F486322
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 940 | 409 | 923 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300053117|Ga0500593_029496|Ga0500593_029496_813_1625 |
| Length | 270 |
| Sequence | MSEAMSDTMAAPTASNTAVPALEVRGVNKNFGALQVARDVNLTLERGARRALIGPNGAGKTSLVNLITGVLKPSSGQVLLGGEDITSWSSAHRARRGLARTFQINQLFRGLSVLENVCLAIGERRGESYNLWRPAGSKAAVIDEALDHLNSLRLVDDALKLVSELPYGRQRLVEIAIALAQKPKVLLLDEPAAGVPSHESHVILDVVASLDPDIAILIIEHDMDVVFRFAQSITVLVAGAVLTEGSPQQILADERVRAVYLGQEADRGHG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 2 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 3 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 4 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 5 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 6 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 7 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 8 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 9 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 10 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 11 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 12 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 13 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 14 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 15 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 16 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 17 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 19 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 93 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 94 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 102 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 133 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 134 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 204 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 205 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 207 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 209 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 212 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 213 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 214 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 215 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 216 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 217 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 218 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 219 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 220 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 221 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 223 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 227 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 230 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 231 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 237 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 239 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 244 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 245 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 247 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 248 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 249 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 250 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 253 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 254 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 255 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 256 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 257 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 258 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 259 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 260 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 261 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 262 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 263 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 264 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 265 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 266 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 267 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 268 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 269 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 270 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 334 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 335 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 336 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 337 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 338 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 339 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 342 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 343 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 344 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 345 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 346 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 347 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 348 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 349 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 350 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 395 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 396 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 397 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 398 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 399 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 400 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 401 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 402 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 403 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 406 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 407 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 408 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 409 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.77 |
| Metatranscriptomes | 0.43 |
| Isolates | 1.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.06 |
| Nodule | 1.7 |
| Rhizoplane | 6.17 |
| Rhizosphere | 89.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c000028 | 3300000041 | Bacteria | 29588 |
| 2 | ARSoilOldRDRAFT_c000023 | 3300000044 | Bacteria | 34965 |
| 3 | JGI24737J22298_10000458 | 3300001990 | Bacteria | 14018 |
| 4 | JGI24737J22298_10003428 | 3300001990 | Bacteria | 5606 |
| 5 | Ga0065704_10104383 | 3300005289 | Bacteria | 2142 |
| 6 | Ga0065712_10072517 | 3300005290 | Bacteria | 4722 |
| 7 | Ga0065712_10087111 | 3300005290 | Bacteria | 2597 |
| 8 | Ga0065715_10001564 | 3300005293 | Bacteria | 10196 |
| 9 | Ga0070658_10011642 | 3300005327 | Bacteria | 7056 |
| 10 | Ga0070658_10033788 | 3300005327 | Bacteria | 4115 |
| 11 | Ga0070690_100147733 | 3300005330 | Bacteria | 1601 |
| 12 | Ga0070690_100291039 | 3300005330 | Bacteria | 1168 |
| 13 | Ga0070690_100293859 | 3300005330 | Bacteria | 1163 |
| 14 | Ga0070670_100000437 | 3300005331 | Bacteria | 34047 |
| 15 | Ga0070670_100107537 | 3300005331 | Bacteria | 2403 |
| 16 | Ga0070666_10006881 | 3300005335 | Bacteria | 7005 |
| 17 | Ga0070666_10075867 | 3300005335 | Bacteria | 2293 |
| 18 | Ga0070680_100010932 | 3300005336 | Bacteria | 7015 |
| 19 | Ga0070680_100023460 | 3300005336 | Bacteria | 4920 |
| 20 | Ga0070680_100032247 | 3300005336 | Bacteria | 4216 |
| 21 | Ga0070680_100126715 | 3300005336 | Bacteria | 2134 |
| 22 | Ga0070680_100347009 | 3300005336 | Bacteria | 1262 |
| 23 | Ga0070682_100013961 | 3300005337 | Bacteria | 4634 |
| 24 | Ga0070682_100079462 | 3300005337 | Bacteria | 2118 |
| 25 | Ga0068868_100120853 | 3300005338 | Bacteria | 2136 |
| 26 | Ga0068868_100423853 | 3300005338 | Bacteria | 1152 |
| 27 | Ga0070660_100008614 | 3300005339 | Bacteria | 7139 |
| 28 | Ga0070660_100277606 | 3300005339 | Bacteria | 1371 |
| 29 | Ga0070689_100051873 | 3300005340 | Bacteria | 3171 |
| 30 | Ga0070689_100122333 | 3300005340 | Bacteria | 2079 |
| 31 | Ga0070691_10152228 | 3300005341 | Bacteria | 1187 |
| 32 | Ga0070687_100180124 | 3300005343 | Bacteria | 1265 |
| 33 | Ga0070692_10000008 | 3300005345 | Bacteria | 47438 |
| 34 | Ga0070692_10027989 | 3300005345 | Bacteria | 2798 |
| 35 | Ga0070669_100058695 | 3300005353 | Bacteria | 2824 |
| 36 | Ga0070675_100016085 | 3300005354 | Bacteria | 5930 |
| 37 | Ga0070675_100096738 | 3300005354 | Bacteria | 2481 |
| 38 | Ga0070671_100033139 | 3300005355 | Bacteria | 4271 |
| 39 | Ga0070671_100100134 | 3300005355 | Bacteria | 2431 |
| 40 | Ga0070671_100496951 | 3300005355 | Bacteria | 1049 |
| 41 | Ga0070671_100616961 | 3300005355 | Bacteria | 938 |
| 42 | Ga0070674_100000456 | 3300005356 | Bacteria | 20586 |
| 43 | Ga0070674_100179631 | 3300005356 | Bacteria | 1620 |
| 44 | Ga0070673_100037972 | 3300005364 | Bacteria | 3674 |
| 45 | Ga0070673_100328753 | 3300005364 | Bacteria | 1352 |
| 46 | Ga0070688_100008112 | 3300005365 | Bacteria | 5690 |
| 47 | Ga0070688_100035477 | 3300005365 | Bacteria | 3030 |
| 48 | Ga0070688_100407982 | 3300005365 | Bacteria | 1007 |
| 49 | Ga0070659_100009561 | 3300005366 | Bacteria | 7124 |
| 50 | Ga0070659_100120197 | 3300005366 | Bacteria | 2127 |
| 51 | Ga0070659_100205586 | 3300005366 | Bacteria | 1622 |
| 52 | Ga0070667_100041051 | 3300005367 | Bacteria | 3882 |
| 53 | Ga0070667_100067811 | 3300005367 | Bacteria | 3035 |
| 54 | Ga0070667_100565571 | 3300005367 | Bacteria | 1046 |
| 55 | Ga0070703_10003001 | 3300005406 | Bacteria | 4821 |
| 56 | Ga0070703_10050284 | 3300005406 | Bacteria | 1330 |
| 57 | Ga0070709_10008980 | 3300005434 | Bacteria | 5505 |
| 58 | Ga0070709_10036382 | 3300005434 | Bacteria | 2999 |
| 59 | Ga0070709_10037312 | 3300005434 | Bacteria | 2967 |
| 60 | Ga0070709_10045792 | 3300005434 | Bacteria | 2717 |
| 61 | Ga0070709_10121863 | 3300005434 | Bacteria | 1769 |
| 62 | Ga0070709_10463575 | 3300005434 | Bacteria | 956 |
| 63 | Ga0070714_100035035 | 3300005435 | Bacteria | 4205 |
| 64 | Ga0070714_100057751 | 3300005435 | Bacteria | 3322 |
| 65 | Ga0070714_100137227 | 3300005435 | Bacteria | 2192 |
| 66 | Ga0070713_100020676 | 3300005436 | Bacteria | 5050 |
| 67 | Ga0070713_100258275 | 3300005436 | Bacteria | 1591 |
| 68 | Ga0070710_10053671 | 3300005437 | Bacteria | 2271 |
| 69 | Ga0070701_10217497 | 3300005438 | Bacteria | 1138 |
| 70 | Ga0070711_100043656 | 3300005439 | Bacteria | 3038 |
| 71 | Ga0070711_100102762 | 3300005439 | Bacteria | 2082 |
| 72 | Ga0070711_100163490 | 3300005439 | Bacteria | 1690 |
| 73 | Ga0070711_100214283 | 3300005439 | Bacteria | 1493 |
| 74 | Ga0070705_100048399 | 3300005440 | Bacteria | 2463 |
| 75 | Ga0070705_100158202 | 3300005440 | Bacteria | 1511 |
| 76 | Ga0070705_100165663 | 3300005440 | Bacteria | 1482 |
| 77 | Ga0070705_100174827 | 3300005440 | Bacteria | 1449 |
| 78 | Ga0070700_100005017 | 3300005441 | Bacteria | 6979 |
| 79 | Ga0070694_100011811 | 3300005444 | Bacteria | 5415 |
| 80 | Ga0070694_100060362 | 3300005444 | Bacteria | 2585 |
| 81 | Ga0070694_100069947 | 3300005444 | Bacteria | 2415 |
| 82 | Ga0070708_100025847 | 3300005445 | Bacteria | 5021 |
| 83 | Ga0070663_100036543 | 3300005455 | Bacteria | 3413 |
| 84 | Ga0070678_100061496 | 3300005456 | Bacteria | 2768 |
| 85 | Ga0070662_100009709 | 3300005457 | Bacteria | 6298 |
| 86 | Ga0070662_100121499 | 3300005457 | Bacteria | 2003 |
| 87 | Ga0070681_10087410 | 3300005458 | Bacteria | 3070 |
| 88 | Ga0070681_10214217 | 3300005458 | Bacteria | 1842 |
| 89 | Ga0070681_10440376 | 3300005458 | Bacteria | 1215 |
| 90 | Ga0070681_10639002 | 3300005458 | Bacteria | 979 |
| 91 | Ga0068867_100059792 | 3300005459 | Bacteria | 2825 |
| 92 | Ga0070685_10009054 | 3300005466 | Bacteria | 5136 |
| 93 | Ga0070685_10066335 | 3300005466 | Bacteria | 2126 |
| 94 | Ga0070707_100069965 | 3300005468 | Bacteria | 3380 |
| 95 | Ga0070707_100251491 | 3300005468 | Bacteria | 1720 |
| 96 | Ga0070707_100524883 | 3300005468 | Bacteria | 1146 |
| 97 | Ga0070698_100929307 | 3300005471 | Bacteria | 816 |
| 98 | Ga0070679_100052860 | 3300005530 | Bacteria | 4044 |
| 99 | Ga0070679_100174006 | 3300005530 | Bacteria | 2125 |
| 100 | Ga0070679_100254195 | 3300005530 | Bacteria | 1713 |
| 101 | Ga0070679_100254589 | 3300005530 | Bacteria | 1711 |
| 102 | Ga0070684_100322239 | 3300005535 | Bacteria | 1420 |
| 103 | Ga0068853_100023115 | 3300005539 | Bacteria | 5203 |
| 104 | Ga0070672_100233162 | 3300005543 | Bacteria | 1547 |
| 105 | Ga0070672_100268521 | 3300005543 | Bacteria | 1440 |
| 106 | Ga0070686_100022223 | 3300005544 | Bacteria | 3775 |
| 107 | Ga0070686_100203350 | 3300005544 | Bacteria | 1421 |
| 108 | Ga0070695_100011865 | 3300005545 | Bacteria | 5215 |
| 109 | Ga0070695_100014581 | 3300005545 | Bacteria | 4738 |
| 110 | Ga0070695_100026690 | 3300005545 | Bacteria | 3575 |
| 111 | Ga0070695_100375927 | 3300005545 | Bacteria | 1071 |
| 112 | Ga0070695_100451580 | 3300005545 | Bacteria | 985 |
| 113 | Ga0070696_100024640 | 3300005546 | Bacteria | 4090 |
| 114 | Ga0070696_100091787 | 3300005546 | Bacteria | 2163 |
| 115 | Ga0070696_100115984 | 3300005546 | Bacteria | 1933 |
| 116 | Ga0070693_100011715 | 3300005547 | Bacteria | 4421 |
| 117 | Ga0070693_100047229 | 3300005547 | Bacteria | 2449 |
| 118 | Ga0070704_100003857 | 3300005549 | Bacteria | 8632 |
| 119 | Ga0070704_100030432 | 3300005549 | Bacteria | 3617 |
| 120 | Ga0070704_100140760 | 3300005549 | Bacteria | 1883 |
| 121 | Ga0070704_100744635 | 3300005549 | Bacteria | 872 |
| 122 | Ga0068855_100067277 | 3300005563 | Bacteria | 4174 |
| 123 | Ga0068855_100093341 | 3300005563 | Bacteria | 3470 |
| 124 | Ga0068855_100132246 | 3300005563 | Bacteria | 2848 |
