ga0209674_100070 3300025226 Bacteria 242214
315 Ga0209674_100741 3300025226 Bacteria 11140
316 Ga0209672_100436 3300025228 Bacteria 23953
317 Ga0209672_101988 3300025228 Bacteria 5711
318 Ga0209672_102654 3300025228 Bacteria 4192
319 Ga0209147_100005 3300025229 Bacteria 1036530
320 Ga0209147_100541 3300025229 Bacteria 21608
321 Ga0209563_100010 3300025230 Bacteria 1337457
322 Ga0209563_100016 3300025230 Bacteria 802091
323 Ga0207427_100468 3300025231 Bacteria 22112
324 Ga0209258_100007 3300025242 Bacteria 1036530
325 Ga0209258_100022 3300025242 Bacteria 553584
326 Ga0209258_100163 3300025242 Bacteria 149677
327 Ga0209258_100903 3300025242 Bacteria 15270
328 Ga0207425_1001500 3300025245 Bacteria 9683
329 Ga0209646_1000001 3300025246 Bacteria 3092932
330 Ga0209646_1000016 3300025246 Bacteria 501688
331 Ga0209646_1000226 3300025246 Bacteria 60008
332 Ga0209026_1000001 3300025250 Bacteria 1228671
333 Ga0209026_1000021 3300025250 Bacteria 375165
334 Ga0209026_1001650 3300025250 Bacteria 9455
335 Ga0209677_100008 3300025253 Bacteria 802091
336 Ga0209677_100106 3300025253 Bacteria 89125
337 Ga0209677_100480 3300025253 Bacteria 22721
338 Ga0209148_1000034 3300025254 Bacteria 553584
339 Ga0209148_1000051 3300025254 Bacteria 401000
340 Ga0209759_1000001 3300025256 Bacteria 2799452
341 Ga0209759_1000025 3300025256 Bacteria 317082
342 Ga0209759_1000684 3300025256 Bacteria 30588
343 Ga0209759_1000939 3300025256 Bacteria 20977
344 Ga0209759_1001423 3300025256 Bacteria 13586
345 Ga0209759_1002409 3300025256 Bacteria 8224
346 Ga0209759_1019363 3300025256 Bacteria 1615
347 Ga0209129_1000023 3300025258 Bacteria 420646
348 Ga0209565_1000096 3300025263 Bacteria 134434
349 Ga0209565_1000288 3300025263 Bacteria 49295
350 Ga0209455_1000011 3300025272 Bacteria 947242
351 Ga0209455_1000059 3300025272 Bacteria 339995
352 Ga0209673_1000232 3300025273 Bacteria 108581
353 Ga0209673_1000838 3300025273 Bacteria 40184
354 Ga0209673_1004143 3300025273 Bacteria 7943
355 Ga0209673_1006206 3300025273 Bacteria 5834
356 Ga0209130_1000041 3300025284 Bacteria 261078
357 Ga0209130_1000113 3300025284 Bacteria 130804
358 Ga0209130_1000508 3300025284 Bacteria 39372
359 Ga0209130_1001465 3300025284 Bacteria 15515
360 Ga0209130_1002443 3300025284 Bacteria 9301
361 Ga0209130_1012728 3300025284 Bacteria 2184
362 Ga0209675_1000128 3300025291 Bacteria 103111
363 Ga0209675_1000276 3300025291 Bacteria 49295
364 Ga0209675_1002475 3300025291 Bacteria 9472
365 Ga0209675_1002568 3300025291 Bacteria 9212
366 Ga0209675_1003811 3300025291 Bacteria 6959
367 Ga0209676_1000005 3300025292 Bacteria 1076001
368 Ga0209676_1000054 3300025292 Bacteria 365890
369 Ga0209676_1000418 3300025292 Bacteria 75214
370 Ga0209676_1000705 3300025292 Bacteria 46561
371 Ga0209676_1003053 3300025292 Bacteria 10807
372 Ga0209025_1000531 3300025294 Bacteria 72578
373 Ga0209025_1001493 3300025294 Bacteria 30271
374 Ga0209025_1003884 3300025294 Bacteria 13507
375 Ga0209025_1006696 3300025294 Bacteria 8844
376 Ga0209025_1014270 3300025294 Bacteria 4906
377 Ga0209025_1016285 3300025294 Bacteria 4403
378 Ga0209025_1020721 3300025294 Bacteria 3576
379 Ga0209025_1053271 3300025294 Bacteria 1589
380 Ga0209564_1000394 3300025295 Bacteria 78197
381 Ga0209564_1000912 3300025295 Bacteria 38636
382 Ga0209564_1001098 3300025295 Bacteria 32197
383 Ga0209564_1009461 3300025295 Bacteria 4634
384 Ga0209564_1021392 3300025295 Bacteria 2328
385 Ga0209758_1000064 3300025297 Bacteria 311812
386 Ga0209758_1004529 3300025297 Bacteria 11503
387 Ga0209050_1000007 3300025298 Bacteria 1187891
388 Ga0209050_1000066 3300025298 Bacteria 305458
389 Ga0209050_1000570 3300025298 Bacteria 59779
390 Ga0209050_1000690 3300025298 Bacteria 50644
391 Ga0209050_1002949 3300025298 Bacteria 13300
392 Ga0209050_1016296 3300025298 Bacteria 3052
393 Ga0209050_1028547 3300025298 Bacteria 1807
394 Ga0209256_1000003 3300025299 Bacteria 1661127
395 Ga0209256_1000020 3300025299 Bacteria 542402
396 Ga0209256_1000577 3300025299 Bacteria 52302
397 Ga0209256_1017307 3300025299 Bacteria 2402
398 Ga0207426_1000001 3300025302 Bacteria 1341301
399 Ga0207426_1000031 3300025302 Bacteria 460699
400 Ga0207426_1000061 3300025302 Bacteria 362507
401 Ga0207426_1020654 3300025302 Bacteria 2286
402 Ga0209051_1000009 3300025303 Bacteria 706778
403 Ga0209051_1000044 3300025303 Bacteria 305458
404 Ga0209051_1000363 3300025303 Bacteria 66432
405 Ga0209051_1000385 3300025303 Bacteria 62270
406 Ga0209051_1000491 3300025303 Bacteria 51059
407 Ga0209051_1001856 3300025303 Bacteria 16643
408 Ga0209051_1001872 3300025303 Bacteria 16521
409 Ga0209051_1012913 3300025303 Bacteria 4009
410 Ga0209257_1000011 3300025304 Bacteria 1112630
411 Ga0209257_1000032 3300025304 Bacteria 680354
412 Ga0209257_1000055 3300025304 Bacteria 415534
413 Ga0209257_1000082 3300025304 Bacteria 305458
414 Ga0209257_1000502 3300025304 Bacteria 69204
415 Ga0209257_1007175 3300025304 Bacteria 6843
416 Ga0209257_1017587 3300025304 Bacteria 2805
417 Ga0207697_10073410 3300025315 Bacteria 1436
418 Ga0207656_10002382 3300025321 Bacteria 6320
419 Ga0207656_10002699 3300025321 Bacteria 6018
420 Ga0207655_1001588 3300025728 Bacteria 20387
421 Ga0207688_10031734 3300025901 Bacteria 2918
422 Ga0207688_10079934 3300025901 Bacteria 1866
423 Ga0207680_10002745 3300025903 Bacteria 8233
424 Ga0207645_10045934 3300025907 Bacteria 2790
425 Ga0207705_10022746 3300025909 Bacteria 4471
426 Ga0207705_10066011 3300025909 Bacteria 2617
427 Ga0207695_10001193 3300025913 Bacteria 44667
428 Ga0207695_10021707 3300025913 Bacteria 7317
429 Ga0207695_10053129 3300025913 Bacteria 4239
430 Ga0207695_10057592 3300025913 Bacteria 4036
431 Ga0207695_10111600 3300025913 Bacteria 2713
432 Ga0207695_10119697 3300025913 Bacteria 2603
433 Ga0207671_10111753 3300025914 Bacteria 2079
434 Ga0207663_10076611 3300025916 Bacteria 2174
435 Ga0207657_10078012 3300025919 Bacteria 2791
436 Ga0207657_10158475 3300025919 Bacteria 1839
437 Ga0207649_10000573 3300025920 Bacteria 25163
438 Ga0207649_10002026 3300025920 Bacteria 11523
439 Ga0207649_10016787 3300025920 Bacteria 4139
440 Ga0207694_10018078 3300025924 Bacteria 5329
441 Ga0207650_10001127 3300025925 Bacteria 19637
442 Ga0207650_10008883 3300025925 Bacteria 6865
443 Ga0207650_10056820 3300025925 Bacteria 2909
444 Ga0207650_10124999 3300025925 Bacteria 2007
445 Ga0207659_10000725 3300025926 Bacteria 19531
446 Ga0207659_10005217 3300025926 Bacteria 7864
447 Ga0207659_10007325 3300025926 Bacteria 6781
448 Ga0207659_10023175 3300025926 Bacteria 4141
449 Ga0207659_10029587 3300025926 Bacteria 3735
450 Ga0207687_10041114 3300025927 Bacteria 3173
451 Ga0207700_10000189 3300025928 Bacteria 36770
452 Ga0207644_10003511 3300025931 Bacteria 10148
453 Ga0207644_10008443 3300025931 Bacteria 6740
454 Ga0207644_10034969 3300025931 Bacteria 3518
455 Ga0207644_10047418 3300025931 Bacteria 3066
456 Ga0207644_10068715 3300025931 Bacteria 2585
457 Ga0207690_10016369 3300025932 Bacteria 4508
458 Ga0207690_10067507 3300025932 Bacteria 2453
459 Ga0207690_10073921 3300025932 Bacteria 2359
460 Ga0207706_10025633 3300025933 Bacteria 5282
461 Ga0207706_10128246 3300025933 Bacteria 2231
462 Ga0207686_10013089 3300025934 Bacteria 4581
463 Ga0207686_10063141 3300025934 Bacteria 2354
464 Ga0207686_10063988 3300025934 Bacteria 2341
465 Ga0207709_10001604 3300025935 Bacteria 15408
466 Ga0207709_10021990 3300025935 Bacteria 3614
467 Ga0207670_10019227 3300025936 Bacteria 4168
468 Ga0207670_10029754 3300025936 Bacteria 3482
469 Ga0207669_10007934 3300025937 Bacteria 4952
470 Ga0207691_10001444 3300025940 Bacteria 23682
471 Ga0207691_10002459 3300025940 Bacteria 18118
472 Ga0207691_10009240 3300025940 Bacteria 9460
473 Ga0207691_10010513 3300025940 Bacteria 8880
474 Ga0207691_10093396 3300025940 Bacteria 2694
475 Ga0207711_10008783 3300025941 Bacteria 8450
476 Ga0207711_10011843 3300025941 Bacteria 7247
477 Ga0207711_10129756 3300025941 Bacteria 2259
478 Ga0207689_10015681 3300025942 Bacteria 6416
479 Ga0207689_10097636 3300025942 Bacteria 2413
480 Ga0207661_10007156 3300025944 Bacteria 7926
481 Ga0207661_10092462 3300025944 Bacteria 2522
482 Ga0207679_10000002 3300025945 Bacteria 634491
483 Ga0207679_10001704 3300025945 Bacteria 13702
484 Ga0207679_10007132 3300025945 Bacteria 7080
485 Ga0207667_10004568 3300025949 Bacteria 16974
486 Ga0207667_10009460 3300025949 Bacteria 11475
487 Ga0207667_10061375 3300025949 Bacteria 3932
488 Ga0207651_10002950 3300025960 Bacteria 8227
489 Ga0207651_10004833 3300025960 Bacteria 6860
490 Ga0207640_10017885 3300025981 Bacteria 4155
491 Ga0207640_10018533 3300025981 Bacteria 4092
492 Ga0207640_10027293 3300025981 Bacteria 3477
493 Ga0207640_10086378 3300025981 Bacteria 2160
494 Ga0207658_10025926 3300025986 Bacteria 4107
495 Ga0207658_10052793 3300025986 Bacteria 3001
496 Ga0207677_10003064 3300026023 Bacteria 8834
497 Ga0207677_10008356 3300026023 Bacteria 5778
498 Ga0207677_10026784 3300026023 Bacteria 3621
499 Ga0207677_10030189 3300026023 Bacteria 3456
500 Ga0207703_10001773 3300026035 Bacteria 19268
501 Ga0207703_10012670 3300026035 Bacteria 6575
502 Ga0207678_10000003 3300026067 Bacteria 282716
503 Ga0207708_10067958 3300026075 Bacteria 2727
504 Ga0207702_10000010 3300026078 Bacteria 292789
505 Ga0207702_10000522 3300026078 Bacteria 43072
506 Ga0207702_10036919 3300026078 Bacteria 4087
507 Ga0207702_10099499 3300026078 Bacteria 2563
508 Ga0207702_10107674 3300026078 Bacteria 2472
509 Ga0207702_10118365 3300026078 Bacteria 2367
510 Ga0207641_10019102 3300026088 Bacteria 5621
511 Ga0207641_10036585 3300026088 Bacteria 4098
512 Ga0207641_10162307 3300026088 Bacteria 2033
513 Ga0207641_10190351 3300026088 Bacteria 1885
514 Ga0207641_10222677 3300026088 Bacteria 1750
515 Ga0207648_10019713 3300026089 Bacteria 6086
516 Ga0207648_10024255 3300026089 Bacteria 5417
517 Ga0207648_10067748 3300026089 Bacteria 3111
518 Ga0207648_10075838 3300026089 Bacteria 2931
519 Ga0207648_10160568 3300026089 Bacteria 1985
520 Ga0207648_10246668 3300026089 Bacteria 1592
521 Ga0207676_10001271 3300026095 Bacteria 18758
522 Ga0207676_10012287 3300026095 Bacteria 6130
523 Ga0207676_10020956 3300026095 Bacteria 4791
524 Ga0207676_10035333 3300026095 Bacteria 3792
525 Ga0207674_10023464 3300026116 Bacteria 6607
526 Ga0207674_10079210 3300026116 Bacteria 3290
527 Ga0207674_10107212 3300026116 Bacteria 2771
528 Ga0207674_10232195 3300026116 Bacteria 1792
529 Ga0207675_100018746 3300026118 Bacteria 6458
530 Ga0207675_100065898 3300026118 Bacteria 3385
531 Ga0207675_100079404 3300026118 Bacteria 3075
532 Ga0207675_100193442 3300026118 Bacteria 1952
533 Ga0207675_100267998 3300026118 Bacteria 1657
534 Ga0207683_10000838 3300026121 Bacteria 28142
535 Ga0207683_10005156 3300026121 Bacteria 11217
536 Ga0207683_10006290 3300026121 Bacteria 10176
537 Ga0207683_10015911 3300026121 Bacteria 6405
538 Ga0207683_10037520 3300026121 Bacteria 4220
539 Ga0207683_10039060 3300026121 Bacteria 4140
540 Ga0207683_10089575 3300026121 Bacteria 2739
541 Ga0207683_10129250 3300026121 Bacteria 2271
542 Ga0207698_10001250 3300026142 Bacteria 14873
543 Ga0207698_10009072 3300026142 Bacteria 6319
544 Ga0207698_10019512 3300026142 Bacteria 4643
545 Ga0207698_10052932 3300026142 Bacteria 3112
546 Ga0207698_10195860 3300026142 Bacteria 1805
547 Ga0207428_10001012 3300027907 Bacteria 31168
548 Ga0207428_10012148 3300027907 Bacteria 7579
549 Ga0268264_10137133 3300028381 Bacteria 2177
550 Ga0265337_1032774 3300028556 Bacteria 1536
551 Ga0265323_10003116 3300028653 Bacteria 7378
552 Ga0265323_10008205 3300028653 Bacteria 4319
553 Ga0265336_10000051 3300028666 Bacteria 114796
554 Ga0307515_10000028 3300028794 Bacteria 368467
555 Ga0307515_10000458 3300028794 Bacteria 97523
556 Ga0307515_10016545 3300028794 Bacteria 13496
557 Ga0307515_10048179 3300028794 Bacteria 6450
558 Ga0307515_10056923 3300028794 Bacteria 5670
559 Ga0307512_10055475 3300030522 Bacteria 3124
560 Ga0265325_10001972 3300031241 Bacteria 14131
561 Ga0265340_10000047 3300031247 Bacteria 55910
562 Ga0265331_10002871 3300031250 Bacteria 11392
563 Ga0265331_10031690 3300031250 Bacteria 2626
564 Ga0307513_10000021 3300031456 Bacteria 228078
565 Ga0307509_10000120 3300031507 Bacteria 114238
566 Ga0307509_10013526 3300031507 Bacteria 9654
567 Ga0307509_10060091 3300031507 Bacteria 4019
568 Ga0307509_10069501 3300031507 Bacteria 3681
569 Ga0307408_100000046 3300031548 Bacteria 167686
570 Ga0307408_100003007 3300031548 Bacteria 11658
571 Ga0307408_100047082 3300031548 Bacteria 3086
572 Ga0307408_100079883 3300031548 Bacteria 2442
573 Ga0307508_10000163 3300031616 Bacteria 80086
574 Ga0307508_10019292 3300031616 Bacteria 6200
575 Ga0307508_10023931 3300031616 Bacteria 5543
576 Ga0307514_10000828 3300031649 Bacteria 49982
577 Ga0307514_10046625 3300031649 Bacteria 3386
578 Ga0265314_10000007 3300031711 Bacteria 491737
579 Ga0265342_10001861 3300031712 Bacteria 19067
580 Ga0316576_10003935 3300031727 Bacteria 8816
581 Ga0307516_10018571 3300031730 Bacteria 7222
582 Ga0307516_10022115 3300031730 Bacteria 6534
583 Ga0307405_10049640 3300031731 Bacteria 2594
584 Ga0307413_10016958 3300031824 Bacteria 3781
585 Ga0307410_10056048 3300031852 Bacteria 2678
586 Ga0307406_10002339 3300031901 Bacteria 10300
587 Ga0307406_10008992 3300031901 Bacteria 5587
588 Ga0307406_10105266 3300031901 Bacteria 1930
589 Ga0307412_10000135 3300031911 Bacteria 53519
