F486322

General Info

Members Datasets Scaffolds Average Seq Length
940 409 923 254

Family's Representative Sequence

Representative Sequence 3300053117|Ga0500593_029496|Ga0500593_029496_813_1625
Length 270
Sequence MSEAMSDTMAAPTASNTAVPALEVRGVNKNFGALQVARDVNLTLERGARRALIGPNGAGKTSLVNLITGVLKPSSGQVLLGGEDITSWSSAHRARRGLARTFQINQLFRGLSVLENVCLAIGERRGESYNLWRPAGSKAAVIDEALDHLNSLRLVDDALKLVSELPYGRQRLVEIAIALAQKPKVLLLDEPAAGVPSHESHVILDVVASLDPDIAILIIEHDMDVVFRFAQSITVLVAGAVLTEGSPQQILADERVRAVYLGQEADRGHG

Samples

Sample ID Description Type Environment
1 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
2 2841760612 Bosea sp. Tri-49 Isolate Nodule
3 2844104063 Bosea sp. Tri-39 Isolate Nodule
4 2851246043 Bosea sp. Tri-54 Isolate Nodule
5 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
6 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
7 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
8 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
9 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
10 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
11 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
12 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
13 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
14 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
15 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
102 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
133 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
134 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
200 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
202 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
203 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
204 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
205 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
206 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
207 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
208 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
209 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
210 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
211 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
212 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
213 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
214 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
215 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
216 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
217 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
218 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
219 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
220 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
221 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
222 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
223 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
224 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
225 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
226 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
227 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
229 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
231 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
232 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
233 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
234 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
235 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
236 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
237 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
238 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
239 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
240 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
241 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
242 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
243 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
244 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
245 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
246 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
247 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
248 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
249 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
250 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
253 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
254 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
255 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
256 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
257 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
258 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
259 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
260 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
261 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
262 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
263 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
264 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
265 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
266 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
267 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
268 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
269 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
270 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
271 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
272 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
273 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
274 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
275 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
276 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
277 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
278 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
279 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
280 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
281 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
282 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
283 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
284 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
285 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
286 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
287 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
288 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
289 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
290 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
291 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
292 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
293 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
294 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
295 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
296 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
297 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
298 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
299 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
300 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
301 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
302 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
303 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
304 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
305 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
306 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
307 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
308 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
309 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
310 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
311 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
312 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
313 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
314 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
315 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
316 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
317 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
318 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
319 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
320 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
321 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
322 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
323 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
324 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
325 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
326 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
327 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
328 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
329 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
330 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
331 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
332 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
333 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
334 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
335 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
336 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
337 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
338 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
339 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
340 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
341 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
342 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
343 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
344 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
345 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
346 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
347 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
348 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
349 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
350 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
365 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
366 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
367 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
368 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
369 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
370 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
371 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
372 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
373 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
374 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
375 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
376 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
377 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
378 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
381 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
382 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
383 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
384 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
385 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
386 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
387 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
388 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
389 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
390 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
391 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
392 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
393 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
394 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
395 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
396 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
397 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
398 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
399 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
400 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
401 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
402 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
403 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
404 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
405 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
406 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
407 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
408 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
409 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.77
Metatranscriptomes 0.43
Isolates 1.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 1.7
Rhizoplane 6.17
Rhizosphere 89.79
Stem 0
Stem Tuber 0
Unclassified 1.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c000028 3300000041 Bacteria 29588
2 ARSoilOldRDRAFT_c000023 3300000044 Bacteria 34965
3 JGI24737J22298_10000458 3300001990 Bacteria 14018
4 JGI24737J22298_10003428 3300001990 Bacteria 5606
5 Ga0065704_10104383 3300005289 Bacteria 2142
6 Ga0065712_10072517 3300005290 Bacteria 4722
7 Ga0065712_10087111 3300005290 Bacteria 2597
8 Ga0065715_10001564 3300005293 Bacteria 10196
9 Ga0070658_10011642 3300005327 Bacteria 7056
10 Ga0070658_10033788 3300005327 Bacteria 4115
11 Ga0070690_100147733 3300005330 Bacteria 1601
12 Ga0070690_100291039 3300005330 Bacteria 1168
13 Ga0070690_100293859 3300005330 Bacteria 1163
14 Ga0070670_100000437 3300005331 Bacteria 34047
15 Ga0070670_100107537 3300005331 Bacteria 2403
16 Ga0070666_10006881 3300005335 Bacteria 7005
17 Ga0070666_10075867 3300005335 Bacteria 2293
18 Ga0070680_100010932 3300005336 Bacteria 7015
19 Ga0070680_100023460 3300005336 Bacteria 4920
20 Ga0070680_100032247 3300005336 Bacteria 4216
21 Ga0070680_100126715 3300005336 Bacteria 2134
22 Ga0070680_100347009 3300005336 Bacteria 1262
23 Ga0070682_100013961 3300005337 Bacteria 4634
24 Ga0070682_100079462 3300005337 Bacteria 2118
25 Ga0068868_100120853 3300005338 Bacteria 2136
26 Ga0068868_100423853 3300005338 Bacteria 1152
27 Ga0070660_100008614 3300005339 Bacteria 7139
28 Ga0070660_100277606 3300005339 Bacteria 1371
29 Ga0070689_100051873 3300005340 Bacteria 3171
30 Ga0070689_100122333 3300005340 Bacteria 2079
31 Ga0070691_10152228 3300005341 Bacteria 1187
32 Ga0070687_100180124 3300005343 Bacteria 1265
33 Ga0070692_10000008 3300005345 Bacteria 47438
34 Ga0070692_10027989 3300005345 Bacteria 2798
35 Ga0070669_100058695 3300005353 Bacteria 2824
36 Ga0070675_100016085 3300005354 Bacteria 5930
37 Ga0070675_100096738 3300005354 Bacteria 2481
38 Ga0070671_100033139 3300005355 Bacteria 4271
39 Ga0070671_100100134 3300005355 Bacteria 2431
40 Ga0070671_100496951 3300005355 Bacteria 1049
41 Ga0070671_100616961 3300005355 Bacteria 938
42 Ga0070674_100000456 3300005356 Bacteria 20586
43 Ga0070674_100179631 3300005356 Bacteria 1620
44 Ga0070673_100037972 3300005364 Bacteria 3674
45 Ga0070673_100328753 3300005364 Bacteria 1352
46 Ga0070688_100008112 3300005365 Bacteria 5690
47 Ga0070688_100035477 3300005365 Bacteria 3030
48 Ga0070688_100407982 3300005365 Bacteria 1007
49 Ga0070659_100009561 3300005366 Bacteria 7124
50 Ga0070659_100120197 3300005366 Bacteria 2127
51 Ga0070659_100205586 3300005366 Bacteria 1622
52 Ga0070667_100041051 3300005367 Bacteria 3882
53 Ga0070667_100067811 3300005367 Bacteria 3035
54 Ga0070667_100565571 3300005367 Bacteria 1046
55 Ga0070703_10003001 3300005406 Bacteria 4821
56 Ga0070703_10050284 3300005406 Bacteria 1330
57 Ga0070709_10008980 3300005434 Bacteria 5505
58 Ga0070709_10036382 3300005434 Bacteria 2999
59 Ga0070709_10037312 3300005434 Bacteria 2967
60 Ga0070709_10045792 3300005434 Bacteria 2717
61 Ga0070709_10121863 3300005434 Bacteria 1769
62 Ga0070709_10463575 3300005434 Bacteria 956
63 Ga0070714_100035035 3300005435 Bacteria 4205
64 Ga0070714_100057751 3300005435 Bacteria 3322
65 Ga0070714_100137227 3300005435 Bacteria 2192
66 Ga0070713_100020676 3300005436 Bacteria 5050
67 Ga0070713_100258275 3300005436 Bacteria 1591
68 Ga0070710_10053671 3300005437 Bacteria 2271
69 Ga0070701_10217497 3300005438 Bacteria 1138
70 Ga0070711_100043656 3300005439 Bacteria 3038
71 Ga0070711_100102762 3300005439 Bacteria 2082
72 Ga0070711_100163490 3300005439 Bacteria 1690
73 Ga0070711_100214283 3300005439 Bacteria 1493
74 Ga0070705_100048399 3300005440 Bacteria 2463
75 Ga0070705_100158202 3300005440 Bacteria 1511
76 Ga0070705_100165663 3300005440 Bacteria 1482
77 Ga0070705_100174827 3300005440 Bacteria 1449
78 Ga0070700_100005017 3300005441 Bacteria 6979
79 Ga0070694_100011811 3300005444 Bacteria 5415
80 Ga0070694_100060362 3300005444 Bacteria 2585
81 Ga0070694_100069947 3300005444 Bacteria 2415
82 Ga0070708_100025847 3300005445 Bacteria 5021
83 Ga0070663_100036543 3300005455 Bacteria 3413
84 Ga0070678_100061496 3300005456 Bacteria 2768
85 Ga0070662_100009709 3300005457 Bacteria 6298
86 Ga0070662_100121499 3300005457 Bacteria 2003
87 Ga0070681_10087410 3300005458 Bacteria 3070
88 Ga0070681_10214217 3300005458 Bacteria 1842
89 Ga0070681_10440376 3300005458 Bacteria 1215
90 Ga0070681_10639002 3300005458 Bacteria 979
91 Ga0068867_100059792 3300005459 Bacteria 2825
92 Ga0070685_10009054 3300005466 Bacteria 5136
93 Ga0070685_10066335 3300005466 Bacteria 2126
94 Ga0070707_100069965 3300005468 Bacteria 3380
95 Ga0070707_100251491 3300005468 Bacteria 1720
96 Ga0070707_100524883 3300005468 Bacteria 1146
97 Ga0070698_100929307 3300005471 Bacteria 816
98 Ga0070679_100052860 3300005530 Bacteria 4044
99 Ga0070679_100174006 3300005530 Bacteria 2125
100 Ga0070679_100254195 3300005530 Bacteria 1713
101 Ga0070679_100254589 3300005530 Bacteria 1711
102 Ga0070684_100322239 3300005535 Bacteria 1420
103 Ga0068853_100023115 3300005539 Bacteria 5203
104 Ga0070672_100233162 3300005543 Bacteria 1547
105 Ga0070672_100268521 3300005543 Bacteria 1440
106 Ga0070686_100022223 3300005544 Bacteria 3775
107 Ga0070686_100203350 3300005544 Bacteria 1421
108 Ga0070695_100011865 3300005545 Bacteria 5215
109 Ga0070695_100014581 3300005545 Bacteria 4738
110 Ga0070695_100026690 3300005545 Bacteria 3575
111 Ga0070695_100375927 3300005545 Bacteria 1071
112 Ga0070695_100451580 3300005545 Bacteria 985
113 Ga0070696_100024640 3300005546 Bacteria 4090
114 Ga0070696_100091787 3300005546 Bacteria 2163
115 Ga0070696_100115984 3300005546 Bacteria 1933
116 Ga0070693_100011715 3300005547 Bacteria 4421
117 Ga0070693_100047229 3300005547 Bacteria 2449
118 Ga0070704_100003857 3300005549 Bacteria 8632
119 Ga0070704_100030432 3300005549 Bacteria 3617
120 Ga0070704_100140760 3300005549 Bacteria 1883
121 Ga0070704_100744635 3300005549 Bacteria 872
122 Ga0068855_100067277 3300005563 Bacteria 4174
123 Ga0068855_100093341 3300005563 Bacteria 3470
124 Ga0068855_100132246 3300005563 Bacteria 2848
125 Ga0068855_100200073 3300005563 Bacteria 2249
126 Ga0070664_100058305 3300005564 Bacteria 3284
127 Ga0070664_100359893 3300005564 Bacteria 1325
128 Ga0068857_100259640 3300005577 Bacteria 1594
129 Ga0068857_100277508 3300005577 Bacteria 1541
130 Ga0068857_100392680 3300005577 Bacteria 1290