| 125 | Ga0068855_100200073 | 3300005563 | Bacteria | 2249 |
| 126 | Ga0070664_100058305 | 3300005564 | Bacteria | 3284 |
| 127 | Ga0070664_100359893 | 3300005564 | Bacteria | 1325 |
| 128 | Ga0068857_100259640 | 3300005577 | Bacteria | 1594 |
| 129 | Ga0068857_100277508 | 3300005577 | Bacteria | 1541 |
| 130 | Ga0068857_100392680 | 3300005577 | Bacteria | 1290 |
| 131 | Ga0068854_100080568 | 3300005578 | Bacteria | 2403 |
| 132 | Ga0068856_100041527 | 3300005614 | Bacteria | 4521 |
| 133 | Ga0068856_100137973 | 3300005614 | Bacteria | 2445 |
| 134 | Ga0068856_100262757 | 3300005614 | Bacteria | 1742 |
| 135 | Ga0068856_100373940 | 3300005614 | Bacteria | 1444 |
| 136 | Ga0070702_100071323 | 3300005615 | Bacteria | 2053 |
| 137 | Ga0068852_100042613 | 3300005616 | Bacteria | 3843 |
| 138 | Ga0068852_100282026 | 3300005616 | Bacteria | 1602 |
| 139 | Ga0068852_100398951 | 3300005616 | Bacteria | 1353 |
| 140 | Ga0068859_100036332 | 3300005617 | Bacteria | 4946 |
| 141 | Ga0068859_100115780 | 3300005617 | Bacteria | 2745 |
| 142 | Ga0068859_100150189 | 3300005617 | Bacteria | 2405 |
| 143 | Ga0068864_100079171 | 3300005618 | Bacteria | 2877 |
| 144 | Ga0068864_100181923 | 3300005618 | Bacteria | 1922 |
| 145 | Ga0068866_10070764 | 3300005718 | Bacteria | 1843 |
| 146 | Ga0068861_100098948 | 3300005719 | Bacteria | 2316 |
| 147 | Ga0068863_100111336 | 3300005841 | Bacteria | 2608 |
| 148 | Ga0068863_100295529 | 3300005841 | Bacteria | 1570 |
| 149 | Ga0068863_100471954 | 3300005841 | Bacteria | 1233 |
| 150 | Ga0068858_100000512 | 3300005842 | Bacteria | 40596 |
| 151 | Ga0068858_100065166 | 3300005842 | Bacteria | 3371 |
| 152 | Ga0068858_100113862 | 3300005842 | Bacteria | 2526 |
| 153 | Ga0068858_100157576 | 3300005842 | Bacteria | 2137 |
| 154 | Ga0068858_100276198 | 3300005842 | Bacteria | 1599 |
| 155 | Ga0068860_100040149 | 3300005843 | Bacteria | 4474 |
| 156 | Ga0068860_100181065 | 3300005843 | Bacteria | 2036 |
| 157 | Ga0068862_100000557 | 3300005844 | Bacteria | 38898 |
| 158 | Ga0068862_100021018 | 3300005844 | Bacteria | 5453 |
| 159 | Ga0068862_100552056 | 3300005844 | Bacteria | 1100 |
| 160 | Ga0081455_10000035 | 3300005937 | Bacteria | 136366 |
| 161 | Ga0081455_10069074 | 3300005937 | Bacteria | 2939 |
| 162 | Ga0070717_10003781 | 3300006028 | Bacteria | 10877 |
| 163 | Ga0070717_10348501 | 3300006028 | Bacteria | 1324 |
| 164 | Ga0070717_10587645 | 3300006028 | Bacteria | 1010 |
| 165 | Ga0070715_10035594 | 3300006163 | Bacteria | 2049 |
| 166 | Ga0070716_100046614 | 3300006173 | Bacteria | 2440 |
| 167 | Ga0070716_100067257 | 3300006173 | Bacteria | 2093 |
| 168 | Ga0070716_100301529 | 3300006173 | Bacteria | 1115 |
| 169 | Ga0070712_100003673 | 3300006175 | Bacteria | 9460 |
| 170 | Ga0070712_100057204 | 3300006175 | Bacteria | 2738 |
| 171 | Ga0070712_100175892 | 3300006175 | Bacteria | 1664 |
| 172 | Ga0075427_10001188 | 3300006194 | Bacteria | 3308 |
| 173 | Ga0097621_100092009 | 3300006237 | Bacteria | 2539 |
| 174 | Ga0068871_100159997 | 3300006358 | Bacteria | 1925 |
| 175 | Ga0075428_100015574 | 3300006844 | Bacteria | 8429 |
| 176 | Ga0075428_100091010 | 3300006844 | Bacteria | 3328 |
| 177 | Ga0075430_100003545 | 3300006846 | Bacteria | 13067 |
| 178 | Ga0075430_100007795 | 3300006846 | Bacteria | 9046 |
| 179 | Ga0075430_100142740 | 3300006846 | Bacteria | 1994 |
| 180 | Ga0075431_100012917 | 3300006847 | Bacteria | 8429 |
| 181 | Ga0075431_100029273 | 3300006847 | Bacteria | 5667 |
| 182 | Ga0075433_10004405 | 3300006852 | Bacteria | 10960 |
| 183 | Ga0075433_10066986 | 3300006852 | Bacteria | 3151 |
| 184 | Ga0075433_10252959 | 3300006852 | Bacteria | 1563 |
| 185 | Ga0075434_100001135 | 3300006871 | Bacteria | 21932 |
| 186 | Ga0075434_100045346 | 3300006871 | Bacteria | 4361 |
| 187 | Ga0075434_100102139 | 3300006871 | Bacteria | 2875 |
| 188 | Ga0075434_100299100 | 3300006871 | Bacteria | 1630 |
| 189 | Ga0075434_100814204 | 3300006871 | Bacteria | 950 |
| 190 | Ga0075429_100000008 | 3300006880 | Bacteria | 86739 |
| 191 | Ga0075429_100001354 | 3300006880 | Bacteria | 20025 |
| 192 | Ga0068865_100000119 | 3300006881 | Bacteria | 39895 |
| 193 | Ga0068865_100117671 | 3300006881 | Bacteria | 1970 |
| 194 | Ga0075436_100010766 | 3300006914 | Bacteria | 6274 |
| 195 | Ga0075436_100019478 | 3300006914 | Bacteria | 4650 |
| 196 | Ga0075436_100052595 | 3300006914 | Bacteria | 2812 |
| 197 | Ga0097620_100036331 | 3300006931 | Bacteria | 4946 |
| 198 | Ga0097620_100115777 | 3300006931 | Bacteria | 2745 |
| 199 | Ga0097620_100150183 | 3300006931 | Bacteria | 2405 |
| 200 | Ga0075435_100042204 | 3300007076 | Bacteria | 3649 |
| 201 | Ga0075435_100045146 | 3300007076 | Bacteria | 3531 |
| 202 | Ga0075435_100047158 | 3300007076 | Bacteria | 3459 |
| 203 | Ga0075435_100213941 | 3300007076 | Bacteria | 1636 |
| 204 | Ga0075435_100219849 | 3300007076 | Bacteria | 1613 |
| 205 | Ga0075435_100267505 | 3300007076 | Bacteria | 1457 |
| 206 | Ga0099795_10007316 | 3300007788 | Bacteria | 3073 |
| 207 | Ga0105251_10024945 | 3300009011 | Bacteria | 3064 |
| 208 | Ga0105240_10035786 | 3300009093 | Bacteria | 6394 |
| 209 | Ga0111539_10001512 | 3300009094 | Bacteria | 31036 |
| 210 | Ga0111539_10019347 | 3300009094 | Bacteria | 8406 |
| 211 | Ga0111539_11143595 | 3300009094 | Bacteria | 904 |
| 212 | Ga0105245_10128369 | 3300009098 | Bacteria | 2376 |
| 213 | Ga0105245_10218347 | 3300009098 | Bacteria | 1838 |
| 214 | Ga0105247_10191744 | 3300009101 | Bacteria | 1369 |
| 215 | Ga0105247_10255653 | 3300009101 | Bacteria | 1199 |
| 216 | Ga0114129_10056907 | 3300009147 | Bacteria | 5474 |
| 217 | Ga0114129_10066967 | 3300009147 | Bacteria | 5008 |
| 218 | Ga0114129_10175903 | 3300009147 | Bacteria | 2915 |
| 219 | Ga0105243_10020499 | 3300009148 | Bacteria | 5012 |
| 220 | Ga0105243_10146344 | 3300009148 | Bacteria | 2022 |
| 221 | Ga0105242_10002839 | 3300009176 | Bacteria | 13572 |
| 222 | Ga0105248_10190862 | 3300009177 | Bacteria | 2309 |
| 223 | Ga0105248_10240117 | 3300009177 | Bacteria | 2039 |
| 224 | Ga0105248_10372572 | 3300009177 | Bacteria | 1607 |
| 225 | Ga0105248_10633902 | 3300009177 | Bacteria | 1206 |
| 226 | Ga0105237_10265205 | 3300009545 | Bacteria | 1720 |
| 227 | Ga0105238_10085262 | 3300009551 | Bacteria | 3147 |
| 228 | Ga0105249_10000215 | 3300009553 | Bacteria | 66439 |
| 229 | Ga0105249_10009891 | 3300009553 | Bacteria | 8360 |
| 230 | Ga0105249_10115843 | 3300009553 | Bacteria | 2540 |
| 231 | Ga0105249_10133900 | 3300009553 | Bacteria | 2369 |
| 232 | Ga0105249_10688926 | 3300009553 | Bacteria | 1081 |
| 233 | Ga0099796_10005784 | 3300010159 | Bacteria | 3112 |
| 234 | Ga0105239_10028262 | 3300010375 | Bacteria | 6169 |
| 235 | Ga0105239_10319600 | 3300010375 | Bacteria | 1750 |
| 236 | Ga0105239_10414397 | 3300010375 | Bacteria | 1526 |
| 237 | Ga0105239_10525955 | 3300010375 | Bacteria | 1346 |
| 238 | Ga0105246_10000019 | 3300011119 | Bacteria | 62666 |
| 239 | Ga0105246_10145180 | 3300011119 | Bacteria | 1789 |
| 240 | Ga0105246_10225498 | 3300011119 | Bacteria | 1472 |
| 241 | Ga0157370_10051700 | 3300013104 | Bacteria | 3924 |
| 242 | Ga0157370_10263703 | 3300013104 | Bacteria | 1592 |
| 243 | Ga0157370_10319230 | 3300013104 | Bacteria | 1433 |
| 244 | Ga0157369_10004736 | 3300013105 | Bacteria | 15983 |
| 245 | Ga0157374_10326771 | 3300013296 | Unclassified | 1521 |
| 246 | Ga0157374_10539711 | 3300013296 | Bacteria | 1173 |
| 247 | Ga0157378_10002701 | 3300013297 | Bacteria | 15807 |
| 248 | Ga0157378_10240375 | 3300013297 | Bacteria | 1729 |
| 249 | Ga0157378_10246363 | 3300013297 | Bacteria | 1709 |
| 250 | Ga0163162_10001187 | 3300013306 | Bacteria | 24299 |
| 251 | Ga0163162_10087104 | 3300013306 | Bacteria | 3201 |
| 252 | Ga0163162_10306353 | 3300013306 | Bacteria | 1721 |
| 253 | Ga0163162_10570722 | 3300013306 | Bacteria | 1259 |
| 254 | Ga0157372_10701660 | 3300013307 | Bacteria | 1177 |
| 255 | Ga0157372_10992013 | 3300013307 | Bacteria | 973 |
| 256 | Ga0157375_10010957 | 3300013308 | Bacteria | 7996 |
| 257 | Ga0157375_10228605 | 3300013308 | Bacteria | 2019 |
| 258 | Ga0157375_10493174 | 3300013308 | Bacteria | 1389 |
| 259 | Ga0157375_10499742 | 3300013308 | Bacteria | 1380 |
| 260 | Ga0163163_10019264 | 3300014325 | Bacteria | 6406 |
| 261 | Ga0163163_10263527 | 3300014325 | Bacteria | 1774 |
| 262 | Ga0163163_10393967 | 3300014325 | Bacteria | 1443 |
| 263 | Ga0157380_10000284 | 3300014326 | Bacteria | 30507 |
| 264 | Ga0157380_10578608 | 3300014326 | Bacteria | 1107 |
| 265 | Ga0182008_10017977 | 3300014497 | Bacteria | 3662 |
| 266 | Ga0182008_10131793 | 3300014497 | Bacteria | 1246 |
| 267 | Ga0157379_10208769 | 3300014968 | Bacteria | 1767 |
| 268 | Ga0157379_10320881 | 3300014968 | Bacteria | 1414 |
| 269 | Ga0157376_10363081 | 3300014969 | Bacteria | 1389 |
| 270 | Ga0163161_10100882 | 3300017792 | Bacteria | 2149 |
| 271 | Ga0163161_10274660 | 3300017792 | Bacteria | 1320 |
| 272 | Ga0206354_10285912 | 3300020081 | Bacteria | 1614 |
| 273 | Ga0206353_10528377 | 3300020082 | Bacteria | 2063 |
| 274 | Ga0206353_11144301 | 3300020082 | Bacteria | 1886 |
| 275 | Ga0213876_10033890 | 3300021384 | Bacteria | 2692 |
| 276 | Ga0213875_10000165 | 3300021388 | Bacteria | 68805 |
| 277 | Ga0207666_1000744 | 3300025271 | Bacteria | 3908 |
| 278 | Ga0207697_10003696 | 3300025315 | Bacteria | 7483 |
| 279 | Ga0207653_10001699 | 3300025885 | Bacteria | 7037 |
| 280 | Ga0207692_10040821 | 3300025898 | Bacteria | 2292 |
| 281 | Ga0207692_10052375 | 3300025898 | Bacteria | 2074 |
| 282 | Ga0207692_10092149 | 3300025898 | Bacteria | 1646 |
| 283 | Ga0207710_10004914 | 3300025900 | Bacteria | 5794 |
| 284 | Ga0207688_10034764 | 3300025901 | Bacteria | 2790 |
| 285 | Ga0207688_10155127 | 3300025901 | Bacteria | 1355 |
| 286 | Ga0207680_10101178 | 3300025903 | Bacteria | 1852 |
| 287 | Ga0207647_10043164 | 3300025904 | Bacteria | 2823 |
| 288 | Ga0207685_10013800 | 3300025905 | Bacteria | 2510 |
| 289 | Ga0207685_10016988 | 3300025905 | Bacteria | 2341 |
| 290 | Ga0207699_10061149 | 3300025906 | Bacteria | 2265 |
| 291 | Ga0207699_10068983 | 3300025906 | Bacteria | 2154 |
| 292 | Ga0207699_10106676 | 3300025906 | Bacteria | 1788 |
| 293 | Ga0207699_10160123 | 3300025906 | Bacteria | 1497 |
| 294 | Ga0207699_10318315 | 3300025906 | Bacteria | 1090 |
| 295 | Ga0207645_10053476 | 3300025907 | Bacteria | 2581 |
| 296 | Ga0207705_10203974 | 3300025909 | Bacteria | 1498 |
| 297 | Ga0207707_10009645 | 3300025912 | Bacteria | 8375 |
| 298 | Ga0207707_10211145 | 3300025912 | Bacteria | 1691 |
| 299 | Ga0207707_10256086 | 3300025912 | Bacteria | 1519 |
| 300 | Ga0207693_10009873 | 3300025915 | Bacteria | 7764 |
| 301 | Ga0207693_10017770 | 3300025915 | Bacteria | 5671 |
| 302 | Ga0207693_10209191 | 3300025915 | Bacteria | 1533 |
| 303 | Ga0207663_10043923 | 3300025916 | Bacteria | 2740 |
| 304 | Ga0207663_10194238 | 3300025916 | Bacteria | 1460 |
| 305 | Ga0207660_10174634 | 3300025917 | Bacteria | 1665 |
| 306 | Ga0207660_10314724 | 3300025917 | Bacteria | 1249 |
| 307 | Ga0207657_10010318 | 3300025919 | Bacteria | 9328 |
| 308 | Ga0207657_10074179 | 3300025919 | Bacteria | 2874 |
| 309 | Ga0207657_10120100 | 3300025919 | Bacteria | 2163 |
| 310 | Ga0207649_10293675 | 3300025920 | Bacteria | 1186 |
| 311 | Ga0207652_10026006 | 3300025921 | Bacteria | 4871 |
| 312 | Ga0207652_10153018 | 3300025921 | Bacteria | 2066 |
| 313 | Ga0207652_10209758 | 3300025921 | Bacteria | 1754 |
| 314 | Ga0207646_10085210 | 3300025922 | Bacteria | 2827 |
| 315 | Ga0207646_10446086 | 3300025922 | Bacteria | 1168 |
| 316 | Ga0207681_10277169 | 3300025923 | Bacteria | 1319 |
| 317 | Ga0207694_10244276 | 3300025924 | Bacteria | 1468 |
| 318 | Ga0207650_10603563 | 3300025925 | Bacteria | 923 |
| 319 | Ga0207659_10028682 | 3300025926 | Bacteria | 3784 |
| 320 | Ga0207687_10006850 | 3300025927 | Bacteria | 7503 |
| 321 | Ga0207687_10179633 | 3300025927 | Bacteria | 1639 |
| 322 | Ga0207700_10004694 | 3300025928 | Bacteria | 8096 |
| 323 | Ga0207700_10018933 | 3300025928 | Bacteria | 4640 |
| 324 | Ga0207700_10426199 | 3300025928 | Bacteria | 1166 |
| 325 | Ga0207664_10041800 | 3300025929 | Bacteria | 3573 |
| 326 | Ga0207664_10098805 | 3300025929 | Bacteria | 2408 |
| 327 | Ga0207664_10410093 | 3300025929 | Bacteria | 1206 |
| 328 | Ga0207644_10120276 | 3300025931 | Bacteria | 1998 |
| 329 | Ga0207644_10312897 | 3300025931 | Bacteria | 1268 |
| 330 | Ga0207644_10432814 | 3300025931 | Bacteria | 1079 |
| 331 | Ga0207690_10040362 | 3300025932 | Bacteria | 3051 |
| 332 | Ga0207690_10231023 | 3300025932 | Bacteria | 1420 |
| 333 | Ga0207706_10017526 | 3300025933 | Bacteria | 6456 |
| 334 | Ga0207706_10088991 | 3300025933 | Bacteria | 2714 |
| 335 | Ga0207686_10035002 | 3300025934 | Bacteria | 3011 |
| 336 | Ga0207686_10038994 | 3300025934 | Bacteria | 2879 |
| 337 | Ga0207709_10070620 | 3300025935 | Bacteria | 2215 |
| 338 | Ga0207670_10112784 | 3300025936 | Bacteria | 1962 |
| 339 | Ga0207669_10026526 | 3300025937 | Bacteria | 3153 |
| 340 | Ga0207669_10119421 | 3300025937 | Bacteria | 1786 |
| 341 | Ga0207704_10024045 | 3300025938 | Bacteria | 3295 |
| 342 | Ga0207665_10000631 | 3300025939 | Bacteria | 23652 |
| 343 | Ga0207665_10265993 | 3300025939 | Bacteria | 1272 |
| 344 | Ga0207665_10267406 | 3300025939 | Bacteria | 1268 |
| 345 | Ga0207665_10480970 | 3300025939 | Bacteria | 957 |
| 346 | Ga0207691_10055482 | 3300025940 | Bacteria | 3611 |
| 347 | Ga0207691_10285128 | 3300025940 | Bacteria | 1421 |
| 348 | Ga0207711_10016598 | 3300025941 | Bacteria | 6115 |
| 349 | Ga0207711_10054868 | 3300025941 | Bacteria | 3420 |