590 Ga0307412_10015988 3300031911 Bacteria 4459
591 Ga0307409_100010337 3300031995 Bacteria 5795
592 Ga0307416_100003363 3300032002 Bacteria 9368
593 Ga0307416_100017961 3300032002 Bacteria 4968
594 Ga0307416_100099633 3300032002 Bacteria 2524
595 Ga0307411_10011035 3300032005 Bacteria 4852
596 Ga0307411_10019119 3300032005 Bacteria 3948
597 Ga0307411_10040848 3300032005 Bacteria 2946
598 Ga0307415_100016744 3300032126 Bacteria 4378
599 Ga0307415_100023469 3300032126 Bacteria 3830
600 Ga0307510_10002394 3300033180 Bacteria 21269
601 Ga0307510_10018033 3300033180 Bacteria 8317
602 Ga0373926_0037748 3300035083 Bacteria 1719
603 Ga0373949_0004987 3300035090 Bacteria 2994
604 Ga0373923_0048720 3300035111 Bacteria 1770
605 Ga0373923_0067250 3300035111 Bacteria 1532
606 Ga0373939_0000139 3300035114 Bacteria 20747
607 Ga0373941_0013544 3300035115 Bacteria 2158
608 Ga0373945_0012903 3300035116 Bacteria 2783
609 Ga0373956_0000193 3300035119 Bacteria 23411
610 Ga0373931_0000908 3300035691 Bacteria 12513
611 Ga0373931_0004912 3300035691 Bacteria 6148
612 Ga0373927_0005732 3300035695 Bacteria 8531
613 Ga0373933_0000364 3300035724 Bacteria 28986
614 Ga0373937_0000182 3300036401 Bacteria 61628
615 Ga0373925_0045523 3300037068 Bacteria 3260
616 Ga0395899_0012470 3300037312 Bacteria 6511
617 Ga0395900_0003483 3300037418 Bacteria 16983
618 Ga0395898_0006685 3300037466 Bacteria 12296
619 Ga0395898_0010478 3300037466 Bacteria 9690
620 Ga0395905_0002802 3300037471 Bacteria 19102
621 Ga0395905_0018172 3300037471 Bacteria 6674
622 Ga0395905_0024518 3300037471 Bacteria 5692
623 Ga0395905_0029244 3300037471 Bacteria 5193
624 Ga0395905_0113031 3300037471 Bacteria 2551
625 Ga0395901_0015357 3300038443 Bacteria 7793
626 Ga0395901_0015454 3300038443 Bacteria 7773
627 Ga0395901_0022158 3300038443 Bacteria 6509
628 Ga0436361_0034352 3300039447 Bacteria 2194
629 Ga0436361_0625540 3300039447 Bacteria 4196
630 Ga0436363_0667407 3300039450 Bacteria 4068
631 Ga0439436_0007418 3300041404 Bacteria 3375
632 Ga0439436_0020373 3300041404 Bacteria 1975
633 Ga0451807_0675626 3300041486 Bacteria 9142
634 Ga0439445_0008291 3300042004 Bacteria 2429
635 Ga0439449_0008125 3300042007 Bacteria 3988
636 Ga0439449_0012578 3300042007 Bacteria 3183
637 Ga0439457_009413 3300042014 Bacteria 2275
638 Ga0450890_000536 3300042127 Bacteria 5601
639 Ga0450891_000192 3300042129 Bacteria 5988
640 Ga0439446_0019780 3300042156 Bacteria 1894
641 Ga0450893_0000214 3300042532 Bacteria 7709
642 Ga0451577_0000742 3300042876 Bacteria 50207
643 Ga0451577_0043187 3300042876 Bacteria 4038
644 Ga0451577_0085905 3300042876 Bacteria 2807
645 Ga0451577_0133455 3300042876 Bacteria 2228
646 Ga0466969_0000001 3300044656 Bacteria 189617
647 Ga0466969_0004528 3300044656 Bacteria 7398
648 Ga0466969_0016894 3300044656 Bacteria 3815
649 Ga0466972_0055407 3300044658 Bacteria 1907
650 Ga0466965_0004669 3300044683 Bacteria 6109
651 Ga0466966_0005235 3300044684 Bacteria 8527
652 Ga0466966_0006418 3300044684 Bacteria 7777
653 Ga0466961_0011024 3300044693 Bacteria 5776
654 Ga0466963_0008073 3300044694 Bacteria 6301
655 Ga0466964_0003328 3300044706 Bacteria 5858
656 Ga0466964_0004632 3300044706 Bacteria 5086
657 Ga0466964_0028165 3300044706 Bacteria 2211
658 Ga0453684_0000065 3300044712 Bacteria 468481
659 Ga0453684_0009901 3300044712 Bacteria 16457
660 Ga0466971_0004295 3300044719 Bacteria 6142
661 Ga0466970_0004172 3300044765 Bacteria 7108
662 Ga0466957_0014724 3300044842 Bacteria 4557
663 Ga0466957_0062297 3300044842 Bacteria 2290
664 Ga0466959_0000063 3300045049 Bacteria 75428
665 Ga0466959_0006014 3300045049 Bacteria 8376
666 Ga0466959_0026775 3300045049 Bacteria 4276
667 Ga0451576_0013881 3300045051 Bacteria 8997
668 Ga0451576_0044822 3300045051 Bacteria 4660
669 Ga0451576_0136973 3300045051 Bacteria 2553
670 Ga0466958_0004695 3300045836 Bacteria 7252
671 Ga0466958_0017953 3300045836 Bacteria 4100
672 Ga0466958_0018095 3300045836 Bacteria 4083
673 Ga0495617_012554 3300046452 Bacteria 2888
674 Ga0495617_038624 3300046452 Bacteria 1596
675 Ga0495592_0002422 3300046454 Bacteria 13147
676 Ga0495590_0010273 3300046457 Bacteria 3526
677 Ga0495629_0011897 3300046459 Bacteria 6309
678 Ga0495638_0002153 3300046460 Bacteria 16525
679 Ga0495638_0061966 3300046460 Bacteria 2310
680 Ga0495651_0000027 3300046462 Bacteria 107496
681 Ga0495580_0021078 3300046472 Bacteria 4813
682 Ga0495580_0028185 3300046472 Bacteria 4084
683 Ga0495582_0011400 3300046473 Bacteria 4897
684 Ga0495605_0001486 3300046474 Bacteria 15297
685 Ga0495639_0004066 3300046475 Bacteria 6270
686 Ga0495584_0000621 3300046491 Bacteria 23734
687 Ga0495585_0007084 3300046492 Bacteria 6891
688 Ga0495585_0056295 3300046492 Bacteria 2172
689 Ga0495585_0059195 3300046492 Bacteria 2111
690 Ga0495594_0002498 3300046499 Bacteria 9578
691 Ga0495583_0000016 3300046506 Bacteria 312691
692 Ga0495606_0002620 3300046507 Bacteria 20518
693 Ga0495616_0004257 3300046513 Bacteria 9046
694 Ga0495616_0005761 3300046513 Bacteria 7576
695 Ga0495616_0027002 3300046513 Bacteria 3049
696 Ga0495628_0005560 3300046516 Bacteria 11034
697 Ga0495628_0094618 3300046516 Bacteria 2309
698 Ga0495637_0045719 3300046520 Bacteria 1855
699 Ga0495637_0050812 3300046520 Bacteria 1738
700 Ga0495643_0003120 3300046522 Bacteria 12380
701 Ga0495648_0000593 3300046524 Bacteria 38760
702 Ga0495666_0064639 3300046526 Bacteria 1746
703 Ga0495652_0036854 3300046529 Bacteria 4247
704 Ga0495652_0071658 3300046529 Bacteria 2891
705 Ga0495665_0003964 3300046531 Bacteria 7996
706 Ga0495586_0090949 3300046535 Bacteria 1686
707 Ga0495587_0006273 3300046536 Bacteria 7760
708 Ga0495597_0004154 3300046542 Bacteria 8032
709 Ga0495597_0015616 3300046542 Bacteria 3592
710 Ga0495645_0002395 3300046543 Bacteria 12721
711 Ga0495622_0005439 3300046557 Bacteria 5910
712 Ga0495633_0002301 3300046558 Bacteria 13619
713 Ga0495633_0015720 3300046558 Bacteria 3922
714 Ga0495656_0000110 3300046615 Bacteria 32732
715 Ga0495668_0044647 3300046616 Bacteria 2463
716 Ga0495634_0019399 3300046642 Bacteria 4832
717 Ga0495611_0008728 3300046648 Bacteria 4286
718 Ga0495625_0002383 3300046660 Bacteria 20428
719 Ga0495625_0010249 3300046660 Bacteria 7771
720 Ga0495625_0080003 3300046660 Bacteria 2277
721 Ga0495635_0030188 3300046663 Bacteria 3767
722 Ga0495659_0007216 3300046664 Bacteria 3519
723 Ga0495661_0002005 3300046665 Bacteria 16054
724 Ga0495599_0000531 3300046678 Bacteria 21912
725 Ga0495599_0022849 3300046678 Bacteria 3906
726 Ga0495599_0140589 3300046678 Bacteria 1498
727 Ga0495623_0016524 3300046679 Bacteria 4768
728 Ga0495647_0011450 3300046681 Bacteria 3040
729 Ga0495658_0001699 3300046683 Bacteria 11444
730 Ga0495669_0025706 3300046684 Bacteria 2569
731 Ga0495670_0002770 3300046691 Bacteria 8667
732 Ga0495670_0005224 3300046691 Bacteria 6392
733 Ga0495671_0080841 3300046692 Bacteria 1592
734 Ga0495671_0111269 3300046692 Bacteria 1337
735 Ga0495581_0008234 3300047315 Bacteria 6042
736 Ga0495636_0000920 3300047318 Bacteria 10942
737 Ga0495672_0012407 3300047320 Bacteria 5948
738 Ga0495676_0012265 3300047321 Bacteria 7722
739 Ga0495676_0016453 3300047321 Bacteria 6564
740 Ga0495683_0006098 3300047323 Bacteria 6608
741 Ga0495687_000138 3300047443 Bacteria 110840
742 Ga0495687_006782 3300047443 Bacteria 6925
743 Ga0495687_025727 3300047443 Bacteria 2777
744 Ga0495677_0003212 3300047445 Bacteria 6372
745 Ga0495685_000219 3300047447 Bacteria 19447
746 Ga0495673_0000060 3300047469 Bacteria 231642
747 Ga0495684_0038078 3300047471 Bacteria 3688
748 Ga0495686_0006352 3300047472 Bacteria 9067
749 Ga0495593_0000759 3300047673 Bacteria 18716
750 Ga0495593_0011141 3300047673 Bacteria 5171
751 Ga0496100_0018668 3300048903 Bacteria 4119
752 Ga0496101_0061878 3300048904 Bacteria 2720
753 Ga0496101_0232980 3300048904 Bacteria 1432
754 Ga0496102_0071667 3300048905 Bacteria 3182
755 Ga0496102_0072781 3300048905 Bacteria 3159
756 Ga0496104_0040730 3300048907 Bacteria 4355
757 Ga0496105_0062478 3300048908 Bacteria 3074
758 Ga0496106_0023204 3300048909 Bacteria 4609
759 Ga0496107_0137097 3300048910 Bacteria 1808
760 Ga0496108_0040990 3300048911 Bacteria 3863
761 Ga0496108_0087964 3300048911 Bacteria 2639
762 Ga0496109_0024792 3300048912 Bacteria 5336
763 Ga0496109_0027408 3300048912 Bacteria 5086
764 Ga0496110_0004858 3300048913 Bacteria 10483
765 Ga0496110_0009425 3300048913 Bacteria 7908
766 Ga0496111_0032942 3300048914 Bacteria 3695
767 Ga0496111_0053081 3300048914 Bacteria 2928
768 Ga0496111_0086850 3300048914 Bacteria 2289
769 Ga0496112_0050038 3300048915 Bacteria 4096
770 Ga0496113_0146119 3300048916 Bacteria 1863
771 Ga0496115_0027971 3300048918 Bacteria 4415
772 Ga0496115_0066235 3300048918 Bacteria 2919
773 Ga0496116_0010521 3300048919 Bacteria 7738
774 Ga0496117_0025555 3300048920 Bacteria 4640
775 Ga0496119_0035106 3300048922 Bacteria 3290
776 Ga0496121_0000314 3300048924 Bacteria 100909
777 Ga0496121_0072459 3300048924 Bacteria 2765
778 Ga0496122_0000046 3300048925 Bacteria 274640
779 Ga0496122_0000217 3300048925 Bacteria 128502
780 Ga0496123_0000082 3300048926 Bacteria 188909
781 Ga0496123_0001126 3300048926 Bacteria 39890
782 Ga0496123_0022919 3300048926 Bacteria 4796
783 Ga0496124_0000038 3300048927 Bacteria 312485
784 Ga0496124_0057503 3300048927 Bacteria 3276
785 Ga0496125_0000028 3300048928 Bacteria 387222
786 Ga0496125_0000532 3300048928 Bacteria 65618
787 Ga0496125_0079036 3300048928 Bacteria 2525
788 Ga0495682_0002647 3300049460 Bacteria 8374
789 Ga0501034_0006242 3300049571 Bacteria 12827
790 Ga0501041_0172858 3300049577 Bacteria 1352
791 Ga0501042_0143664 3300049578 Bacteria 1721
792 Ga0501043_0156886 3300049579 Bacteria 1780
793 Ga0501047_0023913 3300049581 Bacteria 5866
794 Ga0501068_0067902 3300049584 Bacteria 2173
795 Ga0501069_0001500 3300049585 Bacteria 11533
796 Ga0501070_0003950 3300049586 Bacteria 12768
797 Ga0501072_0110293 3300049588 Bacteria 2190
798 Ga0501073_0000374 3300049589 Bacteria 30124
799 Ga0501073_0009188 3300049589 Bacteria 7290
800 Ga0501073_0019817 3300049589 Bacteria 4854
801 Ga0501074_0000125 3300049590 Bacteria 39203
802 Ga0501076_0025005 3300049592 Bacteria 4619
803 Ga0501198_000005 3300049649 Bacteria 156657
804 Ga0501222_000003 3300049662 Bacteria 157406
805 Ga0501079_0013497 3300049741 Bacteria 6229
806 Ga0501080_0001248 3300049742 Bacteria 21187
807 Ga0501080_0007975 3300049742 Bacteria 9595
808 Ga0501080_0039560 3300049742 Bacteria 4401
809 Ga0501083_0007469 3300049744 Bacteria 7746
810 Ga0501266_001164 3300049763 Bacteria 3377
811 Ga0501035_0067904 3300049822 Bacteria 3162
812 Ga0501035_0095951 3300049822 Bacteria 2606
813 nmdc:mga03683_20354_c1 3300050489 Bacteria 2545
814 nmdc:mga03683_22410_c1 3300050489 Bacteria 2449
815 nmdc:mga00v17_10232_c1 3300050491 Bacteria 5114
816 nmdc:mga00v17_48905_c1 3300050491 Bacteria 2563
817 nmdc:mga0k408_1565_c1 3300050493 Bacteria 12364
818 nmdc:mga0k408_26727_c1 3300050493 Bacteria 3274
819 nmdc:mga0k408_4867_c1 3300050493 Bacteria 7123
820 nmdc:mga0k408_6461_c1 3300050493 Bacteria 6248
821 nmdc:mga0k408_6553_c1 3300050493 Bacteria 6203
822 nmdc:mga0k408_76088_c1 3300050493 Bacteria 1962
823 nmdc:mga06z11_50874_c1 3300050494 Bacteria 2119
824 nmdc:mga07m45_18826_c1 3300050496 Bacteria 3734
825 nmdc:mga07m45_19735_c1 3300050496 Bacteria 3654
826 nmdc:mga07m45_202_c1 3300050496 Bacteria 23538
827 nmdc:mga07m45_21064_c1 3300050496 Bacteria 3547
828 nmdc:mga07m45_2832_c1 3300050496 Bacteria 8203
829 nmdc:mga07m45_43302_c1 3300050496 Bacteria 2524
830 nmdc:mga07m45_61657_c1 3300050496 Bacteria 2125
831 nmdc:mga07m45_716_c1 3300050496 Bacteria 14102
832 nmdc:mga07m45_8065_c1 3300050496 Bacteria 5399
833 nmdc:mga05p37_109213_c1 3300050507 Bacteria 3403
834 nmdc:mga0qj67_172497_c1 3300050509 Bacteria 1756
835 nmdc:mga0qj67_61514_c1 3300050509 Bacteria 2981
836 nmdc:mga06r32_704_c1 3300050510 Bacteria 29199
837 nmdc:mga08y16_59229_c1 3300050511 Bacteria 4001
838 nmdc:mga08y16_7529_c1 3300050511 Bacteria 11403
839 nmdc:mga0n895_13563_c1 3300050512 Bacteria 7361
840 nmdc:mga0rr50_11608_c1 3300050513 Bacteria 5651
841 nmdc:mga0rr50_119039_c1 3300050513 Bacteria 2099
842 nmdc:mga0rr50_33844_c1 3300050513 Bacteria 3654
843 nmdc:mga0rr50_7922_c1 3300050513 Bacteria 6590
844 nmdc:mga08x19_118322_c1 3300050514 Bacteria 1773
845 nmdc:mga08x19_9403_c1 3300050514 Bacteria 5853
846 nmdc:mga0a205_95540_c1 3300050515 Bacteria 2871
847 Ga0495601_0000822 3300053077 Bacteria 16815
848 Ga0500610_0000344 3300053079 Bacteria 14067
849 Ga0500610_0020666 3300053079 Bacteria 3217
850 Ga0500635_0000145 3300053080 Bacteria 40070
851 Ga0500651_0000353 3300053093 Bacteria 25788
852 Ga0500566_0000008 3300053094 Bacteria 143641
853 Ga0500562_004134 3300053108 Bacteria 3662
854 Ga0500569_000840 3300053109 Bacteria 5448
855 Ga0500572_001770 3300053111 Bacteria 5559
856 Ga0500614_003737 3300053123 Bacteria 3259
857 Ga0500652_035527 3300053131 Bacteria 1980
858 Ga0500559_0000011 3300053136 Bacteria 164751
859 Ga0500568_0005309 3300053139 Bacteria 6691
860 Ga0500600_0030483 3300053149 Bacteria 3174
861 Ga0500603_000040 3300053150 Bacteria 30803
862 Ga0500639_000010 3300053163 Bacteria 136747
863 Ga0500636_0034879 3300053177 Bacteria 2978
864 Ga0500637_0024809 3300053178 Bacteria 3288
865 Ga0500645_000274 3300053730 Bacteria 36869
866 Ga0500645_003458 3300053730 Bacteria 6402
867 Ga0587072_001478 3300059643 Bacteria 2920
868 Ga0466962_0008617 3300061719 Bacteria 4888