131 Ga0068854_100080568 3300005578 Bacteria 2403
132 Ga0068856_100041527 3300005614 Bacteria 4521
133 Ga0068856_100137973 3300005614 Bacteria 2445
134 Ga0068856_100262757 3300005614 Bacteria 1742
135 Ga0068856_100373940 3300005614 Bacteria 1444
136 Ga0070702_100071323 3300005615 Bacteria 2053
137 Ga0068852_100042613 3300005616 Bacteria 3843
138 Ga0068852_100282026 3300005616 Bacteria 1602
139 Ga0068852_100398951 3300005616 Bacteria 1353
140 Ga0068859_100036332 3300005617 Bacteria 4946
141 Ga0068859_100115780 3300005617 Bacteria 2745
142 Ga0068859_100150189 3300005617 Bacteria 2405
143 Ga0068864_100079171 3300005618 Bacteria 2877
144 Ga0068864_100181923 3300005618 Bacteria 1922
145 Ga0068866_10070764 3300005718 Bacteria 1843
146 Ga0068861_100098948 3300005719 Bacteria 2316
147 Ga0068863_100111336 3300005841 Bacteria 2608
148 Ga0068863_100295529 3300005841 Bacteria 1570
149 Ga0068863_100471954 3300005841 Bacteria 1233
150 Ga0068858_100000512 3300005842 Bacteria 40596
151 Ga0068858_100065166 3300005842 Bacteria 3371
152 Ga0068858_100113862 3300005842 Bacteria 2526
153 Ga0068858_100157576 3300005842 Bacteria 2137
154 Ga0068858_100276198 3300005842 Bacteria 1599
155 Ga0068860_100040149 3300005843 Bacteria 4474
156 Ga0068860_100181065 3300005843 Bacteria 2036
157 Ga0068862_100000557 3300005844 Bacteria 38898
158 Ga0068862_100021018 3300005844 Bacteria 5453
159 Ga0068862_100552056 3300005844 Bacteria 1100
160 Ga0081455_10000035 3300005937 Bacteria 136366
161 Ga0081455_10069074 3300005937 Bacteria 2939
162 Ga0070717_10003781 3300006028 Bacteria 10877
163 Ga0070717_10348501 3300006028 Bacteria 1324
164 Ga0070717_10587645 3300006028 Bacteria 1010
165 Ga0070715_10035594 3300006163 Bacteria 2049
166 Ga0070716_100046614 3300006173 Bacteria 2440
167 Ga0070716_100067257 3300006173 Bacteria 2093
168 Ga0070716_100301529 3300006173 Bacteria 1115
169 Ga0070712_100003673 3300006175 Bacteria 9460
170 Ga0070712_100057204 3300006175 Bacteria 2738
171 Ga0070712_100175892 3300006175 Bacteria 1664
172 Ga0075427_10001188 3300006194 Bacteria 3308
173 Ga0097621_100092009 3300006237 Bacteria 2539
174 Ga0068871_100159997 3300006358 Bacteria 1925
175 Ga0075428_100015574 3300006844 Bacteria 8429
176 Ga0075428_100091010 3300006844 Bacteria 3328
177 Ga0075430_100003545 3300006846 Bacteria 13067
178 Ga0075430_100007795 3300006846 Bacteria 9046
179 Ga0075430_100142740 3300006846 Bacteria 1994
180 Ga0075431_100012917 3300006847 Bacteria 8429
181 Ga0075431_100029273 3300006847 Bacteria 5667
182 Ga0075433_10004405 3300006852 Bacteria 10960
183 Ga0075433_10066986 3300006852 Bacteria 3151
184 Ga0075433_10252959 3300006852 Bacteria 1563
185 Ga0075434_100001135 3300006871 Bacteria 21932
186 Ga0075434_100045346 3300006871 Bacteria 4361
187 Ga0075434_100102139 3300006871 Bacteria 2875
188 Ga0075434_100299100 3300006871 Bacteria 1630
189 Ga0075434_100814204 3300006871 Bacteria 950
190 Ga0075429_100000008 3300006880 Bacteria 86739
191 Ga0075429_100001354 3300006880 Bacteria 20025
192 Ga0068865_100000119 3300006881 Bacteria 39895
193 Ga0068865_100117671 3300006881 Bacteria 1970
194 Ga0075436_100010766 3300006914 Bacteria 6274
195 Ga0075436_100019478 3300006914 Bacteria 4650
196 Ga0075436_100052595 3300006914 Bacteria 2812
197 Ga0097620_100036331 3300006931 Bacteria 4946
198 Ga0097620_100115777 3300006931 Bacteria 2745
199 Ga0097620_100150183 3300006931 Bacteria 2405
200 Ga0075435_100042204 3300007076 Bacteria 3649
201 Ga0075435_100045146 3300007076 Bacteria 3531
202 Ga0075435_100047158 3300007076 Bacteria 3459
203 Ga0075435_100213941 3300007076 Bacteria 1636
204 Ga0075435_100219849 3300007076 Bacteria 1613
205 Ga0075435_100267505 3300007076 Bacteria 1457
206 Ga0099795_10007316 3300007788 Bacteria 3073
207 Ga0105251_10024945 3300009011 Bacteria 3064
208 Ga0105240_10035786 3300009093 Bacteria 6394
209 Ga0111539_10001512 3300009094 Bacteria 31036
210 Ga0111539_10019347 3300009094 Bacteria 8406
211 Ga0111539_11143595 3300009094 Bacteria 904
212 Ga0105245_10128369 3300009098 Bacteria 2376
213 Ga0105245_10218347 3300009098 Bacteria 1838
214 Ga0105247_10191744 3300009101 Bacteria 1369
215 Ga0105247_10255653 3300009101 Bacteria 1199
216 Ga0114129_10056907 3300009147 Bacteria 5474
217 Ga0114129_10066967 3300009147 Bacteria 5008
218 Ga0114129_10175903 3300009147 Bacteria 2915
219 Ga0105243_10020499 3300009148 Bacteria 5012
220 Ga0105243_10146344 3300009148 Bacteria 2022
221 Ga0105242_10002839 3300009176 Bacteria 13572
222 Ga0105248_10190862 3300009177 Bacteria 2309
223 Ga0105248_10240117 3300009177 Bacteria 2039
224 Ga0105248_10372572 3300009177 Bacteria 1607
225 Ga0105248_10633902 3300009177 Bacteria 1206
226 Ga0105237_10265205 3300009545 Bacteria 1720
227 Ga0105238_10085262 3300009551 Bacteria 3147
228 Ga0105249_10000215 3300009553 Bacteria 66439
229 Ga0105249_10009891 3300009553 Bacteria 8360
230 Ga0105249_10115843 3300009553 Bacteria 2540
231 Ga0105249_10133900 3300009553 Bacteria 2369
232 Ga0105249_10688926 3300009553 Bacteria 1081
233 Ga0099796_10005784 3300010159 Bacteria 3112
234 Ga0105239_10028262 3300010375 Bacteria 6169
235 Ga0105239_10319600 3300010375 Bacteria 1750
236 Ga0105239_10414397 3300010375 Bacteria 1526
237 Ga0105239_10525955 3300010375 Bacteria 1346
238 Ga0105246_10000019 3300011119 Bacteria 62666
239 Ga0105246_10145180 3300011119 Bacteria 1789
240 Ga0105246_10225498 3300011119 Bacteria 1472
241 Ga0157370_10051700 3300013104 Bacteria 3924
242 Ga0157370_10263703 3300013104 Bacteria 1592
243 Ga0157370_10319230 3300013104 Bacteria 1433
244 Ga0157369_10004736 3300013105 Bacteria 15983
245 Ga0157374_10326771 3300013296 Unclassified 1521
246 Ga0157374_10539711 3300013296 Bacteria 1173
247 Ga0157378_10002701 3300013297 Bacteria 15807
248 Ga0157378_10240375 3300013297 Bacteria 1729
249 Ga0157378_10246363 3300013297 Bacteria 1709
250 Ga0163162_10001187 3300013306 Bacteria 24299
251 Ga0163162_10087104 3300013306 Bacteria 3201
252 Ga0163162_10306353 3300013306 Bacteria 1721
253 Ga0163162_10570722 3300013306 Bacteria 1259
254 Ga0157372_10701660 3300013307 Bacteria 1177
255 Ga0157372_10992013 3300013307 Bacteria 973
256 Ga0157375_10010957 3300013308 Bacteria 7996
257 Ga0157375_10228605 3300013308 Bacteria 2019
258 Ga0157375_10493174 3300013308 Bacteria 1389
259 Ga0157375_10499742 3300013308 Bacteria 1380
260 Ga0163163_10019264 3300014325 Bacteria 6406
261 Ga0163163_10263527 3300014325 Bacteria 1774
262 Ga0163163_10393967 3300014325 Bacteria 1443
263 Ga0157380_10000284 3300014326 Bacteria 30507
264 Ga0157380_10578608 3300014326 Bacteria 1107
265 Ga0182008_10017977 3300014497 Bacteria 3662
266 Ga0182008_10131793 3300014497 Bacteria 1246
267 Ga0157379_10208769 3300014968 Bacteria 1767
268 Ga0157379_10320881 3300014968 Bacteria 1414
269 Ga0157376_10363081 3300014969 Bacteria 1389
270 Ga0163161_10100882 3300017792 Bacteria 2149
271 Ga0163161_10274660 3300017792 Bacteria 1320
272 Ga0206354_10285912 3300020081 Bacteria 1614
273 Ga0206353_10528377 3300020082 Bacteria 2063
274 Ga0206353_11144301 3300020082 Bacteria 1886
275 Ga0213876_10033890 3300021384 Bacteria 2692
276 Ga0213875_10000165 3300021388 Bacteria 68805
277 Ga0207666_1000744 3300025271 Bacteria 3908
278 Ga0207697_10003696 3300025315 Bacteria 7483
279 Ga0207653_10001699 3300025885 Bacteria 7037
280 Ga0207692_10040821 3300025898 Bacteria 2292
281 Ga0207692_10052375 3300025898 Bacteria 2074
282 Ga0207692_10092149 3300025898 Bacteria 1646
283 Ga0207710_10004914 3300025900 Bacteria 5794
284 Ga0207688_10034764 3300025901 Bacteria 2790
285 Ga0207688_10155127 3300025901 Bacteria 1355
286 Ga0207680_10101178 3300025903 Bacteria 1852
287 Ga0207647_10043164 3300025904 Bacteria 2823
288 Ga0207685_10013800 3300025905 Bacteria 2510
289 Ga0207685_10016988 3300025905 Bacteria 2341
290 Ga0207699_10061149 3300025906 Bacteria 2265
291 Ga0207699_10068983 3300025906 Bacteria 2154
292 Ga0207699_10106676 3300025906 Bacteria 1788
293 Ga0207699_10160123 3300025906 Bacteria 1497
294 Ga0207699_10318315 3300025906 Bacteria 1090
295 Ga0207645_10053476 3300025907 Bacteria 2581
296 Ga0207705_10203974 3300025909 Bacteria 1498
297 Ga0207707_10009645 3300025912 Bacteria 8375
298 Ga0207707_10211145 3300025912 Bacteria 1691
299 Ga0207707_10256086 3300025912 Bacteria 1519
300 Ga0207693_10009873 3300025915 Bacteria 7764
301 Ga0207693_10017770 3300025915 Bacteria 5671
302 Ga0207693_10209191 3300025915 Bacteria 1533
303 Ga0207663_10043923 3300025916 Bacteria 2740
304 Ga0207663_10194238 3300025916 Bacteria 1460
305 Ga0207660_10174634 3300025917 Bacteria 1665
306 Ga0207660_10314724 3300025917 Bacteria 1249
307 Ga0207657_10010318 3300025919 Bacteria 9328
308 Ga0207657_10074179 3300025919 Bacteria 2874
309 Ga0207657_10120100 3300025919 Bacteria 2163
310 Ga0207649_10293675 3300025920 Bacteria 1186
311 Ga0207652_10026006 3300025921 Bacteria 4871
312 Ga0207652_10153018 3300025921 Bacteria 2066
313 Ga0207652_10209758 3300025921 Bacteria 1754
314 Ga0207646_10085210 3300025922 Bacteria 2827
315 Ga0207646_10446086 3300025922 Bacteria 1168
316 Ga0207681_10277169 3300025923 Bacteria 1319
317 Ga0207694_10244276 3300025924 Bacteria 1468
318 Ga0207650_10603563 3300025925 Bacteria 923
319 Ga0207659_10028682 3300025926 Bacteria 3784
320 Ga0207687_10006850 3300025927 Bacteria 7503
321 Ga0207687_10179633 3300025927 Bacteria 1639
322 Ga0207700_10004694 3300025928 Bacteria 8096
323 Ga0207700_10018933 3300025928 Bacteria 4640
324 Ga0207700_10426199 3300025928 Bacteria 1166
325 Ga0207664_10041800 3300025929 Bacteria 3573
326 Ga0207664_10098805 3300025929 Bacteria 2408
327 Ga0207664_10410093 3300025929 Bacteria 1206
328 Ga0207644_10120276 3300025931 Bacteria 1998
329 Ga0207644_10312897 3300025931 Bacteria 1268
330 Ga0207644_10432814 3300025931 Bacteria 1079
331 Ga0207690_10040362 3300025932 Bacteria 3051
332 Ga0207690_10231023 3300025932 Bacteria 1420
333 Ga0207706_10017526 3300025933 Bacteria 6456
334 Ga0207706_10088991 3300025933 Bacteria 2714
335 Ga0207686_10035002 3300025934 Bacteria 3011
336 Ga0207686_10038994 3300025934 Bacteria 2879
337 Ga0207709_10070620 3300025935 Bacteria 2215
338 Ga0207670_10112784 3300025936 Bacteria 1962
339 Ga0207669_10026526 3300025937 Bacteria 3153
340 Ga0207669_10119421 3300025937 Bacteria 1786
341 Ga0207704_10024045 3300025938 Bacteria 3295
342 Ga0207665_10000631 3300025939 Bacteria 23652
343 Ga0207665_10265993 3300025939 Bacteria 1272
344 Ga0207665_10267406 3300025939 Bacteria 1268
345 Ga0207665_10480970 3300025939 Bacteria 957
346 Ga0207691_10055482 3300025940 Bacteria 3611
347 Ga0207691_10285128 3300025940 Bacteria 1421
348 Ga0207711_10016598 3300025941 Bacteria 6115
349 Ga0207711_10054868 3300025941 Bacteria 3420
350 Ga0207711_10455513 3300025941 Bacteria 1191
351 Ga0207689_10036982 3300025942 Bacteria 4052
352 Ga0207679_10066279 3300025945 Bacteria 2705
353 Ga0207679_10126399 3300025945 Bacteria 2044
354 Ga0207667_10099491 3300025949 Bacteria 3000
355 Ga0207667_10220282 3300025949 Bacteria 1944
356 Ga0207651_10037972 3300025960 Bacteria 3160
357 Ga0207651_10691524 3300025960 Bacteria 898
358 Ga0207712_10037284 3300025961 Bacteria 3316
359 Ga0207712_10073558 3300025961 Bacteria 2465
360 Ga0207712_10126500 3300025961 Bacteria 1941
361 Ga0207712_10535035 3300025961 Bacteria 1006
362 Ga0207668_10090761 3300025972 Bacteria 2243
363 Ga0207640_10061221 3300025981 Bacteria 2492
364 Ga0207658_10015437 3300025986 Bacteria 5240
365 Ga0207658_10399165 3300025986 Bacteria 1208
366 Ga0207677_10578127 3300026023 Bacteria 983
367 Ga0207639_10092709 3300026041 Bacteria 2421
368 Ga0207678_10014489 3300026067 Bacteria 6931
369 Ga0207678_10027526 3300026067 Bacteria 4961
370 Ga0207678_10036968 3300026067 Bacteria 4250
371 Ga0207708_10002641 3300026075 Bacteria 13186
372 Ga0207708_10281192 3300026075 Bacteria 1348
373 Ga0207702_10101298 3300026078 Bacteria 2543
374 Ga0207702_10204902 3300026078 Bacteria 1831
375 Ga0207702_10281850 3300026078 Bacteria 1571
376 Ga0207641_10118183 3300026088 Bacteria 2361
377 Ga0207641_10161900 3300026088 Bacteria 2035
378 Ga0207641_10190827 3300026088 Bacteria 1883
379 Ga0207648_10038868 3300026089 Bacteria 4187
380 Ga0207648_10289894 3300026089 Bacteria 1465
381 Ga0207676_10072633 3300026095 Bacteria 2766
382 Ga0207674_10235913 3300026116 Bacteria 1777
383 Ga0207674_10266694 3300026116 Bacteria 1660
384 Ga0207674_10301720 3300026116 Bacteria 1550
385 Ga0207675_100028481 3300026118 Bacteria 5201
386 Ga0207683_10045639 3300026121 Bacteria 3832
387 Ga0207683_10054532 3300026121 Bacteria 3505
388 Ga0207683_10141858 3300026121 Bacteria 2165
389 Ga0207698_10126915 3300026142 Bacteria 2172
390 Ga0207698_10158228 3300026142 Bacteria 1977
391 Ga0209966_1001251 3300027695 Bacteria 4513
392 Ga0209966_1001450 3300027695 Bacteria 4112
393 Ga0209966_1008347 3300027695 Bacteria 1837
394 Ga0209998_10000949 3300027717 Bacteria 7357
395 Ga0209998_10009395 3300027717 Bacteria 2030
396 Ga0209974_10001910 3300027876 Bacteria 7600
397 Ga0209974_10087552 3300027876 Bacteria 1077
398 Ga0207428_10000308 3300027907 Bacteria 64810
399 Ga0207428_10000474 3300027907 Bacteria 48360
400 Ga0268266_10051110 3300028379 Bacteria 3547
401 Ga0268266_10294300 3300028379 Bacteria 1513
402 Ga0268265_10026332 3300028380 Bacteria 4137
403 Ga0268265_10612441 3300028380 Bacteria 1042
404 Ga0268264_10159321 3300028381 Bacteria 2031
405 Ga0268264_10359016 3300028381 Bacteria 1389
406 Ga0268264_10476480 3300028381 Bacteria 1213
407 Ga0265338_10002492 3300028800 Bacteria 27463
408 Ga0265338_10064148 3300028800 Bacteria 3197
409 Ga0265762_1006598 3300030760 Bacteria 2074
410 Ga0265330_10003043 3300031235 Bacteria 8895
411 Ga0265332_10001070 3300031238 Bacteria 15993
412 Ga0265325_10000352 3300031241 Bacteria 32405
413 Ga0265325_10052644 3300031241 Bacteria 2089
414 Ga0265325_10165057 3300031241 Bacteria 1039
415 Ga0265340_10006050 3300031247 Bacteria 6672
416 Ga0265340_10034466 3300031247 Bacteria 2518
417 Ga0265340_10100770 3300031247 Bacteria 1342
418 Ga0265339_10000979 3300031249 Bacteria 21883
419 Ga0265339_10005391 3300031249 Bacteria 8520
420 Ga0265339_10012730 3300031249 Bacteria 5120
421 Ga0265339_10015364 3300031249 Bacteria 4590
422 Ga0265316_10044436 3300031344 Bacteria 3534
423 Ga0265316_10084271 3300031344 Bacteria 2434
424 Ga0265313_10000686 3300031595 Bacteria 34918
425 Ga0316579_10024922 3300031691 Bacteria 2696
426 Ga0265314_10003780 3300031711 Bacteria 14466
427 Ga0265314_10005573 3300031711 Bacteria 11319
428 Ga0265342_10000031 3300031712 Bacteria 152577
429 Ga0265342_10000882 3300031712 Bacteria 29894
430 Ga0265342_10004819 3300031712 Bacteria 10468
431 Ga0316583_10000161 3300032133 Bacteria 16491
432 Ga0373930_0000020 3300034816 Bacteria 15356
433 Ga0373930_0012248 3300034816 Bacteria 1562
434 Ga0373948_0000371 3300034817 Bacteria 5533
435 Ga0373948_0012850 3300034817 Bacteria 1502
436 Ga0373950_0000266 3300034818 Bacteria 6589
437 Ga0373958_0000533 3300034819 Bacteria 4759
438 Ga0373959_0000539 3300034820 Bacteria 6764
439 Ga0373938_0000748 3300034957 Bacteria 5254
440 Ga0373926_0004368 3300035083 Bacteria 4639
441 Ga0373926_0016309 3300035083 Bacteria 2539
442 Ga0373926_0106149 3300035083 Bacteria 1053
443 Ga0373928_0004305 3300035084 Bacteria 2718
444 Ga0373929_0000042 3300035085 Bacteria 29236
445 Ga0373934_0013885 3300035086 Bacteria 3047
446 Ga0373934_0042312 3300035086 Bacteria 1799
447 Ga0373934_0054287 3300035086 Bacteria 1591
448 Ga0373940_0000325 3300035088 Bacteria 7005
449 Ga0373944_0019405 3300035089 Bacteria 1950
450 Ga0373949_0001117 3300035090 Bacteria 8122
451 Ga0373951_0000547 3300035091 Bacteria 10574
452 Ga0373952_0000713 3300035092 Bacteria 5943
453 Ga0373952_0008868 3300035092 Bacteria 1914
454 Ga0373952_0021568 3300035092 Bacteria 1361
455 Ga0373923_0002274 3300035111 Bacteria 5855
456 Ga0373923_0041700 3300035111 Bacteria 1893
457 Ga0373932_0001186 3300035112 Bacteria 7459
458 Ga0373932_0002300 3300035112 Bacteria 4857
459 Ga0373936_0001104 3300035113 Bacteria 9672
460 Ga0373936_0019802 3300035113 Bacteria 2610
461 Ga0373936_0084800 3300035113 Bacteria 1322
462 Ga0373939_0000360 3300035114 Bacteria 11493
463 Ga0373939_0011935 3300035114 Bacteria 2205
464 Ga0373941_0001805 3300035115 Bacteria 4608
465 Ga0373941_0005933 3300035115 Bacteria 2911
466 Ga0373945_0000503 3300035116 Bacteria 11108
467 Ga0373953_0000488 3300035117 Bacteria 10969
468 Ga0373953_0048465 3300035117 Bacteria 1712
469 Ga0373954_0004286 3300035118 Bacteria 6131
470 Ga0373954_0057832 3300035118 Bacteria 1826
471 Ga0373956_0014464 3300035119 Bacteria 3298
472 Ga0373956_0024246 3300035119 Bacteria 2611
473 Ga0373957_0005912 3300035120 Bacteria 3826
474 Ga0373957_0016648 3300035120 Bacteria 2548
475 Ga0373957_0052263 3300035120 Bacteria 1565
476 Ga0373957_0133632 3300035120 Bacteria 1011
477 Ga0373960_0003891 3300035121 Bacteria 3403
478 Ga0373960_0019041 3300035121 Bacteria 1798
479 Ga0373960_0036289 3300035121 Bacteria 1403
480 Ga0373943_0003705 3300035170 Bacteria 6950
481 Ga0373943_0010637 3300035170 Bacteria 4128
482 Ga0373943_0027110 3300035170 Bacteria 2689
483 Ga0373946_0001059 3300035171 Bacteria 9481
484 Ga0373946_0002277 3300035171 Bacteria 6784
485 Ga0373955_0000425 3300035172 Bacteria 17797
486 Ga0373955_0129552 3300035172 Bacteria 1472
487 Ga0373955_0139733 3300035172 Bacteria 1419
488 Ga0373942_0001477 3300035207 Bacteria 6050
489 Ga0373942_0003320 3300035207 Bacteria 3782
490 Ga0373942_0018232 3300035207 Bacteria 1740
491 Ga0373961_0003189 3300035241 Bacteria 4093
492 Ga0373962_0000354 3300035242 Bacteria 10085
493 Ga0373962_0013857 3300035242 Bacteria 2048
494 Ga0373924_0049494 3300035410 Bacteria 1739
495 Ga0373931_0030133 3300035691 Bacteria 2791
496 Ga0373931_0053231 3300035691 Bacteria 2159
497 Ga0373931_0252020 3300035691 Bacteria 1074
498 Ga0373935_0000337 3300035692 Bacteria 23756
499 Ga0373935_0003255 3300035692 Bacteria 9390
500 Ga0373935_0036252 3300035692 Bacteria 3083
501 Ga0373935_0040667 3300035692 Bacteria 2918
502 Ga0373935_0076945 3300035692 Bacteria 2161
503 Ga0373927_0011982 3300035695 Bacteria 5768
504 Ga0373927_0039586 3300035695 Bacteria 3060
505 Ga0373927_0039898 3300035695 Bacteria 3046
506 Ga0373927_0043067 3300035695 Bacteria 2924
507 Ga0373927_0071590 3300035695 Bacteria 2244
508 Ga0373933_0002475 3300035724 Bacteria 10393
509 Ga0373933_0010438 3300035724 Bacteria 5091
510 Ga0373933_0019109 3300035724 Bacteria 3864
511 Ga0373933_0024531 3300035724 Bacteria 3452
512 Ga0373933_0071924 3300035724 Bacteria 2106
513 Ga0373933_0344860 3300035724 Bacteria 967
514 Ga0373947_0001536 3300035725 Bacteria 14154
515 Ga0373947_0012712 3300035725 Bacteria 4827
516 Ga0373947_0030383 3300035725 Bacteria 3174
517 Ga0373947_0053434 3300035725 Bacteria 2436
518 Ga0373947_0494248 3300035725 Bacteria 831
519 Ga0373937_0000223 3300036401 Bacteria 54957
520 Ga0373937_0005292 3300036401 Bacteria 11025
521 Ga0373937_0011036 3300036401 Bacteria 7921
522 Ga0373937_0027077 3300036401 Bacteria 5182
523 Ga0373937_0043671 3300036401 Bacteria 4093
524 Ga0373937_0073445 3300036401 Bacteria 3155
525 Ga0373925_0000741 3300037068 Bacteria 29997