| 350 | Ga0207711_10455513 | 3300025941 | Bacteria | 1191 |
| 351 | Ga0207689_10036982 | 3300025942 | Bacteria | 4052 |
| 352 | Ga0207679_10066279 | 3300025945 | Bacteria | 2705 |
| 353 | Ga0207679_10126399 | 3300025945 | Bacteria | 2044 |
| 354 | Ga0207667_10099491 | 3300025949 | Bacteria | 3000 |
| 355 | Ga0207667_10220282 | 3300025949 | Bacteria | 1944 |
| 356 | Ga0207651_10037972 | 3300025960 | Bacteria | 3160 |
| 357 | Ga0207651_10691524 | 3300025960 | Bacteria | 898 |
| 358 | Ga0207712_10037284 | 3300025961 | Bacteria | 3316 |
| 359 | Ga0207712_10073558 | 3300025961 | Bacteria | 2465 |
| 360 | Ga0207712_10126500 | 3300025961 | Bacteria | 1941 |
| 361 | Ga0207712_10535035 | 3300025961 | Bacteria | 1006 |
| 362 | Ga0207668_10090761 | 3300025972 | Bacteria | 2243 |
| 363 | Ga0207640_10061221 | 3300025981 | Bacteria | 2492 |
| 364 | Ga0207658_10015437 | 3300025986 | Bacteria | 5240 |
| 365 | Ga0207658_10399165 | 3300025986 | Bacteria | 1208 |
| 366 | Ga0207677_10578127 | 3300026023 | Bacteria | 983 |
| 367 | Ga0207639_10092709 | 3300026041 | Bacteria | 2421 |
| 368 | Ga0207678_10014489 | 3300026067 | Bacteria | 6931 |
| 369 | Ga0207678_10027526 | 3300026067 | Bacteria | 4961 |
| 370 | Ga0207678_10036968 | 3300026067 | Bacteria | 4250 |
| 371 | Ga0207708_10002641 | 3300026075 | Bacteria | 13186 |
| 372 | Ga0207708_10281192 | 3300026075 | Bacteria | 1348 |
| 373 | Ga0207702_10101298 | 3300026078 | Bacteria | 2543 |
| 374 | Ga0207702_10204902 | 3300026078 | Bacteria | 1831 |
| 375 | Ga0207702_10281850 | 3300026078 | Bacteria | 1571 |
| 376 | Ga0207641_10118183 | 3300026088 | Bacteria | 2361 |
| 377 | Ga0207641_10161900 | 3300026088 | Bacteria | 2035 |
| 378 | Ga0207641_10190827 | 3300026088 | Bacteria | 1883 |
| 379 | Ga0207648_10038868 | 3300026089 | Bacteria | 4187 |
| 380 | Ga0207648_10289894 | 3300026089 | Bacteria | 1465 |
| 381 | Ga0207676_10072633 | 3300026095 | Bacteria | 2766 |
| 382 | Ga0207674_10235913 | 3300026116 | Bacteria | 1777 |
| 383 | Ga0207674_10266694 | 3300026116 | Bacteria | 1660 |
| 384 | Ga0207674_10301720 | 3300026116 | Bacteria | 1550 |
| 385 | Ga0207675_100028481 | 3300026118 | Bacteria | 5201 |
| 386 | Ga0207683_10045639 | 3300026121 | Bacteria | 3832 |
| 387 | Ga0207683_10054532 | 3300026121 | Bacteria | 3505 |
| 388 | Ga0207683_10141858 | 3300026121 | Bacteria | 2165 |
| 389 | Ga0207698_10126915 | 3300026142 | Bacteria | 2172 |
| 390 | Ga0207698_10158228 | 3300026142 | Bacteria | 1977 |
| 391 | Ga0209966_1001251 | 3300027695 | Bacteria | 4513 |
| 392 | Ga0209966_1001450 | 3300027695 | Bacteria | 4112 |
| 393 | Ga0209966_1008347 | 3300027695 | Bacteria | 1837 |
| 394 | Ga0209998_10000949 | 3300027717 | Bacteria | 7357 |
| 395 | Ga0209998_10009395 | 3300027717 | Bacteria | 2030 |
| 396 | Ga0209974_10001910 | 3300027876 | Bacteria | 7600 |
| 397 | Ga0209974_10087552 | 3300027876 | Bacteria | 1077 |
| 398 | Ga0207428_10000308 | 3300027907 | Bacteria | 64810 |
| 399 | Ga0207428_10000474 | 3300027907 | Bacteria | 48360 |
| 400 | Ga0268266_10051110 | 3300028379 | Bacteria | 3547 |
| 401 | Ga0268266_10294300 | 3300028379 | Bacteria | 1513 |
| 402 | Ga0268265_10026332 | 3300028380 | Bacteria | 4137 |
| 403 | Ga0268265_10612441 | 3300028380 | Bacteria | 1042 |
| 404 | Ga0268264_10159321 | 3300028381 | Bacteria | 2031 |
| 405 | Ga0268264_10359016 | 3300028381 | Bacteria | 1389 |
| 406 | Ga0268264_10476480 | 3300028381 | Bacteria | 1213 |
| 407 | Ga0265338_10002492 | 3300028800 | Bacteria | 27463 |
| 408 | Ga0265338_10064148 | 3300028800 | Bacteria | 3197 |
| 409 | Ga0265762_1006598 | 3300030760 | Bacteria | 2074 |
| 410 | Ga0265330_10003043 | 3300031235 | Bacteria | 8895 |
| 411 | Ga0265332_10001070 | 3300031238 | Bacteria | 15993 |
| 412 | Ga0265325_10000352 | 3300031241 | Bacteria | 32405 |
| 413 | Ga0265325_10052644 | 3300031241 | Bacteria | 2089 |
| 414 | Ga0265325_10165057 | 3300031241 | Bacteria | 1039 |
| 415 | Ga0265340_10006050 | 3300031247 | Bacteria | 6672 |
| 416 | Ga0265340_10034466 | 3300031247 | Bacteria | 2518 |
| 417 | Ga0265340_10100770 | 3300031247 | Bacteria | 1342 |
| 418 | Ga0265339_10000979 | 3300031249 | Bacteria | 21883 |
| 419 | Ga0265339_10005391 | 3300031249 | Bacteria | 8520 |
| 420 | Ga0265339_10012730 | 3300031249 | Bacteria | 5120 |
| 421 | Ga0265339_10015364 | 3300031249 | Bacteria | 4590 |
| 422 | Ga0265316_10044436 | 3300031344 | Bacteria | 3534 |
| 423 | Ga0265316_10084271 | 3300031344 | Bacteria | 2434 |
| 424 | Ga0265313_10000686 | 3300031595 | Bacteria | 34918 |
| 425 | Ga0316579_10024922 | 3300031691 | Bacteria | 2696 |
| 426 | Ga0265314_10003780 | 3300031711 | Bacteria | 14466 |
| 427 | Ga0265314_10005573 | 3300031711 | Bacteria | 11319 |
| 428 | Ga0265342_10000031 | 3300031712 | Bacteria | 152577 |
| 429 | Ga0265342_10000882 | 3300031712 | Bacteria | 29894 |
| 430 | Ga0265342_10004819 | 3300031712 | Bacteria | 10468 |
| 431 | Ga0316583_10000161 | 3300032133 | Bacteria | 16491 |
| 432 | Ga0373930_0000020 | 3300034816 | Bacteria | 15356 |
| 433 | Ga0373930_0012248 | 3300034816 | Bacteria | 1562 |
| 434 | Ga0373948_0000371 | 3300034817 | Bacteria | 5533 |
| 435 | Ga0373948_0012850 | 3300034817 | Bacteria | 1502 |
| 436 | Ga0373950_0000266 | 3300034818 | Bacteria | 6589 |
| 437 | Ga0373958_0000533 | 3300034819 | Bacteria | 4759 |
| 438 | Ga0373959_0000539 | 3300034820 | Bacteria | 6764 |
| 439 | Ga0373938_0000748 | 3300034957 | Bacteria | 5254 |
| 440 | Ga0373926_0004368 | 3300035083 | Bacteria | 4639 |
| 441 | Ga0373926_0016309 | 3300035083 | Bacteria | 2539 |
| 442 | Ga0373926_0106149 | 3300035083 | Bacteria | 1053 |
| 443 | Ga0373928_0004305 | 3300035084 | Bacteria | 2718 |
| 444 | Ga0373929_0000042 | 3300035085 | Bacteria | 29236 |
| 445 | Ga0373934_0013885 | 3300035086 | Bacteria | 3047 |
| 446 | Ga0373934_0042312 | 3300035086 | Bacteria | 1799 |
| 447 | Ga0373934_0054287 | 3300035086 | Bacteria | 1591 |
| 448 | Ga0373940_0000325 | 3300035088 | Bacteria | 7005 |
| 449 | Ga0373944_0019405 | 3300035089 | Bacteria | 1950 |
| 450 | Ga0373949_0001117 | 3300035090 | Bacteria | 8122 |
| 451 | Ga0373951_0000547 | 3300035091 | Bacteria | 10574 |
| 452 | Ga0373952_0000713 | 3300035092 | Bacteria | 5943 |
| 453 | Ga0373952_0008868 | 3300035092 | Bacteria | 1914 |
| 454 | Ga0373952_0021568 | 3300035092 | Bacteria | 1361 |
| 455 | Ga0373923_0002274 | 3300035111 | Bacteria | 5855 |
| 456 | Ga0373923_0041700 | 3300035111 | Bacteria | 1893 |
| 457 | Ga0373932_0001186 | 3300035112 | Bacteria | 7459 |
| 458 | Ga0373932_0002300 | 3300035112 | Bacteria | 4857 |
| 459 | Ga0373936_0001104 | 3300035113 | Bacteria | 9672 |
| 460 | Ga0373936_0019802 | 3300035113 | Bacteria | 2610 |
| 461 | Ga0373936_0084800 | 3300035113 | Bacteria | 1322 |
| 462 | Ga0373939_0000360 | 3300035114 | Bacteria | 11493 |
| 463 | Ga0373939_0011935 | 3300035114 | Bacteria | 2205 |
| 464 | Ga0373941_0001805 | 3300035115 | Bacteria | 4608 |
| 465 | Ga0373941_0005933 | 3300035115 | Bacteria | 2911 |
| 466 | Ga0373945_0000503 | 3300035116 | Bacteria | 11108 |
| 467 | Ga0373953_0000488 | 3300035117 | Bacteria | 10969 |
| 468 | Ga0373953_0048465 | 3300035117 | Bacteria | 1712 |
| 469 | Ga0373954_0004286 | 3300035118 | Bacteria | 6131 |
| 470 | Ga0373954_0057832 | 3300035118 | Bacteria | 1826 |
| 471 | Ga0373956_0014464 | 3300035119 | Bacteria | 3298 |
| 472 | Ga0373956_0024246 | 3300035119 | Bacteria | 2611 |
| 473 | Ga0373957_0005912 | 3300035120 | Bacteria | 3826 |
| 474 | Ga0373957_0016648 | 3300035120 | Bacteria | 2548 |
| 475 | Ga0373957_0052263 | 3300035120 | Bacteria | 1565 |
| 476 | Ga0373957_0133632 | 3300035120 | Bacteria | 1011 |
| 477 | Ga0373960_0003891 | 3300035121 | Bacteria | 3403 |
| 478 | Ga0373960_0019041 | 3300035121 | Bacteria | 1798 |
| 479 | Ga0373960_0036289 | 3300035121 | Bacteria | 1403 |
| 480 | Ga0373943_0003705 | 3300035170 | Bacteria | 6950 |
| 481 | Ga0373943_0010637 | 3300035170 | Bacteria | 4128 |
| 482 | Ga0373943_0027110 | 3300035170 | Bacteria | 2689 |
| 483 | Ga0373946_0001059 | 3300035171 | Bacteria | 9481 |
| 484 | Ga0373946_0002277 | 3300035171 | Bacteria | 6784 |
| 485 | Ga0373955_0000425 | 3300035172 | Bacteria | 17797 |
| 486 | Ga0373955_0129552 | 3300035172 | Bacteria | 1472 |
| 487 | Ga0373955_0139733 | 3300035172 | Bacteria | 1419 |
| 488 | Ga0373942_0001477 | 3300035207 | Bacteria | 6050 |
| 489 | Ga0373942_0003320 | 3300035207 | Bacteria | 3782 |
| 490 | Ga0373942_0018232 | 3300035207 | Bacteria | 1740 |
| 491 | Ga0373961_0003189 | 3300035241 | Bacteria | 4093 |
| 492 | Ga0373962_0000354 | 3300035242 | Bacteria | 10085 |
| 493 | Ga0373962_0013857 | 3300035242 | Bacteria | 2048 |
| 494 | Ga0373924_0049494 | 3300035410 | Bacteria | 1739 |
| 495 | Ga0373931_0030133 | 3300035691 | Bacteria | 2791 |
| 496 | Ga0373931_0053231 | 3300035691 | Bacteria | 2159 |
| 497 | Ga0373931_0252020 | 3300035691 | Bacteria | 1074 |
| 498 | Ga0373935_0000337 | 3300035692 | Bacteria | 23756 |
| 499 | Ga0373935_0003255 | 3300035692 | Bacteria | 9390 |
| 500 | Ga0373935_0036252 | 3300035692 | Bacteria | 3083 |
| 501 | Ga0373935_0040667 | 3300035692 | Bacteria | 2918 |
| 502 | Ga0373935_0076945 | 3300035692 | Bacteria | 2161 |
| 503 | Ga0373927_0011982 | 3300035695 | Bacteria | 5768 |
| 504 | Ga0373927_0039586 | 3300035695 | Bacteria | 3060 |
| 505 | Ga0373927_0039898 | 3300035695 | Bacteria | 3046 |
| 506 | Ga0373927_0043067 | 3300035695 | Bacteria | 2924 |
| 507 | Ga0373927_0071590 | 3300035695 | Bacteria | 2244 |
| 508 | Ga0373933_0002475 | 3300035724 | Bacteria | 10393 |
| 509 | Ga0373933_0010438 | 3300035724 | Bacteria | 5091 |
| 510 | Ga0373933_0019109 | 3300035724 | Bacteria | 3864 |
| 511 | Ga0373933_0024531 | 3300035724 | Bacteria | 3452 |
| 512 | Ga0373933_0071924 | 3300035724 | Bacteria | 2106 |
| 513 | Ga0373933_0344860 | 3300035724 | Bacteria | 967 |
| 514 | Ga0373947_0001536 | 3300035725 | Bacteria | 14154 |
| 515 | Ga0373947_0012712 | 3300035725 | Bacteria | 4827 |
| 516 | Ga0373947_0030383 | 3300035725 | Bacteria | 3174 |
| 517 | Ga0373947_0053434 | 3300035725 | Bacteria | 2436 |
| 518 | Ga0373947_0494248 | 3300035725 | Bacteria | 831 |
| 519 | Ga0373937_0000223 | 3300036401 | Bacteria | 54957 |
| 520 | Ga0373937_0005292 | 3300036401 | Bacteria | 11025 |
| 521 | Ga0373937_0011036 | 3300036401 | Bacteria | 7921 |
| 522 | Ga0373937_0027077 | 3300036401 | Bacteria | 5182 |
| 523 | Ga0373937_0043671 | 3300036401 | Bacteria | 4093 |
| 524 | Ga0373937_0073445 | 3300036401 | Bacteria | 3155 |
| 525 | Ga0373925_0000741 | 3300037068 | Bacteria | 29997 |
| 526 | Ga0373925_0008940 | 3300037068 | Bacteria | 7298 |
| 527 | Ga0373925_0150446 | 3300037068 | Bacteria | 1828 |
| 528 | Ga0373925_0179833 | 3300037068 | Bacteria | 1673 |
| 529 | Ga0373925_0351784 | 3300037068 | Bacteria | 1196 |
| 530 | Ga0395899_0036755 | 3300037312 | Bacteria | 3672 |
| 531 | Ga0395900_0005074 | 3300037418 | Bacteria | 13816 |
| 532 | Ga0395900_0008149 | 3300037418 | Bacteria | 10783 |
| 533 | Ga0395900_0424802 | 3300037418 | Bacteria | 1289 |
| 534 | Ga0395898_0032574 | 3300037466 | Bacteria | 5203 |
| 535 | Ga0395898_0110478 | 3300037466 | Bacteria | 2635 |
| 536 | Ga0395898_0121248 | 3300037466 | Bacteria | 2505 |
| 537 | Ga0436364_1070861 | 3300037853 | Bacteria | 2778 |
| 538 | Ga0436364_1177974 | 3300037853 | Bacteria | 47646 |
| 539 | Ga0395901_0009281 | 3300038443 | Bacteria | 9972 |
| 540 | Ga0395901_0014372 | 3300038443 | Bacteria | 8058 |
| 541 | Ga0436365_0380370 | 3300039437 | Bacteria | 3101 |
| 542 | Ga0436365_0442321 | 3300039437 | Bacteria | 3409 |
| 543 | Ga0436365_0592364 | 3300039437 | Bacteria | 2713 |
| 544 | Ga0436361_0189320 | 3300039447 | Bacteria | 1174 |
| 545 | Ga0436361_0944607 | 3300039447 | Bacteria | 2274 |
| 546 | Ga0436363_0323907 | 3300039450 | Bacteria | 2156 |
| 547 | Ga0436362_0454806 | 3300039453 | Bacteria | 1227 |
| 548 | Ga0436362_1243395 | 3300039453 | Bacteria | 1501 |
| 549 | Ga0439441_006313 | 3300042001 | Bacteria | 1876 |
| 550 | Ga0439441_020180 | 3300042001 | Bacteria | 1219 |
| 551 | Ga0439460_0014322 | 3300042461 | Bacteria | 2084 |
| 552 | Ga0466966_0125083 | 3300044684 | Bacteria | 1577 |
| 553 | Ga0466963_0121732 | 3300044694 | Bacteria | 1796 |
| 554 | Ga0466971_0180933 | 3300044719 | Bacteria | 991 |
| 555 | Ga0466957_0066173 | 3300044842 | Bacteria | 2227 |
| 556 | Ga0466957_0187463 | 3300044842 | Bacteria | 1353 |
| 557 | Ga0451576_0023021 | 3300045051 | Bacteria | 6751 |
| 558 | Ga0451576_0056338 | 3300045051 | Bacteria | 4111 |
| 559 | Ga0466958_0067366 | 3300045836 | Bacteria | 2187 |
| 560 | Ga0466958_0320245 | 3300045836 | Bacteria | 996 |
| 561 | Ga0466967_0022504 | 3300045976 | Bacteria | 5144 |
| 562 | Ga0466967_0450012 | 3300045976 | Bacteria | 1258 |
| 563 | Ga0495592_0000188 | 3300046454 | Bacteria | 54485 |
| 564 | Ga0495592_0007677 | 3300046454 | Bacteria | 8074 |
| 565 | Ga0495592_0060198 | 3300046454 | Bacteria | 2794 |
| 566 | Ga0495592_0067404 | 3300046454 | Bacteria | 2615 |
| 567 | Ga0495592_0180560 | 3300046454 | Bacteria | 1438 |
| 568 | Ga0495603_0015554 | 3300046455 | Bacteria | 4605 |
| 569 | Ga0495603_0091022 | 3300046455 | Bacteria | 1783 |
| 570 | Ga0495591_033479 | 3300046458 | Bacteria | 1520 |
| 571 | Ga0495629_0000222 | 3300046459 | Bacteria | 50600 |
| 572 | Ga0495629_0002114 | 3300046459 | Bacteria | 15386 |
| 573 | Ga0495629_0092397 | 3300046459 | Bacteria | 2112 |
| 574 | Ga0495629_0101992 | 3300046459 | Bacteria | 2002 |
| 575 | Ga0495629_0139671 | 3300046459 | Bacteria | 1686 |
| 576 | Ga0495629_0158420 | 3300046459 | Bacteria | 1572 |
| 577 | Ga0495641_0013226 | 3300046461 | Bacteria | 4551 |
| 578 | Ga0495651_0001439 | 3300046462 | Bacteria | 18418 |