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048911 Ga0496108_0087964 Ga0496108_0087964_1362_2627 412
2 3300026089 Ga0207648_10246668 Ga0207648_102466682 416
3 3300046678 Ga0495599_0140589 Ga0495599_0140589_18_1304 423
4 3300046692 Ga0495671_0111269 Ga0495671_0111269_44_1327 423
5 3300049577 Ga0501041_0172858 Ga0501041_0172858_64_1338 423
6 3300050493 nmdc:mga0k408_76088_c1 nmdc:mga0k408_76088_c1_12_1283 423
7 3300053149 Ga0500600_0030483 Ga0500600_0030483_1856_3133 423
8 3300031616 Ga0307508_10000163 Ga0307508_1000016333 429
9 3300031507 Ga0307509_10013526 Ga0307509_100135264 430
10 3300050493 nmdc:mga0k408_1565_c1 nmdc:mga0k408_1565_c1_8446_9837 439
11 3300050491 nmdc:mga00v17_48905_c1 nmdc:mga00v17_48905_c1_853_2268 448
12 3300006048 Ga0075363_100008202 Ga0075363_1000082022 450
13 3300006177 Ga0075362_10013155 Ga0075362_100131552 450
14 3300050489 nmdc:mga03683_22410_c1 nmdc:mga03683_22410_c1_132_1547 450
15 3300050493 nmdc:mga0k408_4867_c1 nmdc:mga0k408_4867_c1_3947_5362 450
16 3300050496 nmdc:mga07m45_202_c1 nmdc:mga07m45_202_c1_12158_13573 450
17 3300048924 Ga0496121_0072459 Ga0496121_0072459_934_2319 451
18 3300046520 Ga0495637_0050812 Ga0495637_0050812_17_1393 457
19 iso_pu_bacteria 2547132374 2548498292 457
20 iso_pu_bacteria 2547132512 2548849106 457
21 iso_pu_bacteria 2599185178 2599446114 457
22 iso_pu_bacteria 2643221554 2643789322 457
23 iso_pu_bacteria 2643221569 2643862684 457
24 iso_pu_bacteria 2643221594 2643980310 457
25 iso_pu_bacteria 2643221609 2644062964 457
26 iso_pu_bacteria 2643221611 2644070647 457
27 iso_pu_bacteria 2643221621 2644121910 457
28 iso_pu_bacteria 2643221717 2644648826 457
29 iso_pu_bacteria 2738543012 2739243723 457
30 iso_pu_bacteria 2808606395 2809032376 457
31 iso_pu_bacteria 2816332133 2816472553 457
32 iso_pu_bacteria 2842718218 2842720292 457
33 iso_pu_bacteria 2842747753 2842751360 457
34 iso_pu_bacteria 2857537821 2857542486 457
35 iso_pu_bacteria 2857542790 2857544781 457
36 iso_pu_bacteria 2885192300 2885192848 457
37 iso_pu_bacteria 2885266251 2885266755 457
38 iso_pu_bacteria 2904479285 2904480318 457
39 iso_pu_bacteria 2919476304 2919480809 457
40 iso_pu_bacteria 2974320154 2974322718 457
41 3300005535 Ga0070684_100144926 Ga0070684_1001449262 458
42 3300013306 Ga0163162_10181338 Ga0163162_101813382 458
43 3300026088 Ga0207641_10222677 Ga0207641_102226772 458
44 3300028794 Ga0307515_10048179 Ga0307515_100481795 458
45 3300030522 Ga0307512_10055475 Ga0307512_100554752 458
46 3300031507 Ga0307509_10000120 Ga0307509_1000012072 458
47 3300031507 Ga0307509_10060091 Ga0307509_100600914 458
48 3300031507 Ga0307509_10069501 Ga0307509_100695012 458
49 3300031616 Ga0307508_10023931 Ga0307508_100239313 458
50 3300032002 Ga0307416_100017961 Ga0307416_1000179613 458
51 3300033180 Ga0307510_10002394 Ga0307510_100023945 458
52 3300033180 Ga0307510_10018033 Ga0307510_100180336 458
53 3300044658 Ga0466972_0055407 Ga0466972_0055407_153_1547 458
54 3300046454 Ga0495592_0002422 Ga0495592_0002422_9426_10814 458
55 3300048916 Ga0496113_0146119 Ga0496113_0146119_288_1694 458
56 3300049649 Ga0501198_000005 Ga0501198_000005_35055_36476 458
57 3300049662 Ga0501222_000003 Ga0501222_000003_35804_37225 458
58 3300053131 Ga0500652_035527 Ga0500652_035527_361_1749 458
59 3300053136 Ga0500559_0000011 Ga0500559_0000011_58055_59443 458
60 iso_pu_bacteria 2643221654 2644304754 458
61 iso_pu_bacteria 2773857925 2774870257 458
62 iso_pu_bacteria 2884298095 2884299549 458
63 3300002774 JGI25150J39212_1003709 JGI25150J39212_10037092 459
64 3300002987 JGI25159J45721_1001031 JGI25159J45721_10010311 459
65 3300003354 JGI25160J50197_1000301 JGI25160J50197_10003011 459
66 3300003374 JGI25161J50226_1000043 JGI25161J50226_1000043114 459
67 3300003781 Ga0055536_1008676 Ga0055536_10086763 459
68 3300003791 Ga0055530_10013640 Ga0055530_100136402 459
69 3300003792 Ga0055540_1005170 Ga0055540_10051703 459
70 3300003794 Ga0055531_10002186 Ga0055531_100021868 459
71 3300004625 Ga0055543_1000805 Ga0055543_100080514 459
72 3300005340 Ga0070689_100017673 Ga0070689_1000176732 459
73 3300005354 Ga0070675_100068410 Ga0070675_1000684103 459
74 3300005365 Ga0070688_100011876 Ga0070688_1000118763 459
75 3300005546 Ga0070696_100161684 Ga0070696_1001616842 459
76 3300005547 Ga0070693_100001943 Ga0070693_10000194310 459
77 3300005983 Ga0081540_1028320 Ga0081540_10283203 459
78 3300006051 Ga0075364_10043684 Ga0075364_100436842 459
79 3300006358 Ga0068871_100010284 Ga0068871_1000102847 459
80 3300006871 Ga0075434_100017636 Ga0075434_1000176364 459
81 3300009098 Ga0105245_10015781 Ga0105245_100157816 459
82 3300009176 Ga0105242_10014042 Ga0105242_100140425 459
83 3300009176 Ga0105242_10018794 Ga0105242_100187944 459
84 3300009177 Ga0105248_10035562 Ga0105248_100355627 459
85 3300013296 Ga0157374_10027309 Ga0157374_100273096 459
86 3300013297 Ga0157378_10104692 Ga0157378_101046922 459
87 3300014969 Ga0157376_10122217 Ga0157376_101222173 459
88 3300025245 Ga0207425_1001500 Ga0207425_10015007 459
89 3300025284 Ga0209130_1000041 Ga0209130_1000041185 459
90 3300025292 Ga0209676_1003053 Ga0209676_10030535 459
91 3300025294 Ga0209025_1016285 Ga0209025_10162853 459
92 3300025295 Ga0209564_1009461 Ga0209564_10094613 459
93 3300025297 Ga0209758_1004529 Ga0209758_10045295 459
94 3300025298 Ga0209050_1028547 Ga0209050_10285472 459
95 3300025299 Ga0209256_1017307 Ga0209256_10173071 459
96 3300025302 Ga0207426_1000061 Ga0207426_100006156 459
97 3300025303 Ga0209051_1000491 Ga0209051_10004913 459
98 3300025304 Ga0209257_1000055 Ga0209257_100005530 459
99 3300025304 Ga0209257_1007175 Ga0209257_10071754 459
100 3300025901 Ga0207688_10031734 Ga0207688_100317344 459
101 3300025934 Ga0207686_10063141 Ga0207686_100631413 459
102 3300025936 Ga0207670_10019227 Ga0207670_100192271 459
103 3300025941 Ga0207711_10129756 Ga0207711_101297562 459
104 3300026075 Ga0207708_10067958 Ga0207708_100679582 459
105 3300026088 Ga0207641_10162307 Ga0207641_101623071 459
106 3300026121 Ga0207683_10039060 Ga0207683_100390602 459
107 3300028653 Ga0265323_10008205 Ga0265323_100082054 459
108 3300028794 Ga0307515_10016545 Ga0307515_100165453 459
109 3300037068 Ga0373925_0045523 Ga0373925_0045523_1074_2471 459
110 3300037312 Ga0395899_0012470 Ga0395899_0012470_1263_2642 459
111 3300037466 Ga0395898_0010478 Ga0395898_0010478_4794_6173 459
112 3300037471 Ga0395905_0024518 Ga0395905_0024518_1651_3030 459
113 3300037471 Ga0395905_0029244 Ga0395905_0029244_1822_3210 459
114 3300038443 Ga0395901_0015357 Ga0395901_0015357_747_2126 459
115 3300038443 Ga0395901_0015454 Ga0395901_0015454_5673_7052 459
116 3300042876 Ga0451577_0000742 Ga0451577_0000742_18345_19730 459
117 3300042876 Ga0451577_0085905 Ga0451577_0085905_1235_2644 459
118 3300042876 Ga0451577_0133455 Ga0451577_0133455_188_1570 459
119 3300044656 Ga0466969_0000001 Ga0466969_0000001_64976_66361 459
120 3300044712 Ga0453684_0000065 Ga0453684_0000065_387027_388412 459
121 3300045049 Ga0466959_0006014 Ga0466959_0006014_5106_6491 459
122 3300046529 Ga0495652_0071658 Ga0495652_0071658_152_1561 459
123 3300046535 Ga0495586_0090949 Ga0495586_0090949_45_1442 459
124 3300046536 Ga0495587_0006273 Ga0495587_0006273_753_2162 459
125 3300046678 Ga0495599_0000531 Ga0495599_0000531_19005_20414 459
126 3300046679 Ga0495623_0016524 Ga0495623_0016524_1677_3086 459
127 3300047471 Ga0495684_0038078 Ga0495684_0038078_1802_3211 459
128 3300048904 Ga0496101_0232980 Ga0496101_0232980_19_1416 459
129 3300049579 Ga0501043_0156886 Ga0501043_0156886_199_1602 459
130 3300049763 Ga0501266_001164 Ga0501266_001164_598_2001 459
131 3300050496 nmdc:mga07m45_18826_c1 nmdc:mga07m45_18826_c1_1575_2963 459
132 3300050512 nmdc:mga0n895_13563_c1 nmdc:mga0n895_13563_c1_2270_3667 459
133 3300053077 Ga0495601_0000822 Ga0495601_0000822_9128_10771 459
134 3300053109 Ga0500569_000840 Ga0500569_000840_3569_4996 459
135 iso_pu_bacteria 2511231002 2511245553 459
136 iso_pu_bacteria 2513237139 2513874577 459
137 iso_pu_bacteria 2513237141 2513894527 459
138 iso_pu_bacteria 2524023250 2524610238 459
139 iso_pu_bacteria 2643221651 2644287379 459
140 iso_pu_bacteria 2643221660 2644338114 459
141 iso_pu_bacteria 2802429603 2805916573 459
142 iso_pu_bacteria 2928115317 2928119752 459
143 iso_pu_bacteria 8006926726 8006930500 459
144 3300002738 JGI25154J39366_1003035 JGI25154J39366_10030353 460
145 3300002741 JGI25157J39369_1000015 JGI25157J39369_1000015118 460
146 3300003752 Ga0055539_1000170 Ga0055539_100017035 460
147 3300003752 Ga0055539_1001228 Ga0055539_10012282 460
148 3300003756 Ga0055533_1000010 Ga0055533_1000010103 460
149 3300003759 Ga0055525_1001192 Ga0055525_10011924 460
150 3300003763 Ga0055529_1000303 Ga0055529_100030345 460
151 3300005329 Ga0070683_100119340 Ga0070683_1001193403 460
152 3300005330 Ga0070690_100019559 Ga0070690_1000195593 460
153 3300005330 Ga0070690_100067862 Ga0070690_1000678623 460
154 3300005331 Ga0070670_100014050 Ga0070670_1000140502 460
155 3300005331 Ga0070670_100149804 Ga0070670_1001498042 460
156 3300005334 Ga0068869_100017109 Ga0068869_1000171094 460
157 3300005334 Ga0068869_100101671 Ga0068869_1001016712 460
158 3300005335 Ga0070666_10003561 Ga0070666_100035612 460
159 3300005335 Ga0070666_10062188 Ga0070666_100621882 460
160 3300005336 Ga0070680_100006104 Ga0070680_1000061046 460
161 3300005338 Ga0068868_100001107 Ga0068868_10000110712 460
162 3300005338 Ga0068868_100012489 Ga0068868_1000124893 460
163 3300005338 Ga0068868_100068762 Ga0068868_1000687624 460
164 3300005339 Ga0070660_100008902 Ga0070660_1000089024 460
165 3300005339 Ga0070660_100071336 Ga0070660_1000713363 460
166 3300005344 Ga0070661_100005559 Ga0070661_1000055595 460
167 3300005353 Ga0070669_100038621 Ga0070669_1000386211 460
168 3300005354 Ga0070675_100002327 Ga0070675_1000023278 460
169 3300005354 Ga0070675_100055711 Ga0070675_1000557112 460
170 3300005354 Ga0070675_100079092 Ga0070675_1000790922 460
171 3300005355 Ga0070671_100003169 Ga0070671_10000316910 460
172 3300005356 Ga0070674_100012531 Ga0070674_1000125315 460
173 3300005364 Ga0070673_100007098 Ga0070673_1000070988 460
174 3300005365 Ga0070688_100008223 Ga0070688_1000082232 460
175 3300005366 Ga0070659_100072608 Ga0070659_1000726082 460
176 3300005367 Ga0070667_100002446 Ga0070667_1000024465 460
177 3300005455 Ga0070663_100043557 Ga0070663_1000435572 460
178 3300005456 Ga0070678_100004119 Ga0070678_1000041194 460
179 3300005458 Ga0070681_10060581 Ga0070681_100605814 460
180 3300005459 Ga0068867_100084636 Ga0068867_1000846362 460
181 3300005530 Ga0070679_100008378 Ga0070679_1000083786 460
182 3300005535 Ga0070684_100047479 Ga0070684_1000474793 460
183 3300005539 Ga0068853_100119887 Ga0068853_1001198872 460
184 3300005547 Ga0070693_100080148 Ga0070693_1000801482 460
185 3300005563 Ga0068855_100008864 Ga0068855_10000886411 460
186 3300005563 Ga0068855_100023596 Ga0068855_1000235967 460
187 3300005563 Ga0068855_100032986 Ga0068855_1000329865 460
188 3300005563 Ga0068855_100211745 Ga0068855_1002117452 460
189 3300005564 Ga0070664_100024552 Ga0070664_1000245524 460
190 3300005564 Ga0070664_100075463 Ga0070664_1000754634 460
191 3300005577 Ga0068857_100011891 Ga0068857_1000118912 460
192 3300005578 Ga0068854_100046118 Ga0068854_1000461182 460
193 3300005578 Ga0068854_100049539 Ga0068854_1000495392 460