526 Ga0373925_0008940 3300037068 Bacteria 7298
527 Ga0373925_0150446 3300037068 Bacteria 1828
528 Ga0373925_0179833 3300037068 Bacteria 1673
529 Ga0373925_0351784 3300037068 Bacteria 1196
530 Ga0395899_0036755 3300037312 Bacteria 3672
531 Ga0395900_0005074 3300037418 Bacteria 13816
532 Ga0395900_0008149 3300037418 Bacteria 10783
533 Ga0395900_0424802 3300037418 Bacteria 1289
534 Ga0395898_0032574 3300037466 Bacteria 5203
535 Ga0395898_0110478 3300037466 Bacteria 2635
536 Ga0395898_0121248 3300037466 Bacteria 2505
537 Ga0436364_1070861 3300037853 Bacteria 2778
538 Ga0436364_1177974 3300037853 Bacteria 47646
539 Ga0395901_0009281 3300038443 Bacteria 9972
540 Ga0395901_0014372 3300038443 Bacteria 8058
541 Ga0436365_0380370 3300039437 Bacteria 3101
542 Ga0436365_0442321 3300039437 Bacteria 3409
543 Ga0436365_0592364 3300039437 Bacteria 2713
544 Ga0436361_0189320 3300039447 Bacteria 1174
545 Ga0436361_0944607 3300039447 Bacteria 2274
546 Ga0436363_0323907 3300039450 Bacteria 2156
547 Ga0436362_0454806 3300039453 Bacteria 1227
548 Ga0436362_1243395 3300039453 Bacteria 1501
549 Ga0439441_006313 3300042001 Bacteria 1876
550 Ga0439441_020180 3300042001 Bacteria 1219
551 Ga0439460_0014322 3300042461 Bacteria 2084
552 Ga0466966_0125083 3300044684 Bacteria 1577
553 Ga0466963_0121732 3300044694 Bacteria 1796
554 Ga0466971_0180933 3300044719 Bacteria 991
555 Ga0466957_0066173 3300044842 Bacteria 2227
556 Ga0466957_0187463 3300044842 Bacteria 1353
557 Ga0451576_0023021 3300045051 Bacteria 6751
558 Ga0451576_0056338 3300045051 Bacteria 4111
559 Ga0466958_0067366 3300045836 Bacteria 2187
560 Ga0466958_0320245 3300045836 Bacteria 996
561 Ga0466967_0022504 3300045976 Bacteria 5144
562 Ga0466967_0450012 3300045976 Bacteria 1258
563 Ga0495592_0000188 3300046454 Bacteria 54485
564 Ga0495592_0007677 3300046454 Bacteria 8074
565 Ga0495592_0060198 3300046454 Bacteria 2794
566 Ga0495592_0067404 3300046454 Bacteria 2615
567 Ga0495592_0180560 3300046454 Bacteria 1438
568 Ga0495603_0015554 3300046455 Bacteria 4605
569 Ga0495603_0091022 3300046455 Bacteria 1783
570 Ga0495591_033479 3300046458 Bacteria 1520
571 Ga0495629_0000222 3300046459 Bacteria 50600
572 Ga0495629_0002114 3300046459 Bacteria 15386
573 Ga0495629_0092397 3300046459 Bacteria 2112
574 Ga0495629_0101992 3300046459 Bacteria 2002
575 Ga0495629_0139671 3300046459 Bacteria 1686
576 Ga0495629_0158420 3300046459 Bacteria 1572
577 Ga0495641_0013226 3300046461 Bacteria 4551
578 Ga0495651_0001439 3300046462 Bacteria 18418
579 Ga0495651_0014733 3300046462 Bacteria 6046
580 Ga0495651_0101853 3300046462 Bacteria 2136
581 Ga0495651_0142149 3300046462 Bacteria 1739
582 Ga0495651_0149293 3300046462 Bacteria 1687
583 Ga0495651_0164873 3300046462 Bacteria 1584
584 Ga0495651_0248429 3300046462 Bacteria 1216
585 Ga0495653_0000198 3300046463 Bacteria 49009
586 Ga0495653_0027955 3300046463 Bacteria 4514
587 Ga0495653_0037313 3300046463 Bacteria 3819
588 Ga0495653_0140058 3300046463 Bacteria 1703
589 Ga0495580_0022328 3300046472 Bacteria 4657
590 Ga0495580_0120836 3300046472 Bacteria 1819
591 Ga0495582_0040673 3300046473 Bacteria 2560
592 Ga0495605_0151191 3300046474 Bacteria 1036
593 Ga0495639_0008708 3300046475 Bacteria 4350
594 Ga0495639_0137851 3300046475 Bacteria 1171
595 Ga0495662_0000720 3300046476 Bacteria 15794
596 Ga0495662_0009876 3300046476 Bacteria 4688
597 Ga0495662_0096654 3300046476 Bacteria 1443
598 Ga0495664_0000002 3300046477 Bacteria 625183
599 Ga0495664_0003233 3300046477 Bacteria 8850
600 Ga0495584_0077382 3300046491 Bacteria 1673
601 Ga0495585_0001425 3300046492 Bacteria 18789
602 Ga0495594_0091858 3300046499 Bacteria 1701
603 Ga0495608_0000009 3300046511 Bacteria 266614
604 Ga0495608_0002323 3300046511 Bacteria 13726
605 Ga0495608_0014885 3300046511 Bacteria 5398
606 Ga0495608_0423360 3300046511 Bacteria 812
607 Ga0495618_0000005 3300046514 Bacteria 230421
608 Ga0495618_0060945 3300046514 Bacteria 2393
609 Ga0495628_0000002 3300046516 Bacteria 589399
610 Ga0495628_0011343 3300046516 Bacteria 7543
611 Ga0495628_0014516 3300046516 Bacteria 6598
612 Ga0495628_0372241 3300046516 Bacteria 1047
613 Ga0495630_0000614 3300046517 Bacteria 25848
614 Ga0495630_0057444 3300046517 Bacteria 2916
615 Ga0495630_0065524 3300046517 Bacteria 2730
616 Ga0495630_0117096 3300046517 Bacteria 2020
617 Ga0495630_0213547 3300046517 Bacteria 1472
618 Ga0495644_0000656 3300046523 Bacteria 14496
619 Ga0495663_0011247 3300046525 Bacteria 2491
620 Ga0495666_0008769 3300046526 Bacteria 5065
621 Ga0495666_0033500 3300046526 Bacteria 2509
622 Ga0495652_0000004 3300046529 Bacteria 588877
623 Ga0495652_0020572 3300046529 Bacteria 5865
624 Ga0495652_0098442 3300046529 Bacteria 2377
625 Ga0495665_0003071 3300046531 Bacteria 9032
626 Ga0495665_0052758 3300046531 Bacteria 2152
627 Ga0495640_0000005 3300046533 Bacteria 318271
628 Ga0495640_0022097 3300046533 Bacteria 4659
629 Ga0495640_0082608 3300046533 Bacteria 2133
630 Ga0495640_0090755 3300046533 Bacteria 2016
631 Ga0495640_0317171 3300046533 Bacteria 966
632 Ga0495640_0438369 3300046533 Bacteria 799
633 Ga0495586_0016023 3300046535 Bacteria 3988
634 Ga0495586_0039975 3300046535 Bacteria 2522
635 Ga0495586_0090372 3300046535 Bacteria 1691
636 Ga0495587_0000007 3300046536 Bacteria 290788
637 Ga0495587_0006576 3300046536 Bacteria 7568
638 Ga0495609_0107194 3300046538 Bacteria 1208
639 Ga0495645_0000003 3300046543 Bacteria 570133
640 Ga0495645_0049212 3300046543 Bacteria 3070
641 Ga0495645_0070637 3300046543 Bacteria 2519
642 Ga0495622_0006136 3300046557 Bacteria 5584
643 Ga0495633_0009720 3300046558 Bacteria 5287
644 Ga0495667_0000002 3300046559 Bacteria 437535
645 Ga0495667_0002675 3300046559 Bacteria 11909
646 Ga0495667_0022163 3300046559 Bacteria 4280
647 Ga0495667_0034249 3300046559 Bacteria 3396
648 Ga0495667_0132571 3300046559 Bacteria 1607
649 Ga0495656_0000262 3300046615 Bacteria 18537
650 Ga0495634_0000129 3300046642 Bacteria 65082
651 Ga0495634_0131359 3300046642 Bacteria 1596
652 Ga0495634_0135142 3300046642 Bacteria 1569
653 Ga0495634_0190723 3300046642 Bacteria 1278
654 Ga0495634_0216474 3300046642 Bacteria 1184
655 Ga0495611_0010698 3300046648 Bacteria 3885
656 Ga0495635_0000289 3300046663 Bacteria 32189
657 Ga0495635_0002537 3300046663 Bacteria 12495
658 Ga0495635_0225378 3300046663 Bacteria 1267
659 Ga0495659_0006163 3300046664 Bacteria 3790
660 Ga0495661_0053372 3300046665 Bacteria 2431
661 Ga0495588_0009638 3300046674 Bacteria 4471
662 Ga0495588_0093201 3300046674 Bacteria 1579
663 Ga0495657_0000781 3300046675 Bacteria 28299
664 Ga0495657_0004771 3300046675 Bacteria 10810
665 Ga0495599_0000001 3300046678 Bacteria 537563
666 Ga0495599_0025159 3300046678 Bacteria 3725
667 Ga0495599_0063998 3300046678 Bacteria 2297
668 Ga0495623_0000001 3300046679 Bacteria 313861
669 Ga0495623_0001394 3300046679 Bacteria 16421
670 Ga0495623_0119546 3300046679 Bacteria 1587
671 Ga0495646_0000013 3300046680 Bacteria 159700
672 Ga0495646_0001135 3300046680 Bacteria 15537
673 Ga0495646_0005931 3300046680 Bacteria 7743
674 Ga0495647_0003047 3300046681 Bacteria 5340
675 Ga0495647_0003641 3300046681 Bacteria 4947
676 Ga0495658_0000656 3300046683 Bacteria 18755
677 Ga0495658_0013420 3300046683 Bacteria 4171
678 Ga0495658_0085832 3300046683 Bacteria 1856
679 Ga0495613_0004890 3300046689 Bacteria 10065
680 Ga0495613_0031920 3300046689 Bacteria 3912
681 Ga0495613_0044829 3300046689 Bacteria 3271
682 Ga0495613_0074197 3300046689 Bacteria 2477
683 Ga0495613_0132259 3300046689 Bacteria 1786
684 Ga0495613_0157754 3300046689 Bacteria 1616
685 Ga0495624_0015796 3300046690 Bacteria 5085
686 Ga0495624_0024272 3300046690 Bacteria 3991
687 Ga0495624_0073691 3300046690 Bacteria 2122
688 Ga0495670_0001048 3300046691 Bacteria 13379
689 Ga0495671_0045891 3300046692 Bacteria 2186
690 Ga0495600_0000233 3300046809 Bacteria 30755
691 Ga0495600_0000708 3300046809 Bacteria 17501
692 Ga0495600_0003719 3300046809 Bacteria 9018
693 Ga0495581_0006809 3300047315 Bacteria 6627
694 Ga0495581_0025414 3300047315 Bacteria 3433
695 Ga0495581_0052490 3300047315 Bacteria 2355
696 Ga0495604_0000005 3300047317 Bacteria 424516
697 Ga0495604_0017043 3300047317 Bacteria 5811
698 Ga0495604_0127058 3300047317 Bacteria 1837
699 Ga0495674_0000003 3300047319 Bacteria 562126
700 Ga0495674_0002023 3300047319 Bacteria 19947
701 Ga0495674_0007365 3300047319 Bacteria 10524
702 Ga0495674_0061512 3300047319 Bacteria 3272
703 Ga0495674_0249218 3300047319 Bacteria 1462
704 Ga0495676_0042309 3300047321 Bacteria 3741
705 Ga0495676_0224287 3300047321 Bacteria 1293
706 Ga0495680_0000002 3300047322 Bacteria 197533
707 Ga0495680_0005048 3300047322 Bacteria 12467
708 Ga0495680_0008971 3300047322 Bacteria 9036
709 Ga0495680_0009889 3300047322 Bacteria 8550
710 Ga0495680_0042831 3300047322 Bacteria 3588
711 Ga0495680_0095117 3300047322 Bacteria 2228
712 Ga0495675_0000437 3300047444 Bacteria 27820
713 Ga0495675_0003495 3300047444 Bacteria 9466
714 Ga0495675_0017856 3300047444 Bacteria 4498
715 Ga0495684_0000020 3300047471 Bacteria 148507
716 Ga0495684_0181447 3300047471 Bacteria 1560
717 Ga0495684_0295581 3300047471 Bacteria 1164
718 Ga0495593_0001400 3300047673 Bacteria 14114
719 Ga0495593_0039987 3300047673 Bacteria 2526
720 Ga0495602_0000027 3300048088 Bacteria 145010
721 Ga0495602_0092297 3300048088 Bacteria 2509
722 Ga0495602_0111968 3300048088 Bacteria 2216
723 Ga0495614_0028550 3300048089 Bacteria 2403
724 Ga0495614_0171943 3300048089 Bacteria 972
725 Ga0496100_0029850 3300048903 Unclassified 3376
726 Ga0496100_0112447 3300048903 Bacteria 1894
727 Ga0496100_0272038 3300048903 Bacteria 1260
728 Ga0496101_0036257 3300048904 Bacteria 3492
729 Ga0496101_0364461 3300048904 Bacteria 1136
730 Ga0496101_0493255 3300048904 Bacteria 967
731 Ga0496102_0005220 3300048905 Bacteria 11029
732 Ga0496102_0250040 3300048905 Bacteria 1671
733 Ga0496102_0537203 3300048905 Bacteria 1092
734 Ga0496103_0024207 3300048906 Bacteria 3663
735 Ga0496103_0297315 3300048906 Bacteria 1038
736 Ga0496104_0000116 3300048907 Bacteria 74423
737 Ga0496104_0063343 3300048907 Bacteria 3506
738 Ga0496104_0138651 3300048907 Bacteria 2337
739 Ga0496104_0154803 3300048907 Bacteria 2200
740 Ga0496104_0440187 3300048907 Bacteria 1215
741 Ga0496105_0000550 3300048908 Bacteria 24744
742 Ga0496105_0133733 3300048908 Bacteria 2043
743 Ga0496105_0134925 3300048908 Bacteria 2033
744 Ga0496105_0480073 3300048908 Bacteria 978
745 Ga0496105_0676823 3300048908 Bacteria 794
746 Ga0496106_0014148 3300048909 Bacteria 5894
747 Ga0496106_0135542 3300048909 Bacteria 1934
748 Ga0496106_0184687 3300048909 Bacteria 1656
749 Ga0496107_0018580 3300048910 Bacteria 4896
750 Ga0496107_0205083 3300048910 Bacteria 1465
751 Ga0496107_0258789 3300048910 Bacteria 1295
752 Ga0496108_0004997 3300048911 Bacteria 10716
753 Ga0496108_0064653 3300048911 Bacteria 3082
754 Ga0496108_0084202 3300048911 Bacteria 2698
755 Ga0496108_0187737 3300048911 Bacteria 1791
756 Ga0496108_0488539 3300048911 Bacteria 1075
757 Ga0496109_0014904 3300048912 Bacteria 6765
758 Ga0496109_0143348 3300048912 Bacteria 2234
759 Ga0496109_0144684 3300048912 Unclassified 2223
760 Ga0496109_0168587 3300048912 Bacteria 2054
761 Ga0496110_0062381 3300048913 Bacteria 3292
762 Ga0496110_0098569 3300048913 Bacteria 2619
763 Ga0496110_0305854 3300048913 Bacteria 1448
764 Ga0496111_0101271 3300048914 Bacteria 2116
765 Ga0496111_0564802 3300048914 Bacteria 834
766 Ga0496112_0006007 3300048915 Bacteria 10597
767 Ga0496112_0044146 3300048915 Bacteria 4367
768 Ga0496112_0077584 3300048915 Bacteria 3285
769 Ga0496112_0204620 3300048915 Bacteria 1932
770 Ga0496112_0329436 3300048915 Bacteria 1471
771 Ga0496113_0000721 3300048916 Bacteria 16927
772 Ga0496113_0121831 3300048916 Bacteria 2039
773 Ga0496113_0143331 3300048916 Bacteria 1881
774 Ga0496113_0171033 3300048916 Bacteria 1720
775 Ga0496114_0072297 3300048917 Bacteria 2900
776 Ga0496114_0098697 3300048917 Bacteria 2490
777 Ga0496114_0162064 3300048917 Bacteria 1945
778 Ga0496115_0009214 3300048918 Bacteria 7328
779 Ga0496115_0054870 3300048918 Bacteria 3200
780 Ga0496115_0080495 3300048918 Bacteria 2652
781 Ga0496115_0164148 3300048918 Bacteria 1836
782 Ga0496115_0177654 3300048918 Bacteria 1760
783 Ga0496116_0033108 3300048919 Bacteria 3672
784 Ga0496118_0011606 3300048921 Bacteria 8578
785 Ga0496121_0011689 3300048924 Bacteria 9696
786 Ga0501031_0048621 3300049568 Bacteria 2763
787 Ga0501031_0078386 3300049568 Bacteria 2153
788 Ga0501032_0027977 3300049569 Bacteria 3874
789 Ga0501033_0005800 3300049570 Bacteria 9718
790 Ga0501033_0016275 3300049570 Bacteria 5632
791 Ga0501033_0487378 3300049570 Bacteria 854
792 Ga0501034_0027708 3300049571 Bacteria 5761
793 Ga0501034_0060022 3300049571 Bacteria 3820
794 Ga0501034_0078119 3300049571 Bacteria 3315
795 Ga0501036_0001338 3300049572 Bacteria 18941
796 Ga0501036_0061331 3300049572 Bacteria 3185
797 Ga0501036_0156419 3300049572 Bacteria 1922
798 Ga0501037_0020100 3300049573 Bacteria 4930
799 Ga0501037_0093858 3300049573 Bacteria 2170
800 Ga0501038_0012207 3300049574 Bacteria 7844
801 Ga0501038_0019214 3300049574 Bacteria 6162
802 Ga0501038_0153783 3300049574 Bacteria 1874
803 Ga0501039_0014409 3300049575 Bacteria 6054
804 Ga0501039_0308725 3300049575 Bacteria 1243
805 Ga0501041_0000199 3300049577 Bacteria 27732
806 Ga0501042_0001962 3300049578 Bacteria 12397
807 Ga0501043_0072302 3300049579 Bacteria 2709
808 Ga0501046_0009502 3300049580 Bacteria 8403
809 Ga0501047_0057389 3300049581 Bacteria 3765
810 Ga0501047_0064895 3300049581 Bacteria 3521
811 Ga0501047_0114563 3300049581 Bacteria 2578
812 Ga0501047_0201312 3300049581 Bacteria 1852
813 Ga0501048_0023681 3300049582 Bacteria 4485
814 Ga0501067_0113131 3300049583 Bacteria 1509
815 Ga0501067_0206532 3300049583 Bacteria 1094
816 Ga0501068_0015810 3300049584 Bacteria 4343
817 Ga0501069_0039000 3300049585 Bacteria 2623
818 Ga0501070_0008050 3300049586 Bacteria 8921
819 Ga0501070_0029949 3300049586 Bacteria 4560
820 Ga0501071_0017834 3300049587 Bacteria 4905
821 Ga0501071_0067829 3300049587 Bacteria 2595
822 Ga0501072_0072111 3300049588 Bacteria 2729
823 Ga0501072_0521330 3300049588 Bacteria 940
824 Ga0501073_0115989 3300049589 Bacteria 1856
825 Ga0501073_0190218 3300049589 Bacteria 1420
826 Ga0501073_0315088 3300049589 Bacteria 1079
827 Ga0501074_0053507 3300049590 Bacteria 2911
828 Ga0501075_0000297 3300049591 Bacteria 27597
829 Ga0501076_0001204 3300049592 Bacteria 17188
830 Ga0501077_0040212 3300049593 Bacteria 2979
831 Ga0501077_0342441 3300049593 Bacteria 954
832 Ga0501079_0375507 3300049741 Bacteria 1115
833 Ga0501080_0035829 3300049742 Bacteria 4631
834 Ga0501080_0467639 3300049742 Bacteria 1129
835 Ga0501081_0001439 3300049743 Bacteria 14553
836 Ga0501081_0373961 3300049743 Bacteria 1052
837 Ga0501035_0002939 3300049822 Bacteria 16395
838 Ga0501035_0035392 3300049822 Bacteria 4532
839 Ga0501035_0085525 3300049822 Bacteria 2780
840 Ga0501035_0101959 3300049822 Bacteria 2518
841 Ga0501044_0178984 3300049823 Bacteria 2088
842 Ga0501044_0192820 3300049823 Bacteria 1999
843 Ga0501044_0237119 3300049823 Bacteria 1769
844 Ga0501044_0299869 3300049823 Bacteria 1536
845 Ga0501044_0453378 3300049823 Bacteria 1189
846 Ga0501045_0000711 3300049824 Bacteria 21168
847 nmdc:mga05p37_109_c1 3300050507 Bacteria 74571
848 nmdc:mga05p37_46780_c1 3300050507 Bacteria 5320
849 nmdc:mga05p37_5632_c1 3300050507 Bacteria 14723
850 nmdc:mga09592_1148_c1 3300050508 Bacteria 21118
851 nmdc:mga09592_594788_c1 3300050508 Bacteria 948
852 nmdc:mga09592_6478_c1 3300050508 Bacteria 9536
853 nmdc:mga0qj67_16395_c1 3300050509 Bacteria 5619
854 nmdc:mga0qj67_2133_c1 3300050509 Bacteria 14087
855 nmdc:mga06r32_13847_c1 3300050510 Bacteria 7318
856 nmdc:mga06r32_4222_c1 3300050510 Bacteria 12874
857 nmdc:mga08y16_241874_c1 3300050511 Bacteria 1865
858 nmdc:mga08y16_4316_c1 3300050511 Bacteria 14850
859 nmdc:mga08y16_693078_c1 3300050511 Bacteria 1019
860 nmdc:mga08y16_93450_c1 3300050511 Bacteria 3134
861 nmdc:mga0n895_15640_c1 3300050512 Bacteria 6928
862 nmdc:mga0n895_268497_c1 3300050512 Bacteria 1731
863 nmdc:mga0n895_353051_c1 3300050512 Bacteria 1489
864 nmdc:mga0n895_489028_c1 3300050512 Bacteria 1240
865 nmdc:mga0n895_562_c1 3300050512 Bacteria 25458
866 nmdc:mga0n895_803338_c1 3300050512 Bacteria 931
867 nmdc:mga0rr50_24709_c1 3300050513 Bacteria 4167
868 nmdc:mga0rr50_35896_c1 3300050513 Bacteria 3565
869 nmdc:mga0rr50_470435_c1 3300050513 Bacteria 1067
870 nmdc:mga0rr50_515631_c1 3300050513 Bacteria 1017
871 nmdc:mga0rr50_9218_c1 3300050513 Bacteria 6191
872 nmdc:mga08x19_215736_c1 3300050514 Bacteria 1318
873 nmdc:mga08x19_23718_c1 3300050514 Bacteria 3807
874 nmdc:mga0a205_1040_c1 3300050515 Bacteria 23115
875 nmdc:mga0a205_10488_c1 3300050515 Bacteria 8513
876 nmdc:mga0a205_214998_c1 3300050515 Bacteria 1809
877 nmdc:mga0a205_32568_c1 3300050515 Bacteria 4997
878 Ga0495601_0000010 3300053077 Bacteria 266222
879 Ga0495601_0001381 3300053077 Bacteria 13364
880 Ga0495601_0002599 3300053077 Bacteria 10240
881 Ga0495601_0005715 3300053077 Bacteria 7248
882 Ga0495601_0024116 3300053077 Bacteria 3744
883 Ga0495601_0394515 3300053077 Bacteria 897
884 Ga0495612_0000002 3300053078 Bacteria 310466
885 Ga0495612_0001058 3300053078 Bacteria 11257
886 Ga0495612_0003240 3300053078 Bacteria 6749
887 Ga0495612_0050948 3300053078 Bacteria 1700
888 Ga0495595_0000184 3300053084 Bacteria 25097
889 Ga0495595_0000762 3300053084 Bacteria 12239
890 Ga0495595_0010966 3300053084 Bacteria 3781
891 Ga0495595_0044213 3300053084 Bacteria 2046
892 Ga0495595_0061228 3300053084 Bacteria 1762
893 Ga0495595_0071133 3300053084 Bacteria 1644
894 Ga0495595_0182374 3300053084 Bacteria 1041
895 Ga0495619_0000002 3300053085 Bacteria 530226
896 Ga0495619_0000271 3300053085 Bacteria 37662
897 Ga0495619_0002564 3300053085 Bacteria 11890
898 Ga0495619_0007587 3300053085 Bacteria 6868
899 Ga0495619_0009292 3300053085 Bacteria 6207
900 Ga0495619_0019964 3300053085 Bacteria 4263
901 Ga0495619_0033088 3300053085 Bacteria 3357
902 Ga0495619_0037127 3300053085 Bacteria 3173
903 Ga0495619_0069065 3300053085 Bacteria 2361
904 Ga0495619_0144114 3300053085 Bacteria 1642
905 Ga0495619_0226106 3300053085 Bacteria 1296
906 Ga0500643_019657 3300053087 Bacteria 2220
907 Ga0500644_0004254 3300053088 Bacteria 3576
908 Ga0500651_0001961 3300053093 Bacteria 10665
909 Ga0500650_0120534 3300053098 Bacteria 1223
910 Ga0500593_029496 3300053117 Bacteria 2451
911 Ga0500595_000062 3300053119 Bacteria 77506
912 Ga0500652_005922 3300053131 Bacteria 3892
913 Ga0500616_0000006 3300053153 Bacteria 944738
914 Ga0500616_0010041 3300053153 Bacteria 5689
915 Ga0500645_000282 3300053730 Bacteria 36379
916 Ga0501084_0044968 3300054114 Bacteria 3697
917 Ga0501084_0121442 3300054114 Bacteria 2197
918 Ga0501082_0002630 3300060353 Bacteria 15693
919 Ga0501082_0015525 3300060353 Bacteria 6557
920 Ga0501082_0247390 3300060353 Bacteria 1552
921 Ga0501082_0630752 3300060353 Bacteria 938
922 Ga0501082_0814466 3300060353 Bacteria 817
923 Ga0530510_0060982 3300061734 Bacteria 2730