| 579 | Ga0495651_0014733 | 3300046462 | Bacteria | 6046 |
| 580 | Ga0495651_0101853 | 3300046462 | Bacteria | 2136 |
| 581 | Ga0495651_0142149 | 3300046462 | Bacteria | 1739 |
| 582 | Ga0495651_0149293 | 3300046462 | Bacteria | 1687 |
| 583 | Ga0495651_0164873 | 3300046462 | Bacteria | 1584 |
| 584 | Ga0495651_0248429 | 3300046462 | Bacteria | 1216 |
| 585 | Ga0495653_0000198 | 3300046463 | Bacteria | 49009 |
| 586 | Ga0495653_0027955 | 3300046463 | Bacteria | 4514 |
| 587 | Ga0495653_0037313 | 3300046463 | Bacteria | 3819 |
| 588 | Ga0495653_0140058 | 3300046463 | Bacteria | 1703 |
| 589 | Ga0495580_0022328 | 3300046472 | Bacteria | 4657 |
| 590 | Ga0495580_0120836 | 3300046472 | Bacteria | 1819 |
| 591 | Ga0495582_0040673 | 3300046473 | Bacteria | 2560 |
| 592 | Ga0495605_0151191 | 3300046474 | Bacteria | 1036 |
| 593 | Ga0495639_0008708 | 3300046475 | Bacteria | 4350 |
| 594 | Ga0495639_0137851 | 3300046475 | Bacteria | 1171 |
| 595 | Ga0495662_0000720 | 3300046476 | Bacteria | 15794 |
| 596 | Ga0495662_0009876 | 3300046476 | Bacteria | 4688 |
| 597 | Ga0495662_0096654 | 3300046476 | Bacteria | 1443 |
| 598 | Ga0495664_0000002 | 3300046477 | Bacteria | 625183 |
| 599 | Ga0495664_0003233 | 3300046477 | Bacteria | 8850 |
| 600 | Ga0495584_0077382 | 3300046491 | Bacteria | 1673 |
| 601 | Ga0495585_0001425 | 3300046492 | Bacteria | 18789 |
| 602 | Ga0495594_0091858 | 3300046499 | Bacteria | 1701 |
| 603 | Ga0495608_0000009 | 3300046511 | Bacteria | 266614 |
| 604 | Ga0495608_0002323 | 3300046511 | Bacteria | 13726 |
| 605 | Ga0495608_0014885 | 3300046511 | Bacteria | 5398 |
| 606 | Ga0495608_0423360 | 3300046511 | Bacteria | 812 |
| 607 | Ga0495618_0000005 | 3300046514 | Bacteria | 230421 |
| 608 | Ga0495618_0060945 | 3300046514 | Bacteria | 2393 |
| 609 | Ga0495628_0000002 | 3300046516 | Bacteria | 589399 |
| 610 | Ga0495628_0011343 | 3300046516 | Bacteria | 7543 |
| 611 | Ga0495628_0014516 | 3300046516 | Bacteria | 6598 |
| 612 | Ga0495628_0372241 | 3300046516 | Bacteria | 1047 |
| 613 | Ga0495630_0000614 | 3300046517 | Bacteria | 25848 |
| 614 | Ga0495630_0057444 | 3300046517 | Bacteria | 2916 |
| 615 | Ga0495630_0065524 | 3300046517 | Bacteria | 2730 |
| 616 | Ga0495630_0117096 | 3300046517 | Bacteria | 2020 |
| 617 | Ga0495630_0213547 | 3300046517 | Bacteria | 1472 |
| 618 | Ga0495644_0000656 | 3300046523 | Bacteria | 14496 |
| 619 | Ga0495663_0011247 | 3300046525 | Bacteria | 2491 |
| 620 | Ga0495666_0008769 | 3300046526 | Bacteria | 5065 |
| 621 | Ga0495666_0033500 | 3300046526 | Bacteria | 2509 |
| 622 | Ga0495652_0000004 | 3300046529 | Bacteria | 588877 |
| 623 | Ga0495652_0020572 | 3300046529 | Bacteria | 5865 |
| 624 | Ga0495652_0098442 | 3300046529 | Bacteria | 2377 |
| 625 | Ga0495665_0003071 | 3300046531 | Bacteria | 9032 |
| 626 | Ga0495665_0052758 | 3300046531 | Bacteria | 2152 |
| 627 | Ga0495640_0000005 | 3300046533 | Bacteria | 318271 |
| 628 | Ga0495640_0022097 | 3300046533 | Bacteria | 4659 |
| 629 | Ga0495640_0082608 | 3300046533 | Bacteria | 2133 |
| 630 | Ga0495640_0090755 | 3300046533 | Bacteria | 2016 |
| 631 | Ga0495640_0317171 | 3300046533 | Bacteria | 966 |
| 632 | Ga0495640_0438369 | 3300046533 | Bacteria | 799 |
| 633 | Ga0495586_0016023 | 3300046535 | Bacteria | 3988 |
| 634 | Ga0495586_0039975 | 3300046535 | Bacteria | 2522 |
| 635 | Ga0495586_0090372 | 3300046535 | Bacteria | 1691 |
| 636 | Ga0495587_0000007 | 3300046536 | Bacteria | 290788 |
| 637 | Ga0495587_0006576 | 3300046536 | Bacteria | 7568 |
| 638 | Ga0495609_0107194 | 3300046538 | Bacteria | 1208 |
| 639 | Ga0495645_0000003 | 3300046543 | Bacteria | 570133 |
| 640 | Ga0495645_0049212 | 3300046543 | Bacteria | 3070 |
| 641 | Ga0495645_0070637 | 3300046543 | Bacteria | 2519 |
| 642 | Ga0495622_0006136 | 3300046557 | Bacteria | 5584 |
| 643 | Ga0495633_0009720 | 3300046558 | Bacteria | 5287 |
| 644 | Ga0495667_0000002 | 3300046559 | Bacteria | 437535 |
| 645 | Ga0495667_0002675 | 3300046559 | Bacteria | 11909 |
| 646 | Ga0495667_0022163 | 3300046559 | Bacteria | 4280 |
| 647 | Ga0495667_0034249 | 3300046559 | Bacteria | 3396 |
| 648 | Ga0495667_0132571 | 3300046559 | Bacteria | 1607 |
| 649 | Ga0495656_0000262 | 3300046615 | Bacteria | 18537 |
| 650 | Ga0495634_0000129 | 3300046642 | Bacteria | 65082 |
| 651 | Ga0495634_0131359 | 3300046642 | Bacteria | 1596 |
| 652 | Ga0495634_0135142 | 3300046642 | Bacteria | 1569 |
| 653 | Ga0495634_0190723 | 3300046642 | Bacteria | 1278 |
| 654 | Ga0495634_0216474 | 3300046642 | Bacteria | 1184 |
| 655 | Ga0495611_0010698 | 3300046648 | Bacteria | 3885 |
| 656 | Ga0495635_0000289 | 3300046663 | Bacteria | 32189 |
| 657 | Ga0495635_0002537 | 3300046663 | Bacteria | 12495 |
| 658 | Ga0495635_0225378 | 3300046663 | Bacteria | 1267 |
| 659 | Ga0495659_0006163 | 3300046664 | Bacteria | 3790 |
| 660 | Ga0495661_0053372 | 3300046665 | Bacteria | 2431 |
| 661 | Ga0495588_0009638 | 3300046674 | Bacteria | 4471 |
| 662 | Ga0495588_0093201 | 3300046674 | Bacteria | 1579 |
| 663 | Ga0495657_0000781 | 3300046675 | Bacteria | 28299 |
| 664 | Ga0495657_0004771 | 3300046675 | Bacteria | 10810 |
| 665 | Ga0495599_0000001 | 3300046678 | Bacteria | 537563 |
| 666 | Ga0495599_0025159 | 3300046678 | Bacteria | 3725 |
| 667 | Ga0495599_0063998 | 3300046678 | Bacteria | 2297 |
| 668 | Ga0495623_0000001 | 3300046679 | Bacteria | 313861 |
| 669 | Ga0495623_0001394 | 3300046679 | Bacteria | 16421 |
| 670 | Ga0495623_0119546 | 3300046679 | Bacteria | 1587 |
| 671 | Ga0495646_0000013 | 3300046680 | Bacteria | 159700 |
| 672 | Ga0495646_0001135 | 3300046680 | Bacteria | 15537 |
| 673 | Ga0495646_0005931 | 3300046680 | Bacteria | 7743 |
| 674 | Ga0495647_0003047 | 3300046681 | Bacteria | 5340 |
| 675 | Ga0495647_0003641 | 3300046681 | Bacteria | 4947 |
| 676 | Ga0495658_0000656 | 3300046683 | Bacteria | 18755 |
| 677 | Ga0495658_0013420 | 3300046683 | Bacteria | 4171 |
| 678 | Ga0495658_0085832 | 3300046683 | Bacteria | 1856 |
| 679 | Ga0495613_0004890 | 3300046689 | Bacteria | 10065 |
| 680 | Ga0495613_0031920 | 3300046689 | Bacteria | 3912 |
| 681 | Ga0495613_0044829 | 3300046689 | Bacteria | 3271 |
| 682 | Ga0495613_0074197 | 3300046689 | Bacteria | 2477 |
| 683 | Ga0495613_0132259 | 3300046689 | Bacteria | 1786 |
| 684 | Ga0495613_0157754 | 3300046689 | Bacteria | 1616 |
| 685 | Ga0495624_0015796 | 3300046690 | Bacteria | 5085 |
| 686 | Ga0495624_0024272 | 3300046690 | Bacteria | 3991 |
| 687 | Ga0495624_0073691 | 3300046690 | Bacteria | 2122 |
| 688 | Ga0495670_0001048 | 3300046691 | Bacteria | 13379 |
| 689 | Ga0495671_0045891 | 3300046692 | Bacteria | 2186 |
| 690 | Ga0495600_0000233 | 3300046809 | Bacteria | 30755 |
| 691 | Ga0495600_0000708 | 3300046809 | Bacteria | 17501 |
| 692 | Ga0495600_0003719 | 3300046809 | Bacteria | 9018 |
| 693 | Ga0495581_0006809 | 3300047315 | Bacteria | 6627 |
| 694 | Ga0495581_0025414 | 3300047315 | Bacteria | 3433 |
| 695 | Ga0495581_0052490 | 3300047315 | Bacteria | 2355 |
| 696 | Ga0495604_0000005 | 3300047317 | Bacteria | 424516 |
| 697 | Ga0495604_0017043 | 3300047317 | Bacteria | 5811 |
| 698 | Ga0495604_0127058 | 3300047317 | Bacteria | 1837 |
| 699 | Ga0495674_0000003 | 3300047319 | Bacteria | 562126 |
| 700 | Ga0495674_0002023 | 3300047319 | Bacteria | 19947 |
| 701 | Ga0495674_0007365 | 3300047319 | Bacteria | 10524 |
| 702 | Ga0495674_0061512 | 3300047319 | Bacteria | 3272 |
| 703 | Ga0495674_0249218 | 3300047319 | Bacteria | 1462 |
| 704 | Ga0495676_0042309 | 3300047321 | Bacteria | 3741 |
| 705 | Ga0495676_0224287 | 3300047321 | Bacteria | 1293 |
| 706 | Ga0495680_0000002 | 3300047322 | Bacteria | 197533 |
| 707 | Ga0495680_0005048 | 3300047322 | Bacteria | 12467 |
| 708 | Ga0495680_0008971 | 3300047322 | Bacteria | 9036 |
| 709 | Ga0495680_0009889 | 3300047322 | Bacteria | 8550 |
| 710 | Ga0495680_0042831 | 3300047322 | Bacteria | 3588 |
| 711 | Ga0495680_0095117 | 3300047322 | Bacteria | 2228 |
| 712 | Ga0495675_0000437 | 3300047444 | Bacteria | 27820 |
| 713 | Ga0495675_0003495 | 3300047444 | Bacteria | 9466 |
| 714 | Ga0495675_0017856 | 3300047444 | Bacteria | 4498 |
| 715 | Ga0495684_0000020 | 3300047471 | Bacteria | 148507 |
| 716 | Ga0495684_0181447 | 3300047471 | Bacteria | 1560 |
| 717 | Ga0495684_0295581 | 3300047471 | Bacteria | 1164 |
| 718 | Ga0495593_0001400 | 3300047673 | Bacteria | 14114 |
| 719 | Ga0495593_0039987 | 3300047673 | Bacteria | 2526 |
| 720 | Ga0495602_0000027 | 3300048088 | Bacteria | 145010 |
| 721 | Ga0495602_0092297 | 3300048088 | Bacteria | 2509 |
| 722 | Ga0495602_0111968 | 3300048088 | Bacteria | 2216 |
| 723 | Ga0495614_0028550 | 3300048089 | Bacteria | 2403 |
| 724 | Ga0495614_0171943 | 3300048089 | Bacteria | 972 |
| 725 | Ga0496100_0029850 | 3300048903 | Unclassified | 3376 |
| 726 | Ga0496100_0112447 | 3300048903 | Bacteria | 1894 |
| 727 | Ga0496100_0272038 | 3300048903 | Bacteria | 1260 |
| 728 | Ga0496101_0036257 | 3300048904 | Bacteria | 3492 |
| 729 | Ga0496101_0364461 | 3300048904 | Bacteria | 1136 |
| 730 | Ga0496101_0493255 | 3300048904 | Bacteria | 967 |
| 731 | Ga0496102_0005220 | 3300048905 | Bacteria | 11029 |
| 732 | Ga0496102_0250040 | 3300048905 | Bacteria | 1671 |
| 733 | Ga0496102_0537203 | 3300048905 | Bacteria | 1092 |
| 734 | Ga0496103_0024207 | 3300048906 | Bacteria | 3663 |
| 735 | Ga0496103_0297315 | 3300048906 | Bacteria | 1038 |
| 736 | Ga0496104_0000116 | 3300048907 | Bacteria | 74423 |
| 737 | Ga0496104_0063343 | 3300048907 | Bacteria | 3506 |
| 738 | Ga0496104_0138651 | 3300048907 | Bacteria | 2337 |
| 739 | Ga0496104_0154803 | 3300048907 | Bacteria | 2200 |
| 740 | Ga0496104_0440187 | 3300048907 | Bacteria | 1215 |
| 741 | Ga0496105_0000550 | 3300048908 | Bacteria | 24744 |
| 742 | Ga0496105_0133733 | 3300048908 | Bacteria | 2043 |
| 743 | Ga0496105_0134925 | 3300048908 | Bacteria | 2033 |
| 744 | Ga0496105_0480073 | 3300048908 | Bacteria | 978 |
| 745 | Ga0496105_0676823 | 3300048908 | Bacteria | 794 |
| 746 | Ga0496106_0014148 | 3300048909 | Bacteria | 5894 |
| 747 | Ga0496106_0135542 | 3300048909 | Bacteria | 1934 |
| 748 | Ga0496106_0184687 | 3300048909 | Bacteria | 1656 |
| 749 | Ga0496107_0018580 | 3300048910 | Bacteria | 4896 |
| 750 | Ga0496107_0205083 | 3300048910 | Bacteria | 1465 |
| 751 | Ga0496107_0258789 | 3300048910 | Bacteria | 1295 |
| 752 | Ga0496108_0004997 | 3300048911 | Bacteria | 10716 |
| 753 | Ga0496108_0064653 | 3300048911 | Bacteria | 3082 |
| 754 | Ga0496108_0084202 | 3300048911 | Bacteria | 2698 |
| 755 | Ga0496108_0187737 | 3300048911 | Bacteria | 1791 |
| 756 | Ga0496108_0488539 | 3300048911 | Bacteria | 1075 |
| 757 | Ga0496109_0014904 | 3300048912 | Bacteria | 6765 |
| 758 | Ga0496109_0143348 | 3300048912 | Bacteria | 2234 |
| 759 | Ga0496109_0144684 | 3300048912 | Unclassified | 2223 |
| 760 | Ga0496109_0168587 | 3300048912 | Bacteria | 2054 |
| 761 | Ga0496110_0062381 | 3300048913 | Bacteria | 3292 |
| 762 | Ga0496110_0098569 | 3300048913 | Bacteria | 2619 |
| 763 | Ga0496110_0305854 | 3300048913 | Bacteria | 1448 |
| 764 | Ga0496111_0101271 | 3300048914 | Bacteria | 2116 |
| 765 | Ga0496111_0564802 | 3300048914 | Bacteria | 834 |
| 766 | Ga0496112_0006007 | 3300048915 | Bacteria | 10597 |
| 767 | Ga0496112_0044146 | 3300048915 | Bacteria | 4367 |
| 768 | Ga0496112_0077584 | 3300048915 | Bacteria | 3285 |
| 769 | Ga0496112_0204620 | 3300048915 | Bacteria | 1932 |
| 770 | Ga0496112_0329436 | 3300048915 | Bacteria | 1471 |
| 771 | Ga0496113_0000721 | 3300048916 | Bacteria | 16927 |
| 772 | Ga0496113_0121831 | 3300048916 | Bacteria | 2039 |
| 773 | Ga0496113_0143331 | 3300048916 | Bacteria | 1881 |
| 774 | Ga0496113_0171033 | 3300048916 | Bacteria | 1720 |
| 775 | Ga0496114_0072297 | 3300048917 | Bacteria | 2900 |
| 776 | Ga0496114_0098697 | 3300048917 | Bacteria | 2490 |
| 777 | Ga0496114_0162064 | 3300048917 | Bacteria | 1945 |
| 778 | Ga0496115_0009214 | 3300048918 | Bacteria | 7328 |
| 779 | Ga0496115_0054870 | 3300048918 | Bacteria | 3200 |
| 780 | Ga0496115_0080495 | 3300048918 | Bacteria | 2652 |
| 781 | Ga0496115_0164148 | 3300048918 | Bacteria | 1836 |
| 782 | Ga0496115_0177654 | 3300048918 | Bacteria | 1760 |
| 783 | Ga0496116_0033108 | 3300048919 | Bacteria | 3672 |
| 784 | Ga0496118_0011606 | 3300048921 | Bacteria | 8578 |
| 785 | Ga0496121_0011689 | 3300048924 | Bacteria | 9696 |
| 786 | Ga0501031_0048621 | 3300049568 | Bacteria | 2763 |
| 787 | Ga0501031_0078386 | 3300049568 | Bacteria | 2153 |
| 788 | Ga0501032_0027977 | 3300049569 | Bacteria | 3874 |
| 789 | Ga0501033_0005800 | 3300049570 | Bacteria | 9718 |
| 790 | Ga0501033_0016275 | 3300049570 | Bacteria | 5632 |
| 791 | Ga0501033_0487378 | 3300049570 | Bacteria | 854 |
| 792 | Ga0501034_0027708 | 3300049571 | Bacteria | 5761 |
| 793 | Ga0501034_0060022 | 3300049571 | Bacteria | 3820 |
| 794 | Ga0501034_0078119 | 3300049571 | Bacteria | 3315 |
| 795 | Ga0501036_0001338 | 3300049572 | Bacteria | 18941 |
| 796 | Ga0501036_0061331 | 3300049572 | Bacteria | 3185 |
| 797 | Ga0501036_0156419 | 3300049572 | Bacteria | 1922 |
| 798 | Ga0501037_0020100 | 3300049573 | Bacteria | 4930 |
| 799 | Ga0501037_0093858 | 3300049573 | Bacteria | 2170 |
| 800 | Ga0501038_0012207 | 3300049574 | Bacteria | 7844 |
| 801 | Ga0501038_0019214 | 3300049574 | Bacteria | 6162 |
| 802 | Ga0501038_0153783 | 3300049574 | Bacteria | 1874 |
| 803 | Ga0501039_0014409 | 3300049575 | Bacteria | 6054 |
| 804 | Ga0501039_0308725 | 3300049575 | Bacteria | 1243 |
| 805 | Ga0501041_0000199 | 3300049577 | Bacteria | 27732 |
| 806 | Ga0501042_0001962 | 3300049578 | Bacteria | 12397 |
| 807 | Ga0501043_0072302 | 3300049579 | Bacteria | 2709 |