194 3300005614 Ga0068856_100003075 Ga0068856_1000030757 460
195 3300005614 Ga0068856_100045672 Ga0068856_1000456724 460
196 3300005616 Ga0068852_100001399 Ga0068852_10000139910 460
197 3300005616 Ga0068852_100046435 Ga0068852_1000464354 460
198 3300005616 Ga0068852_100086172 Ga0068852_1000861723 460
199 3300005617 Ga0068859_100103867 Ga0068859_1001038674 460
200 3300005618 Ga0068864_100002769 Ga0068864_1000027698 460
201 3300005719 Ga0068861_100009167 Ga0068861_1000091672 460
202 3300005834 Ga0068851_10013011 Ga0068851_100130114 460
203 3300005834 Ga0068851_10014932 Ga0068851_100149323 460
204 3300005842 Ga0068858_100002948 Ga0068858_10000294812 460
205 3300005842 Ga0068858_100006154 Ga0068858_1000061547 460
206 3300005843 Ga0068860_100147079 Ga0068860_1001470792 460
207 3300005937 Ga0081455_10072235 Ga0081455_100722352 460
208 3300005983 Ga0081540_1025348 Ga0081540_10253482 460
209 3300006237 Ga0097621_100043803 Ga0097621_1000438034 460
210 3300006353 Ga0075370_10001173 Ga0075370_1000117312 460
211 3300006358 Ga0068871_100041229 Ga0068871_1000412294 460
212 3300006358 Ga0068871_100142682 Ga0068871_1001426822 460
213 3300006871 Ga0075434_100108235 Ga0075434_1001082352 460
214 3300006881 Ga0068865_100077489 Ga0068865_1000774891 460
215 3300006914 Ga0075436_100002487 Ga0075436_1000024879 460
216 3300006931 Ga0097620_100103873 Ga0097620_1001038734 460
217 3300007076 Ga0075435_100106905 Ga0075435_1001069053 460
218 3300009093 Ga0105240_10013136 Ga0105240_100131368 460
219 3300009093 Ga0105240_10027970 Ga0105240_100279705 460
220 3300009093 Ga0105240_10278239 Ga0105240_102782391 460
221 3300009098 Ga0105245_10029552 Ga0105245_100295524 460
222 3300009177 Ga0105248_10061334 Ga0105248_100613344 460
223 3300009551 Ga0105238_10094296 Ga0105238_100942961 460
224 3300009551 Ga0105238_10122429 Ga0105238_101224293 460
225 3300009553 Ga0105249_10286037 Ga0105249_102860372 460
226 3300013102 Ga0157371_10027203 Ga0157371_100272034 460
227 3300013105 Ga0157369_10002601 Ga0157369_1000260116 460
228 3300013105 Ga0157369_10044657 Ga0157369_100446571 460
229 3300013105 Ga0157369_10124864 Ga0157369_101248642 460
230 3300013296 Ga0157374_10087099 Ga0157374_100870992 460
231 3300013296 Ga0157374_10106087 Ga0157374_101060872 460
232 3300013306 Ga0163162_10057090 Ga0163162_100570902 460
233 3300013307 Ga0157372_10003798 Ga0157372_1000379814 460
234 3300013307 Ga0157372_10189877 Ga0157372_101898772 460
235 3300013307 Ga0157372_10215889 Ga0157372_102158892 460
236 3300014325 Ga0163163_10008501 Ga0163163_100085016 460
237 3300014326 Ga0157380_10084084 Ga0157380_100840842 460
238 3300014745 Ga0157377_10002089 Ga0157377_100020894 460
239 3300014968 Ga0157379_10034664 Ga0157379_100346641 460
240 3300014968 Ga0157379_10043161 Ga0157379_100431614 460
241 3300014968 Ga0157379_10248816 Ga0157379_102488162 460
242 3300025226 Ga0209674_100003 Ga0209674_1000031437 460
243 3300025228 Ga0209672_102654 Ga0209672_1026545 460
244 3300025230 Ga0209563_100010 Ga0209563_1000101164 460
245 3300025231 Ga0207427_100468 Ga0207427_1004681 460
246 3300025242 Ga0209258_100163 Ga0209258_100163111 460
247 3300025242 Ga0209258_100903 Ga0209258_10090311 460
248 3300025246 Ga0209646_1000226 Ga0209646_100022612 460
249 3300025250 Ga0209026_1000021 Ga0209026_1000021119 460
250 3300025253 Ga0209677_100106 Ga0209677_10010657 460
251 3300025253 Ga0209677_100480 Ga0209677_10048013 460
252 3300025256 Ga0209759_1000025 Ga0209759_1000025119 460
253 3300025256 Ga0209759_1000939 Ga0209759_100093912 460
254 3300025256 Ga0209759_1001423 Ga0209759_10014235 460
255 3300025272 Ga0209455_1000059 Ga0209455_1000059182 460
256 3300025298 Ga0209050_1002949 Ga0209050_100294910 460
257 3300025304 Ga0209257_1000032 Ga0209257_1000032334 460
258 3300025315 Ga0207697_10073410 Ga0207697_100734101 460
259 3300025901 Ga0207688_10079934 Ga0207688_100799342 460
260 3300025903 Ga0207680_10002745 Ga0207680_100027455 460
261 3300025907 Ga0207645_10045934 Ga0207645_100459342 460
262 3300025909 Ga0207705_10022746 Ga0207705_100227463 460
263 3300025909 Ga0207705_10066011 Ga0207705_100660112 460
264 3300025913 Ga0207695_10021707 Ga0207695_100217076 460
265 3300025913 Ga0207695_10053129 Ga0207695_100531294 460
266 3300025913 Ga0207695_10057592 Ga0207695_100575923 460
267 3300025919 Ga0207657_10078012 Ga0207657_100780122 460
268 3300025919 Ga0207657_10158475 Ga0207657_101584752 460
269 3300025920 Ga0207649_10016787 Ga0207649_100167872 460
270 3300025924 Ga0207694_10018078 Ga0207694_100180783 460
271 3300025925 Ga0207650_10008883 Ga0207650_100088833 460
272 3300025925 Ga0207650_10056820 Ga0207650_100568202 460
273 3300025925 Ga0207650_10124999 Ga0207650_101249992 460
274 3300025926 Ga0207659_10000725 Ga0207659_100007258 460
275 3300025926 Ga0207659_10007325 Ga0207659_100073253 460
276 3300025927 Ga0207687_10041114 Ga0207687_100411142 460
277 3300025931 Ga0207644_10003511 Ga0207644_100035114 460
278 3300025931 Ga0207644_10034969 Ga0207644_100349693 460
279 3300025931 Ga0207644_10068715 Ga0207644_100687153 460
280 3300025932 Ga0207690_10016369 Ga0207690_100163693 460
281 3300025932 Ga0207690_10067507 Ga0207690_100675072 460
282 3300025932 Ga0207690_10073921 Ga0207690_100739212 460
283 3300025933 Ga0207706_10025633 Ga0207706_100256334 460
284 3300025935 Ga0207709_10021990 Ga0207709_100219904 460
285 3300025940 Ga0207691_10002459 Ga0207691_1000245916 460
286 3300025941 Ga0207711_10008783 Ga0207711_100087835 460
287 3300025941 Ga0207711_10011843 Ga0207711_100118438 460
288 3300025942 Ga0207689_10015681 Ga0207689_100156812 460
289 3300025942 Ga0207689_10097636 Ga0207689_100976362 460
290 3300025944 Ga0207661_10092462 Ga0207661_100924621 460
291 3300025949 Ga0207667_10004568 Ga0207667_1000456813 460
292 3300025949 Ga0207667_10009460 Ga0207667_1000946011 460
293 3300025949 Ga0207667_10061375 Ga0207667_100613755 460
294 3300025960 Ga0207651_10002950 Ga0207651_100029504 460
295 3300025981 Ga0207640_10018533 Ga0207640_100185332 460
296 3300025981 Ga0207640_10027293 Ga0207640_100272932 460
297 3300025981 Ga0207640_10086378 Ga0207640_100863781 460
298 3300025986 Ga0207658_10052793 Ga0207658_100527932 460
299 3300026023 Ga0207677_10003064 Ga0207677_100030644 460
300 3300026023 Ga0207677_10026784 Ga0207677_100267842 460
301 3300026023 Ga0207677_10030189 Ga0207677_100301891 460
302 3300026035 Ga0207703_10012670 Ga0207703_100126704 460
303 3300026078 Ga0207702_10000522 Ga0207702_1000052228 460
304 3300026078 Ga0207702_10036919 Ga0207702_100369194 460
305 3300026078 Ga0207702_10118365 Ga0207702_101183652 460
306 3300026088 Ga0207641_10036585 Ga0207641_100365854 460
307 3300026089 Ga0207648_10075838 Ga0207648_100758382 460
308 3300026095 Ga0207676_10001271 Ga0207676_1000127113 460
309 3300026095 Ga0207676_10035333 Ga0207676_100353332 460
310 3300026118 Ga0207675_100018746 Ga0207675_1000187462 460
311 3300026118 Ga0207675_100079404 Ga0207675_1000794042 460
312 3300026118 Ga0207675_100193442 Ga0207675_1001934422 460
313 3300026121 Ga0207683_10005156 Ga0207683_100051562 460
314 3300026121 Ga0207683_10006290 Ga0207683_100062909 460
315 3300026121 Ga0207683_10129250 Ga0207683_101292501 460
316 3300026142 Ga0207698_10009072 Ga0207698_100090724 460
317 3300026142 Ga0207698_10019512 Ga0207698_100195123 460
318 3300026142 Ga0207698_10052932 Ga0207698_100529322 460
319 3300028666 Ga0265336_10000051 Ga0265336_1000005186 460
320 3300031456 Ga0307513_10000021 Ga0307513_1000002199 460
321 3300031548 Ga0307408_100079883 Ga0307408_1000798832 460
322 3300031730 Ga0307516_10018571 Ga0307516_100185714 460
323 3300031730 Ga0307516_10022115 Ga0307516_100221153 460
324 3300031824 Ga0307413_10016958 Ga0307413_100169582 460
325 3300031852 Ga0307410_10056048 Ga0307410_100560484 460
326 3300031911 Ga0307412_10015988 Ga0307412_100159883 460
327 3300031995 Ga0307409_100010337 Ga0307409_1000103376 460
328 3300032002 Ga0307416_100003363 Ga0307416_1000033638 460
329 3300032005 Ga0307411_10019119 Ga0307411_100191194 460
330 3300032126 Ga0307415_100016744 Ga0307415_1000167444 460
331 3300032126 Ga0307415_100023469 Ga0307415_1000234691 460
332 3300035090 Ga0373949_0004987 Ga0373949_0004987_731_2146 460
333 3300035111 Ga0373923_0048720 Ga0373923_0048720_36_1430 460
334 3300035114 Ga0373939_0000139 Ga0373939_0000139_5257_6681 460
335 3300035115 Ga0373941_0013544 Ga0373941_0013544_535_1950 460
336 3300035691 Ga0373931_0000908 Ga0373931_0000908_10296_11720 460
337 3300035691 Ga0373931_0004912 Ga0373931_0004912_1151_2545 460
338 3300037466 Ga0395898_0006685 Ga0395898_0006685_3763_5157 460
339 3300037471 Ga0395905_0113031 Ga0395905_0113031_67_1494 460
340 3300038443 Ga0395901_0022158 Ga0395901_0022158_2340_3734 460
341 3300039447 Ga0436361_0034352 Ga0436361_0034352_638_2032 460
342 3300039447 Ga0436361_0625540 Ga0436361_0625540_475_1869 460
343 3300042127 Ga0450890_000536 Ga0450890_000536_669_2093 460
344 3300042129 Ga0450891_000192 Ga0450891_000192_1591_3015 460
345 3300042532 Ga0450893_0000214 Ga0450893_0000214_5667_7091 460
346 3300044656 Ga0466969_0004528 Ga0466969_0004528_553_1947 460
347 3300044683 Ga0466965_0004669 Ga0466965_0004669_843_2237 460
348 3300044684 Ga0466966_0005235 Ga0466966_0005235_5456_6850 460
349 3300044706 Ga0466964_0028165 Ga0466964_0028165_72_1466 460
350 3300044842 Ga0466957_0062297 Ga0466957_0062297_721_2115 460
351 3300045049 Ga0466959_0026775 Ga0466959_0026775_1890_3284 460
352 3300045836 Ga0466958_0004695 Ga0466958_0004695_464_1858 460
353 3300045836 Ga0466958_0017953 Ga0466958_0017953_2332_3723 460
354 3300046459 Ga0495629_0011897 Ga0495629_0011897_1524_2930 460
355 3300046475 Ga0495639_0004066 Ga0495639_0004066_519_1928 460
356 3300046492 Ga0495585_0056295 Ga0495585_0056295_482_1876 460
357 3300046616 Ga0495668_0044647 Ga0495668_0044647_429_1838 460
358 3300046660 Ga0495625_0080003 Ga0495625_0080003_645_2039 460
359 3300048905 Ga0496102_0072781 Ga0496102_0072781_1475_2890 460
360 3300048907 Ga0496104_0040730 Ga0496104_0040730_1139_2530 460
361 3300048908 Ga0496105_0062478 Ga0496105_0062478_804_2195 460
362 3300048909 Ga0496106_0023204 Ga0496106_0023204_1025_2440 460
363 3300048913 Ga0496110_0009425 Ga0496110_0009425_3816_5231 460
364 3300048914 Ga0496111_0032942 Ga0496111_0032942_1358_2773 460
365 3300048918 Ga0496115_0027971 Ga0496115_0027971_2788_4203 460
366 3300049581 Ga0501047_0023913 Ga0501047_0023913_3144_4541 460
367 3300049584 Ga0501068_0067902 Ga0501068_0067902_531_1928 460
368 3300049585 Ga0501069_0001500 Ga0501069_0001500_5088_6485 460
369 3300049586 Ga0501070_0003950 Ga0501070_0003950_9375_10772 460
370 3300049588 Ga0501072_0110293 Ga0501072_0110293_100_1497 460
371 3300049589 Ga0501073_0000374 Ga0501073_0000374_23392_24789 460
372 3300049590 Ga0501074_0000125 Ga0501074_0000125_27324_28721 460
373 3300049741 Ga0501079_0013497 Ga0501079_0013497_2034_3431 460
374 3300049742 Ga0501080_0001248 Ga0501080_0001248_2529_3926 460
375 3300049742 Ga0501080_0039560 Ga0501080_0039560_1321_2715 460
376 3300049822 Ga0501035_0095951 Ga0501035_0095951_1080_2477 460
377 3300050493 nmdc:mga0k408_6461_c1 nmdc:mga0k408_6461_c1_1909_3303 460
378 3300050496 nmdc:mga07m45_716_c1 nmdc:mga07m45_716_c1_2735_4129 460
379 3300050514 nmdc:mga08x19_9403_c1 nmdc:mga08x19_9403_c1_3434_4828 460
380 3300053080 Ga0500635_0000145 Ga0500635_0000145_34648_36042 460