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046459 Ga0495629_0158420 Ga0495629_0158420_878_1543 221
2 3300046517 Ga0495630_0213547 Ga0495630_0213547_24_689 221
3 3300025923 Ga0207681_10277169 Ga0207681_102771692 229
4 3300035724 Ga0373933_0019109 Ga0373933_0019109_1686_2444 233
5 3300036401 Ga0373937_0027077 Ga0373937_0027077_2974_3732 233
6 3300005336 Ga0070680_100347009 Ga0070680_1003470092 234
7 3300005530 Ga0070679_100052860 Ga0070679_1000528603 234
8 3300005577 Ga0068857_100259640 Ga0068857_1002596402 234
9 3300013105 Ga0157369_10004736 Ga0157369_100047363 234
10 3300013307 Ga0157372_10992013 Ga0157372_109920131 234
11 3300014497 Ga0182008_10017977 Ga0182008_100179774 234
12 3300020081 Ga0206354_10285912 Ga0206354_102859122 234
13 3300025917 Ga0207660_10314724 Ga0207660_103147242 234
14 3300026116 Ga0207674_10266694 Ga0207674_102666942 234
15 3300049593 Ga0501077_0342441 Ga0501077_0342441_12_752 246
16 3300049743 Ga0501081_0373961 Ga0501081_0373961_139_879 246
17 iso_pu_bacteria 2522572158 2523103031 246
18 iso_pu_bacteria 2935616580 2935616983 246
19 iso_pu_bacteria 2935703347 2935711735 246
20 iso_pu_bacteria 2935801545 2935810205 246
21 iso_pu_bacteria 2935837841 2935846850 246
22 iso_pu_bacteria 2935855204 2935855608 246
23 iso_pu_bacteria 2935864058 2935870246 246
24 iso_pu_bacteria 2935873716 2935876033 246
25 iso_pu_bacteria 2936002035 2936010668 246
26 iso_pu_bacteria 2941538514 2941547301 246
27 iso_pu_bacteria 8019576017 8019583374 246
28 iso_pu_bacteria 8019586578 8019591186 246
29 iso_pu_bacteria 8019597564 8019600152 246
30 iso_pu_bacteria 8019608314 8019618389 246
31 3300005440 Ga0070705_100165663 Ga0070705_1001656632 247
32 3300005549 Ga0070704_100030432 Ga0070704_1000304323 247
33 3300006844 Ga0075428_100091010 Ga0075428_1000910103 247
34 3300006847 Ga0075431_100029273 Ga0075431_1000292734 247
35 3300006880 Ga0075429_100000008 Ga0075429_1000000089 247
36 3300035691 Ga0373931_0252020 Ga0373931_0252020_321_1064 247
37 3300042001 Ga0439441_006313 Ga0439441_006313_650_1393 247
38 3300042001 Ga0439441_020180 Ga0439441_020180_49_792 247
39 3300050511 nmdc:mga08y16_241874_c1 nmdc:mga08y16_241874_c1_511_1254 247
40 iso_pu_bacteria 2841760612 2841766628 247
41 iso_pu_bacteria 2844104063 2844105366 247
42 iso_pu_bacteria 2851246043 2851252357 247
43 3300007076 Ga0075435_100213941 Ga0075435_1002139412 248
44 3300035120 Ga0373957_0052263 Ga0373957_0052263_114_863 248
45 3300035695 Ga0373927_0071590 Ga0373927_0071590_1042_1791 248
46 3300049822 Ga0501035_0002939 Ga0501035_0002939_6986_7744 248
47 3300050513 nmdc:mga0rr50_515631_c1 nmdc:mga0rr50_515631_c1_143_895 248
48 3300005468 Ga0070707_100524883 Ga0070707_1005248832 249
49 3300005544 Ga0070686_100203350 Ga0070686_1002033502 249
50 3300005615 Ga0070702_100071323 Ga0070702_1000713232 249
51 3300009176 Ga0105242_10002839 Ga0105242_1000283912 249
52 3300025922 Ga0207646_10446086 Ga0207646_104460862 249
53 3300025929 Ga0207664_10410093 Ga0207664_104100932 249
54 3300025934 Ga0207686_10038994 Ga0207686_100389943 249
55 3300035083 Ga0373926_0016309 Ga0373926_0016309_835_1587 249
56 3300035692 Ga0373935_0040667 Ga0373935_0040667_2112_2864 249
57 3300035695 Ga0373927_0039586 Ga0373927_0039586_827_1579 249
58 3300035724 Ga0373933_0071924 Ga0373933_0071924_714_1466 249
59 3300035725 Ga0373947_0012712 Ga0373947_0012712_3103_3855 249
60 3300035725 Ga0373947_0494248 Ga0373947_0494248_22_774 249
61 3300036401 Ga0373937_0043671 Ga0373937_0043671_1106_1858 249
62 3300037068 Ga0373925_0351784 Ga0373925_0351784_274_1026 249
63 3300039453 Ga0436362_1243395 Ga0436362_1243395_677_1426 249
64 3300047319 Ga0495674_0249218 Ga0495674_0249218_677_1429 249
65 3300047471 Ga0495684_0181447 Ga0495684_0181447_638_1390 249
66 3300048918 Ga0496115_0080495 Ga0496115_0080495_40_792 249
67 3300049593 Ga0501077_0040212 Ga0501077_0040212_1355_2107 249
68 3300053085 Ga0495619_0144114 Ga0495619_0144114_221_973 249
69 3300054114 Ga0501084_0121442 Ga0501084_0121442_971_1723 249
70 3300061734 Ga0530510_0060982 Ga0530510_0060982_1873_2625 249
71 3300005330 Ga0070690_100293859 Ga0070690_1002938591 250
72 3300005343 Ga0070687_100180124 Ga0070687_1001801242 250
73 3300005356 Ga0070674_100000456 Ga0070674_10000045612 250
74 3300005365 Ga0070688_100035477 Ga0070688_1000354772 250
75 3300005439 Ga0070711_100102762 Ga0070711_1001027622 250
76 3300005440 Ga0070705_100048399 Ga0070705_1000483992 250
77 3300005444 Ga0070694_100069947 Ga0070694_1000699473 250
78 3300005445 Ga0070708_100025847 Ga0070708_1000258474 250
79 3300005458 Ga0070681_10214217 Ga0070681_102142172 250
80 3300005458 Ga0070681_10440376 Ga0070681_104403762 250
81 3300005468 Ga0070707_100251491 Ga0070707_1002514912 250
82 3300005471 Ga0070698_100929307 Ga0070698_1009293071 250
83 3300005530 Ga0070679_100174006 Ga0070679_1001740063 250
84 3300005543 Ga0070672_100268521 Ga0070672_1002685212 250
85 3300005545 Ga0070695_100026690 Ga0070695_1000266901 250
86 3300005545 Ga0070695_100451580 Ga0070695_1004515802 250
87 3300005546 Ga0070696_100091787 Ga0070696_1000917873 250
88 3300005547 Ga0070693_100047229 Ga0070693_1000472292 250
89 3300005549 Ga0070704_100140760 Ga0070704_1001407602 250
90 3300005549 Ga0070704_100744635 Ga0070704_1007446351 250
91 3300005577 Ga0068857_100392680 Ga0068857_1003926802 250
92 3300005617 Ga0068859_100115780 Ga0068859_1001157802 250
93 3300005617 Ga0068859_100150189 Ga0068859_1001501893 250
94 3300005844 Ga0068862_100552056 Ga0068862_1005520562 250
95 3300006846 Ga0075430_100007795 Ga0075430_1000077959 250
96 3300006846 Ga0075430_100142740 Ga0075430_1001427402 250
97 3300006931 Ga0097620_100115777 Ga0097620_1001157772 250
98 3300006931 Ga0097620_100150183 Ga0097620_1001501833 250
99 3300009101 Ga0105247_10255653 Ga0105247_102556532 250
100 3300009147 Ga0114129_10066967 Ga0114129_100669674 250
101 3300009177 Ga0105248_10633902 Ga0105248_106339022 250
102 3300017792 Ga0163161_10274660 Ga0163161_102746602 250
103 3300025901 Ga0207688_10155127 Ga0207688_101551272 250
104 3300025912 Ga0207707_10211145 Ga0207707_102111452 250
105 3300025922 Ga0207646_10085210 Ga0207646_100852104 250
106 3300025937 Ga0207669_10026526 Ga0207669_100265263 250
107 3300025940 Ga0207691_10285128 Ga0207691_102851282 250
108 3300026075 Ga0207708_10281192 Ga0207708_102811922 250
109 3300026078 Ga0207702_10204902 Ga0207702_102049021 250
110 3300026116 Ga0207674_10235913 Ga0207674_102359132 250
111 3300026121 Ga0207683_10141858 Ga0207683_101418583 250
112 3300027695 Ga0209966_1008347 Ga0209966_10083472 250
113 3300028380 Ga0268265_10612441 Ga0268265_106124412 250
114 3300028381 Ga0268264_10159321 Ga0268264_101593212 250
115 3300028800 Ga0265338_10002492 Ga0265338_1000249224 250
116 3300031241 Ga0265325_10165057 Ga0265325_101650572 250
117 3300031249 Ga0265339_10012730 Ga0265339_100127304 250
118 3300035695 Ga0373927_0039898 Ga0373927_0039898_1394_2149 250
119 3300035724 Ga0373933_0344860 Ga0373933_0344860_23_790 250
120 3300035725 Ga0373947_0053434 Ga0373947_0053434_1484_2239 250
121 3300044694 Ga0466963_0121732 Ga0466963_0121732_885_1637 250
122 3300044719 Ga0466971_0180933 Ga0466971_0180933_220_972 250
123 3300044842 Ga0466957_0187463 Ga0466957_0187463_115_867 250
124 3300045051 Ga0451576_0023021 Ga0451576_0023021_4869_5627 250
125 3300045836 Ga0466958_0320245 Ga0466958_0320245_40_792 250
126 3300046474 Ga0495605_0151191 Ga0495605_0151191_127_885 250
127 3300046533 Ga0495640_0438369 Ga0495640_0438369_11_778 250
128 3300046535 Ga0495586_0090372 Ga0495586_0090372_894_1646 250
129 3300046538 Ga0495609_0107194 Ga0495609_0107194_270_1025 250
130 3300046689 Ga0495613_0157754 Ga0495613_0157754_16_771 250
131 3300048904 Ga0496101_0493255 Ga0496101_0493255_45_803 250
132 3300048909 Ga0496106_0184687 Ga0496106_0184687_872_1630 250
133 3300048911 Ga0496108_0187737 Ga0496108_0187737_643_1395 250
134 3300048913 Ga0496110_0305854 Ga0496110_0305854_567_1325 250
135 3300048915 Ga0496112_0044146 Ga0496112_0044146_1922_2680 250
136 3300048918 Ga0496115_0054870 Ga0496115_0054870_1418_2179 250
137 3300048919 Ga0496116_0033108 Ga0496116_0033108_1730_2488 250
138 3300048921 Ga0496118_0011606 Ga0496118_0011606_5606_6364 250
139 3300048924 Ga0496121_0011689 Ga0496121_0011689_6737_7495 250
140 3300049589 Ga0501073_0190218 Ga0501073_0190218_374_1129 250
141 3300049589 Ga0501073_0315088 Ga0501073_0315088_314_1069 250
142 3300050507 nmdc:mga05p37_109_c1 nmdc:mga05p37_109_c1_177_935 250
143 3300050508 nmdc:mga09592_594788_c1 nmdc:mga09592_594788_c1_173_931 250
144 3300050508 nmdc:mga09592_6478_c1 nmdc:mga09592_6478_c1_3284_4042 250
145 3300050509 nmdc:mga0qj67_16395_c1 nmdc:mga0qj67_16395_c1_1108_1863 250
146 3300050510 nmdc:mga06r32_13847_c1 nmdc:mga06r32_13847_c1_4398_5156 250
147 3300050512 nmdc:mga0n895_489028_c1 nmdc:mga0n895_489028_c1_19_789 250
148 3300053085 Ga0495619_0033088 Ga0495619_0033088_1745_2497 250
149 3300053153 Ga0500616_0010041 Ga0500616_0010041_2984_3739 250
150 3300060353 Ga0501082_0814466 Ga0501082_0814466_22_777 250
151 3300005327 Ga0070658_10011642 Ga0070658_100116424 251
152 3300005327 Ga0070658_10033788 Ga0070658_100337883 251
153 3300005336 Ga0070680_100023460 Ga0070680_1000234603 251
154 3300005336 Ga0070680_100032247 Ga0070680_1000322472 251
155 3300005339 Ga0070660_100277606 Ga0070660_1002776062 251
156 3300005366 Ga0070659_100205586 Ga0070659_1002055862 251
157 3300005435 Ga0070714_100035035 Ga0070714_1000350353 251
158 3300005458 Ga0070681_10087410 Ga0070681_100874102 251
159 3300005530 Ga0070679_100254589 Ga0070679_1002545892 251
160 3300005563 Ga0068855_100093341 Ga0068855_1000933413 251
161 3300005563 Ga0068855_100132246 Ga0068855_1001322463 251
162 3300005563 Ga0068855_100200073 Ga0068855_1002000734 251
163 3300005614 Ga0068856_100262757 Ga0068856_1002627572 251
164 3300005614 Ga0068856_100373940 Ga0068856_1003739402 251
165 3300005616 Ga0068852_100042613 Ga0068852_1000426132 251
166 3300005616 Ga0068852_100282026 Ga0068852_1002820262 251
167 3300006028 Ga0070717_10587645 Ga0070717_105876452 251
168 3300006914 Ga0075436_100010766 Ga0075436_1000107664 251
169 3300007076 Ga0075435_100267505 Ga0075435_1002675052 251
170 3300009093 Ga0105240_10035786 Ga0105240_100357865 251
171 3300009551 Ga0105238_10085262 Ga0105238_100852623 251
172 3300013104 Ga0157370_10051700 Ga0157370_100517004 251
173 3300013104 Ga0157370_10319230 Ga0157370_103192302 251
174 3300013307 Ga0157372_10701660 Ga0157372_107016601 251
175 3300020082 Ga0206353_10528377 Ga0206353_105283772 251
176 3300025909 Ga0207705_10203974 Ga0207705_102039742 251
177 3300025917 Ga0207660_10174634 Ga0207660_101746342 251
178 3300025919 Ga0207657_10074179 Ga0207657_100741793 251
179 3300025924 Ga0207694_10244276 Ga0207694_102442761 251
180 3300025929 Ga0207664_10098805 Ga0207664_100988052 251
181 3300025932 Ga0207690_10231023 Ga0207690_102310232 251
182 3300025939 Ga0207665_10480970 Ga0207665_104809702 251
183 3300025949 Ga0207667_10099491 Ga0207667_100994912 251
184 3300025949 Ga0207667_10220282 Ga0207667_102202824 251
185 3300026041 Ga0207639_10092709 Ga0207639_100927093 251
186 3300026078 Ga0207702_10101298 Ga0207702_101012983 251
187 3300026078 Ga0207702_10281850 Ga0207702_102818502 251
188 3300026142 Ga0207698_10158228 Ga0207698_101582282 251
189 3300028381 Ga0268264_10476480 Ga0268264_104764802 251
190 3300031235 Ga0265330_10003043 Ga0265330_100030432 251
191 3300031247 Ga0265340_10100770 Ga0265340_101007702 251
192 3300031249 Ga0265339_10015364 Ga0265339_100153641 251
193 3300031344 Ga0265316_10084271 Ga0265316_100842712 251
194 3300031712 Ga0265342_10000882 Ga0265342_1000088216 251
195 3300031712 Ga0265342_10004819 Ga0265342_100048198 251
196 3300032133 Ga0316583_10000161 Ga0316583_1000016114 251
197 3300035410 Ga0373924_0049494 Ga0373924_0049494_763_1518 251
198 3300035692 Ga0373935_0036252 Ga0373935_0036252_161_916 251
199 3300037312 Ga0395899_0036755 Ga0395899_0036755_2002_2757 251
200 3300037418 Ga0395900_0005074 Ga0395900_0005074_12907_13662 251
201 3300037418 Ga0395900_0008149 Ga0395900_0008149_9109_9864 251
202 3300037418 Ga0395900_0424802 Ga0395900_0424802_226_981 251
203 3300037466 Ga0395898_0032574 Ga0395898_0032574_1516_2271 251
204 3300037466 Ga0395898_0110478 Ga0395898_0110478_1703_2458 251
205 3300037466 Ga0395898_0121248 Ga0395898_0121248_695_1450 251
206 3300037853 Ga0436364_1070861 Ga0436364_1070861_1365_2120 251
207 3300038443 Ga0395901_0009281 Ga0395901_0009281_5407_6162 251
208 3300038443 Ga0395901_0014372 Ga0395901_0014372_5733_6488 251
209 3300039437 Ga0436365_0380370 Ga0436365_0380370_826_1581 251
210 3300039437 Ga0436365_0442321 Ga0436365_0442321_2034_2789 251
211 3300039447 Ga0436361_0189320 Ga0436361_0189320_405_1160 251
212 3300039450 Ga0436363_0323907 Ga0436363_0323907_791_1546 251
213 3300044684 Ga0466966_0125083 Ga0466966_0125083_17_772 251
214 3300045836 Ga0466958_0067366 Ga0466958_0067366_13_768 251
215 3300045976 Ga0466967_0022504 Ga0466967_0022504_1030_1785 251
216 3300046454 Ga0495592_0180560 Ga0495592_0180560_54_809 251
217 3300046459 Ga0495629_0139671 Ga0495629_0139671_654_1409 251
218 3300046462 Ga0495651_0248429 Ga0495651_0248429_203_958 251
219 3300046463 Ga0495653_0140058 Ga0495653_0140058_375_1130 251
220 3300046472 Ga0495580_0120836 Ga0495580_0120836_319_1074 251
221 3300046517 Ga0495630_0117096 Ga0495630_0117096_534_1289 251
222 3300046533 Ga0495640_0082608 Ga0495640_0082608_157_912 251
223 3300046533 Ga0495640_0317171 Ga0495640_0317171_90_845 251
224 3300046559 Ga0495667_0132571 Ga0495667_0132571_491_1246 251
225 3300046642 Ga0495634_0216474 Ga0495634_0216474_274_1029 251
226 3300046663 Ga0495635_0225378 Ga0495635_0225378_375_1130 251
227 3300046683 Ga0495658_0085832 Ga0495658_0085832_628_1383 251
228 3300046689 Ga0495613_0031920 Ga0495613_0031920_407_1162 251
229 3300047317 Ga0495604_0127058 Ga0495604_0127058_1050_1805 251
230 3300047319 Ga0495674_0061512 Ga0495674_0061512_1416_2171 251
231 3300048088 Ga0495602_0092297 Ga0495602_0092297_565_1320 251
232 3300048903 Ga0496100_0272038 Ga0496100_0272038_306_1061 251
233 3300048907 Ga0496104_0154803 Ga0496104_0154803_851_1606 251
234 3300048908 Ga0496105_0480073 Ga0496105_0480073_203_958 251
235 3300048909 Ga0496106_0135542 Ga0496106_0135542_92_847 251
236 3300048910 Ga0496107_0258789 Ga0496107_0258789_58_813 251
237 3300048915 Ga0496112_0204620 Ga0496112_0204620_303_1058 251
238 3300049568 Ga0501031_0048621 Ga0501031_0048621_346_1104 251
239 3300049569 Ga0501032_0027977 Ga0501032_0027977_1660_2418 251
240 3300049570 Ga0501033_0005800 Ga0501033_0005800_139_897 251
241 3300049570 Ga0501033_0487378 Ga0501033_0487378_49_804 251