| 808 | Ga0501046_0009502 | 3300049580 | Bacteria | 8403 |
| 809 | Ga0501047_0057389 | 3300049581 | Bacteria | 3765 |
| 810 | Ga0501047_0064895 | 3300049581 | Bacteria | 3521 |
| 811 | Ga0501047_0114563 | 3300049581 | Bacteria | 2578 |
| 812 | Ga0501047_0201312 | 3300049581 | Bacteria | 1852 |
| 813 | Ga0501048_0023681 | 3300049582 | Bacteria | 4485 |
| 814 | Ga0501067_0113131 | 3300049583 | Bacteria | 1509 |
| 815 | Ga0501067_0206532 | 3300049583 | Bacteria | 1094 |
| 816 | Ga0501068_0015810 | 3300049584 | Bacteria | 4343 |
| 817 | Ga0501069_0039000 | 3300049585 | Bacteria | 2623 |
| 818 | Ga0501070_0008050 | 3300049586 | Bacteria | 8921 |
| 819 | Ga0501070_0029949 | 3300049586 | Bacteria | 4560 |
| 820 | Ga0501071_0017834 | 3300049587 | Bacteria | 4905 |
| 821 | Ga0501071_0067829 | 3300049587 | Bacteria | 2595 |
| 822 | Ga0501072_0072111 | 3300049588 | Bacteria | 2729 |
| 823 | Ga0501072_0521330 | 3300049588 | Bacteria | 940 |
| 824 | Ga0501073_0115989 | 3300049589 | Bacteria | 1856 |
| 825 | Ga0501073_0190218 | 3300049589 | Bacteria | 1420 |
| 826 | Ga0501073_0315088 | 3300049589 | Bacteria | 1079 |
| 827 | Ga0501074_0053507 | 3300049590 | Bacteria | 2911 |
| 828 | Ga0501075_0000297 | 3300049591 | Bacteria | 27597 |
| 829 | Ga0501076_0001204 | 3300049592 | Bacteria | 17188 |
| 830 | Ga0501077_0040212 | 3300049593 | Bacteria | 2979 |
| 831 | Ga0501077_0342441 | 3300049593 | Bacteria | 954 |
| 832 | Ga0501079_0375507 | 3300049741 | Bacteria | 1115 |
| 833 | Ga0501080_0035829 | 3300049742 | Bacteria | 4631 |
| 834 | Ga0501080_0467639 | 3300049742 | Bacteria | 1129 |
| 835 | Ga0501081_0001439 | 3300049743 | Bacteria | 14553 |
| 836 | Ga0501081_0373961 | 3300049743 | Bacteria | 1052 |
| 837 | Ga0501035_0002939 | 3300049822 | Bacteria | 16395 |
| 838 | Ga0501035_0035392 | 3300049822 | Bacteria | 4532 |
| 839 | Ga0501035_0085525 | 3300049822 | Bacteria | 2780 |
| 840 | Ga0501035_0101959 | 3300049822 | Bacteria | 2518 |
| 841 | Ga0501044_0178984 | 3300049823 | Bacteria | 2088 |
| 842 | Ga0501044_0192820 | 3300049823 | Bacteria | 1999 |
| 843 | Ga0501044_0237119 | 3300049823 | Bacteria | 1769 |
| 844 | Ga0501044_0299869 | 3300049823 | Bacteria | 1536 |
| 845 | Ga0501044_0453378 | 3300049823 | Bacteria | 1189 |
| 846 | Ga0501045_0000711 | 3300049824 | Bacteria | 21168 |
| 847 | nmdc:mga05p37_109_c1 | 3300050507 | Bacteria | 74571 |
| 848 | nmdc:mga05p37_46780_c1 | 3300050507 | Bacteria | 5320 |
| 849 | nmdc:mga05p37_5632_c1 | 3300050507 | Bacteria | 14723 |
| 850 | nmdc:mga09592_1148_c1 | 3300050508 | Bacteria | 21118 |
| 851 | nmdc:mga09592_594788_c1 | 3300050508 | Bacteria | 948 |
| 852 | nmdc:mga09592_6478_c1 | 3300050508 | Bacteria | 9536 |
| 853 | nmdc:mga0qj67_16395_c1 | 3300050509 | Bacteria | 5619 |
| 854 | nmdc:mga0qj67_2133_c1 | 3300050509 | Bacteria | 14087 |
| 855 | nmdc:mga06r32_13847_c1 | 3300050510 | Bacteria | 7318 |
| 856 | nmdc:mga06r32_4222_c1 | 3300050510 | Bacteria | 12874 |
| 857 | nmdc:mga08y16_241874_c1 | 3300050511 | Bacteria | 1865 |
| 858 | nmdc:mga08y16_4316_c1 | 3300050511 | Bacteria | 14850 |
| 859 | nmdc:mga08y16_693078_c1 | 3300050511 | Bacteria | 1019 |
| 860 | nmdc:mga08y16_93450_c1 | 3300050511 | Bacteria | 3134 |
| 861 | nmdc:mga0n895_15640_c1 | 3300050512 | Bacteria | 6928 |
| 862 | nmdc:mga0n895_268497_c1 | 3300050512 | Bacteria | 1731 |
| 863 | nmdc:mga0n895_353051_c1 | 3300050512 | Bacteria | 1489 |
| 864 | nmdc:mga0n895_489028_c1 | 3300050512 | Bacteria | 1240 |
| 865 | nmdc:mga0n895_562_c1 | 3300050512 | Bacteria | 25458 |
| 866 | nmdc:mga0n895_803338_c1 | 3300050512 | Bacteria | 931 |
| 867 | nmdc:mga0rr50_24709_c1 | 3300050513 | Bacteria | 4167 |
| 868 | nmdc:mga0rr50_35896_c1 | 3300050513 | Bacteria | 3565 |
| 869 | nmdc:mga0rr50_470435_c1 | 3300050513 | Bacteria | 1067 |
| 870 | nmdc:mga0rr50_515631_c1 | 3300050513 | Bacteria | 1017 |
| 871 | nmdc:mga0rr50_9218_c1 | 3300050513 | Bacteria | 6191 |
| 872 | nmdc:mga08x19_215736_c1 | 3300050514 | Bacteria | 1318 |
| 873 | nmdc:mga08x19_23718_c1 | 3300050514 | Bacteria | 3807 |
| 874 | nmdc:mga0a205_1040_c1 | 3300050515 | Bacteria | 23115 |
| 875 | nmdc:mga0a205_10488_c1 | 3300050515 | Bacteria | 8513 |
| 876 | nmdc:mga0a205_214998_c1 | 3300050515 | Bacteria | 1809 |
| 877 | nmdc:mga0a205_32568_c1 | 3300050515 | Bacteria | 4997 |
| 878 | Ga0495601_0000010 | 3300053077 | Bacteria | 266222 |
| 879 | Ga0495601_0001381 | 3300053077 | Bacteria | 13364 |
| 880 | Ga0495601_0002599 | 3300053077 | Bacteria | 10240 |
| 881 | Ga0495601_0005715 | 3300053077 | Bacteria | 7248 |
| 882 | Ga0495601_0024116 | 3300053077 | Bacteria | 3744 |
| 883 | Ga0495601_0394515 | 3300053077 | Bacteria | 897 |
| 884 | Ga0495612_0000002 | 3300053078 | Bacteria | 310466 |
| 885 | Ga0495612_0001058 | 3300053078 | Bacteria | 11257 |
| 886 | Ga0495612_0003240 | 3300053078 | Bacteria | 6749 |
| 887 | Ga0495612_0050948 | 3300053078 | Bacteria | 1700 |
| 888 | Ga0495595_0000184 | 3300053084 | Bacteria | 25097 |
| 889 | Ga0495595_0000762 | 3300053084 | Bacteria | 12239 |
| 890 | Ga0495595_0010966 | 3300053084 | Bacteria | 3781 |
| 891 | Ga0495595_0044213 | 3300053084 | Bacteria | 2046 |
| 892 | Ga0495595_0061228 | 3300053084 | Bacteria | 1762 |
| 893 | Ga0495595_0071133 | 3300053084 | Bacteria | 1644 |
| 894 | Ga0495595_0182374 | 3300053084 | Bacteria | 1041 |
| 895 | Ga0495619_0000002 | 3300053085 | Bacteria | 530226 |
| 896 | Ga0495619_0000271 | 3300053085 | Bacteria | 37662 |
| 897 | Ga0495619_0002564 | 3300053085 | Bacteria | 11890 |
| 898 | Ga0495619_0007587 | 3300053085 | Bacteria | 6868 |
| 899 | Ga0495619_0009292 | 3300053085 | Bacteria | 6207 |
| 900 | Ga0495619_0019964 | 3300053085 | Bacteria | 4263 |
| 901 | Ga0495619_0033088 | 3300053085 | Bacteria | 3357 |
| 902 | Ga0495619_0037127 | 3300053085 | Bacteria | 3173 |
| 903 | Ga0495619_0069065 | 3300053085 | Bacteria | 2361 |
| 904 | Ga0495619_0144114 | 3300053085 | Bacteria | 1642 |
| 905 | Ga0495619_0226106 | 3300053085 | Bacteria | 1296 |
| 906 | Ga0500643_019657 | 3300053087 | Bacteria | 2220 |
| 907 | Ga0500644_0004254 | 3300053088 | Bacteria | 3576 |
| 908 | Ga0500651_0001961 | 3300053093 | Bacteria | 10665 |
| 909 | Ga0500650_0120534 | 3300053098 | Bacteria | 1223 |
| 910 | Ga0500593_029496 | 3300053117 | Bacteria | 2451 |
| 911 | Ga0500595_000062 | 3300053119 | Bacteria | 77506 |
| 912 | Ga0500652_005922 | 3300053131 | Bacteria | 3892 |
| 913 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 914 | Ga0500616_0010041 | 3300053153 | Bacteria | 5689 |
| 915 | Ga0500645_000282 | 3300053730 | Bacteria | 36379 |
| 916 | Ga0501084_0044968 | 3300054114 | Bacteria | 3697 |
| 917 | Ga0501084_0121442 | 3300054114 | Bacteria | 2197 |
| 918 | Ga0501082_0002630 | 3300060353 | Bacteria | 15693 |
| 919 | Ga0501082_0015525 | 3300060353 | Bacteria | 6557 |
| 920 | Ga0501082_0247390 | 3300060353 | Bacteria | 1552 |
| 921 | Ga0501082_0630752 | 3300060353 | Bacteria | 938 |
| 922 | Ga0501082_0814466 | 3300060353 | Bacteria | 817 |
| 923 | Ga0530510_0060982 | 3300061734 | Bacteria | 2730 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046459 | Ga0495629_0158420 | Ga0495629_0158420_878_1543 | 221 |
| 2 | 3300046517 | Ga0495630_0213547 | Ga0495630_0213547_24_689 | 221 |
| 3 | 3300025923 | Ga0207681_10277169 | Ga0207681_102771692 | 229 |
| 4 | 3300035724 | Ga0373933_0019109 | Ga0373933_0019109_1686_2444 | 233 |
| 5 | 3300036401 | Ga0373937_0027077 | Ga0373937_0027077_2974_3732 | 233 |
| 6 | 3300005336 | Ga0070680_100347009 | Ga0070680_1003470092 | 234 |
| 7 | 3300005530 | Ga0070679_100052860 | Ga0070679_1000528603 | 234 |
| 8 | 3300005577 | Ga0068857_100259640 | Ga0068857_1002596402 | 234 |
| 9 | 3300013105 | Ga0157369_10004736 | Ga0157369_100047363 | 234 |
| 10 | 3300013307 | Ga0157372_10992013 | Ga0157372_109920131 | 234 |
| 11 | 3300014497 | Ga0182008_10017977 | Ga0182008_100179774 | 234 |
| 12 | 3300020081 | Ga0206354_10285912 | Ga0206354_102859122 | 234 |
| 13 | 3300025917 | Ga0207660_10314724 | Ga0207660_103147242 | 234 |
| 14 | 3300026116 | Ga0207674_10266694 | Ga0207674_102666942 | 234 |
| 15 | 3300049593 | Ga0501077_0342441 | Ga0501077_0342441_12_752 | 246 |
| 16 | 3300049743 | Ga0501081_0373961 | Ga0501081_0373961_139_879 | 246 |
| 17 | iso_pu_bacteria | 2522572158 | 2523103031 | 246 |
| 18 | iso_pu_bacteria | 2935616580 | 2935616983 | 246 |
| 19 | iso_pu_bacteria | 2935703347 | 2935711735 | 246 |
| 20 | iso_pu_bacteria | 2935801545 | 2935810205 | 246 |
| 21 | iso_pu_bacteria | 2935837841 | 2935846850 | 246 |
| 22 | iso_pu_bacteria | 2935855204 | 2935855608 | 246 |
| 23 | iso_pu_bacteria | 2935864058 | 2935870246 | 246 |
| 24 | iso_pu_bacteria | 2935873716 | 2935876033 | 246 |
| 25 | iso_pu_bacteria | 2936002035 | 2936010668 | 246 |
| 26 | iso_pu_bacteria | 2941538514 | 2941547301 | 246 |
| 27 | iso_pu_bacteria | 8019576017 | 8019583374 | 246 |
| 28 | iso_pu_bacteria | 8019586578 | 8019591186 | 246 |
| 29 | iso_pu_bacteria | 8019597564 | 8019600152 | 246 |
| 30 | iso_pu_bacteria | 8019608314 | 8019618389 | 246 |
| 31 | 3300005440 | Ga0070705_100165663 | Ga0070705_1001656632 | 247 |
| 32 | 3300005549 | Ga0070704_100030432 | Ga0070704_1000304323 | 247 |
| 33 | 3300006844 | Ga0075428_100091010 | Ga0075428_1000910103 | 247 |
| 34 | 3300006847 | Ga0075431_100029273 | Ga0075431_1000292734 | 247 |
| 35 | 3300006880 | Ga0075429_100000008 | Ga0075429_1000000089 | 247 |
| 36 | 3300035691 | Ga0373931_0252020 | Ga0373931_0252020_321_1064 | 247 |
| 37 | 3300042001 | Ga0439441_006313 | Ga0439441_006313_650_1393 | 247 |
| 38 | 3300042001 | Ga0439441_020180 | Ga0439441_020180_49_792 | 247 |
| 39 | 3300050511 | nmdc:mga08y16_241874_c1 | nmdc:mga08y16_241874_c1_511_1254 | 247 |
| 40 | iso_pu_bacteria | 2841760612 | 2841766628 | 247 |
| 41 | iso_pu_bacteria | 2844104063 | 2844105366 | 247 |
| 42 | iso_pu_bacteria | 2851246043 | 2851252357 | 247 |
| 43 | 3300007076 | Ga0075435_100213941 | Ga0075435_1002139412 | 248 |
| 44 | 3300035120 | Ga0373957_0052263 | Ga0373957_0052263_114_863 | 248 |
| 45 | 3300035695 | Ga0373927_0071590 | Ga0373927_0071590_1042_1791 | 248 |
| 46 | 3300049822 | Ga0501035_0002939 | Ga0501035_0002939_6986_7744 | 248 |
| 47 | 3300050513 | nmdc:mga0rr50_515631_c1 | nmdc:mga0rr50_515631_c1_143_895 | 248 |
| 48 | 3300005468 | Ga0070707_100524883 | Ga0070707_1005248832 | 249 |
| 49 | 3300005544 | Ga0070686_100203350 | Ga0070686_1002033502 | 249 |
| 50 | 3300005615 | Ga0070702_100071323 | Ga0070702_1000713232 | 249 |
| 51 | 3300009176 | Ga0105242_10002839 | Ga0105242_1000283912 | 249 |
| 52 | 3300025922 | Ga0207646_10446086 | Ga0207646_104460862 | 249 |
| 53 | 3300025929 | Ga0207664_10410093 | Ga0207664_104100932 | 249 |
| 54 | 3300025934 | Ga0207686_10038994 | Ga0207686_100389943 | 249 |
| 55 | 3300035083 | Ga0373926_0016309 | Ga0373926_0016309_835_1587 | 249 |
| 56 | 3300035692 | Ga0373935_0040667 | Ga0373935_0040667_2112_2864 | 249 |
| 57 | 3300035695 | Ga0373927_0039586 | Ga0373927_0039586_827_1579 | 249 |
| 58 | 3300035724 | Ga0373933_0071924 | Ga0373933_0071924_714_1466 | 249 |
| 59 | 3300035725 | Ga0373947_0012712 | Ga0373947_0012712_3103_3855 | 249 |
| 60 | 3300035725 | Ga0373947_0494248 | Ga0373947_0494248_22_774 | 249 |
| 61 | 3300036401 | Ga0373937_0043671 | Ga0373937_0043671_1106_1858 | 249 |
| 62 | 3300037068 | Ga0373925_0351784 | Ga0373925_0351784_274_1026 | 249 |
| 63 | 3300039453 | Ga0436362_1243395 | Ga0436362_1243395_677_1426 | 249 |
| 64 | 3300047319 | Ga0495674_0249218 | Ga0495674_0249218_677_1429 | 249 |
| 65 | 3300047471 | Ga0495684_0181447 | Ga0495684_0181447_638_1390 | 249 |
| 66 | 3300048918 | Ga0496115_0080495 | Ga0496115_0080495_40_792 | 249 |
| 67 | 3300049593 | Ga0501077_0040212 | Ga0501077_0040212_1355_2107 | 249 |
| 68 | 3300053085 | Ga0495619_0144114 | Ga0495619_0144114_221_973 | 249 |
| 69 | 3300054114 | Ga0501084_0121442 | Ga0501084_0121442_971_1723 | 249 |
| 70 | 3300061734 | Ga0530510_0060982 | Ga0530510_0060982_1873_2625 | 249 |
| 71 | 3300005330 | Ga0070690_100293859 | Ga0070690_1002938591 | 250 |
| 72 | 3300005343 | Ga0070687_100180124 | Ga0070687_1001801242 | 250 |
| 73 | 3300005356 | Ga0070674_100000456 | Ga0070674_10000045612 | 250 |
| 74 | 3300005365 | Ga0070688_100035477 | Ga0070688_1000354772 | 250 |
| 75 | 3300005439 | Ga0070711_100102762 | Ga0070711_1001027622 | 250 |
| 76 | 3300005440 | Ga0070705_100048399 | Ga0070705_1000483992 | 250 |
| 77 | 3300005444 | Ga0070694_100069947 | Ga0070694_1000699473 | 250 |
| 78 | 3300005445 | Ga0070708_100025847 | Ga0070708_1000258474 | 250 |
| 79 | 3300005458 | Ga0070681_10214217 | Ga0070681_102142172 | 250 |
| 80 | 3300005458 | Ga0070681_10440376 | Ga0070681_104403762 | 250 |
| 81 | 3300005468 | Ga0070707_100251491 | Ga0070707_1002514912 | 250 |
| 82 | 3300005471 | Ga0070698_100929307 | Ga0070698_1009293071 | 250 |
| 83 | 3300005530 | Ga0070679_100174006 | Ga0070679_1001740063 | 250 |
| 84 | 3300005543 | Ga0070672_100268521 | Ga0070672_1002685212 | 250 |
| 85 | 3300005545 | Ga0070695_100026690 | Ga0070695_1000266901 | 250 |
| 86 | 3300005545 | Ga0070695_100451580 | Ga0070695_1004515802 | 250 |
| 87 | 3300005546 | Ga0070696_100091787 | Ga0070696_1000917873 | 250 |
| 88 | 3300005547 | Ga0070693_100047229 | Ga0070693_1000472292 | 250 |
| 89 | 3300005549 | Ga0070704_100140760 | Ga0070704_1001407602 | 250 |
| 90 | 3300005549 | Ga0070704_100744635 | Ga0070704_1007446351 | 250 |
| 91 | 3300005577 | Ga0068857_100392680 | Ga0068857_1003926802 | 250 |
| 92 | 3300005617 | Ga0068859_100115780 | Ga0068859_1001157802 | 250 |
| 93 | 3300005617 | Ga0068859_100150189 | Ga0068859_1001501893 | 250 |
| 94 | 3300005844 | Ga0068862_100552056 | Ga0068862_1005520562 | 250 |