381 3300053177 Ga0500636_0034879 Ga0500636_0034879_160_1554 460
382 3300053730 Ga0500645_000274 Ga0500645_000274_6685_8079 460
383 3300053730 Ga0500645_003458 Ga0500645_003458_3985_5376 460
384 iso_pu_bacteria 2738541337 2739057284 460
385 3300001915 JGI24741J21665_1000804 JGI24741J21665_10008046 461
386 3300001979 JGI24740J21852_10000278 JGI24740J21852_100002783 461
387 3300001979 JGI24740J21852_10001064 JGI24740J21852_100010645 461
388 3300002704 JGI25155J39150_1000008 JGI25155J39150_1000008106 461
389 3300002705 JGI25156J39149_1000002 JGI25156J39149_1000002149 461
390 3300002705 JGI25156J39149_1012444 JGI25156J39149_10124441 461
391 3300002705 JGI25156J39149_1012868 JGI25156J39149_10128681 461
392 3300002738 JGI25154J39366_1000010 JGI25154J39366_1000010168 461
393 3300002738 JGI25154J39366_1000110 JGI25154J39366_100011024 461
394 3300002741 JGI25157J39369_1000001 JGI25157J39369_1000001170 461
395 3300002987 JGI25159J45721_1003729 JGI25159J45721_10037292 461
396 3300003187 JGI25151J46595_10007117 JGI25151J46595_100071175 461
397 3300003374 JGI25161J50226_1004540 JGI25161J50226_10045402 461
398 3300003751 Ga0055538_1002482 Ga0055538_10024821 461
399 3300003751 Ga0055538_1002934 Ga0055538_10029341 461
400 3300003752 Ga0055539_1000075 Ga0055539_100007551 461
401 3300003756 Ga0055533_1001222 Ga0055533_10012223 461
402 3300003756 Ga0055533_1002231 Ga0055533_10022313 461
403 3300003756 Ga0055533_1002410 Ga0055533_10024101 461
404 3300003758 Ga0055532_1000056 Ga0055532_100005695 461
405 3300003759 Ga0055525_1000363 Ga0055525_100036316 461
406 3300003761 Ga0055535_1000013 Ga0055535_1000013211 461
407 3300003761 Ga0055535_1000263 Ga0055535_100026329 461
408 3300003762 Ga0055542_1000004 Ga0055542_1000004133 461
409 3300003762 Ga0055542_1001053 Ga0055542_100105313 461
410 3300003763 Ga0055529_1000074 Ga0055529_100007460 461
411 3300003771 Ga0055526_1004895 Ga0055526_10048954 461
412 3300003773 Ga0055537_1000479 Ga0055537_100047915 461
413 3300003773 Ga0055537_1001694 Ga0055537_10016945 461
414 3300003775 Ga0055524_1000130 Ga0055524_100013027 461
415 3300003781 Ga0055536_1004820 Ga0055536_10048202 461
416 3300003781 Ga0055536_1005488 Ga0055536_10054884 461
417 3300003784 Ga0055534_1001079 Ga0055534_100107912 461
418 3300003784 Ga0055534_1001759 Ga0055534_10017595 461
419 3300003790 Ga0055528_1000145 Ga0055528_100014544 461
420 3300003790 Ga0055528_1003313 Ga0055528_10033135 461
421 3300003791 Ga0055530_10000265 Ga0055530_1000026516 461
422 3300003791 Ga0055530_10007868 Ga0055530_100078682 461
423 3300003791 Ga0055530_10016000 Ga0055530_100160002 461
424 3300003792 Ga0055540_1000079 Ga0055540_10000797 461
425 3300003792 Ga0055540_1004516 Ga0055540_10045165 461
426 3300003794 Ga0055531_10006273 Ga0055531_100062735 461
427 3300003841 Ga0055541_1000278 Ga0055541_10002786 461
428 3300003841 Ga0055541_1002512 Ga0055541_10025123 461
429 3300005288 Ga0065714_10004198 Ga0065714_100041985 461
430 3300005328 Ga0070676_10003870 Ga0070676_100038706 461
431 3300005328 Ga0070676_10056245 Ga0070676_100562452 461
432 3300005329 Ga0070683_100003533 Ga0070683_1000035333 461
433 3300005331 Ga0070670_100003950 Ga0070670_10000395012 461
434 3300005331 Ga0070670_100004715 Ga0070670_1000047159 461
435 3300005334 Ga0068869_100058068 Ga0068869_1000580682 461
436 3300005338 Ga0068868_100002281 Ga0068868_1000022816 461
437 3300005344 Ga0070661_100000154 Ga0070661_10000015433 461
438 3300005347 Ga0070668_100062585 Ga0070668_1000625852 461
439 3300005353 Ga0070669_100175811 Ga0070669_1001758111 461
440 3300005354 Ga0070675_100217010 Ga0070675_1002170102 461
441 3300005355 Ga0070671_100006639 Ga0070671_1000066395 461
442 3300005356 Ga0070674_100094518 Ga0070674_1000945181 461
443 3300005364 Ga0070673_100004435 Ga0070673_1000044358 461
444 3300005364 Ga0070673_100141301 Ga0070673_1001413011 461
445 3300005367 Ga0070667_100045319 Ga0070667_1000453192 461
446 3300005367 Ga0070667_100049466 Ga0070667_1000494661 461
447 3300005367 Ga0070667_100057059 Ga0070667_1000570592 461
448 3300005436 Ga0070713_100000260 Ga0070713_10000026020 461
449 3300005438 Ga0070701_10000785 Ga0070701_1000078512 461
450 3300005439 Ga0070711_100049030 Ga0070711_1000490302 461
451 3300005441 Ga0070700_100005781 Ga0070700_1000057811 461
452 3300005455 Ga0070663_100000002 Ga0070663_100000002210 461
453 3300005456 Ga0070678_100002072 Ga0070678_1000020722 461
454 3300005456 Ga0070678_100123478 Ga0070678_1001234781 461
455 3300005457 Ga0070662_100162058 Ga0070662_1001620581 461
456 3300005459 Ga0068867_100004890 Ga0068867_1000048906 461
457 3300005459 Ga0068867_100008662 Ga0068867_1000086624 461
458 3300005459 Ga0068867_100021092 Ga0068867_1000210925 461
459 3300005459 Ga0068867_100026104 Ga0068867_1000261041 461
460 3300005471 Ga0070698_100192809 Ga0070698_1001928091 461
461 3300005543 Ga0070672_100001173 Ga0070672_1000011732 461
462 3300005543 Ga0070672_100011477 Ga0070672_1000114772 461
463 3300005543 Ga0070672_100021015 Ga0070672_1000210155 461
464 3300005543 Ga0070672_100109306 Ga0070672_1001093062 461
465 3300005546 Ga0070696_100112285 Ga0070696_1001122852 461
466 3300005549 Ga0070704_100032829 Ga0070704_1000328292 461
467 3300005564 Ga0070664_100000004 Ga0070664_100000004211 461
468 3300005564 Ga0070664_100001898 Ga0070664_1000018981 461
469 3300005564 Ga0070664_100021981 Ga0070664_1000219812 461
470 3300005577 Ga0068857_100114094 Ga0068857_1001140942 461
471 3300005578 Ga0068854_100000007 Ga0068854_10000000741 461
472 3300005578 Ga0068854_100019412 Ga0068854_1000194122 461
473 3300005614 Ga0068856_100000105 Ga0068856_10000010550 461
474 3300005614 Ga0068856_100062489 Ga0068856_1000624893 461
475 3300005615 Ga0070702_100026225 Ga0070702_1000262252 461
476 3300005616 Ga0068852_100000657 Ga0068852_10000065718 461
477 3300005616 Ga0068852_100071851 Ga0068852_1000718512 461
478 3300005616 Ga0068852_100220107 Ga0068852_1002201072 461
479 3300005617 Ga0068859_100040590 Ga0068859_1000405903 461
480 3300005617 Ga0068859_100215420 Ga0068859_1002154202 461
481 3300005618 Ga0068864_100014646 Ga0068864_1000146463 461
482 3300005834 Ga0068851_10002400 Ga0068851_100024003 461
483 3300005834 Ga0068851_10004032 Ga0068851_100040325 461
484 3300005841 Ga0068863_100038522 Ga0068863_1000385222 461
485 3300005841 Ga0068863_100082128 Ga0068863_1000821282 461
486 3300005841 Ga0068863_100091842 Ga0068863_1000918422 461
487 3300005842 Ga0068858_100002093 Ga0068858_1000020936 461
488 3300005842 Ga0068858_100024262 Ga0068858_1000242622 461
489 3300006038 Ga0075365_10006297 Ga0075365_100062972 461
490 3300006048 Ga0075363_100027756 Ga0075363_1000277562 461
491 3300006058 Ga0075432_10008307 Ga0075432_100083072 461
492 3300006177 Ga0075362_10005224 Ga0075362_100052245 461
493 3300006177 Ga0075362_10024609 Ga0075362_100246092 461
494 3300006178 Ga0075367_10038654 Ga0075367_100386543 461
495 3300006195 Ga0075366_10002236 Ga0075366_1000223611 461
496 3300006195 Ga0075366_10015544 Ga0075366_100155441 461
497 3300006195 Ga0075366_10026976 Ga0075366_100269762 461
498 3300006195 Ga0075366_10141961 Ga0075366_101419611 461
499 3300006237 Ga0097621_100003706 Ga0097621_10000370610 461
500 3300006353 Ga0075370_10003518 Ga0075370_100035186 461
501 3300006353 Ga0075370_10006457 Ga0075370_100064571 461
502 3300006353 Ga0075370_10017583 Ga0075370_100175832 461
503 3300006353 Ga0075370_10038206 Ga0075370_100382062 461
504 3300006353 Ga0075370_10038706 Ga0075370_100387062 461
505 3300006353 Ga0075370_10047214 Ga0075370_100472142 461
506 3300006353 Ga0075370_10067516 Ga0075370_100675162 461
507 3300006353 Ga0075370_10109081 Ga0075370_101090811 461
508 3300006358 Ga0068871_100007836 Ga0068871_1000078364 461
509 3300006844 Ga0075428_100007264 Ga0075428_1000072645 461
510 3300006844 Ga0075428_100027967 Ga0075428_1000279674 461
511 3300006844 Ga0075428_100126167 Ga0075428_1001261672 461
512 3300006847 Ga0075431_100017842 Ga0075431_1000178427 461
513 3300006852 Ga0075433_10056526 Ga0075433_100565262 461
514 3300006881 Ga0068865_100023267 Ga0068865_1000232672 461
515 3300006931 Ga0097620_100040590 Ga0097620_1000405903 461
516 3300006931 Ga0097620_100215428 Ga0097620_1002154282 461
517 3300006948 Ga0099826_10013779 Ga0099826_100137794 461
518 3300007076 Ga0075435_100009943 Ga0075435_1000099437 461
519 3300007265 Ga0099794_10007301 Ga0099794_100073014 461
520 3300009036 Ga0105244_10013167 Ga0105244_100131675 461
521 3300009093 Ga0105240_10008549 Ga0105240_100085499 461
522 3300009093 Ga0105240_10047106 Ga0105240_100471062 461
523 3300009093 Ga0105240_10056972 Ga0105240_100569722 461
524 3300009093 Ga0105240_10072570 Ga0105240_100725702 461
525 3300009094 Ga0111539_10003794 Ga0111539_100037946 461
526 3300009094 Ga0111539_10076735 Ga0111539_100767353 461
527 3300009147 Ga0114129_10000191 Ga0114129_1000019133 461
528 3300009148 Ga0105243_10001633 Ga0105243_1000163312 461
529 3300009148 Ga0105243_10094247 Ga0105243_100942471 461
530 3300009148 Ga0105243_10114106 Ga0105243_101141062 461
531 3300009148 Ga0105243_10175915 Ga0105243_101759151 461
532 3300009174 Ga0105241_10029165 Ga0105241_100291653 461
533 3300009176 Ga0105242_10011209 Ga0105242_100112093 461
534 3300009176 Ga0105242_10095363 Ga0105242_100953632 461
535 3300009177 Ga0105248_10231613 Ga0105248_102316132 461
536 3300009545 Ga0105237_10011535 Ga0105237_100115353 461
537 3300010375 Ga0105239_10064425 Ga0105239_100644252 461
538 3300011119 Ga0105246_10095577 Ga0105246_100955772 461
539 3300012513 Ga0157326_1001558 Ga0157326_10015582 461
540 3300013100 Ga0157373_10010719 Ga0157373_100107195 461
541 3300013102 Ga0157371_10000223 Ga0157371_1000022348 461
542 3300013104 Ga0157370_10000074 Ga0157370_1000007451 461
543 3300013105 Ga0157369_10001333 Ga0157369_1000133326 461
544 3300013105 Ga0157369_10042171 Ga0157369_100421713 461
545 3300013306 Ga0163162_10028421 Ga0163162_100284213 461
546 3300013307 Ga0157372_10000085 Ga0157372_1000008548 461
547 3300013308 Ga0157375_10017231 Ga0157375_100172314 461
548 3300013308 Ga0157375_10070595 Ga0157375_100705951 461
549 3300013308 Ga0157375_10306790 Ga0157375_103067902 461
550 3300014497 Ga0182008_10003393 Ga0182008_100033937 461
551 3300014497 Ga0182008_10005698 Ga0182008_100056983 461
552 3300014745 Ga0157377_10013626 Ga0157377_100136262 461
553 3300015261 Ga0182006_1000867 Ga0182006_100086716 461
554 3300015261 Ga0182006_1003465 Ga0182006_10034653 461
555 3300015262 Ga0182007_10006348 Ga0182007_100063483 461
556 3300015262 Ga0182007_10027387 Ga0182007_100273872 461
557 3300015683 Ga0183362_10001 Ga0183362_100011489 461
558 3300017792 Ga0163161_10001379 Ga0163161_100013798 461
559 3300017792 Ga0163161_10004878 Ga0163161_1000487810 461
560 3300020610 Ga0154015_1416575 Ga0154015_14165756 461
561 3300021361 Ga0213872_10000029 Ga0213872_1000002929 461
562 3300021361 Ga0213872_10000618 Ga0213872_1000061814 461
563 3300025206 Ga0209435_100001 Ga0209435_1000011148 461
564 3300025224 Ga0209784_100008 Ga0209784_100008477 461
565 3300025224 Ga0209784_100500 Ga0209784_10050015 461
566 3300025224 Ga0209784_101272 Ga0209784_1012723 461
567 3300025225 Ga0209566_100006 Ga0209566_100006477 461
568 3300025225 Ga0209566_100280 Ga0209566_10028012 461
569 3300025225 Ga0209566_102291 Ga0209566_1022913 461
570 3300025226 Ga0209674_100070 Ga0209674_10007056 461