242 3300049571 Ga0501034_0027708 Ga0501034_0027708_2645_3403 251
243 3300049571 Ga0501034_0060022 Ga0501034_0060022_2154_2912 251
244 3300049572 Ga0501036_0061331 Ga0501036_0061331_1472_2230 251
245 3300049572 Ga0501036_0156419 Ga0501036_0156419_649_1407 251
246 3300049574 Ga0501038_0012207 Ga0501038_0012207_6416_7174 251
247 3300049574 Ga0501038_0153783 Ga0501038_0153783_904_1662 251
248 3300049575 Ga0501039_0308725 Ga0501039_0308725_68_826 251
249 3300049579 Ga0501043_0072302 Ga0501043_0072302_179_937 251
250 3300049581 Ga0501047_0114563 Ga0501047_0114563_104_862 251
251 3300049581 Ga0501047_0201312 Ga0501047_0201312_385_1140 251
252 3300049586 Ga0501070_0029949 Ga0501070_0029949_2260_3018 251
253 3300049822 Ga0501035_0085525 Ga0501035_0085525_441_1199 251
254 3300049822 Ga0501035_0101959 Ga0501035_0101959_1141_1899 251
255 3300049823 Ga0501044_0178984 Ga0501044_0178984_509_1264 251
256 3300049823 Ga0501044_0237119 Ga0501044_0237119_450_1208 251
257 3300050513 nmdc:mga0rr50_470435_c1 nmdc:mga0rr50_470435_c1_268_1023 251
258 3300050514 nmdc:mga08x19_23718_c1 nmdc:mga08x19_23718_c1_2781_3536 251
259 3300053077 Ga0495601_0002599 Ga0495601_0002599_8776_9531 251
260 3300053077 Ga0495601_0024116 Ga0495601_0024116_2081_2836 251
261 3300053084 Ga0495595_0044213 Ga0495595_0044213_556_1311 251
262 3300053153 Ga0500616_0000006 Ga0500616_0000006_865720_866517 251
263 3300005434 Ga0070709_10045792 Ga0070709_100457923 252
264 3300006175 Ga0070712_100003673 Ga0070712_1000036734 252
265 3300013104 Ga0157370_10263703 Ga0157370_102637032 252
266 3300025915 Ga0207693_10009873 Ga0207693_100098734 252
267 3300025928 Ga0207700_10426199 Ga0207700_104261991 252
268 3300049581 Ga0501047_0064895 Ga0501047_0064895_767_1537 252
269 3300049583 Ga0501067_0113131 Ga0501067_0113131_434_1204 252
270 3300049585 Ga0501069_0039000 Ga0501069_0039000_882_1652 252
271 3300049586 Ga0501070_0008050 Ga0501070_0008050_3210_3980 252
272 3300049588 Ga0501072_0072111 Ga0501072_0072111_543_1313 252
273 3300049590 Ga0501074_0053507 Ga0501074_0053507_1041_1811 252
274 3300049742 Ga0501080_0035829 Ga0501080_0035829_3832_4602 252
275 3300049823 Ga0501044_0192820 Ga0501044_0192820_100_870 252
276 3300053085 Ga0495619_0069065 Ga0495619_0069065_683_1447 252
277 3300053098 Ga0500650_0120534 Ga0500650_0120534_54_836 252
278 3300060353 Ga0501082_0630752 Ga0501082_0630752_33_803 252
279 3300005434 Ga0070709_10036382 Ga0070709_100363823 253
280 3300005439 Ga0070711_100163490 Ga0070711_1001634901 253
281 3300006028 Ga0070717_10348501 Ga0070717_103485012 253
282 3300006173 Ga0070716_100067257 Ga0070716_1000672572 253
283 3300007788 Ga0099795_10007316 Ga0099795_100073163 253
284 3300010159 Ga0099796_10005784 Ga0099796_100057842 253
285 3300025898 Ga0207692_10092149 Ga0207692_100921492 253
286 3300025906 Ga0207699_10068983 Ga0207699_100689832 253
287 3300025916 Ga0207663_10194238 Ga0207663_101942382 253
288 3300035083 Ga0373926_0106149 Ga0373926_0106149_109_870 253
289 3300035086 Ga0373934_0013885 Ga0373934_0013885_2235_2996 253
290 3300035111 Ga0373923_0041700 Ga0373923_0041700_1073_1834 253
291 3300035113 Ga0373936_0001104 Ga0373936_0001104_3433_4194 253
292 3300035116 Ga0373945_0000503 Ga0373945_0000503_4117_4878 253
293 3300035117 Ga0373953_0000488 Ga0373953_0000488_4037_4798 253
294 3300035120 Ga0373957_0016648 Ga0373957_0016648_1753_2514 253
295 3300035170 Ga0373943_0003705 Ga0373943_0003705_3593_4354 253
296 3300035171 Ga0373946_0002277 Ga0373946_0002277_5521_6282 253
297 3300035172 Ga0373955_0000425 Ga0373955_0000425_5223_5984 253
298 3300035692 Ga0373935_0000337 Ga0373935_0000337_16748_17509 253
299 3300035695 Ga0373927_0043067 Ga0373927_0043067_1390_2151 253
300 3300035724 Ga0373933_0002475 Ga0373933_0002475_5029_5790 253
301 3300035725 Ga0373947_0001536 Ga0373947_0001536_8971_9732 253
302 3300036401 Ga0373937_0000223 Ga0373937_0000223_50753_51514 253
303 3300037068 Ga0373925_0000741 Ga0373925_0000741_16745_17506 253
304 3300044842 Ga0466957_0066173 Ga0466957_0066173_705_1466 253
305 3300046454 Ga0495592_0000188 Ga0495592_0000188_35368_36129 253
306 3300046454 Ga0495592_0060198 Ga0495592_0060198_1763_2527 253
307 3300046459 Ga0495629_0002114 Ga0495629_0002114_8014_8775 253
308 3300046462 Ga0495651_0001439 Ga0495651_0001439_6896_7657 253
309 3300046462 Ga0495651_0101853 Ga0495651_0101853_31_795 253
310 3300046463 Ga0495653_0000198 Ga0495653_0000198_18022_18783 253
311 3300046476 Ga0495662_0000720 Ga0495662_0000720_2658_3419 253
312 3300046477 Ga0495664_0000002 Ga0495664_0000002_416946_417707 253
313 3300046511 Ga0495608_0000009 Ga0495608_0000009_62728_63489 253
314 3300046511 Ga0495608_0423360 Ga0495608_0423360_23_787 253
315 3300046514 Ga0495618_0000005 Ga0495618_0000005_194305_195066 253
316 3300046516 Ga0495628_0000002 Ga0495628_0000002_381331_382092 253
317 3300046517 Ga0495630_0000614 Ga0495630_0000614_11875_12636 253
318 3300046529 Ga0495652_0000004 Ga0495652_0000004_206791_207552 253
319 3300046533 Ga0495640_0000005 Ga0495640_0000005_62743_63504 253
320 3300046536 Ga0495587_0000007 Ga0495587_0000007_254738_255499 253
321 3300046543 Ga0495645_0000003 Ga0495645_0000003_362582_363343 253
322 3300046559 Ga0495667_0000002 Ga0495667_0000002_55631_56392 253
323 3300046642 Ga0495634_0000129 Ga0495634_0000129_47598_48359 253
324 3300046663 Ga0495635_0000289 Ga0495635_0000289_1138_1899 253
325 3300046675 Ga0495657_0000781 Ga0495657_0000781_27155_27916 253
326 3300046678 Ga0495599_0000001 Ga0495599_0000001_520009_520770 253
327 3300046679 Ga0495623_0000001 Ga0495623_0000001_288954_289715 253
328 3300046680 Ga0495646_0000013 Ga0495646_0000013_139587_140348 253
329 3300046689 Ga0495613_0044829 Ga0495613_0044829_581_1342 253
330 3300046690 Ga0495624_0024272 Ga0495624_0024272_3158_3919 253
331 3300046809 Ga0495600_0000233 Ga0495600_0000233_13236_13997 253
332 3300047315 Ga0495581_0006809 Ga0495581_0006809_3564_4325 253
333 3300047317 Ga0495604_0000005 Ga0495604_0000005_406975_407736 253
334 3300047319 Ga0495674_0000003 Ga0495674_0000003_180034_180795 253
335 3300047322 Ga0495680_0000002 Ga0495680_0000002_184398_185159 253
336 3300047322 Ga0495680_0095117 Ga0495680_0095117_730_1494 253
337 3300047444 Ga0495675_0000437 Ga0495675_0000437_13995_14756 253
338 3300047471 Ga0495684_0000020 Ga0495684_0000020_131000_131761 253
339 3300048088 Ga0495602_0000027 Ga0495602_0000027_108891_109652 253
340 3300049573 Ga0501037_0093858 Ga0501037_0093858_814_1587 253
341 3300049581 Ga0501047_0057389 Ga0501047_0057389_701_1474 253
342 3300049588 Ga0501072_0521330 Ga0501072_0521330_15_788 253
343 3300049823 Ga0501044_0453378 Ga0501044_0453378_116_889 253
344 3300053077 Ga0495601_0000010 Ga0495601_0000010_206745_207506 253
345 3300053078 Ga0495612_0000002 Ga0495612_0000002_292927_293688 253
346 3300053084 Ga0495595_0000184 Ga0495595_0000184_3498_4259 253
347 3300053084 Ga0495595_0182374 Ga0495595_0182374_244_1008 253
348 3300053085 Ga0495619_0000002 Ga0495619_0000002_381334_382095 253
349 3300053117 Ga0500593_029496 Ga0500593_029496_813_1625 253
350 3300060353 Ga0501082_0015525 Ga0501082_0015525_4763_5536 253
351 3300005336 Ga0070680_100126715 Ga0070680_1001267152 254
352 3300005338 Ga0068868_100423853 Ga0068868_1004238532 254
353 3300005440 Ga0070705_100158202 Ga0070705_1001582022 254
354 3300005547 Ga0070693_100011715 Ga0070693_1000117152 254
355 3300005842 Ga0068858_100157576 Ga0068858_1001575762 254
356 3300006871 Ga0075434_100102139 Ga0075434_1001021392 254
357 3300007076 Ga0075435_100219849 Ga0075435_1002198492 254
358 3300009553 Ga0105249_10133900 Ga0105249_101339003 254
359 3300010375 Ga0105239_10319600 Ga0105239_103196002 254
360 3300013297 Ga0157378_10246363 Ga0157378_102463632 254
361 3300025904 Ga0207647_10043164 Ga0207647_100431643 254
362 3300025907 Ga0207645_10053476 Ga0207645_100534763 254
363 3300025912 Ga0207707_10009645 Ga0207707_100096459 254
364 3300025921 Ga0207652_10026006 Ga0207652_100260064 254
365 3300025961 Ga0207712_10073558 Ga0207712_100735582 254
366 3300026023 Ga0207677_10578127 Ga0207677_105781272 254
367 3300026067 Ga0207678_10036968 Ga0207678_100369684 254
368 3300028379 Ga0268266_10294300 Ga0268266_102943002 254
369 3300035083 Ga0373926_0004368 Ga0373926_0004368_2140_2904 254
370 3300035086 Ga0373934_0054287 Ga0373934_0054287_408_1172 254
371 3300035089 Ga0373944_0019405 Ga0373944_0019405_472_1236 254
372 3300035092 Ga0373952_0008868 Ga0373952_0008868_266_1033 254
373 3300035111 Ga0373923_0002274 Ga0373923_0002274_3313_4077 254
374 3300035113 Ga0373936_0084800 Ga0373936_0084800_463_1227 254
375 3300035118 Ga0373954_0004286 Ga0373954_0004286_2150_2914 254
376 3300035119 Ga0373956_0014464 Ga0373956_0014464_1851_2615 254
377 3300035170 Ga0373943_0010637 Ga0373943_0010637_2846_3610 254
378 3300035171 Ga0373946_0001059 Ga0373946_0001059_4408_5172 254
379 3300035172 Ga0373955_0139733 Ga0373955_0139733_195_959 254
380 3300035692 Ga0373935_0076945 Ga0373935_0076945_879_1643 254
381 3300035695 Ga0373927_0011982 Ga0373927_0011982_4673_5437 254
382 3300035724 Ga0373933_0010438 Ga0373933_0010438_3695_4459 254
383 3300037068 Ga0373925_0179833 Ga0373925_0179833_714_1478 254
384 3300046454 Ga0495592_0007677 Ga0495592_0007677_3611_4375 254
385 3300046455 Ga0495603_0091022 Ga0495603_0091022_824_1588 254
386 3300046458 Ga0495591_033479 Ga0495591_033479_103_867 254
387 3300046463 Ga0495653_0037313 Ga0495653_0037313_877_1641 254
388 3300046472 Ga0495580_0022328 Ga0495580_0022328_3560_4324 254
389 3300046473 Ga0495582_0040673 Ga0495582_0040673_835_1599 254
390 3300046475 Ga0495639_0008708 Ga0495639_0008708_628_1392 254
391 3300046476 Ga0495662_0009876 Ga0495662_0009876_3353_4117 254
392 3300046477 Ga0495664_0003233 Ga0495664_0003233_3585_4349 254
393 3300046492 Ga0495585_0001425 Ga0495585_0001425_8030_8794 254
394 3300046499 Ga0495594_0091858 Ga0495594_0091858_196_960 254
395 3300046511 Ga0495608_0014885 Ga0495608_0014885_4304_5068 254
396 3300046516 Ga0495628_0372241 Ga0495628_0372241_55_819 254
397 3300046523 Ga0495644_0000656 Ga0495644_0000656_2296_3060 254
398 3300046525 Ga0495663_0011247 Ga0495663_0011247_1018_1782 254
399 3300046526 Ga0495666_0008769 Ga0495666_0008769_3219_3983 254
400 3300046531 Ga0495665_0003071 Ga0495665_0003071_4582_5346 254
401 3300046535 Ga0495586_0016023 Ga0495586_0016023_1029_1793 254
402 3300046543 Ga0495645_0049212 Ga0495645_0049212_1210_1974 254
403 3300046557 Ga0495622_0006136 Ga0495622_0006136_1320_2084 254
404 3300046558 Ga0495633_0009720 Ga0495633_0009720_1861_2625 254
405 3300046559 Ga0495667_0022163 Ga0495667_0022163_1667_2431 254
406 3300046615 Ga0495656_0000262 Ga0495656_0000262_7037_7801 254
407 3300046642 Ga0495634_0190723 Ga0495634_0190723_68_832 254
408 3300046648 Ga0495611_0010698 Ga0495611_0010698_640_1404 254
409 3300046664 Ga0495659_0006163 Ga0495659_0006163_269_1033 254
410 3300046665 Ga0495661_0053372 Ga0495661_0053372_528_1292 254
411 3300046674 Ga0495588_0009638 Ga0495588_0009638_1540_2304 254
412 3300046678 Ga0495599_0063998 Ga0495599_0063998_763_1527 254
413 3300046680 Ga0495646_0005931 Ga0495646_0005931_3459_4223 254
414 3300046681 Ga0495647_0003641 Ga0495647_0003641_1737_2501 254
415 3300046689 Ga0495613_0074197 Ga0495613_0074197_835_1599 254
416 3300046690 Ga0495624_0015796 Ga0495624_0015796_3408_4172 254
417 3300046691 Ga0495670_0001048 Ga0495670_0001048_5788_6552 254
418 3300046692 Ga0495671_0045891 Ga0495671_0045891_399_1163 254
419 3300046809 Ga0495600_0003719 Ga0495600_0003719_1103_1867 254
420 3300047315 Ga0495581_0025414 Ga0495581_0025414_519_1283 254
421 3300047317 Ga0495604_0017043 Ga0495604_0017043_721_1485 254
422 3300047321 Ga0495676_0224287 Ga0495676_0224287_196_960 254
423 3300047322 Ga0495680_0042831 Ga0495680_0042831_2179_2943 254
424 3300047444 Ga0495675_0017856 Ga0495675_0017856_145_909 254
425 3300047471 Ga0495684_0295581 Ga0495684_0295581_205_969 254
426 3300047673 Ga0495593_0001400 Ga0495593_0001400_205_969 254
427 3300048088 Ga0495602_0111968 Ga0495602_0111968_228_992 254
428 3300048089 Ga0495614_0028550 Ga0495614_0028550_835_1599 254
429 3300050512 nmdc:mga0n895_353051_c1 nmdc:mga0n895_353051_c1_474_1241 254
430 3300053077 Ga0495601_0394515 Ga0495601_0394515_56_820 254
431 3300053078 Ga0495612_0003240 Ga0495612_0003240_461_1225 254
432 3300053084 Ga0495595_0071133 Ga0495595_0071133_56_820 254
433 3300053085 Ga0495619_0009292 Ga0495619_0009292_823_1587 254
434 3300000041 ARcpr5oldR_c000028 ARcpr5oldR_0000288 255
435 3300000044 ARSoilOldRDRAFT_c000023 ARSoilOldRDRAFT_00002323 255
436 3300001990 JGI24737J22298_10000458 JGI24737J22298_100004584 255
437 3300001990 JGI24737J22298_10003428 JGI24737J22298_100034283 255
438 3300005289 Ga0065704_10104383 Ga0065704_101043832 255
439 3300005290 Ga0065712_10072517 Ga0065712_100725173 255
440 3300005290 Ga0065712_10087111 Ga0065712_100871113 255
441 3300005293 Ga0065715_10001564 Ga0065715_100015648 255
442 3300005330 Ga0070690_100147733 Ga0070690_1001477332 255
443 3300005330 Ga0070690_100291039 Ga0070690_1002910392 255
444 3300005331 Ga0070670_100000437 Ga0070670_10000043716 255
445 3300005331 Ga0070670_100107537 Ga0070670_1001075371 255
446 3300005335 Ga0070666_10006881 Ga0070666_100068817 255
447 3300005335 Ga0070666_10075867 Ga0070666_100758673 255
448 3300005336 Ga0070680_100010932 Ga0070680_1000109324 255
449 3300005337 Ga0070682_100013961 Ga0070682_1000139613 255
450 3300005337 Ga0070682_100079462 Ga0070682_1000794622 255
451 3300005338 Ga0068868_100120853 Ga0068868_1001208532 255
452 3300005339 Ga0070660_100008614 Ga0070660_1000086144 255
453 3300005340 Ga0070689_100051873 Ga0070689_1000518732 255
454 3300005340 Ga0070689_100122333 Ga0070689_1001223332 255
455 3300005341 Ga0070691_10152228 Ga0070691_101522282 255
456 3300005345 Ga0070692_10000008 Ga0070692_100000082 255
457 3300005345 Ga0070692_10027989 Ga0070692_100279892 255
458 3300005353 Ga0070669_100058695 Ga0070669_1000586952 255
459 3300005354 Ga0070675_100016085 Ga0070675_1000160854 255
460 3300005354 Ga0070675_100096738 Ga0070675_1000967383 255
461 3300005355 Ga0070671_100033139 Ga0070671_1000331392 255
462 3300005355 Ga0070671_100100134 Ga0070671_1001001342 255
463 3300005355 Ga0070671_100496951 Ga0070671_1004969512 255
464 3300005355 Ga0070671_100616961 Ga0070671_1006169611 255
465 3300005356 Ga0070674_100179631 Ga0070674_1001796312 255
466 3300005364 Ga0070673_100037972 Ga0070673_1000379722 255
467 3300005364 Ga0070673_100328753 Ga0070673_1003287532 255
468 3300005365 Ga0070688_100008112 Ga0070688_1000081125 255
469 3300005365 Ga0070688_100407982 Ga0070688_1004079821 255
470 3300005366 Ga0070659_100009561 Ga0070659_1000095615 255