| 95 | 3300006846 | Ga0075430_100007795 | Ga0075430_1000077959 | 250 |
| 96 | 3300006846 | Ga0075430_100142740 | Ga0075430_1001427402 | 250 |
| 97 | 3300006931 | Ga0097620_100115777 | Ga0097620_1001157772 | 250 |
| 98 | 3300006931 | Ga0097620_100150183 | Ga0097620_1001501833 | 250 |
| 99 | 3300009101 | Ga0105247_10255653 | Ga0105247_102556532 | 250 |
| 100 | 3300009147 | Ga0114129_10066967 | Ga0114129_100669674 | 250 |
| 101 | 3300009177 | Ga0105248_10633902 | Ga0105248_106339022 | 250 |
| 102 | 3300017792 | Ga0163161_10274660 | Ga0163161_102746602 | 250 |
| 103 | 3300025901 | Ga0207688_10155127 | Ga0207688_101551272 | 250 |
| 104 | 3300025912 | Ga0207707_10211145 | Ga0207707_102111452 | 250 |
| 105 | 3300025922 | Ga0207646_10085210 | Ga0207646_100852104 | 250 |
| 106 | 3300025937 | Ga0207669_10026526 | Ga0207669_100265263 | 250 |
| 107 | 3300025940 | Ga0207691_10285128 | Ga0207691_102851282 | 250 |
| 108 | 3300026075 | Ga0207708_10281192 | Ga0207708_102811922 | 250 |
| 109 | 3300026078 | Ga0207702_10204902 | Ga0207702_102049021 | 250 |
| 110 | 3300026116 | Ga0207674_10235913 | Ga0207674_102359132 | 250 |
| 111 | 3300026121 | Ga0207683_10141858 | Ga0207683_101418583 | 250 |
| 112 | 3300027695 | Ga0209966_1008347 | Ga0209966_10083472 | 250 |
| 113 | 3300028380 | Ga0268265_10612441 | Ga0268265_106124412 | 250 |
| 114 | 3300028381 | Ga0268264_10159321 | Ga0268264_101593212 | 250 |
| 115 | 3300028800 | Ga0265338_10002492 | Ga0265338_1000249224 | 250 |
| 116 | 3300031241 | Ga0265325_10165057 | Ga0265325_101650572 | 250 |
| 117 | 3300031249 | Ga0265339_10012730 | Ga0265339_100127304 | 250 |
| 118 | 3300035695 | Ga0373927_0039898 | Ga0373927_0039898_1394_2149 | 250 |
| 119 | 3300035724 | Ga0373933_0344860 | Ga0373933_0344860_23_790 | 250 |
| 120 | 3300035725 | Ga0373947_0053434 | Ga0373947_0053434_1484_2239 | 250 |
| 121 | 3300044694 | Ga0466963_0121732 | Ga0466963_0121732_885_1637 | 250 |
| 122 | 3300044719 | Ga0466971_0180933 | Ga0466971_0180933_220_972 | 250 |
| 123 | 3300044842 | Ga0466957_0187463 | Ga0466957_0187463_115_867 | 250 |
| 124 | 3300045051 | Ga0451576_0023021 | Ga0451576_0023021_4869_5627 | 250 |
| 125 | 3300045836 | Ga0466958_0320245 | Ga0466958_0320245_40_792 | 250 |
| 126 | 3300046474 | Ga0495605_0151191 | Ga0495605_0151191_127_885 | 250 |
| 127 | 3300046533 | Ga0495640_0438369 | Ga0495640_0438369_11_778 | 250 |
| 128 | 3300046535 | Ga0495586_0090372 | Ga0495586_0090372_894_1646 | 250 |
| 129 | 3300046538 | Ga0495609_0107194 | Ga0495609_0107194_270_1025 | 250 |
| 130 | 3300046689 | Ga0495613_0157754 | Ga0495613_0157754_16_771 | 250 |
| 131 | 3300048904 | Ga0496101_0493255 | Ga0496101_0493255_45_803 | 250 |
| 132 | 3300048909 | Ga0496106_0184687 | Ga0496106_0184687_872_1630 | 250 |
| 133 | 3300048911 | Ga0496108_0187737 | Ga0496108_0187737_643_1395 | 250 |
| 134 | 3300048913 | Ga0496110_0305854 | Ga0496110_0305854_567_1325 | 250 |
| 135 | 3300048915 | Ga0496112_0044146 | Ga0496112_0044146_1922_2680 | 250 |
| 136 | 3300048918 | Ga0496115_0054870 | Ga0496115_0054870_1418_2179 | 250 |
| 137 | 3300048919 | Ga0496116_0033108 | Ga0496116_0033108_1730_2488 | 250 |
| 138 | 3300048921 | Ga0496118_0011606 | Ga0496118_0011606_5606_6364 | 250 |
| 139 | 3300048924 | Ga0496121_0011689 | Ga0496121_0011689_6737_7495 | 250 |
| 140 | 3300049589 | Ga0501073_0190218 | Ga0501073_0190218_374_1129 | 250 |
| 141 | 3300049589 | Ga0501073_0315088 | Ga0501073_0315088_314_1069 | 250 |
| 142 | 3300050507 | nmdc:mga05p37_109_c1 | nmdc:mga05p37_109_c1_177_935 | 250 |
| 143 | 3300050508 | nmdc:mga09592_594788_c1 | nmdc:mga09592_594788_c1_173_931 | 250 |
| 144 | 3300050508 | nmdc:mga09592_6478_c1 | nmdc:mga09592_6478_c1_3284_4042 | 250 |
| 145 | 3300050509 | nmdc:mga0qj67_16395_c1 | nmdc:mga0qj67_16395_c1_1108_1863 | 250 |
| 146 | 3300050510 | nmdc:mga06r32_13847_c1 | nmdc:mga06r32_13847_c1_4398_5156 | 250 |
| 147 | 3300050512 | nmdc:mga0n895_489028_c1 | nmdc:mga0n895_489028_c1_19_789 | 250 |
| 148 | 3300053085 | Ga0495619_0033088 | Ga0495619_0033088_1745_2497 | 250 |
| 149 | 3300053153 | Ga0500616_0010041 | Ga0500616_0010041_2984_3739 | 250 |
| 150 | 3300060353 | Ga0501082_0814466 | Ga0501082_0814466_22_777 | 250 |
| 151 | 3300005327 | Ga0070658_10011642 | Ga0070658_100116424 | 251 |
| 152 | 3300005327 | Ga0070658_10033788 | Ga0070658_100337883 | 251 |
| 153 | 3300005336 | Ga0070680_100023460 | Ga0070680_1000234603 | 251 |
| 154 | 3300005336 | Ga0070680_100032247 | Ga0070680_1000322472 | 251 |
| 155 | 3300005339 | Ga0070660_100277606 | Ga0070660_1002776062 | 251 |
| 156 | 3300005366 | Ga0070659_100205586 | Ga0070659_1002055862 | 251 |
| 157 | 3300005435 | Ga0070714_100035035 | Ga0070714_1000350353 | 251 |
| 158 | 3300005458 | Ga0070681_10087410 | Ga0070681_100874102 | 251 |
| 159 | 3300005530 | Ga0070679_100254589 | Ga0070679_1002545892 | 251 |
| 160 | 3300005563 | Ga0068855_100093341 | Ga0068855_1000933413 | 251 |
| 161 | 3300005563 | Ga0068855_100132246 | Ga0068855_1001322463 | 251 |
| 162 | 3300005563 | Ga0068855_100200073 | Ga0068855_1002000734 | 251 |
| 163 | 3300005614 | Ga0068856_100262757 | Ga0068856_1002627572 | 251 |
| 164 | 3300005614 | Ga0068856_100373940 | Ga0068856_1003739402 | 251 |
| 165 | 3300005616 | Ga0068852_100042613 | Ga0068852_1000426132 | 251 |
| 166 | 3300005616 | Ga0068852_100282026 | Ga0068852_1002820262 | 251 |
| 167 | 3300006028 | Ga0070717_10587645 | Ga0070717_105876452 | 251 |
| 168 | 3300006914 | Ga0075436_100010766 | Ga0075436_1000107664 | 251 |
| 169 | 3300007076 | Ga0075435_100267505 | Ga0075435_1002675052 | 251 |
| 170 | 3300009093 | Ga0105240_10035786 | Ga0105240_100357865 | 251 |
| 171 | 3300009551 | Ga0105238_10085262 | Ga0105238_100852623 | 251 |
| 172 | 3300013104 | Ga0157370_10051700 | Ga0157370_100517004 | 251 |
| 173 | 3300013104 | Ga0157370_10319230 | Ga0157370_103192302 | 251 |
| 174 | 3300013307 | Ga0157372_10701660 | Ga0157372_107016601 | 251 |
| 175 | 3300020082 | Ga0206353_10528377 | Ga0206353_105283772 | 251 |
| 176 | 3300025909 | Ga0207705_10203974 | Ga0207705_102039742 | 251 |
| 177 | 3300025917 | Ga0207660_10174634 | Ga0207660_101746342 | 251 |
| 178 | 3300025919 | Ga0207657_10074179 | Ga0207657_100741793 | 251 |
| 179 | 3300025924 | Ga0207694_10244276 | Ga0207694_102442761 | 251 |
| 180 | 3300025929 | Ga0207664_10098805 | Ga0207664_100988052 | 251 |
| 181 | 3300025932 | Ga0207690_10231023 | Ga0207690_102310232 | 251 |
| 182 | 3300025939 | Ga0207665_10480970 | Ga0207665_104809702 | 251 |
| 183 | 3300025949 | Ga0207667_10099491 | Ga0207667_100994912 | 251 |
| 184 | 3300025949 | Ga0207667_10220282 | Ga0207667_102202824 | 251 |
| 185 | 3300026041 | Ga0207639_10092709 | Ga0207639_100927093 | 251 |
| 186 | 3300026078 | Ga0207702_10101298 | Ga0207702_101012983 | 251 |
| 187 | 3300026078 | Ga0207702_10281850 | Ga0207702_102818502 | 251 |
| 188 | 3300026142 | Ga0207698_10158228 | Ga0207698_101582282 | 251 |
| 189 | 3300028381 | Ga0268264_10476480 | Ga0268264_104764802 | 251 |
| 190 | 3300031235 | Ga0265330_10003043 | Ga0265330_100030432 | 251 |
| 191 | 3300031247 | Ga0265340_10100770 | Ga0265340_101007702 | 251 |
| 192 | 3300031249 | Ga0265339_10015364 | Ga0265339_100153641 | 251 |
| 193 | 3300031344 | Ga0265316_10084271 | Ga0265316_100842712 | 251 |
| 194 | 3300031712 | Ga0265342_10000882 | Ga0265342_1000088216 | 251 |
| 195 | 3300031712 | Ga0265342_10004819 | Ga0265342_100048198 | 251 |
| 196 | 3300032133 | Ga0316583_10000161 | Ga0316583_1000016114 | 251 |
| 197 | 3300035410 | Ga0373924_0049494 | Ga0373924_0049494_763_1518 | 251 |
| 198 | 3300035692 | Ga0373935_0036252 | Ga0373935_0036252_161_916 | 251 |
| 199 | 3300037312 | Ga0395899_0036755 | Ga0395899_0036755_2002_2757 | 251 |
| 200 | 3300037418 | Ga0395900_0005074 | Ga0395900_0005074_12907_13662 | 251 |
| 201 | 3300037418 | Ga0395900_0008149 | Ga0395900_0008149_9109_9864 | 251 |
| 202 | 3300037418 | Ga0395900_0424802 | Ga0395900_0424802_226_981 | 251 |
| 203 | 3300037466 | Ga0395898_0032574 | Ga0395898_0032574_1516_2271 | 251 |
| 204 | 3300037466 | Ga0395898_0110478 | Ga0395898_0110478_1703_2458 | 251 |
| 205 | 3300037466 | Ga0395898_0121248 | Ga0395898_0121248_695_1450 | 251 |
| 206 | 3300037853 | Ga0436364_1070861 | Ga0436364_1070861_1365_2120 | 251 |
| 207 | 3300038443 | Ga0395901_0009281 | Ga0395901_0009281_5407_6162 | 251 |
| 208 | 3300038443 | Ga0395901_0014372 | Ga0395901_0014372_5733_6488 | 251 |
| 209 | 3300039437 | Ga0436365_0380370 | Ga0436365_0380370_826_1581 | 251 |
| 210 | 3300039437 | Ga0436365_0442321 | Ga0436365_0442321_2034_2789 | 251 |
| 211 | 3300039447 | Ga0436361_0189320 | Ga0436361_0189320_405_1160 | 251 |
| 212 | 3300039450 | Ga0436363_0323907 | Ga0436363_0323907_791_1546 | 251 |
| 213 | 3300044684 | Ga0466966_0125083 | Ga0466966_0125083_17_772 | 251 |
| 214 | 3300045836 | Ga0466958_0067366 | Ga0466958_0067366_13_768 | 251 |
| 215 | 3300045976 | Ga0466967_0022504 | Ga0466967_0022504_1030_1785 | 251 |
| 216 | 3300046454 | Ga0495592_0180560 | Ga0495592_0180560_54_809 | 251 |
| 217 | 3300046459 | Ga0495629_0139671 | Ga0495629_0139671_654_1409 | 251 |
| 218 | 3300046462 | Ga0495651_0248429 | Ga0495651_0248429_203_958 | 251 |
| 219 | 3300046463 | Ga0495653_0140058 | Ga0495653_0140058_375_1130 | 251 |
| 220 | 3300046472 | Ga0495580_0120836 | Ga0495580_0120836_319_1074 | 251 |
| 221 | 3300046517 | Ga0495630_0117096 | Ga0495630_0117096_534_1289 | 251 |
| 222 | 3300046533 | Ga0495640_0082608 | Ga0495640_0082608_157_912 | 251 |
| 223 | 3300046533 | Ga0495640_0317171 | Ga0495640_0317171_90_845 | 251 |
| 224 | 3300046559 | Ga0495667_0132571 | Ga0495667_0132571_491_1246 | 251 |
| 225 | 3300046642 | Ga0495634_0216474 | Ga0495634_0216474_274_1029 | 251 |
| 226 | 3300046663 | Ga0495635_0225378 | Ga0495635_0225378_375_1130 | 251 |
| 227 | 3300046683 | Ga0495658_0085832 | Ga0495658_0085832_628_1383 | 251 |
| 228 | 3300046689 | Ga0495613_0031920 | Ga0495613_0031920_407_1162 | 251 |
| 229 | 3300047317 | Ga0495604_0127058 | Ga0495604_0127058_1050_1805 | 251 |
| 230 | 3300047319 | Ga0495674_0061512 | Ga0495674_0061512_1416_2171 | 251 |
| 231 | 3300048088 | Ga0495602_0092297 | Ga0495602_0092297_565_1320 | 251 |
| 232 | 3300048903 | Ga0496100_0272038 | Ga0496100_0272038_306_1061 | 251 |
| 233 | 3300048907 | Ga0496104_0154803 | Ga0496104_0154803_851_1606 | 251 |
| 234 | 3300048908 | Ga0496105_0480073 | Ga0496105_0480073_203_958 | 251 |
| 235 | 3300048909 | Ga0496106_0135542 | Ga0496106_0135542_92_847 | 251 |
| 236 | 3300048910 | Ga0496107_0258789 | Ga0496107_0258789_58_813 | 251 |
| 237 | 3300048915 | Ga0496112_0204620 | Ga0496112_0204620_303_1058 | 251 |
| 238 | 3300049568 | Ga0501031_0048621 | Ga0501031_0048621_346_1104 | 251 |
| 239 | 3300049569 | Ga0501032_0027977 | Ga0501032_0027977_1660_2418 | 251 |
| 240 | 3300049570 | Ga0501033_0005800 | Ga0501033_0005800_139_897 | 251 |
| 241 | 3300049570 | Ga0501033_0487378 | Ga0501033_0487378_49_804 | 251 |
| 242 | 3300049571 | Ga0501034_0027708 | Ga0501034_0027708_2645_3403 | 251 |
| 243 | 3300049571 | Ga0501034_0060022 | Ga0501034_0060022_2154_2912 | 251 |
| 244 | 3300049572 | Ga0501036_0061331 | Ga0501036_0061331_1472_2230 | 251 |
| 245 | 3300049572 | Ga0501036_0156419 | Ga0501036_0156419_649_1407 | 251 |
| 246 | 3300049574 | Ga0501038_0012207 | Ga0501038_0012207_6416_7174 | 251 |
| 247 | 3300049574 | Ga0501038_0153783 | Ga0501038_0153783_904_1662 | 251 |
| 248 | 3300049575 | Ga0501039_0308725 | Ga0501039_0308725_68_826 | 251 |
| 249 | 3300049579 | Ga0501043_0072302 | Ga0501043_0072302_179_937 | 251 |
| 250 | 3300049581 | Ga0501047_0114563 | Ga0501047_0114563_104_862 | 251 |
| 251 | 3300049581 | Ga0501047_0201312 | Ga0501047_0201312_385_1140 | 251 |
| 252 | 3300049586 | Ga0501070_0029949 | Ga0501070_0029949_2260_3018 | 251 |
| 253 | 3300049822 | Ga0501035_0085525 | Ga0501035_0085525_441_1199 | 251 |
| 254 | 3300049822 | Ga0501035_0101959 | Ga0501035_0101959_1141_1899 | 251 |
| 255 | 3300049823 | Ga0501044_0178984 | Ga0501044_0178984_509_1264 | 251 |
| 256 | 3300049823 | Ga0501044_0237119 | Ga0501044_0237119_450_1208 | 251 |
| 257 | 3300050513 | nmdc:mga0rr50_470435_c1 | nmdc:mga0rr50_470435_c1_268_1023 | 251 |
| 258 | 3300050514 | nmdc:mga08x19_23718_c1 | nmdc:mga08x19_23718_c1_2781_3536 | 251 |
| 259 | 3300053077 | Ga0495601_0002599 | Ga0495601_0002599_8776_9531 | 251 |
| 260 | 3300053077 | Ga0495601_0024116 | Ga0495601_0024116_2081_2836 | 251 |
| 261 | 3300053084 | Ga0495595_0044213 | Ga0495595_0044213_556_1311 | 251 |
| 262 | 3300053153 | Ga0500616_0000006 | Ga0500616_0000006_865720_866517 | 251 |
| 263 | 3300005434 | Ga0070709_10045792 | Ga0070709_100457923 | 252 |
| 264 | 3300006175 | Ga0070712_100003673 | Ga0070712_1000036734 | 252 |
| 265 | 3300013104 | Ga0157370_10263703 | Ga0157370_102637032 | 252 |
| 266 | 3300025915 | Ga0207693_10009873 | Ga0207693_100098734 | 252 |
| 267 | 3300025928 | Ga0207700_10426199 | Ga0207700_104261991 | 252 |
| 268 | 3300049581 | Ga0501047_0064895 | Ga0501047_0064895_767_1537 | 252 |
| 269 | 3300049583 | Ga0501067_0113131 | Ga0501067_0113131_434_1204 | 252 |
| 270 | 3300049585 | Ga0501069_0039000 | Ga0501069_0039000_882_1652 | 252 |
| 271 | 3300049586 | Ga0501070_0008050 | Ga0501070_0008050_3210_3980 | 252 |
| 272 | 3300049588 | Ga0501072_0072111 | Ga0501072_0072111_543_1313 | 252 |
| 273 | 3300049590 | Ga0501074_0053507 | Ga0501074_0053507_1041_1811 | 252 |
| 274 | 3300049742 | Ga0501080_0035829 | Ga0501080_0035829_3832_4602 | 252 |
| 275 | 3300049823 | Ga0501044_0192820 | Ga0501044_0192820_100_870 | 252 |
| 276 | 3300053085 | Ga0495619_0069065 | Ga0495619_0069065_683_1447 | 252 |
| 277 | 3300053098 | Ga0500650_0120534 | Ga0500650_0120534_54_836 | 252 |
| 278 | 3300060353 | Ga0501082_0630752 | Ga0501082_0630752_33_803 | 252 |