571 3300025226 Ga0209674_100741 Ga0209674_1007419 461
572 3300025228 Ga0209672_100436 Ga0209672_10043611 461
573 3300025228 Ga0209672_101988 Ga0209672_1019883 461
574 3300025229 Ga0209147_100005 Ga0209147_100005484 461
575 3300025229 Ga0209147_100541 Ga0209147_10054121 461
576 3300025230 Ga0209563_100016 Ga0209563_100016477 461
577 3300025242 Ga0209258_100007 Ga0209258_100007484 461
578 3300025242 Ga0209258_100022 Ga0209258_100022133 461
579 3300025246 Ga0209646_1000001 Ga0209646_10000011517 461
580 3300025246 Ga0209646_1000016 Ga0209646_1000016278 461
581 3300025250 Ga0209026_1000001 Ga0209026_1000001169 461
582 3300025250 Ga0209026_1001650 Ga0209026_10016502 461
583 3300025253 Ga0209677_100008 Ga0209677_100008216 461
584 3300025254 Ga0209148_1000034 Ga0209148_1000034133 461
585 3300025254 Ga0209148_1000051 Ga0209148_100005192 461
586 3300025256 Ga0209759_1000001 Ga0209759_10000011148 461
587 3300025256 Ga0209759_1000684 Ga0209759_100068418 461
588 3300025256 Ga0209759_1002409 Ga0209759_10024093 461
589 3300025256 Ga0209759_1019363 Ga0209759_10193631 461
590 3300025258 Ga0209129_1000023 Ga0209129_1000023212 461
591 3300025263 Ga0209565_1000096 Ga0209565_1000096101 461
592 3300025263 Ga0209565_1000288 Ga0209565_100028841 461
593 3300025272 Ga0209455_1000011 Ga0209455_1000011409 461
594 3300025273 Ga0209673_1000232 Ga0209673_100023229 461
595 3300025273 Ga0209673_1000838 Ga0209673_100083836 461
596 3300025273 Ga0209673_1004143 Ga0209673_10041435 461
597 3300025273 Ga0209673_1006206 Ga0209673_10062065 461
598 3300025284 Ga0209130_1000113 Ga0209130_100011389 461
599 3300025284 Ga0209130_1000508 Ga0209130_100050822 461
600 3300025284 Ga0209130_1001465 Ga0209130_10014653 461
601 3300025284 Ga0209130_1002443 Ga0209130_10024435 461
602 3300025284 Ga0209130_1012728 Ga0209130_10127282 461
603 3300025291 Ga0209675_1000128 Ga0209675_100012882 461
604 3300025291 Ga0209675_1000276 Ga0209675_100027641 461
605 3300025291 Ga0209675_1002475 Ga0209675_10024757 461
606 3300025291 Ga0209675_1002568 Ga0209675_10025682 461
607 3300025291 Ga0209675_1003811 Ga0209675_10038115 461
608 3300025292 Ga0209676_1000005 Ga0209676_1000005590 461
609 3300025292 Ga0209676_1000054 Ga0209676_1000054187 461
610 3300025292 Ga0209676_1000418 Ga0209676_100041813 461
611 3300025292 Ga0209676_1000705 Ga0209676_100070513 461
612 3300025294 Ga0209025_1000531 Ga0209025_100053154 461
613 3300025294 Ga0209025_1001493 Ga0209025_100149318 461
614 3300025294 Ga0209025_1003884 Ga0209025_10038848 461
615 3300025294 Ga0209025_1006696 Ga0209025_10066965 461
616 3300025294 Ga0209025_1014270 Ga0209025_10142703 461
617 3300025294 Ga0209025_1020721 Ga0209025_10207212 461
618 3300025294 Ga0209025_1053271 Ga0209025_10532711 461
619 3300025295 Ga0209564_1000394 Ga0209564_100039473 461
620 3300025295 Ga0209564_1000912 Ga0209564_100091228 461
621 3300025295 Ga0209564_1001098 Ga0209564_10010984 461
622 3300025295 Ga0209564_1021392 Ga0209564_10213922 461
623 3300025297 Ga0209758_1000064 Ga0209758_1000064113 461
624 3300025298 Ga0209050_1000007 Ga0209050_1000007507 461
625 3300025298 Ga0209050_1000066 Ga0209050_1000066187 461
626 3300025298 Ga0209050_1000570 Ga0209050_100057010 461
627 3300025298 Ga0209050_1000690 Ga0209050_100069035 461
628 3300025298 Ga0209050_1016296 Ga0209050_10162962 461
629 3300025299 Ga0209256_1000003 Ga0209256_10000031460 461
630 3300025299 Ga0209256_1000020 Ga0209256_1000020484 461
631 3300025299 Ga0209256_1000577 Ga0209256_100057739 461
632 3300025302 Ga0207426_1000001 Ga0207426_10000011119 461
633 3300025302 Ga0207426_1000031 Ga0207426_1000031108 461
634 3300025302 Ga0207426_1020654 Ga0207426_10206541 461
635 3300025303 Ga0209051_1000009 Ga0209051_1000009590 461
636 3300025303 Ga0209051_1000044 Ga0209051_1000044187 461
637 3300025303 Ga0209051_1000363 Ga0209051_100036365 461
638 3300025303 Ga0209051_1000385 Ga0209051_100038555 461
639 3300025303 Ga0209051_1001856 Ga0209051_100185613 461
640 3300025303 Ga0209051_1001872 Ga0209051_10018725 461
641 3300025303 Ga0209051_1012913 Ga0209051_10129134 461
642 3300025304 Ga0209257_1000011 Ga0209257_1000011564 461
643 3300025304 Ga0209257_1000082 Ga0209257_1000082187 461
644 3300025304 Ga0209257_1000502 Ga0209257_100050213 461
645 3300025304 Ga0209257_1017587 Ga0209257_10175871 461
646 3300025321 Ga0207656_10002382 Ga0207656_100023825 461
647 3300025321 Ga0207656_10002699 Ga0207656_100026993 461
648 3300025728 Ga0207655_1001588 Ga0207655_100158815 461
649 3300025913 Ga0207695_10001193 Ga0207695_1000119319 461
650 3300025913 Ga0207695_10111600 Ga0207695_101116002 461
651 3300025913 Ga0207695_10119697 Ga0207695_101196972 461
652 3300025914 Ga0207671_10111753 Ga0207671_101117531 461
653 3300025916 Ga0207663_10076611 Ga0207663_100766111 461
654 3300025920 Ga0207649_10000573 Ga0207649_100005738 461
655 3300025920 Ga0207649_10002026 Ga0207649_1000202612 461
656 3300025925 Ga0207650_10001127 Ga0207650_1000112716 461
657 3300025926 Ga0207659_10005217 Ga0207659_100052173 461
658 3300025926 Ga0207659_10023175 Ga0207659_100231753 461
659 3300025926 Ga0207659_10029587 Ga0207659_100295872 461
660 3300025928 Ga0207700_10000189 Ga0207700_1000018920 461
661 3300025931 Ga0207644_10008443 Ga0207644_100084433 461
662 3300025931 Ga0207644_10047418 Ga0207644_100474183 461
663 3300025933 Ga0207706_10128246 Ga0207706_101282462 461
664 3300025934 Ga0207686_10013089 Ga0207686_100130893 461
665 3300025934 Ga0207686_10063988 Ga0207686_100639882 461
666 3300025935 Ga0207709_10001604 Ga0207709_1000160411 461
667 3300025936 Ga0207670_10029754 Ga0207670_100297544 461
668 3300025937 Ga0207669_10007934 Ga0207669_100079343 461
669 3300025940 Ga0207691_10001444 Ga0207691_100014446 461
670 3300025940 Ga0207691_10009240 Ga0207691_100092406 461
671 3300025940 Ga0207691_10010513 Ga0207691_100105135 461
672 3300025940 Ga0207691_10093396 Ga0207691_100933961 461
673 3300025944 Ga0207661_10007156 Ga0207661_100071564 461
674 3300025945 Ga0207679_10000002 Ga0207679_10000002243 461
675 3300025945 Ga0207679_10001704 Ga0207679_100017045 461
676 3300025945 Ga0207679_10007132 Ga0207679_100071324 461
677 3300025960 Ga0207651_10004833 Ga0207651_100048335 461
678 3300025981 Ga0207640_10017885 Ga0207640_100178852 461
679 3300025986 Ga0207658_10025926 Ga0207658_100259262 461
680 3300026023 Ga0207677_10008356 Ga0207677_100083565 461
681 3300026035 Ga0207703_10001773 Ga0207703_1000177314 461
682 3300026067 Ga0207678_10000003 Ga0207678_10000003212 461
683 3300026078 Ga0207702_10000010 Ga0207702_10000010162 461
684 3300026078 Ga0207702_10099499 Ga0207702_100994992 461
685 3300026078 Ga0207702_10107674 Ga0207702_101076742 461
686 3300026088 Ga0207641_10019102 Ga0207641_100191023 461
687 3300026088 Ga0207641_10190351 Ga0207641_101903512 461
688 3300026089 Ga0207648_10019713 Ga0207648_100197134 461
689 3300026089 Ga0207648_10024255 Ga0207648_100242553 461
690 3300026089 Ga0207648_10067748 Ga0207648_100677484 461
691 3300026089 Ga0207648_10160568 Ga0207648_101605681 461
692 3300026095 Ga0207676_10012287 Ga0207676_100122873 461
693 3300026095 Ga0207676_10020956 Ga0207676_100209565 461
694 3300026116 Ga0207674_10023464 Ga0207674_100234642 461
695 3300026116 Ga0207674_10079210 Ga0207674_100792103 461
696 3300026116 Ga0207674_10107212 Ga0207674_101072121 461
697 3300026116 Ga0207674_10232195 Ga0207674_102321952 461
698 3300026118 Ga0207675_100065898 Ga0207675_1000658983 461
699 3300026118 Ga0207675_100267998 Ga0207675_1002679981 461
700 3300026121 Ga0207683_10000838 Ga0207683_1000083810 461
701 3300026121 Ga0207683_10015911 Ga0207683_100159112 461
702 3300026121 Ga0207683_10037520 Ga0207683_100375204 461
703 3300026121 Ga0207683_10089575 Ga0207683_100895752 461
704 3300026142 Ga0207698_10001250 Ga0207698_100012505 461
705 3300026142 Ga0207698_10195860 Ga0207698_101958601 461
706 3300027907 Ga0207428_10001012 Ga0207428_1000101216 461
707 3300027907 Ga0207428_10012148 Ga0207428_100121482 461
708 3300028381 Ga0268264_10137133 Ga0268264_101371332 461
709 3300028556 Ga0265337_1032774 Ga0265337_10327741 461
710 3300028653 Ga0265323_10003116 Ga0265323_100031163 461
711 3300028794 Ga0307515_10000028 Ga0307515_10000028291 461
712 3300028794 Ga0307515_10000458 Ga0307515_1000045884 461
713 3300028794 Ga0307515_10056923 Ga0307515_100569232 461
714 3300031241 Ga0265325_10001972 Ga0265325_100019723 461
715 3300031247 Ga0265340_10000047 Ga0265340_1000004721 461
716 3300031250 Ga0265331_10002871 Ga0265331_100028714 461
717 3300031250 Ga0265331_10031690 Ga0265331_100316903 461
718 3300031548 Ga0307408_100000046 Ga0307408_100000046115 461
719 3300031548 Ga0307408_100003007 Ga0307408_1000030079 461
720 3300031548 Ga0307408_100047082 Ga0307408_1000470821 461
721 3300031616 Ga0307508_10019292 Ga0307508_100192922 461
722 3300031649 Ga0307514_10000828 Ga0307514_1000082844 461
723 3300031649 Ga0307514_10046625 Ga0307514_100466252 461
724 3300031711 Ga0265314_10000007 Ga0265314_10000007361 461
725 3300031712 Ga0265342_10001861 Ga0265342_100018614 461
726 3300031727 Ga0316576_10003935 Ga0316576_100039356 461
727 3300031731 Ga0307405_10049640 Ga0307405_100496403 461
728 3300031901 Ga0307406_10002339 Ga0307406_100023398 461
729 3300031901 Ga0307406_10008992 Ga0307406_100089923 461
730 3300031901 Ga0307406_10105266 Ga0307406_101052662 461
731 3300031911 Ga0307412_10000135 Ga0307412_1000013515 461
732 3300032002 Ga0307416_100099633 Ga0307416_1000996333 461
733 3300032005 Ga0307411_10011035 Ga0307411_100110352 461
734 3300032005 Ga0307411_10040848 Ga0307411_100408482 461
735 3300035083 Ga0373926_0037748 Ga0373926_0037748_273_1709 461
736 3300035111 Ga0373923_0067250 Ga0373923_0067250_103_1497 461
737 3300035116 Ga0373945_0012903 Ga0373945_0012903_783_2177 461
738 3300035119 Ga0373956_0000193 Ga0373956_0000193_300_1694 461
739 3300035695 Ga0373927_0005732 Ga0373927_0005732_3914_5359 461
740 3300035724 Ga0373933_0000364 Ga0373933_0000364_26734_28128 461
741 3300036401 Ga0373937_0000182 Ga0373937_0000182_56946_58340 461
742 3300037418 Ga0395900_0003483 Ga0395900_0003483_843_2228 461
743 3300037471 Ga0395905_0002802 Ga0395905_0002802_7454_8854 461
744 3300037471 Ga0395905_0018172 Ga0395905_0018172_1304_2785 461
745 3300039450 Ga0436363_0667407 Ga0436363_0667407_76_1494 461
746 3300041404 Ga0439436_0007418 Ga0439436_0007418_1855_3243 461
747 3300041404 Ga0439436_0020373 Ga0439436_0020373_411_1808 461
748 3300041486 Ga0451807_0675626 Ga0451807_0675626_1628_3025 461
749 3300042004 Ga0439445_0008291 Ga0439445_0008291_75_1463 461
750 3300042007 Ga0439449_0008125 Ga0439449_0008125_620_2017 461
751 3300042007 Ga0439449_0012578 Ga0439449_0012578_1671_3059 461
752 3300042014 Ga0439457_009413 Ga0439457_009413_338_1726 461
753 3300042156 Ga0439446_0019780 Ga0439446_0019780_119_1504 461
754 3300042876 Ga0451577_0043187 Ga0451577_0043187_1831_3228 461
755 3300044656 Ga0466969_0016894 Ga0466969_0016894_1901_3304 461
756 3300044684 Ga0466966_0006418 Ga0466966_0006418_2178_3581 461
757 3300044693 Ga0466961_0011024 Ga0466961_0011024_1987_3390 461
758 3300044694 Ga0466963_0008073 Ga0466963_0008073_2620_4023 461
759 3300044706 Ga0466964_0003328 Ga0466964_0003328_3606_5030 461
760 3300044706 Ga0466964_0004632 Ga0466964_0004632_2239_3642 461
761 3300044712 Ga0453684_0009901 Ga0453684_0009901_8460_9857 461