471 3300005366 Ga0070659_100120197 Ga0070659_1001201971 255
472 3300005367 Ga0070667_100041051 Ga0070667_1000410514 255
473 3300005367 Ga0070667_100067811 Ga0070667_1000678112 255
474 3300005367 Ga0070667_100565571 Ga0070667_1005655712 255
475 3300005406 Ga0070703_10003001 Ga0070703_100030012 255
476 3300005406 Ga0070703_10050284 Ga0070703_100502841 255
477 3300005434 Ga0070709_10008980 Ga0070709_100089803 255
478 3300005434 Ga0070709_10037312 Ga0070709_100373121 255
479 3300005434 Ga0070709_10121863 Ga0070709_101218633 255
480 3300005434 Ga0070709_10463575 Ga0070709_104635751 255
481 3300005435 Ga0070714_100057751 Ga0070714_1000577512 255
482 3300005435 Ga0070714_100137227 Ga0070714_1001372271 255
483 3300005436 Ga0070713_100020676 Ga0070713_1000206763 255
484 3300005436 Ga0070713_100258275 Ga0070713_1002582752 255
485 3300005437 Ga0070710_10053671 Ga0070710_100536712 255
486 3300005438 Ga0070701_10217497 Ga0070701_102174972 255
487 3300005439 Ga0070711_100043656 Ga0070711_1000436562 255
488 3300005439 Ga0070711_100214283 Ga0070711_1002142832 255
489 3300005440 Ga0070705_100174827 Ga0070705_1001748272 255
490 3300005441 Ga0070700_100005017 Ga0070700_1000050174 255
491 3300005444 Ga0070694_100011811 Ga0070694_1000118115 255
492 3300005444 Ga0070694_100060362 Ga0070694_1000603623 255
493 3300005455 Ga0070663_100036543 Ga0070663_1000365433 255
494 3300005456 Ga0070678_100061496 Ga0070678_1000614962 255
495 3300005457 Ga0070662_100009709 Ga0070662_1000097095 255
496 3300005457 Ga0070662_100121499 Ga0070662_1001214992 255
497 3300005458 Ga0070681_10639002 Ga0070681_106390021 255
498 3300005459 Ga0068867_100059792 Ga0068867_1000597922 255
499 3300005466 Ga0070685_10009054 Ga0070685_100090543 255
500 3300005466 Ga0070685_10066335 Ga0070685_100663352 255
501 3300005468 Ga0070707_100069965 Ga0070707_1000699652 255
502 3300005530 Ga0070679_100254195 Ga0070679_1002541952 255
503 3300005535 Ga0070684_100322239 Ga0070684_1003222392 255
504 3300005539 Ga0068853_100023115 Ga0068853_1000231154 255
505 3300005543 Ga0070672_100233162 Ga0070672_1002331622 255
506 3300005544 Ga0070686_100022223 Ga0070686_1000222233 255
507 3300005545 Ga0070695_100011865 Ga0070695_1000118652 255
508 3300005545 Ga0070695_100014581 Ga0070695_1000145814 255
509 3300005545 Ga0070695_100375927 Ga0070695_1003759272 255
510 3300005546 Ga0070696_100024640 Ga0070696_1000246403 255
511 3300005546 Ga0070696_100115984 Ga0070696_1001159842 255
512 3300005549 Ga0070704_100003857 Ga0070704_1000038574 255
513 3300005563 Ga0068855_100067277 Ga0068855_1000672773 255
514 3300005564 Ga0070664_100058305 Ga0070664_1000583053 255
515 3300005564 Ga0070664_100359893 Ga0070664_1003598932 255
516 3300005577 Ga0068857_100277508 Ga0068857_1002775082 255
517 3300005578 Ga0068854_100080568 Ga0068854_1000805683 255
518 3300005614 Ga0068856_100041527 Ga0068856_1000415274 255
519 3300005614 Ga0068856_100137973 Ga0068856_1001379732 255
520 3300005616 Ga0068852_100398951 Ga0068852_1003989512 255
521 3300005617 Ga0068859_100036332 Ga0068859_1000363322 255
522 3300005618 Ga0068864_100079171 Ga0068864_1000791713 255
523 3300005618 Ga0068864_100181923 Ga0068864_1001819232 255
524 3300005718 Ga0068866_10070764 Ga0068866_100707642 255
525 3300005719 Ga0068861_100098948 Ga0068861_1000989482 255
526 3300005841 Ga0068863_100111336 Ga0068863_1001113362 255
527 3300005841 Ga0068863_100295529 Ga0068863_1002955292 255
528 3300005841 Ga0068863_100471954 Ga0068863_1004719542 255
529 3300005842 Ga0068858_100000512 Ga0068858_10000051242 255
530 3300005842 Ga0068858_100065166 Ga0068858_1000651663 255
531 3300005842 Ga0068858_100113862 Ga0068858_1001138622 255
532 3300005842 Ga0068858_100276198 Ga0068858_1002761982 255
533 3300005843 Ga0068860_100040149 Ga0068860_1000401494 255
534 3300005843 Ga0068860_100181065 Ga0068860_1001810652 255
535 3300005844 Ga0068862_100000557 Ga0068862_10000055714 255
536 3300005844 Ga0068862_100021018 Ga0068862_1000210185 255
537 3300005937 Ga0081455_10000035 Ga0081455_1000003573 255
538 3300005937 Ga0081455_10069074 Ga0081455_100690743 255
539 3300006028 Ga0070717_10003781 Ga0070717_100037816 255
540 3300006163 Ga0070715_10035594 Ga0070715_100355941 255
541 3300006173 Ga0070716_100046614 Ga0070716_1000466143 255
542 3300006173 Ga0070716_100301529 Ga0070716_1003015292 255
543 3300006175 Ga0070712_100057204 Ga0070712_1000572042 255
544 3300006175 Ga0070712_100175892 Ga0070712_1001758922 255
545 3300006194 Ga0075427_10001188 Ga0075427_100011882 255
546 3300006237 Ga0097621_100092009 Ga0097621_1000920093 255
547 3300006358 Ga0068871_100159997 Ga0068871_1001599972 255
548 3300006844 Ga0075428_100015574 Ga0075428_1000155744 255
549 3300006846 Ga0075430_100003545 Ga0075430_1000035454 255
550 3300006847 Ga0075431_100012917 Ga0075431_1000129174 255
551 3300006852 Ga0075433_10004405 Ga0075433_100044059 255
552 3300006852 Ga0075433_10066986 Ga0075433_100669862 255
553 3300006852 Ga0075433_10252959 Ga0075433_102529592 255
554 3300006871 Ga0075434_100001135 Ga0075434_1000011359 255
555 3300006871 Ga0075434_100045346 Ga0075434_1000453464 255
556 3300006871 Ga0075434_100299100 Ga0075434_1002991002 255
557 3300006871 Ga0075434_100814204 Ga0075434_1008142041 255
558 3300006880 Ga0075429_100001354 Ga0075429_1000013546 255
559 3300006881 Ga0068865_100000119 Ga0068865_10000011925 255
560 3300006881 Ga0068865_100117671 Ga0068865_1001176712 255
561 3300006914 Ga0075436_100019478 Ga0075436_1000194784 255
562 3300006914 Ga0075436_100052595 Ga0075436_1000525952 255
563 3300006931 Ga0097620_100036331 Ga0097620_1000363312 255
564 3300007076 Ga0075435_100042204 Ga0075435_1000422044 255
565 3300007076 Ga0075435_100045146 Ga0075435_1000451464 255
566 3300007076 Ga0075435_100047158 Ga0075435_1000471583 255
567 3300009011 Ga0105251_10024945 Ga0105251_100249453 255
568 3300009094 Ga0111539_10001512 Ga0111539_100015125 255
569 3300009094 Ga0111539_10019347 Ga0111539_100193474 255
570 3300009094 Ga0111539_11143595 Ga0111539_111435952 255
571 3300009098 Ga0105245_10128369 Ga0105245_101283692 255
572 3300009098 Ga0105245_10218347 Ga0105245_102183472 255
573 3300009101 Ga0105247_10191744 Ga0105247_101917442 255
574 3300009147 Ga0114129_10056907 Ga0114129_100569074 255
575 3300009147 Ga0114129_10175903 Ga0114129_101759033 255
576 3300009148 Ga0105243_10020499 Ga0105243_100204992 255
577 3300009148 Ga0105243_10146344 Ga0105243_101463442 255
578 3300009177 Ga0105248_10190862 Ga0105248_101908622 255
579 3300009177 Ga0105248_10240117 Ga0105248_102401172 255
580 3300009177 Ga0105248_10372572 Ga0105248_103725722 255
581 3300009545 Ga0105237_10265205 Ga0105237_102652052 255
582 3300009553 Ga0105249_10000215 Ga0105249_1000021519 255
583 3300009553 Ga0105249_10009891 Ga0105249_100098918 255
584 3300009553 Ga0105249_10115843 Ga0105249_101158432 255
585 3300009553 Ga0105249_10688926 Ga0105249_106889262 255
586 3300010375 Ga0105239_10028262 Ga0105239_100282624 255
587 3300010375 Ga0105239_10414397 Ga0105239_104143971 255
588 3300010375 Ga0105239_10525955 Ga0105239_105259552 255
589 3300011119 Ga0105246_10000019 Ga0105246_1000001930 255
590 3300011119 Ga0105246_10145180 Ga0105246_101451802 255
591 3300011119 Ga0105246_10225498 Ga0105246_102254982 255
592 3300013296 Ga0157374_10326771 Ga0157374_103267712 255
593 3300013296 Ga0157374_10539711 Ga0157374_105397112 255
594 3300013297 Ga0157378_10002701 Ga0157378_1000270113 255
595 3300013297 Ga0157378_10240375 Ga0157378_102403752 255
596 3300013306 Ga0163162_10001187 Ga0163162_1000118713 255
597 3300013306 Ga0163162_10087104 Ga0163162_100871043 255
598 3300013306 Ga0163162_10306353 Ga0163162_103063532 255
599 3300013306 Ga0163162_10570722 Ga0163162_105707222 255
600 3300013308 Ga0157375_10010957 Ga0157375_100109575 255
601 3300013308 Ga0157375_10228605 Ga0157375_102286052 255
602 3300013308 Ga0157375_10493174 Ga0157375_104931742 255
603 3300013308 Ga0157375_10499742 Ga0157375_104997422 255
604 3300014325 Ga0163163_10019264 Ga0163163_100192642 255
605 3300014325 Ga0163163_10263527 Ga0163163_102635272 255
606 3300014325 Ga0163163_10393967 Ga0163163_103939672 255
607 3300014326 Ga0157380_10000284 Ga0157380_1000028418 255
608 3300014326 Ga0157380_10578608 Ga0157380_105786082 255
609 3300014497 Ga0182008_10131793 Ga0182008_101317932 255
610 3300014968 Ga0157379_10208769 Ga0157379_102087692 255
611 3300014968 Ga0157379_10320881 Ga0157379_103208812 255
612 3300014969 Ga0157376_10363081 Ga0157376_103630812 255
613 3300017792 Ga0163161_10100882 Ga0163161_101008822 255
614 3300020082 Ga0206353_11144301 Ga0206353_111443012 255
615 3300021384 Ga0213876_10033890 Ga0213876_100338904 255
616 3300021388 Ga0213875_10000165 Ga0213875_100001658 255
617 3300025271 Ga0207666_1000744 Ga0207666_10007444 255
618 3300025315 Ga0207697_10003696 Ga0207697_100036965 255
619 3300025885 Ga0207653_10001699 Ga0207653_100016997 255
620 3300025898 Ga0207692_10040821 Ga0207692_100408211 255
621 3300025898 Ga0207692_10052375 Ga0207692_100523752 255
622 3300025900 Ga0207710_10004914 Ga0207710_100049145 255
623 3300025901 Ga0207688_10034764 Ga0207688_100347643 255
624 3300025903 Ga0207680_10101178 Ga0207680_101011782 255
625 3300025905 Ga0207685_10013800 Ga0207685_100138002 255
626 3300025905 Ga0207685_10016988 Ga0207685_100169882 255
627 3300025906 Ga0207699_10061149 Ga0207699_100611492 255
628 3300025906 Ga0207699_10106676 Ga0207699_101066762 255
629 3300025906 Ga0207699_10160123 Ga0207699_101601232 255
630 3300025906 Ga0207699_10318315 Ga0207699_103183152 255
631 3300025912 Ga0207707_10256086 Ga0207707_102560862 255
632 3300025915 Ga0207693_10017770 Ga0207693_100177702 255
633 3300025915 Ga0207693_10209191 Ga0207693_102091912 255
634 3300025916 Ga0207663_10043923 Ga0207663_100439233 255
635 3300025919 Ga0207657_10010318 Ga0207657_100103185 255
636 3300025919 Ga0207657_10120100 Ga0207657_101201002 255
637 3300025920 Ga0207649_10293675 Ga0207649_102936752 255
638 3300025921 Ga0207652_10153018 Ga0207652_101530182 255
639 3300025921 Ga0207652_10209758 Ga0207652_102097582 255
640 3300025925 Ga0207650_10603563 Ga0207650_106035631 255
641 3300025926 Ga0207659_10028682 Ga0207659_100286824 255
642 3300025927 Ga0207687_10006850 Ga0207687_100068502 255
643 3300025927 Ga0207687_10179633 Ga0207687_101796332 255
644 3300025928 Ga0207700_10004694 Ga0207700_100046944 255
645 3300025928 Ga0207700_10018933 Ga0207700_100189333 255
646 3300025929 Ga0207664_10041800 Ga0207664_100418002 255
647 3300025931 Ga0207644_10120276 Ga0207644_101202763 255
648 3300025931 Ga0207644_10312897 Ga0207644_103128972 255
649 3300025931 Ga0207644_10432814 Ga0207644_104328142 255
650 3300025932 Ga0207690_10040362 Ga0207690_100403623 255
651 3300025933 Ga0207706_10017526 Ga0207706_100175263 255
652 3300025933 Ga0207706_10088991 Ga0207706_100889913 255
653 3300025934 Ga0207686_10035002 Ga0207686_100350022 255
654 3300025935 Ga0207709_10070620 Ga0207709_100706202 255
655 3300025936 Ga0207670_10112784 Ga0207670_101127842 255
656 3300025937 Ga0207669_10119421 Ga0207669_101194211 255
657 3300025938 Ga0207704_10024045 Ga0207704_100240453 255
658 3300025939 Ga0207665_10000631 Ga0207665_1000063125 255
659 3300025939 Ga0207665_10265993 Ga0207665_102659932 255
660 3300025939 Ga0207665_10267406 Ga0207665_102674062 255
661 3300025940 Ga0207691_10055482 Ga0207691_100554824 255
662 3300025941 Ga0207711_10016598 Ga0207711_100165983 255
663 3300025941 Ga0207711_10054868 Ga0207711_100548683 255
664 3300025941 Ga0207711_10455513 Ga0207711_104555131 255
665 3300025942 Ga0207689_10036982 Ga0207689_100369822 255
666 3300025945 Ga0207679_10066279 Ga0207679_100662792 255
667 3300025945 Ga0207679_10126399 Ga0207679_101263991 255
668 3300025960 Ga0207651_10037972 Ga0207651_100379724 255
669 3300025960 Ga0207651_10691524 Ga0207651_106915241 255
670 3300025961 Ga0207712_10037284 Ga0207712_100372842 255
671 3300025961 Ga0207712_10126500 Ga0207712_101265002 255
672 3300025961 Ga0207712_10535035 Ga0207712_105350352 255
673 3300025972 Ga0207668_10090761 Ga0207668_100907612 255
674 3300025981 Ga0207640_10061221 Ga0207640_100612213 255
675 3300025986 Ga0207658_10015437 Ga0207658_100154373 255
676 3300025986 Ga0207658_10399165 Ga0207658_103991652 255
677 3300026067 Ga0207678_10014489 Ga0207678_100144895 255
678 3300026067 Ga0207678_10027526 Ga0207678_100275265 255
679 3300026075 Ga0207708_10002641 Ga0207708_1000264110 255
680 3300026088 Ga0207641_10118183 Ga0207641_101181832 255
681 3300026088 Ga0207641_10161900 Ga0207641_101619003 255
682 3300026088 Ga0207641_10190827 Ga0207641_101908271 255
683 3300026089 Ga0207648_10038868 Ga0207648_100388683 255
684 3300026089 Ga0207648_10289894 Ga0207648_102898942 255
685 3300026095 Ga0207676_10072633 Ga0207676_100726333 255
686 3300026116 Ga0207674_10301720 Ga0207674_103017202 255
687 3300026118 Ga0207675_100028481 Ga0207675_1000284813 255
688 3300026121 Ga0207683_10045639 Ga0207683_100456394 255
689 3300026121 Ga0207683_10054532 Ga0207683_100545323 255
690 3300026142 Ga0207698_10126915 Ga0207698_101269152 255
691 3300027695 Ga0209966_1001251 Ga0209966_10012513 255
692 3300027695 Ga0209966_1001450 Ga0209966_10014503 255
693 3300027717 Ga0209998_10000949 Ga0209998_100009495 255
694 3300027717 Ga0209998_10009395 Ga0209998_100093952 255
695 3300027876 Ga0209974_10001910 Ga0209974_100019102 255
696 3300027876 Ga0209974_10087552 Ga0209974_100875522 255
697 3300027907 Ga0207428_10000308 Ga0207428_1000030854 255
698 3300027907 Ga0207428_10000474 Ga0207428_1000047430 255
699 3300028379 Ga0268266_10051110 Ga0268266_100511103 255
700 3300028380 Ga0268265_10026332 Ga0268265_100263324 255
701 3300028381 Ga0268264_10359016 Ga0268264_103590161 255
702 3300028800 Ga0265338_10064148 Ga0265338_100641483 255
703 3300030760 Ga0265762_1006598 Ga0265762_10065982 255
704 3300031238 Ga0265332_10001070 Ga0265332_1000107010 255
705 3300031241 Ga0265325_10000352 Ga0265325_1000035219 255
706 3300031241 Ga0265325_10052644 Ga0265325_100526441 255
707 3300031247 Ga0265340_10006050 Ga0265340_100060507 255
708 3300031247 Ga0265340_10034466 Ga0265340_100344662 255
709 3300031249 Ga0265339_10000979 Ga0265339_1000097919 255
710 3300031249 Ga0265339_10005391 Ga0265339_100053917 255
711 3300031344 Ga0265316_10044436 Ga0265316_100444363 255
712 3300031595 Ga0265313_10000686 Ga0265313_1000068615 255
713 3300031691 Ga0316579_10024922 Ga0316579_100249223 255
714 3300031711 Ga0265314_10003780 Ga0265314_100037806 255
715 3300031711 Ga0265314_10005573 Ga0265314_100055734 255
716 3300031712 Ga0265342_10000031 Ga0265342_10000031149 255
717 3300034816 Ga0373930_0000020 Ga0373930_0000020_7483_8250 255
718 3300034816 Ga0373930_0012248 Ga0373930_0012248_106_873 255