| 279 | 3300005434 | Ga0070709_10036382 | Ga0070709_100363823 | 253 |
| 280 | 3300005439 | Ga0070711_100163490 | Ga0070711_1001634901 | 253 |
| 281 | 3300006028 | Ga0070717_10348501 | Ga0070717_103485012 | 253 |
| 282 | 3300006173 | Ga0070716_100067257 | Ga0070716_1000672572 | 253 |
| 283 | 3300007788 | Ga0099795_10007316 | Ga0099795_100073163 | 253 |
| 284 | 3300010159 | Ga0099796_10005784 | Ga0099796_100057842 | 253 |
| 285 | 3300025898 | Ga0207692_10092149 | Ga0207692_100921492 | 253 |
| 286 | 3300025906 | Ga0207699_10068983 | Ga0207699_100689832 | 253 |
| 287 | 3300025916 | Ga0207663_10194238 | Ga0207663_101942382 | 253 |
| 288 | 3300035083 | Ga0373926_0106149 | Ga0373926_0106149_109_870 | 253 |
| 289 | 3300035086 | Ga0373934_0013885 | Ga0373934_0013885_2235_2996 | 253 |
| 290 | 3300035111 | Ga0373923_0041700 | Ga0373923_0041700_1073_1834 | 253 |
| 291 | 3300035113 | Ga0373936_0001104 | Ga0373936_0001104_3433_4194 | 253 |
| 292 | 3300035116 | Ga0373945_0000503 | Ga0373945_0000503_4117_4878 | 253 |
| 293 | 3300035117 | Ga0373953_0000488 | Ga0373953_0000488_4037_4798 | 253 |
| 294 | 3300035120 | Ga0373957_0016648 | Ga0373957_0016648_1753_2514 | 253 |
| 295 | 3300035170 | Ga0373943_0003705 | Ga0373943_0003705_3593_4354 | 253 |
| 296 | 3300035171 | Ga0373946_0002277 | Ga0373946_0002277_5521_6282 | 253 |
| 297 | 3300035172 | Ga0373955_0000425 | Ga0373955_0000425_5223_5984 | 253 |
| 298 | 3300035692 | Ga0373935_0000337 | Ga0373935_0000337_16748_17509 | 253 |
| 299 | 3300035695 | Ga0373927_0043067 | Ga0373927_0043067_1390_2151 | 253 |
| 300 | 3300035724 | Ga0373933_0002475 | Ga0373933_0002475_5029_5790 | 253 |
| 301 | 3300035725 | Ga0373947_0001536 | Ga0373947_0001536_8971_9732 | 253 |
| 302 | 3300036401 | Ga0373937_0000223 | Ga0373937_0000223_50753_51514 | 253 |
| 303 | 3300037068 | Ga0373925_0000741 | Ga0373925_0000741_16745_17506 | 253 |
| 304 | 3300044842 | Ga0466957_0066173 | Ga0466957_0066173_705_1466 | 253 |
| 305 | 3300046454 | Ga0495592_0000188 | Ga0495592_0000188_35368_36129 | 253 |
| 306 | 3300046454 | Ga0495592_0060198 | Ga0495592_0060198_1763_2527 | 253 |
| 307 | 3300046459 | Ga0495629_0002114 | Ga0495629_0002114_8014_8775 | 253 |
| 308 | 3300046462 | Ga0495651_0001439 | Ga0495651_0001439_6896_7657 | 253 |
| 309 | 3300046462 | Ga0495651_0101853 | Ga0495651_0101853_31_795 | 253 |
| 310 | 3300046463 | Ga0495653_0000198 | Ga0495653_0000198_18022_18783 | 253 |
| 311 | 3300046476 | Ga0495662_0000720 | Ga0495662_0000720_2658_3419 | 253 |
| 312 | 3300046477 | Ga0495664_0000002 | Ga0495664_0000002_416946_417707 | 253 |
| 313 | 3300046511 | Ga0495608_0000009 | Ga0495608_0000009_62728_63489 | 253 |
| 314 | 3300046511 | Ga0495608_0423360 | Ga0495608_0423360_23_787 | 253 |
| 315 | 3300046514 | Ga0495618_0000005 | Ga0495618_0000005_194305_195066 | 253 |
| 316 | 3300046516 | Ga0495628_0000002 | Ga0495628_0000002_381331_382092 | 253 |
| 317 | 3300046517 | Ga0495630_0000614 | Ga0495630_0000614_11875_12636 | 253 |
| 318 | 3300046529 | Ga0495652_0000004 | Ga0495652_0000004_206791_207552 | 253 |
| 319 | 3300046533 | Ga0495640_0000005 | Ga0495640_0000005_62743_63504 | 253 |
| 320 | 3300046536 | Ga0495587_0000007 | Ga0495587_0000007_254738_255499 | 253 |
| 321 | 3300046543 | Ga0495645_0000003 | Ga0495645_0000003_362582_363343 | 253 |
| 322 | 3300046559 | Ga0495667_0000002 | Ga0495667_0000002_55631_56392 | 253 |
| 323 | 3300046642 | Ga0495634_0000129 | Ga0495634_0000129_47598_48359 | 253 |
| 324 | 3300046663 | Ga0495635_0000289 | Ga0495635_0000289_1138_1899 | 253 |
| 325 | 3300046675 | Ga0495657_0000781 | Ga0495657_0000781_27155_27916 | 253 |
| 326 | 3300046678 | Ga0495599_0000001 | Ga0495599_0000001_520009_520770 | 253 |
| 327 | 3300046679 | Ga0495623_0000001 | Ga0495623_0000001_288954_289715 | 253 |
| 328 | 3300046680 | Ga0495646_0000013 | Ga0495646_0000013_139587_140348 | 253 |
| 329 | 3300046689 | Ga0495613_0044829 | Ga0495613_0044829_581_1342 | 253 |
| 330 | 3300046690 | Ga0495624_0024272 | Ga0495624_0024272_3158_3919 | 253 |
| 331 | 3300046809 | Ga0495600_0000233 | Ga0495600_0000233_13236_13997 | 253 |
| 332 | 3300047315 | Ga0495581_0006809 | Ga0495581_0006809_3564_4325 | 253 |
| 333 | 3300047317 | Ga0495604_0000005 | Ga0495604_0000005_406975_407736 | 253 |
| 334 | 3300047319 | Ga0495674_0000003 | Ga0495674_0000003_180034_180795 | 253 |
| 335 | 3300047322 | Ga0495680_0000002 | Ga0495680_0000002_184398_185159 | 253 |
| 336 | 3300047322 | Ga0495680_0095117 | Ga0495680_0095117_730_1494 | 253 |
| 337 | 3300047444 | Ga0495675_0000437 | Ga0495675_0000437_13995_14756 | 253 |
| 338 | 3300047471 | Ga0495684_0000020 | Ga0495684_0000020_131000_131761 | 253 |
| 339 | 3300048088 | Ga0495602_0000027 | Ga0495602_0000027_108891_109652 | 253 |
| 340 | 3300049573 | Ga0501037_0093858 | Ga0501037_0093858_814_1587 | 253 |
| 341 | 3300049581 | Ga0501047_0057389 | Ga0501047_0057389_701_1474 | 253 |
| 342 | 3300049588 | Ga0501072_0521330 | Ga0501072_0521330_15_788 | 253 |
| 343 | 3300049823 | Ga0501044_0453378 | Ga0501044_0453378_116_889 | 253 |
| 344 | 3300053077 | Ga0495601_0000010 | Ga0495601_0000010_206745_207506 | 253 |
| 345 | 3300053078 | Ga0495612_0000002 | Ga0495612_0000002_292927_293688 | 253 |
| 346 | 3300053084 | Ga0495595_0000184 | Ga0495595_0000184_3498_4259 | 253 |
| 347 | 3300053084 | Ga0495595_0182374 | Ga0495595_0182374_244_1008 | 253 |
| 348 | 3300053085 | Ga0495619_0000002 | Ga0495619_0000002_381334_382095 | 253 |
| 349 | 3300053117 | Ga0500593_029496 | Ga0500593_029496_813_1625 | 253 |
| 350 | 3300060353 | Ga0501082_0015525 | Ga0501082_0015525_4763_5536 | 253 |
| 351 | 3300005336 | Ga0070680_100126715 | Ga0070680_1001267152 | 254 |
| 352 | 3300005338 | Ga0068868_100423853 | Ga0068868_1004238532 | 254 |
| 353 | 3300005440 | Ga0070705_100158202 | Ga0070705_1001582022 | 254 |
| 354 | 3300005547 | Ga0070693_100011715 | Ga0070693_1000117152 | 254 |
| 355 | 3300005842 | Ga0068858_100157576 | Ga0068858_1001575762 | 254 |
| 356 | 3300006871 | Ga0075434_100102139 | Ga0075434_1001021392 | 254 |
| 357 | 3300007076 | Ga0075435_100219849 | Ga0075435_1002198492 | 254 |
| 358 | 3300009553 | Ga0105249_10133900 | Ga0105249_101339003 | 254 |
| 359 | 3300010375 | Ga0105239_10319600 | Ga0105239_103196002 | 254 |
| 360 | 3300013297 | Ga0157378_10246363 | Ga0157378_102463632 | 254 |
| 361 | 3300025904 | Ga0207647_10043164 | Ga0207647_100431643 | 254 |
| 362 | 3300025907 | Ga0207645_10053476 | Ga0207645_100534763 | 254 |
| 363 | 3300025912 | Ga0207707_10009645 | Ga0207707_100096459 | 254 |
| 364 | 3300025921 | Ga0207652_10026006 | Ga0207652_100260064 | 254 |
| 365 | 3300025961 | Ga0207712_10073558 | Ga0207712_100735582 | 254 |
| 366 | 3300026023 | Ga0207677_10578127 | Ga0207677_105781272 | 254 |
| 367 | 3300026067 | Ga0207678_10036968 | Ga0207678_100369684 | 254 |
| 368 | 3300028379 | Ga0268266_10294300 | Ga0268266_102943002 | 254 |
| 369 | 3300035083 | Ga0373926_0004368 | Ga0373926_0004368_2140_2904 | 254 |
| 370 | 3300035086 | Ga0373934_0054287 | Ga0373934_0054287_408_1172 | 254 |
| 371 | 3300035089 | Ga0373944_0019405 | Ga0373944_0019405_472_1236 | 254 |
| 372 | 3300035092 | Ga0373952_0008868 | Ga0373952_0008868_266_1033 | 254 |
| 373 | 3300035111 | Ga0373923_0002274 | Ga0373923_0002274_3313_4077 | 254 |
| 374 | 3300035113 | Ga0373936_0084800 | Ga0373936_0084800_463_1227 | 254 |
| 375 | 3300035118 | Ga0373954_0004286 | Ga0373954_0004286_2150_2914 | 254 |
| 376 | 3300035119 | Ga0373956_0014464 | Ga0373956_0014464_1851_2615 | 254 |
| 377 | 3300035170 | Ga0373943_0010637 | Ga0373943_0010637_2846_3610 | 254 |
| 378 | 3300035171 | Ga0373946_0001059 | Ga0373946_0001059_4408_5172 | 254 |
| 379 | 3300035172 | Ga0373955_0139733 | Ga0373955_0139733_195_959 | 254 |
| 380 | 3300035692 | Ga0373935_0076945 | Ga0373935_0076945_879_1643 | 254 |
| 381 | 3300035695 | Ga0373927_0011982 | Ga0373927_0011982_4673_5437 | 254 |
| 382 | 3300035724 | Ga0373933_0010438 | Ga0373933_0010438_3695_4459 | 254 |
| 383 | 3300037068 | Ga0373925_0179833 | Ga0373925_0179833_714_1478 | 254 |
| 384 | 3300046454 | Ga0495592_0007677 | Ga0495592_0007677_3611_4375 | 254 |
| 385 | 3300046455 | Ga0495603_0091022 | Ga0495603_0091022_824_1588 | 254 |
| 386 | 3300046458 | Ga0495591_033479 | Ga0495591_033479_103_867 | 254 |
| 387 | 3300046463 | Ga0495653_0037313 | Ga0495653_0037313_877_1641 | 254 |
| 388 | 3300046472 | Ga0495580_0022328 | Ga0495580_0022328_3560_4324 | 254 |
| 389 | 3300046473 | Ga0495582_0040673 | Ga0495582_0040673_835_1599 | 254 |
| 390 | 3300046475 | Ga0495639_0008708 | Ga0495639_0008708_628_1392 | 254 |
| 391 | 3300046476 | Ga0495662_0009876 | Ga0495662_0009876_3353_4117 | 254 |
| 392 | 3300046477 | Ga0495664_0003233 | Ga0495664_0003233_3585_4349 | 254 |
| 393 | 3300046492 | Ga0495585_0001425 | Ga0495585_0001425_8030_8794 | 254 |
| 394 | 3300046499 | Ga0495594_0091858 | Ga0495594_0091858_196_960 | 254 |
| 395 | 3300046511 | Ga0495608_0014885 | Ga0495608_0014885_4304_5068 | 254 |
| 396 | 3300046516 | Ga0495628_0372241 | Ga0495628_0372241_55_819 | 254 |
| 397 | 3300046523 | Ga0495644_0000656 | Ga0495644_0000656_2296_3060 | 254 |
| 398 | 3300046525 | Ga0495663_0011247 | Ga0495663_0011247_1018_1782 | 254 |
| 399 | 3300046526 | Ga0495666_0008769 | Ga0495666_0008769_3219_3983 | 254 |
| 400 | 3300046531 | Ga0495665_0003071 | Ga0495665_0003071_4582_5346 | 254 |
| 401 | 3300046535 | Ga0495586_0016023 | Ga0495586_0016023_1029_1793 | 254 |
| 402 | 3300046543 | Ga0495645_0049212 | Ga0495645_0049212_1210_1974 | 254 |
| 403 | 3300046557 | Ga0495622_0006136 | Ga0495622_0006136_1320_2084 | 254 |
| 404 | 3300046558 | Ga0495633_0009720 | Ga0495633_0009720_1861_2625 | 254 |
| 405 | 3300046559 | Ga0495667_0022163 | Ga0495667_0022163_1667_2431 | 254 |
| 406 | 3300046615 | Ga0495656_0000262 | Ga0495656_0000262_7037_7801 | 254 |
| 407 | 3300046642 | Ga0495634_0190723 | Ga0495634_0190723_68_832 | 254 |
| 408 | 3300046648 | Ga0495611_0010698 | Ga0495611_0010698_640_1404 | 254 |
| 409 | 3300046664 | Ga0495659_0006163 | Ga0495659_0006163_269_1033 | 254 |
| 410 | 3300046665 | Ga0495661_0053372 | Ga0495661_0053372_528_1292 | 254 |
| 411 | 3300046674 | Ga0495588_0009638 | Ga0495588_0009638_1540_2304 | 254 |
| 412 | 3300046678 | Ga0495599_0063998 | Ga0495599_0063998_763_1527 | 254 |
| 413 | 3300046680 | Ga0495646_0005931 | Ga0495646_0005931_3459_4223 | 254 |
| 414 | 3300046681 | Ga0495647_0003641 | Ga0495647_0003641_1737_2501 | 254 |
| 415 | 3300046689 | Ga0495613_0074197 | Ga0495613_0074197_835_1599 | 254 |
| 416 | 3300046690 | Ga0495624_0015796 | Ga0495624_0015796_3408_4172 | 254 |
| 417 | 3300046691 | Ga0495670_0001048 | Ga0495670_0001048_5788_6552 | 254 |
| 418 | 3300046692 | Ga0495671_0045891 | Ga0495671_0045891_399_1163 | 254 |
| 419 | 3300046809 | Ga0495600_0003719 | Ga0495600_0003719_1103_1867 | 254 |
| 420 | 3300047315 | Ga0495581_0025414 | Ga0495581_0025414_519_1283 | 254 |
| 421 | 3300047317 | Ga0495604_0017043 | Ga0495604_0017043_721_1485 | 254 |
| 422 | 3300047321 | Ga0495676_0224287 | Ga0495676_0224287_196_960 | 254 |
| 423 | 3300047322 | Ga0495680_0042831 | Ga0495680_0042831_2179_2943 | 254 |
| 424 | 3300047444 | Ga0495675_0017856 | Ga0495675_0017856_145_909 | 254 |
| 425 | 3300047471 | Ga0495684_0295581 | Ga0495684_0295581_205_969 | 254 |
| 426 | 3300047673 | Ga0495593_0001400 | Ga0495593_0001400_205_969 | 254 |
| 427 | 3300048088 | Ga0495602_0111968 | Ga0495602_0111968_228_992 | 254 |
| 428 | 3300048089 | Ga0495614_0028550 | Ga0495614_0028550_835_1599 | 254 |
| 429 | 3300050512 | nmdc:mga0n895_353051_c1 | nmdc:mga0n895_353051_c1_474_1241 | 254 |
| 430 | 3300053077 | Ga0495601_0394515 | Ga0495601_0394515_56_820 | 254 |
| 431 | 3300053078 | Ga0495612_0003240 | Ga0495612_0003240_461_1225 | 254 |
| 432 | 3300053084 | Ga0495595_0071133 | Ga0495595_0071133_56_820 | 254 |
| 433 | 3300053085 | Ga0495619_0009292 | Ga0495619_0009292_823_1587 | 254 |
| 434 | 3300000041 | ARcpr5oldR_c000028 | ARcpr5oldR_0000288 | 255 |
| 435 | 3300000044 | ARSoilOldRDRAFT_c000023 | ARSoilOldRDRAFT_00002323 | 255 |
| 436 | 3300001990 | JGI24737J22298_10000458 | JGI24737J22298_100004584 | 255 |
| 437 | 3300001990 | JGI24737J22298_10003428 | JGI24737J22298_100034283 | 255 |
| 438 | 3300005289 | Ga0065704_10104383 | Ga0065704_101043832 | 255 |
| 439 | 3300005290 | Ga0065712_10072517 | Ga0065712_100725173 | 255 |
| 440 | 3300005290 | Ga0065712_10087111 | Ga0065712_100871113 | 255 |
| 441 | 3300005293 | Ga0065715_10001564 | Ga0065715_100015648 | 255 |
| 442 | 3300005330 | Ga0070690_100147733 | Ga0070690_1001477332 | 255 |
| 443 | 3300005330 | Ga0070690_100291039 | Ga0070690_1002910392 | 255 |
| 444 | 3300005331 | Ga0070670_100000437 | Ga0070670_10000043716 | 255 |
| 445 | 3300005331 | Ga0070670_100107537 | Ga0070670_1001075371 | 255 |
| 446 | 3300005335 | Ga0070666_10006881 | Ga0070666_100068817 | 255 |
| 447 | 3300005335 | Ga0070666_10075867 | Ga0070666_100758673 | 255 |
| 448 | 3300005336 | Ga0070680_100010932 | Ga0070680_1000109324 | 255 |
| 449 | 3300005337 | Ga0070682_100013961 | Ga0070682_1000139613 | 255 |
| 450 | 3300005337 | Ga0070682_100079462 | Ga0070682_1000794622 | 255 |
| 451 | 3300005338 | Ga0068868_100120853 | Ga0068868_1001208532 | 255 |
| 452 | 3300005339 | Ga0070660_100008614 | Ga0070660_1000086144 | 255 |
| 453 | 3300005340 | Ga0070689_100051873 | Ga0070689_1000518732 | 255 |
| 454 | 3300005340 | Ga0070689_100122333 | Ga0070689_1001223332 | 255 |
| 455 | 3300005341 | Ga0070691_10152228 | Ga0070691_101522282 | 255 |
| 456 | 3300005345 | Ga0070692_10000008 | Ga0070692_100000082 | 255 |
| 457 | 3300005345 | Ga0070692_10027989 | Ga0070692_100279892 | 255 |
| 458 | 3300005353 | Ga0070669_100058695 | Ga0070669_1000586952 | 255 |