762 3300044719 Ga0466971_0004295 Ga0466971_0004295_2431_3834 461
763 3300044765 Ga0466970_0004172 Ga0466970_0004172_2560_3963 461
764 3300044842 Ga0466957_0014724 Ga0466957_0014724_985_2388 461
765 3300045049 Ga0466959_0000063 Ga0466959_0000063_10739_12142 461
766 3300045051 Ga0451576_0013881 Ga0451576_0013881_855_2252 461
767 3300045051 Ga0451576_0044822 Ga0451576_0044822_2153_3607 461
768 3300045051 Ga0451576_0136973 Ga0451576_0136973_721_2121 461
769 3300045836 Ga0466958_0018095 Ga0466958_0018095_1946_3349 461
770 3300046452 Ga0495617_012554 Ga0495617_012554_1448_2845 461
771 3300046452 Ga0495617_038624 Ga0495617_038624_156_1553 461
772 3300046457 Ga0495590_0010273 Ga0495590_0010273_1263_2660 461
773 3300046460 Ga0495638_0002153 Ga0495638_0002153_14306_15703 461
774 3300046460 Ga0495638_0061966 Ga0495638_0061966_44_1441 461
775 3300046462 Ga0495651_0000027 Ga0495651_0000027_2163_3557 461
776 3300046472 Ga0495580_0021078 Ga0495580_0021078_323_1768 461
777 3300046472 Ga0495580_0028185 Ga0495580_0028185_676_2073 461
778 3300046473 Ga0495582_0011400 Ga0495582_0011400_1385_2830 461
779 3300046474 Ga0495605_0001486 Ga0495605_0001486_2732_4129 461
780 3300046491 Ga0495584_0000621 Ga0495584_0000621_12485_13882 461
781 3300046492 Ga0495585_0007084 Ga0495585_0007084_5451_6848 461
782 3300046492 Ga0495585_0059195 Ga0495585_0059195_44_1441 461
783 3300046499 Ga0495594_0002498 Ga0495594_0002498_3071_4516 461
784 3300046506 Ga0495583_0000016 Ga0495583_0000016_180239_181636 461
785 3300046507 Ga0495606_0002620 Ga0495606_0002620_1398_2792 461
786 3300046513 Ga0495616_0004257 Ga0495616_0004257_5036_6433 461
787 3300046513 Ga0495616_0005761 Ga0495616_0005761_1730_3127 461
788 3300046513 Ga0495616_0027002 Ga0495616_0027002_875_2272 461
789 3300046516 Ga0495628_0005560 Ga0495628_0005560_8335_9729 461
790 3300046516 Ga0495628_0094618 Ga0495628_0094618_223_1617 461
791 3300046520 Ga0495637_0045719 Ga0495637_0045719_416_1813 461
792 3300046522 Ga0495643_0003120 Ga0495643_0003120_4091_5488 461
793 3300046524 Ga0495648_0000593 Ga0495648_0000593_16890_18287 461
794 3300046526 Ga0495666_0064639 Ga0495666_0064639_231_1667 461
795 3300046529 Ga0495652_0036854 Ga0495652_0036854_1792_3186 461
796 3300046531 Ga0495665_0003964 Ga0495665_0003964_1766_3211 461
797 3300046542 Ga0495597_0004154 Ga0495597_0004154_4112_5527 461
798 3300046542 Ga0495597_0015616 Ga0495597_0015616_818_2215 461
799 3300046543 Ga0495645_0002395 Ga0495645_0002395_8791_10185 461
800 3300046557 Ga0495622_0005439 Ga0495622_0005439_1388_2833 461
801 3300046558 Ga0495633_0002301 Ga0495633_0002301_2574_3971 461
802 3300046558 Ga0495633_0015720 Ga0495633_0015720_2451_3848 461
803 3300046615 Ga0495656_0000110 Ga0495656_0000110_6126_7520 461
804 3300046642 Ga0495634_0019399 Ga0495634_0019399_767_2212 461
805 3300046648 Ga0495611_0008728 Ga0495611_0008728_626_2023 461
806 3300046660 Ga0495625_0002383 Ga0495625_0002383_15614_17011 461
807 3300046660 Ga0495625_0010249 Ga0495625_0010249_1562_2959 461
808 3300046663 Ga0495635_0030188 Ga0495635_0030188_1522_2967 461
809 3300046664 Ga0495659_0007216 Ga0495659_0007216_1419_2816 461
810 3300046665 Ga0495661_0002005 Ga0495661_0002005_14206_15603 461
811 3300046678 Ga0495599_0022849 Ga0495599_0022849_2353_3747 461
812 3300046681 Ga0495647_0011450 Ga0495647_0011450_867_2312 461
813 3300046683 Ga0495658_0001699 Ga0495658_0001699_8902_10347 461
814 3300046684 Ga0495669_0025706 Ga0495669_0025706_99_1493 461
815 3300046691 Ga0495670_0002770 Ga0495670_0002770_3601_4998 461
816 3300046691 Ga0495670_0005224 Ga0495670_0005224_1425_2822 461
817 3300046692 Ga0495671_0080841 Ga0495671_0080841_44_1441 461
818 3300047315 Ga0495581_0008234 Ga0495581_0008234_577_2022 461
819 3300047318 Ga0495636_0000920 Ga0495636_0000920_7405_8802 461
820 3300047320 Ga0495672_0012407 Ga0495672_0012407_2702_4099 461
821 3300047321 Ga0495676_0012265 Ga0495676_0012265_4251_5648 461
822 3300047321 Ga0495676_0016453 Ga0495676_0016453_2517_3962 461
823 3300047323 Ga0495683_0006098 Ga0495683_0006098_3651_5048 461
824 3300047443 Ga0495687_000138 Ga0495687_000138_50490_51905 461
825 3300047443 Ga0495687_006782 Ga0495687_006782_4813_6210 461
826 3300047443 Ga0495687_025727 Ga0495687_025727_1171_2589 461
827 3300047445 Ga0495677_0003212 Ga0495677_0003212_1437_2834 461
828 3300047447 Ga0495685_000219 Ga0495685_000219_7384_8781 461
829 3300047469 Ga0495673_0000060 Ga0495673_0000060_198238_199635 461
830 3300047472 Ga0495686_0006352 Ga0495686_0006352_2067_3500 461
831 3300047673 Ga0495593_0000759 Ga0495593_0000759_3491_4936 461
832 3300047673 Ga0495593_0011141 Ga0495593_0011141_3350_4747 461
833 3300048903 Ga0496100_0018668 Ga0496100_0018668_1896_3293 461
834 3300048904 Ga0496101_0061878 Ga0496101_0061878_1035_2429 461
835 3300048905 Ga0496102_0071667 Ga0496102_0071667_346_1764 461
836 3300048910 Ga0496107_0137097 Ga0496107_0137097_311_1705 461
837 3300048911 Ga0496108_0040990 Ga0496108_0040990_321_1718 461
838 3300048912 Ga0496109_0024792 Ga0496109_0024792_1145_2539 461
839 3300048912 Ga0496109_0027408 Ga0496109_0027408_2581_3999 461
840 3300048913 Ga0496110_0004858 Ga0496110_0004858_4085_5479 461
841 3300048914 Ga0496111_0053081 Ga0496111_0053081_1210_2604 461
842 3300048914 Ga0496111_0086850 Ga0496111_0086850_210_1628 461
843 3300048915 Ga0496112_0050038 Ga0496112_0050038_630_2048 461
844 3300048918 Ga0496115_0066235 Ga0496115_0066235_111_1529 461
845 3300048919 Ga0496116_0010521 Ga0496116_0010521_127_1521 461
846 3300048920 Ga0496117_0025555 Ga0496117_0025555_365_1762 461
847 3300048922 Ga0496119_0035106 Ga0496119_0035106_1470_2867 461
848 3300048924 Ga0496121_0000314 Ga0496121_0000314_29453_30850 461
849 3300048925 Ga0496122_0000046 Ga0496122_0000046_64353_65747 461
850 3300048925 Ga0496122_0000217 Ga0496122_0000217_117988_119385 461
851 3300048926 Ga0496123_0000082 Ga0496123_0000082_26249_27643 461
852 3300048926 Ga0496123_0001126 Ga0496123_0001126_6486_7883 461
853 3300048926 Ga0496123_0022919 Ga0496123_0022919_128_1525 461
854 3300048927 Ga0496124_0000038 Ga0496124_0000038_54642_56036 461
855 3300048927 Ga0496124_0057503 Ga0496124_0057503_728_2125 461
856 3300048928 Ga0496125_0000028 Ga0496125_0000028_138499_139896 461
857 3300048928 Ga0496125_0000532 Ga0496125_0000532_59199_60587 461
858 3300048928 Ga0496125_0079036 Ga0496125_0079036_1061_2446 461
859 3300049460 Ga0495682_0002647 Ga0495682_0002647_6934_8331 461
860 3300049571 Ga0501034_0006242 Ga0501034_0006242_6558_7952 461
861 3300049578 Ga0501042_0143664 Ga0501042_0143664_95_1483 461
862 3300049589 Ga0501073_0009188 Ga0501073_0009188_5675_7072 461
863 3300049589 Ga0501073_0019817 Ga0501073_0019817_2192_3589 461
864 3300049592 Ga0501076_0025005 Ga0501076_0025005_1103_2512 461
865 3300049742 Ga0501080_0007975 Ga0501080_0007975_2783_4180 461
866 3300049744 Ga0501083_0007469 Ga0501083_0007469_3791_5188 461
867 3300049822 Ga0501035_0067904 Ga0501035_0067904_1004_2404 461
868 3300050489 nmdc:mga03683_20354_c1 nmdc:mga03683_20354_c1_38_1429 461
869 3300050491 nmdc:mga00v17_10232_c1 nmdc:mga00v17_10232_c1_396_1793 461
870 3300050493 nmdc:mga0k408_26727_c1 nmdc:mga0k408_26727_c1_1840_3255 461
871 3300050493 nmdc:mga0k408_6553_c1 nmdc:mga0k408_6553_c1_4287_5702 461
872 3300050494 nmdc:mga06z11_50874_c1 nmdc:mga06z11_50874_c1_659_2074 461
873 3300050496 nmdc:mga07m45_19735_c1 nmdc:mga07m45_19735_c1_614_2041 461
874 3300050496 nmdc:mga07m45_21064_c1 nmdc:mga07m45_21064_c1_274_1689 461
875 3300050496 nmdc:mga07m45_2832_c1 nmdc:mga07m45_2832_c1_4453_5850 461
876 3300050496 nmdc:mga07m45_43302_c1 nmdc:mga07m45_43302_c1_531_1916 461
877 3300050496 nmdc:mga07m45_61657_c1 nmdc:mga07m45_61657_c1_18_1433 461
878 3300050496 nmdc:mga07m45_8065_c1 nmdc:mga07m45_8065_c1_810_2225 461
879 3300050507 nmdc:mga05p37_109213_c1 nmdc:mga05p37_109213_c1_1700_3094 461
880 3300050509 nmdc:mga0qj67_172497_c1 nmdc:mga0qj67_172497_c1_316_1707 461
881 3300050509 nmdc:mga0qj67_61514_c1 nmdc:mga0qj67_61514_c1_623_2014 461
882 3300050510 nmdc:mga06r32_704_c1 nmdc:mga06r32_704_c1_25731_27128 461
883 3300050511 nmdc:mga08y16_59229_c1 nmdc:mga08y16_59229_c1_727_2124 461
884 3300050511 nmdc:mga08y16_7529_c1 nmdc:mga08y16_7529_c1_5058_6449 461
885 3300050513 nmdc:mga0rr50_11608_c1 nmdc:mga0rr50_11608_c1_2471_3865 461
886 3300050513 nmdc:mga0rr50_119039_c1 nmdc:mga0rr50_119039_c1_397_1791 461
887 3300050513 nmdc:mga0rr50_33844_c1 nmdc:mga0rr50_33844_c1_796_2193 461
888 3300050513 nmdc:mga0rr50_7922_c1 nmdc:mga0rr50_7922_c1_4724_6133 461
889 3300050514 nmdc:mga08x19_118322_c1 nmdc:mga08x19_118322_c1_26_1420 461
890 3300050515 nmdc:mga0a205_95540_c1 nmdc:mga0a205_95540_c1_1103_2500 461
891 3300053079 Ga0500610_0000344 Ga0500610_0000344_385_1782 461
892 3300053079 Ga0500610_0020666 Ga0500610_0020666_385_1782 461
893 3300053093 Ga0500651_0000353 Ga0500651_0000353_19879_21276 461
894 3300053094 Ga0500566_0000008 Ga0500566_0000008_45009_46445 461
895 3300053108 Ga0500562_004134 Ga0500562_004134_1782_3182 461
896 3300053111 Ga0500572_001770 Ga0500572_001770_3085_4521 461
897 3300053123 Ga0500614_003737 Ga0500614_003737_1115_2551 461
898 3300053139 Ga0500568_0005309 Ga0500568_0005309_4116_5513 461
899 3300053150 Ga0500603_000040 Ga0500603_000040_4323_5759 461
900 3300053163 Ga0500639_000010 Ga0500639_000010_71721_73157 461
901 3300053178 Ga0500637_0024809 Ga0500637_0024809_906_2342 461
902 3300059643 Ga0587072_001478 Ga0587072_001478_433_1818 461
903 3300061719 Ga0466962_0008617 Ga0466962_0008617_1540_2943 461
904 iso_pu_bacteria 2513020051 2513227406 461
905 iso_pu_bacteria 2599185214 2599624514 461
906 iso_pu_bacteria 2599185226 2599672624 461
907 iso_pu_bacteria 2599185227 2599683624 461
908 iso_pu_bacteria 2599185229 2599694233 461
909 iso_pu_bacteria 2643221544 2643745913 461
910 iso_pu_bacteria 2643221628 2644163167 461
911 iso_pu_bacteria 2643221639 2644220868 461
912 iso_pu_bacteria 2643221646 2644259689 461
913 iso_pu_bacteria 2643221658 2644328078 461
914 iso_pu_bacteria 2643221672 2644398613 461
915 iso_pu_bacteria 2738541277 2738720186 461
916 iso_pu_bacteria 2738541307 2738881730 461
917 iso_pu_bacteria 2738543019 2739279385 461
918 iso_pu_bacteria 2818991446 2819595927 461
919 iso_pu_bacteria 2831265667 2831266924 461
920 iso_pu_bacteria 2838054893 2838056983 461
921 iso_pu_bacteria 2842677519 2842678798 461
922 iso_pu_bacteria 2842733646 2842735547 461
923 iso_pu_bacteria 2885198086 2885199021 461
924 iso_pu_bacteria 2885211737 2885212716 461
925 iso_pu_bacteria 2899924645 2899925275 461
926 iso_pu_bacteria 2904449895 2904456432 461
927 iso_pu_bacteria 2904456579 2904460705 461
928 iso_pu_bacteria 2904541872 2904548380 461
929 iso_pu_bacteria 2919462493 2919464427 461
930 iso_pu_bacteria 2928037797 2928038602 461
931 iso_pu_bacteria 2928044640 2928045793 461
932 iso_pu_bacteria 2928051484 2928053410 461
933 iso_pu_bacteria 2928064002 2928067015 461
934 iso_pu_bacteria 2928070936 2928071086 461
935 iso_pu_bacteria 2928084124 2928084972 461
936 iso_pu_bacteria 2929160207 2929163773 461
937 iso_pu_bacteria 2929520902 2929524915 461
938 iso_pu_bacteria 2945909444 2945912432 461
939 iso_pu_bacteria 2945945610 2945948342 461
940 iso_pu_bacteria 2945972063 2945977017 461
941 iso_pu_bacteria 2945984333 2945985250 461
942 iso_pu_bacteria 2954767861 2954771993 461