719 3300034817 Ga0373948_0000371 Ga0373948_0000371_3146_3913 255
720 3300034817 Ga0373948_0012850 Ga0373948_0012850_471_1238 255
721 3300034818 Ga0373950_0000266 Ga0373950_0000266_1799_2566 255
722 3300034819 Ga0373958_0000533 Ga0373958_0000533_3311_4078 255
723 3300034820 Ga0373959_0000539 Ga0373959_0000539_3498_4265 255
724 3300034957 Ga0373938_0000748 Ga0373938_0000748_3386_4153 255
725 3300035084 Ga0373928_0004305 Ga0373928_0004305_869_1636 255
726 3300035085 Ga0373929_0000042 Ga0373929_0000042_27071_27838 255
727 3300035086 Ga0373934_0042312 Ga0373934_0042312_673_1443 255
728 3300035088 Ga0373940_0000325 Ga0373940_0000325_2490_3257 255
729 3300035090 Ga0373949_0001117 Ga0373949_0001117_4545_5312 255
730 3300035091 Ga0373951_0000547 Ga0373951_0000547_6316_7083 255
731 3300035092 Ga0373952_0000713 Ga0373952_0000713_1982_2749 255
732 3300035092 Ga0373952_0021568 Ga0373952_0021568_153_920 255
733 3300035112 Ga0373932_0001186 Ga0373932_0001186_3171_3938 255
734 3300035112 Ga0373932_0002300 Ga0373932_0002300_669_1436 255
735 3300035113 Ga0373936_0019802 Ga0373936_0019802_772_1542 255
736 3300035114 Ga0373939_0000360 Ga0373939_0000360_9263_10030 255
737 3300035114 Ga0373939_0011935 Ga0373939_0011935_712_1479 255
738 3300035115 Ga0373941_0001805 Ga0373941_0001805_2612_3379 255
739 3300035115 Ga0373941_0005933 Ga0373941_0005933_617_1384 255
740 3300035117 Ga0373953_0048465 Ga0373953_0048465_98_865 255
741 3300035118 Ga0373954_0057832 Ga0373954_0057832_827_1597 255
742 3300035119 Ga0373956_0024246 Ga0373956_0024246_1807_2577 255
743 3300035120 Ga0373957_0005912 Ga0373957_0005912_2384_3154 255
744 3300035120 Ga0373957_0133632 Ga0373957_0133632_70_837 255
745 3300035121 Ga0373960_0003891 Ga0373960_0003891_142_909 255
746 3300035121 Ga0373960_0019041 Ga0373960_0019041_537_1304 255
747 3300035121 Ga0373960_0036289 Ga0373960_0036289_14_781 255
748 3300035170 Ga0373943_0027110 Ga0373943_0027110_1570_2340 255
749 3300035172 Ga0373955_0129552 Ga0373955_0129552_521_1288 255
750 3300035207 Ga0373942_0001477 Ga0373942_0001477_732_1499 255
751 3300035207 Ga0373942_0003320 Ga0373942_0003320_2811_3578 255
752 3300035207 Ga0373942_0018232 Ga0373942_0018232_239_1009 255
753 3300035241 Ga0373961_0003189 Ga0373961_0003189_2070_2837 255
754 3300035242 Ga0373962_0000354 Ga0373962_0000354_4103_4870 255
755 3300035242 Ga0373962_0013857 Ga0373962_0013857_885_1652 255
756 3300035691 Ga0373931_0030133 Ga0373931_0030133_1354_2121 255
757 3300035691 Ga0373931_0053231 Ga0373931_0053231_163_930 255
758 3300035692 Ga0373935_0003255 Ga0373935_0003255_2675_3442 255
759 3300035724 Ga0373933_0024531 Ga0373933_0024531_963_1733 255
760 3300035725 Ga0373947_0030383 Ga0373947_0030383_1185_1952 255
761 3300036401 Ga0373937_0005292 Ga0373937_0005292_4492_5262 255
762 3300036401 Ga0373937_0011036 Ga0373937_0011036_4534_5301 255
763 3300036401 Ga0373937_0073445 Ga0373937_0073445_605_1372 255
764 3300037068 Ga0373925_0008940 Ga0373925_0008940_4119_4886 255
765 3300037068 Ga0373925_0150446 Ga0373925_0150446_777_1544 255
766 3300037853 Ga0436364_1177974 Ga0436364_1177974_6915_7685 255
767 3300039437 Ga0436365_0592364 Ga0436365_0592364_824_1594 255
768 3300039447 Ga0436361_0944607 Ga0436361_0944607_1223_1993 255
769 3300039453 Ga0436362_0454806 Ga0436362_0454806_246_1016 255
770 3300042461 Ga0439460_0014322 Ga0439460_0014322_1007_1786 255
771 3300045051 Ga0451576_0056338 Ga0451576_0056338_2283_3050 255
772 3300045976 Ga0466967_0450012 Ga0466967_0450012_413_1180 255
773 3300046454 Ga0495592_0067404 Ga0495592_0067404_1049_1819 255
774 3300046455 Ga0495603_0015554 Ga0495603_0015554_2541_3308 255
775 3300046459 Ga0495629_0000222 Ga0495629_0000222_20203_20970 255
776 3300046459 Ga0495629_0092397 Ga0495629_0092397_373_1143 255
777 3300046459 Ga0495629_0101992 Ga0495629_0101992_147_914 255
778 3300046461 Ga0495641_0013226 Ga0495641_0013226_911_1678 255
779 3300046462 Ga0495651_0014733 Ga0495651_0014733_3151_3921 255
780 3300046462 Ga0495651_0142149 Ga0495651_0142149_385_1152 255
781 3300046462 Ga0495651_0149293 Ga0495651_0149293_706_1473 255
782 3300046462 Ga0495651_0164873 Ga0495651_0164873_300_1067 255
783 3300046463 Ga0495653_0027955 Ga0495653_0027955_2127_2897 255
784 3300046475 Ga0495639_0137851 Ga0495639_0137851_377_1144 255
785 3300046476 Ga0495662_0096654 Ga0495662_0096654_399_1169 255
786 3300046491 Ga0495584_0077382 Ga0495584_0077382_221_988 255
787 3300046511 Ga0495608_0002323 Ga0495608_0002323_5042_5812 255
788 3300046514 Ga0495618_0060945 Ga0495618_0060945_632_1399 255
789 3300046516 Ga0495628_0011343 Ga0495628_0011343_2094_2861 255
790 3300046516 Ga0495628_0014516 Ga0495628_0014516_1608_2378 255
791 3300046517 Ga0495630_0057444 Ga0495630_0057444_1832_2602 255
792 3300046517 Ga0495630_0065524 Ga0495630_0065524_1431_2198 255
793 3300046526 Ga0495666_0033500 Ga0495666_0033500_53_820 255
794 3300046529 Ga0495652_0020572 Ga0495652_0020572_983_1753 255
795 3300046529 Ga0495652_0098442 Ga0495652_0098442_128_895 255
796 3300046531 Ga0495665_0052758 Ga0495665_0052758_565_1335 255
797 3300046533 Ga0495640_0022097 Ga0495640_0022097_3819_4586 255
798 3300046533 Ga0495640_0090755 Ga0495640_0090755_898_1668 255
799 3300046535 Ga0495586_0039975 Ga0495586_0039975_416_1186 255
800 3300046536 Ga0495587_0006576 Ga0495587_0006576_1202_1972 255
801 3300046543 Ga0495645_0070637 Ga0495645_0070637_1338_2108 255
802 3300046559 Ga0495667_0002675 Ga0495667_0002675_4700_5470 255
803 3300046559 Ga0495667_0034249 Ga0495667_0034249_1870_2637 255
804 3300046642 Ga0495634_0131359 Ga0495634_0131359_411_1181 255
805 3300046642 Ga0495634_0135142 Ga0495634_0135142_535_1302 255
806 3300046663 Ga0495635_0002537 Ga0495635_0002537_8116_8886 255
807 3300046674 Ga0495588_0093201 Ga0495588_0093201_649_1416 255
808 3300046675 Ga0495657_0004771 Ga0495657_0004771_4441_5211 255
809 3300046678 Ga0495599_0025159 Ga0495599_0025159_1754_2524 255
810 3300046679 Ga0495623_0001394 Ga0495623_0001394_8117_8887 255
811 3300046679 Ga0495623_0119546 Ga0495623_0119546_624_1391 255
812 3300046680 Ga0495646_0001135 Ga0495646_0001135_10244_11014 255
813 3300046681 Ga0495647_0003047 Ga0495647_0003047_2043_2810 255
814 3300046683 Ga0495658_0000656 Ga0495658_0000656_7360_8127 255
815 3300046683 Ga0495658_0013420 Ga0495658_0013420_1438_2205 255
816 3300046689 Ga0495613_0004890 Ga0495613_0004890_5072_5839 255
817 3300046689 Ga0495613_0132259 Ga0495613_0132259_566_1336 255
818 3300046690 Ga0495624_0073691 Ga0495624_0073691_399_1166 255
819 3300046809 Ga0495600_0000708 Ga0495600_0000708_5561_6331 255
820 3300047315 Ga0495581_0052490 Ga0495581_0052490_446_1213 255
821 3300047319 Ga0495674_0002023 Ga0495674_0002023_18923_19693 255
822 3300047319 Ga0495674_0007365 Ga0495674_0007365_9326_10096 255
823 3300047321 Ga0495676_0042309 Ga0495676_0042309_267_1034 255
824 3300047322 Ga0495680_0005048 Ga0495680_0005048_3660_4427 255
825 3300047322 Ga0495680_0008971 Ga0495680_0008971_6475_7245 255
826 3300047322 Ga0495680_0009889 Ga0495680_0009889_3818_4585 255
827 3300047444 Ga0495675_0003495 Ga0495675_0003495_3826_4596 255
828 3300047673 Ga0495593_0039987 Ga0495593_0039987_1340_2107 255
829 3300048089 Ga0495614_0171943 Ga0495614_0171943_98_868 255
830 3300048903 Ga0496100_0029850 Ga0496100_0029850_14_781 255
831 3300048903 Ga0496100_0112447 Ga0496100_0112447_652_1419 255
832 3300048904 Ga0496101_0036257 Ga0496101_0036257_1228_1995 255
833 3300048904 Ga0496101_0364461 Ga0496101_0364461_185_952 255
834 3300048905 Ga0496102_0005220 Ga0496102_0005220_5035_5805 255
835 3300048905 Ga0496102_0250040 Ga0496102_0250040_627_1394 255
836 3300048905 Ga0496102_0537203 Ga0496102_0537203_241_1008 255
837 3300048906 Ga0496103_0024207 Ga0496103_0024207_1597_2367 255
838 3300048906 Ga0496103_0297315 Ga0496103_0297315_258_1025 255
839 3300048907 Ga0496104_0000116 Ga0496104_0000116_32760_33527 255
840 3300048907 Ga0496104_0063343 Ga0496104_0063343_2191_2958 255
841 3300048907 Ga0496104_0138651 Ga0496104_0138651_717_1484 255
842 3300048907 Ga0496104_0440187 Ga0496104_0440187_365_1132 255
843 3300048908 Ga0496105_0000550 Ga0496105_0000550_3449_4216 255
844 3300048908 Ga0496105_0133733 Ga0496105_0133733_377_1144 255
845 3300048908 Ga0496105_0134925 Ga0496105_0134925_847_1617 255
846 3300048908 Ga0496105_0676823 Ga0496105_0676823_15_782 255
847 3300048909 Ga0496106_0014148 Ga0496106_0014148_691_1461 255
848 3300048910 Ga0496107_0018580 Ga0496107_0018580_277_1044 255
849 3300048910 Ga0496107_0205083 Ga0496107_0205083_373_1143 255
850 3300048911 Ga0496108_0004997 Ga0496108_0004997_6603_7370 255
851 3300048911 Ga0496108_0064653 Ga0496108_0064653_1870_2637 255
852 3300048911 Ga0496108_0084202 Ga0496108_0084202_513_1280 255
853 3300048911 Ga0496108_0488539 Ga0496108_0488539_93_863 255
854 3300048912 Ga0496109_0014904 Ga0496109_0014904_1045_1812 255
855 3300048912 Ga0496109_0143348 Ga0496109_0143348_1114_1881 255
856 3300048912 Ga0496109_0144684 Ga0496109_0144684_14_781 255
857 3300048912 Ga0496109_0168587 Ga0496109_0168587_325_1092 255
858 3300048913 Ga0496110_0062381 Ga0496110_0062381_2394_3161 255
859 3300048913 Ga0496110_0098569 Ga0496110_0098569_967_1734 255
860 3300048914 Ga0496111_0101271 Ga0496111_0101271_464_1231 255
861 3300048914 Ga0496111_0564802 Ga0496111_0564802_54_821 255
862 3300048915 Ga0496112_0006007 Ga0496112_0006007_3005_3772 255
863 3300048915 Ga0496112_0077584 Ga0496112_0077584_448_1215 255
864 3300048915 Ga0496112_0329436 Ga0496112_0329436_476_1246 255
865 3300048916 Ga0496113_0000721 Ga0496113_0000721_4578_5345 255
866 3300048916 Ga0496113_0121831 Ga0496113_0121831_939_1706 255
867 3300048916 Ga0496113_0143331 Ga0496113_0143331_940_1707 255
868 3300048916 Ga0496113_0171033 Ga0496113_0171033_900_1667 255
869 3300048917 Ga0496114_0072297 Ga0496114_0072297_740_1510 255
870 3300048917 Ga0496114_0098697 Ga0496114_0098697_583_1350 255
871 3300048917 Ga0496114_0162064 Ga0496114_0162064_386_1153 255
872 3300048918 Ga0496115_0009214 Ga0496115_0009214_1392_2162 255
873 3300048918 Ga0496115_0164148 Ga0496115_0164148_638_1408 255
874 3300048918 Ga0496115_0177654 Ga0496115_0177654_625_1392 255
875 3300049568 Ga0501031_0078386 Ga0501031_0078386_820_1587 255
876 3300049570 Ga0501033_0016275 Ga0501033_0016275_3797_4564 255
877 3300049571 Ga0501034_0078119 Ga0501034_0078119_622_1401 255
878 3300049572 Ga0501036_0001338 Ga0501036_0001338_2259_3026 255
879 3300049573 Ga0501037_0020100 Ga0501037_0020100_914_1681 255
880 3300049574 Ga0501038_0019214 Ga0501038_0019214_3066_3833 255
881 3300049575 Ga0501039_0014409 Ga0501039_0014409_3241_4008 255
882 3300049577 Ga0501041_0000199 Ga0501041_0000199_18121_18888 255
883 3300049578 Ga0501042_0001962 Ga0501042_0001962_2287_3054 255
884 3300049580 Ga0501046_0009502 Ga0501046_0009502_1633_2400 255
885 3300049582 Ga0501048_0023681 Ga0501048_0023681_1062_1829 255
886 3300049583 Ga0501067_0206532 Ga0501067_0206532_283_1050 255
887 3300049584 Ga0501068_0015810 Ga0501068_0015810_3110_3877 255
888 3300049587 Ga0501071_0017834 Ga0501071_0017834_348_1115 255
889 3300049587 Ga0501071_0067829 Ga0501071_0067829_652_1431 255
890 3300049589 Ga0501073_0115989 Ga0501073_0115989_853_1620 255
891 3300049591 Ga0501075_0000297 Ga0501075_0000297_8582_9349 255
892 3300049592 Ga0501076_0001204 Ga0501076_0001204_1529_2296 255
893 3300049741 Ga0501079_0375507 Ga0501079_0375507_138_917 255
894 3300049742 Ga0501080_0467639 Ga0501080_0467639_145_924 255
895 3300049743 Ga0501081_0001439 Ga0501081_0001439_6132_6899 255
896 3300049822 Ga0501035_0035392 Ga0501035_0035392_2156_2923 255
897 3300049823 Ga0501044_0299869 Ga0501044_0299869_89_856 255
898 3300049824 Ga0501045_0000711 Ga0501045_0000711_16104_16871 255
899 3300050507 nmdc:mga05p37_46780_c1 nmdc:mga05p37_46780_c1_676_1455 255
900 3300050507 nmdc:mga05p37_5632_c1 nmdc:mga05p37_5632_c1_4330_5109 255
901 3300050508 nmdc:mga09592_1148_c1 nmdc:mga09592_1148_c1_7108_7887 255
902 3300050509 nmdc:mga0qj67_2133_c1 nmdc:mga0qj67_2133_c1_8894_9673 255
903 3300050510 nmdc:mga06r32_4222_c1 nmdc:mga06r32_4222_c1_7526_8305 255
904 3300050511 nmdc:mga08y16_4316_c1 nmdc:mga08y16_4316_c1_2812_3579 255
905 3300050511 nmdc:mga08y16_693078_c1 nmdc:mga08y16_693078_c1_60_827 255
906 3300050511 nmdc:mga08y16_93450_c1 nmdc:mga08y16_93450_c1_1379_2158 255
907 3300050512 nmdc:mga0n895_15640_c1 nmdc:mga0n895_15640_c1_5379_6158 255
908 3300050512 nmdc:mga0n895_268497_c1 nmdc:mga0n895_268497_c1_611_1378 255
909 3300050512 nmdc:mga0n895_562_c1 nmdc:mga0n895_562_c1_15935_16714 255
910 3300050512 nmdc:mga0n895_803338_c1 nmdc:mga0n895_803338_c1_141_908 255
911 3300050513 nmdc:mga0rr50_24709_c1 nmdc:mga0rr50_24709_c1_2217_2996 255
912 3300050513 nmdc:mga0rr50_35896_c1 nmdc:mga0rr50_35896_c1_618_1385 255
913 3300050513 nmdc:mga0rr50_9218_c1 nmdc:mga0rr50_9218_c1_5019_5798 255
914 3300050514 nmdc:mga08x19_215736_c1 nmdc:mga08x19_215736_c1_467_1234 255
915 3300050515 nmdc:mga0a205_1040_c1 nmdc:mga0a205_1040_c1_16979_17758 255
916 3300050515 nmdc:mga0a205_10488_c1 nmdc:mga0a205_10488_c1_4016_4795 255
917 3300050515 nmdc:mga0a205_214998_c1 nmdc:mga0a205_214998_c1_503_1270 255
918 3300050515 nmdc:mga0a205_32568_c1 nmdc:mga0a205_32568_c1_1209_1976 255
919 3300053077 Ga0495601_0001381 Ga0495601_0001381_11692_12462 255
920 3300053077 Ga0495601_0005715 Ga0495601_0005715_1608_2378 255
921 3300053078 Ga0495612_0001058 Ga0495612_0001058_5662_6432 255
922 3300053078 Ga0495612_0050948 Ga0495612_0050948_399_1169 255
923 3300053084 Ga0495595_0000762 Ga0495595_0000762_6599_7369 255
924 3300053084 Ga0495595_0010966 Ga0495595_0010966_2528_3295 255
925 3300053084 Ga0495595_0061228 Ga0495595_0061228_674_1441 255
926 3300053085 Ga0495619_0000271 Ga0495619_0000271_21200_21967 255
927 3300053085 Ga0495619_0002564 Ga0495619_0002564_5553_6323 255
928 3300053085 Ga0495619_0007587 Ga0495619_0007587_5178_5945 255
929 3300053085 Ga0495619_0019964 Ga0495619_0019964_1133_1900 255
930 3300053085 Ga0495619_0037127 Ga0495619_0037127_429_1199 255
931 3300053085 Ga0495619_0226106 Ga0495619_0226106_54_821 255
932 3300053087 Ga0500643_019657 Ga0500643_019657_205_987 255
933 3300053088 Ga0500644_0004254 Ga0500644_0004254_857_1639 255
934 3300053093 Ga0500651_0001961 Ga0500651_0001961_9231_10013 255
935 3300053119 Ga0500595_000062 Ga0500595_000062_73963_74745 255
936 3300053131 Ga0500652_005922 Ga0500652_005922_2040_2822 255
937 3300053730 Ga0500645_000282 Ga0500645_000282_8284_9066 255
938 3300054114 Ga0501084_0044968 Ga0501084_0044968_1982_2749 255
939 3300060353 Ga0501082_0002630 Ga0501082_0002630_12830_13597 255
940 3300060353 Ga0501082_0247390 Ga0501082_0247390_521_1300 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