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10415

FumaraseC_C

Fumarase C C-terminus

364

417

0.98

PF00206

Lyase_1

Lyase

13

298

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tv2-assembly1.cif.gz_A structure of a class ii fumarate hydratase from burkholderia pseudomallei 0.9808 4 460
6os7-assembly1.cif.gz_A-2 e. coli fumarase mutant - r126a 0.9807 2 460
6nz9-assembly1.cif.gz_B crystal structure of e. coli fumarase c bound to citrate at 1.53 angstrom resolution 0.9806 2 460
6nz9-assembly1.cif.gz_A-2 crystal structure of e. coli fumarase c bound to citrate at 1.53 angstrom resolution 0.9803 2 460
6nzc-assembly1.cif.gz_B-2 crystal structure of e. coli fumarase c n326a variant with closed ss loop at 1.40 angstrom resolution 0.98 2 460
ID Description Score Start End Superfamily
1fuoB03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 1.006 408 456 1.10.40.30
3tv2A03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 1.003 408 460 1.10.40.30
5uppB03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 1.001 408 458 1.10.40.30
3e04D03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 1.001 408 458 1.10.40.30
5uppA03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 1 408 458 1.10.40.30
ID Description Score Start End GO Terms
AF-A0A447KZK2-F1-model_v4 fumarate hydratase (EC 4.2.1.2) 0.9948 3 224 GO:0004333
GO:0006099
GO:0006106
GO:0006108
AF-A0A383EM57-F1-model_v4 Fumarate lyase N-terminal domain-containing protein 0.9899 4 112 GO:0005829
GO:0006531
GO:0008797
AF-A0A828RS23-F1-model_v4 deleted 0.9859 1 207
AF-A0A128FKB9-F1-model_v4 Fumarate hydratase class II (EC 4.2.1.2) 0.985 3 164 GO:0004333
GO:0006106
AF-A0A0U1SEZ2-F1-model_v4 fumarate hydratase (EC 4.2.1.2) 0.9836 3 212 GO:0004333
GO:0005739
GO:0006099
GO:0006106
GO:0006108

Feature Viewer

pLDDT pTM Quality
92.87 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map