37

193

0.95

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

240

266

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9296 5 232
7cad-assembly1.cif.gz_D mycobacterium smegmatis sugabc complex 0.9156 5 232
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.9141 5 232
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9124 5 243
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9068 1 232
ID Description Score Start End Superfamily
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.931 1 228 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9288 5 227 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.927 1 228 3.40.50.300
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9196 4 245 3.40.50.300
af_P31548_12_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9109 16 233 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3M1RA33-F1-model_v4 ABC transporter ATP-binding protein 0.9784 5 244 GO:0005524
GO:0005886
GO:0016887
AF-U4Q7P7-F1-model_v4 Branched-chain amino acid ABC transporter, ATP-binding component 0.9782 2 244 GO:0005524
GO:0005886
GO:0016887
AF-F6FZX2-F1-model_v4 Amino-acid ATP-binding ABC transporter protein 0.972 3 248 GO:0005524
GO:0005886
GO:0016887
AF-N6TX83-F1-model_v4 Putative ATP-binding protein component of ABC transporter 0.9712 1 244 GO:0005524
GO:0005886
GO:0016887
AF-A0A6H2H6E5-F1-model_v4 Lipopolysaccharide export system ATP-binding protein LptB (EC 3.6.3.-) 0.9669 3 244 GO:0005524
GO:0005886
GO:0016887

Feature Viewer

pLDDT pTM Quality
87.47 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map