| 459 | 3300005354 | Ga0070675_100016085 | Ga0070675_1000160854 | 255 |
| 460 | 3300005354 | Ga0070675_100096738 | Ga0070675_1000967383 | 255 |
| 461 | 3300005355 | Ga0070671_100033139 | Ga0070671_1000331392 | 255 |
| 462 | 3300005355 | Ga0070671_100100134 | Ga0070671_1001001342 | 255 |
| 463 | 3300005355 | Ga0070671_100496951 | Ga0070671_1004969512 | 255 |
| 464 | 3300005355 | Ga0070671_100616961 | Ga0070671_1006169611 | 255 |
| 465 | 3300005356 | Ga0070674_100179631 | Ga0070674_1001796312 | 255 |
| 466 | 3300005364 | Ga0070673_100037972 | Ga0070673_1000379722 | 255 |
| 467 | 3300005364 | Ga0070673_100328753 | Ga0070673_1003287532 | 255 |
| 468 | 3300005365 | Ga0070688_100008112 | Ga0070688_1000081125 | 255 |
| 469 | 3300005365 | Ga0070688_100407982 | Ga0070688_1004079821 | 255 |
| 470 | 3300005366 | Ga0070659_100009561 | Ga0070659_1000095615 | 255 |
| 471 | 3300005366 | Ga0070659_100120197 | Ga0070659_1001201971 | 255 |
| 472 | 3300005367 | Ga0070667_100041051 | Ga0070667_1000410514 | 255 |
| 473 | 3300005367 | Ga0070667_100067811 | Ga0070667_1000678112 | 255 |
| 474 | 3300005367 | Ga0070667_100565571 | Ga0070667_1005655712 | 255 |
| 475 | 3300005406 | Ga0070703_10003001 | Ga0070703_100030012 | 255 |
| 476 | 3300005406 | Ga0070703_10050284 | Ga0070703_100502841 | 255 |
| 477 | 3300005434 | Ga0070709_10008980 | Ga0070709_100089803 | 255 |
| 478 | 3300005434 | Ga0070709_10037312 | Ga0070709_100373121 | 255 |
| 479 | 3300005434 | Ga0070709_10121863 | Ga0070709_101218633 | 255 |
| 480 | 3300005434 | Ga0070709_10463575 | Ga0070709_104635751 | 255 |
| 481 | 3300005435 | Ga0070714_100057751 | Ga0070714_1000577512 | 255 |
| 482 | 3300005435 | Ga0070714_100137227 | Ga0070714_1001372271 | 255 |
| 483 | 3300005436 | Ga0070713_100020676 | Ga0070713_1000206763 | 255 |
| 484 | 3300005436 | Ga0070713_100258275 | Ga0070713_1002582752 | 255 |
| 485 | 3300005437 | Ga0070710_10053671 | Ga0070710_100536712 | 255 |
| 486 | 3300005438 | Ga0070701_10217497 | Ga0070701_102174972 | 255 |
| 487 | 3300005439 | Ga0070711_100043656 | Ga0070711_1000436562 | 255 |
| 488 | 3300005439 | Ga0070711_100214283 | Ga0070711_1002142832 | 255 |
| 489 | 3300005440 | Ga0070705_100174827 | Ga0070705_1001748272 | 255 |
| 490 | 3300005441 | Ga0070700_100005017 | Ga0070700_1000050174 | 255 |
| 491 | 3300005444 | Ga0070694_100011811 | Ga0070694_1000118115 | 255 |
| 492 | 3300005444 | Ga0070694_100060362 | Ga0070694_1000603623 | 255 |
| 493 | 3300005455 | Ga0070663_100036543 | Ga0070663_1000365433 | 255 |
| 494 | 3300005456 | Ga0070678_100061496 | Ga0070678_1000614962 | 255 |
| 495 | 3300005457 | Ga0070662_100009709 | Ga0070662_1000097095 | 255 |
| 496 | 3300005457 | Ga0070662_100121499 | Ga0070662_1001214992 | 255 |
| 497 | 3300005458 | Ga0070681_10639002 | Ga0070681_106390021 | 255 |
| 498 | 3300005459 | Ga0068867_100059792 | Ga0068867_1000597922 | 255 |
| 499 | 3300005466 | Ga0070685_10009054 | Ga0070685_100090543 | 255 |
| 500 | 3300005466 | Ga0070685_10066335 | Ga0070685_100663352 | 255 |
| 501 | 3300005468 | Ga0070707_100069965 | Ga0070707_1000699652 | 255 |
| 502 | 3300005530 | Ga0070679_100254195 | Ga0070679_1002541952 | 255 |
| 503 | 3300005535 | Ga0070684_100322239 | Ga0070684_1003222392 | 255 |
| 504 | 3300005539 | Ga0068853_100023115 | Ga0068853_1000231154 | 255 |
| 505 | 3300005543 | Ga0070672_100233162 | Ga0070672_1002331622 | 255 |
| 506 | 3300005544 | Ga0070686_100022223 | Ga0070686_1000222233 | 255 |
| 507 | 3300005545 | Ga0070695_100011865 | Ga0070695_1000118652 | 255 |
| 508 | 3300005545 | Ga0070695_100014581 | Ga0070695_1000145814 | 255 |
| 509 | 3300005545 | Ga0070695_100375927 | Ga0070695_1003759272 | 255 |
| 510 | 3300005546 | Ga0070696_100024640 | Ga0070696_1000246403 | 255 |
| 511 | 3300005546 | Ga0070696_100115984 | Ga0070696_1001159842 | 255 |
| 512 | 3300005549 | Ga0070704_100003857 | Ga0070704_1000038574 | 255 |
| 513 | 3300005563 | Ga0068855_100067277 | Ga0068855_1000672773 | 255 |
| 514 | 3300005564 | Ga0070664_100058305 | Ga0070664_1000583053 | 255 |
| 515 | 3300005564 | Ga0070664_100359893 | Ga0070664_1003598932 | 255 |
| 516 | 3300005577 | Ga0068857_100277508 | Ga0068857_1002775082 | 255 |
| 517 | 3300005578 | Ga0068854_100080568 | Ga0068854_1000805683 | 255 |
| 518 | 3300005614 | Ga0068856_100041527 | Ga0068856_1000415274 | 255 |
| 519 | 3300005614 | Ga0068856_100137973 | Ga0068856_1001379732 | 255 |
| 520 | 3300005616 | Ga0068852_100398951 | Ga0068852_1003989512 | 255 |
| 521 | 3300005617 | Ga0068859_100036332 | Ga0068859_1000363322 | 255 |
| 522 | 3300005618 | Ga0068864_100079171 | Ga0068864_1000791713 | 255 |
| 523 | 3300005618 | Ga0068864_100181923 | Ga0068864_1001819232 | 255 |
| 524 | 3300005718 | Ga0068866_10070764 | Ga0068866_100707642 | 255 |
| 525 | 3300005719 | Ga0068861_100098948 | Ga0068861_1000989482 | 255 |
| 526 | 3300005841 | Ga0068863_100111336 | Ga0068863_1001113362 | 255 |
| 527 | 3300005841 | Ga0068863_100295529 | Ga0068863_1002955292 | 255 |
| 528 | 3300005841 | Ga0068863_100471954 | Ga0068863_1004719542 | 255 |
| 529 | 3300005842 | Ga0068858_100000512 | Ga0068858_10000051242 | 255 |
| 530 | 3300005842 | Ga0068858_100065166 | Ga0068858_1000651663 | 255 |
| 531 | 3300005842 | Ga0068858_100113862 | Ga0068858_1001138622 | 255 |
| 532 | 3300005842 | Ga0068858_100276198 | Ga0068858_1002761982 | 255 |
| 533 | 3300005843 | Ga0068860_100040149 | Ga0068860_1000401494 | 255 |
| 534 | 3300005843 | Ga0068860_100181065 | Ga0068860_1001810652 | 255 |
| 535 | 3300005844 | Ga0068862_100000557 | Ga0068862_10000055714 | 255 |
| 536 | 3300005844 | Ga0068862_100021018 | Ga0068862_1000210185 | 255 |
| 537 | 3300005937 | Ga0081455_10000035 | Ga0081455_1000003573 | 255 |
| 538 | 3300005937 | Ga0081455_10069074 | Ga0081455_100690743 | 255 |
| 539 | 3300006028 | Ga0070717_10003781 | Ga0070717_100037816 | 255 |
| 540 | 3300006163 | Ga0070715_10035594 | Ga0070715_100355941 | 255 |
| 541 | 3300006173 | Ga0070716_100046614 | Ga0070716_1000466143 | 255 |
| 542 | 3300006173 | Ga0070716_100301529 | Ga0070716_1003015292 | 255 |
| 543 | 3300006175 | Ga0070712_100057204 | Ga0070712_1000572042 | 255 |
| 544 | 3300006175 | Ga0070712_100175892 | Ga0070712_1001758922 | 255 |
| 545 | 3300006194 | Ga0075427_10001188 | Ga0075427_100011882 | 255 |
| 546 | 3300006237 | Ga0097621_100092009 | Ga0097621_1000920093 | 255 |
| 547 | 3300006358 | Ga0068871_100159997 | Ga0068871_1001599972 | 255 |
| 548 | 3300006844 | Ga0075428_100015574 | Ga0075428_1000155744 | 255 |
| 549 | 3300006846 | Ga0075430_100003545 | Ga0075430_1000035454 | 255 |
| 550 | 3300006847 | Ga0075431_100012917 | Ga0075431_1000129174 | 255 |
| 551 | 3300006852 | Ga0075433_10004405 | Ga0075433_100044059 | 255 |
| 552 | 3300006852 | Ga0075433_10066986 | Ga0075433_100669862 | 255 |
| 553 | 3300006852 | Ga0075433_10252959 | Ga0075433_102529592 | 255 |
| 554 | 3300006871 | Ga0075434_100001135 | Ga0075434_1000011359 | 255 |
| 555 | 3300006871 | Ga0075434_100045346 | Ga0075434_1000453464 | 255 |
| 556 | 3300006871 | Ga0075434_100299100 | Ga0075434_1002991002 | 255 |
| 557 | 3300006871 | Ga0075434_100814204 | Ga0075434_1008142041 | 255 |
| 558 | 3300006880 | Ga0075429_100001354 | Ga0075429_1000013546 | 255 |
| 559 | 3300006881 | Ga0068865_100000119 | Ga0068865_10000011925 | 255 |
| 560 | 3300006881 | Ga0068865_100117671 | Ga0068865_1001176712 | 255 |
| 561 | 3300006914 | Ga0075436_100019478 | Ga0075436_1000194784 | 255 |
| 562 | 3300006914 | Ga0075436_100052595 | Ga0075436_1000525952 | 255 |
| 563 | 3300006931 | Ga0097620_100036331 | Ga0097620_1000363312 | 255 |
| 564 | 3300007076 | Ga0075435_100042204 | Ga0075435_1000422044 | 255 |
| 565 | 3300007076 | Ga0075435_100045146 | Ga0075435_1000451464 | 255 |
| 566 | 3300007076 | Ga0075435_100047158 | Ga0075435_1000471583 | 255 |
| 567 | 3300009011 | Ga0105251_10024945 | Ga0105251_100249453 | 255 |
| 568 | 3300009094 | Ga0111539_10001512 | Ga0111539_100015125 | 255 |
| 569 | 3300009094 | Ga0111539_10019347 | Ga0111539_100193474 | 255 |
| 570 | 3300009094 | Ga0111539_11143595 | Ga0111539_111435952 | 255 |
| 571 | 3300009098 | Ga0105245_10128369 | Ga0105245_101283692 | 255 |
| 572 | 3300009098 | Ga0105245_10218347 | Ga0105245_102183472 | 255 |
| 573 | 3300009101 | Ga0105247_10191744 | Ga0105247_101917442 | 255 |
| 574 | 3300009147 | Ga0114129_10056907 | Ga0114129_100569074 | 255 |
| 575 | 3300009147 | Ga0114129_10175903 | Ga0114129_101759033 | 255 |
| 576 | 3300009148 | Ga0105243_10020499 | Ga0105243_100204992 | 255 |
| 577 | 3300009148 | Ga0105243_10146344 | Ga0105243_101463442 | 255 |
| 578 | 3300009177 | Ga0105248_10190862 | Ga0105248_101908622 | 255 |
| 579 | 3300009177 | Ga0105248_10240117 | Ga0105248_102401172 | 255 |
| 580 | 3300009177 | Ga0105248_10372572 | Ga0105248_103725722 | 255 |
| 581 | 3300009545 | Ga0105237_10265205 | Ga0105237_102652052 | 255 |
| 582 | 3300009553 | Ga0105249_10000215 | Ga0105249_1000021519 | 255 |
| 583 | 3300009553 | Ga0105249_10009891 | Ga0105249_100098918 | 255 |
| 584 | 3300009553 | Ga0105249_10115843 | Ga0105249_101158432 | 255 |
| 585 | 3300009553 | Ga0105249_10688926 | Ga0105249_106889262 | 255 |
| 586 | 3300010375 | Ga0105239_10028262 | Ga0105239_100282624 | 255 |
| 587 | 3300010375 | Ga0105239_10414397 | Ga0105239_104143971 | 255 |
| 588 | 3300010375 | Ga0105239_10525955 | Ga0105239_105259552 | 255 |
| 589 | 3300011119 | Ga0105246_10000019 | Ga0105246_1000001930 | 255 |
| 590 | 3300011119 | Ga0105246_10145180 | Ga0105246_101451802 | 255 |
| 591 | 3300011119 | Ga0105246_10225498 | Ga0105246_102254982 | 255 |
| 592 | 3300013296 | Ga0157374_10326771 | Ga0157374_103267712 | 255 |
| 593 | 3300013296 | Ga0157374_10539711 | Ga0157374_105397112 | 255 |
| 594 | 3300013297 | Ga0157378_10002701 | Ga0157378_1000270113 | 255 |
| 595 | 3300013297 | Ga0157378_10240375 | Ga0157378_102403752 | 255 |
| 596 | 3300013306 | Ga0163162_10001187 | Ga0163162_1000118713 | 255 |
| 597 | 3300013306 | Ga0163162_10087104 | Ga0163162_100871043 | 255 |
| 598 | 3300013306 | Ga0163162_10306353 | Ga0163162_103063532 | 255 |
| 599 | 3300013306 | Ga0163162_10570722 | Ga0163162_105707222 | 255 |
| 600 | 3300013308 | Ga0157375_10010957 | Ga0157375_100109575 | 255 |
| 601 | 3300013308 | Ga0157375_10228605 | Ga0157375_102286052 | 255 |
| 602 | 3300013308 | Ga0157375_10493174 | Ga0157375_104931742 | 255 |
| 603 | 3300013308 | Ga0157375_10499742 | Ga0157375_104997422 | 255 |
| 604 | 3300014325 | Ga0163163_10019264 | Ga0163163_100192642 | 255 |
| 605 | 3300014325 | Ga0163163_10263527 | Ga0163163_102635272 | 255 |
| 606 | 3300014325 | Ga0163163_10393967 | Ga0163163_103939672 | 255 |
| 607 | 3300014326 | Ga0157380_10000284 | Ga0157380_1000028418 | 255 |
| 608 | 3300014326 | Ga0157380_10578608 | Ga0157380_105786082 | 255 |
| 609 | 3300014497 | Ga0182008_10131793 | Ga0182008_101317932 | 255 |
| 610 | 3300014968 | Ga0157379_10208769 | Ga0157379_102087692 | 255 |
| 611 | 3300014968 | Ga0157379_10320881 | Ga0157379_103208812 | 255 |
| 612 | 3300014969 | Ga0157376_10363081 | Ga0157376_103630812 | 255 |
| 613 | 3300017792 | Ga0163161_10100882 | Ga0163161_101008822 | 255 |
| 614 | 3300020082 | Ga0206353_11144301 | Ga0206353_111443012 | 255 |
| 615 | 3300021384 | Ga0213876_10033890 | Ga0213876_100338904 | 255 |
| 616 | 3300021388 | Ga0213875_10000165 | Ga0213875_100001658 | 255 |
| 617 | 3300025271 | Ga0207666_1000744 | Ga0207666_10007444 | 255 |
| 618 | 3300025315 | Ga0207697_10003696 | Ga0207697_100036965 | 255 |
| 619 | 3300025885 | Ga0207653_10001699 | Ga0207653_100016997 | 255 |
| 620 | 3300025898 | Ga0207692_10040821 | Ga0207692_100408211 | 255 |
| 621 | 3300025898 | Ga0207692_10052375 | Ga0207692_100523752 | 255 |
| 622 | 3300025900 | Ga0207710_10004914 | Ga0207710_100049145 | 255 |
| 623 | 3300025901 | Ga0207688_10034764 | Ga0207688_100347643 | 255 |
| 624 | 3300025903 | Ga0207680_10101178 | Ga0207680_101011782 | 255 |
| 625 | 3300025905 | Ga0207685_10013800 | Ga0207685_100138002 | 255 |
| 626 | 3300025905 | Ga0207685_10016988 | Ga0207685_100169882 | 255 |
| 627 | 3300025906 | Ga0207699_10061149 | Ga0207699_100611492 | 255 |
| 628 | 3300025906 | Ga0207699_10106676 | Ga0207699_101066762 | 255 |
| 629 | 3300025906 | Ga0207699_10160123 | Ga0207699_101601232 | 255 |
| 630 | 3300025906 | Ga0207699_10318315 | Ga0207699_103183152 | 255 |
| 631 | 3300025912 | Ga0207707_10256086 | Ga0207707_102560862 | 255 |
| 632 | 3300025915 | Ga0207693_10017770 | Ga0207693_100177702 | 255 |
| 633 | 3300025915 | Ga0207693_10209191 | Ga0207693_102091912 | 255 |
| 634 | 3300025916 | Ga0207663_10043923 | Ga0207663_100439233 | 255 |
| 635 | 3300025919 | Ga0207657_10010318 | Ga0207657_100103185 | 255 |
| 636 | 3300025919 | Ga0207657_10120100 | Ga0207657_101201002 | 255 |
| 637 | 3300025920 | Ga0207649_10293675 | Ga0207649_102936752 | 255 |
| 638 | 3300025921 | Ga0207652_10153018 | Ga0207652_101530182 | 255 |
| 639 | 3300025921 | Ga0207652_10209758 | Ga0207652_102097582 | 255 |
| 640 | 3300025925 | Ga0207650_10603563 | Ga0207650_106035631 | 255 |
| 641 | 3300025926 | Ga0207659_10028682 | Ga0207659_100286824 | 255 |
| 642 | 3300025927 | Ga0207687_10006850 | Ga0207687_100068502 | 255 |
| 643 | 3300025927 | Ga0207687_10179633 | Ga0207687_101796332 | 255 |
| 644 | 3300025928 | Ga0207700_10004694 | Ga0207700_100046944 | 255 |
| 645 | 3300025928 | Ga0207700_10018933 | Ga0207700_100189333 | 255 |
| 646 | 3300025929 | Ga0207664_10041800 | Ga0207664_100418002 | 255 |
| 647 | 3300025931 | Ga0207644_10120276 | Ga0207644_101202763 | 255 |
| 648 | 3300025931 | Ga0207644_10312897 | Ga0207644_103128972 | 255 |
| 649 | 3300025931 | Ga0207644_10432814 | Ga0207644_104328142 | 255 |
| 650 | 3300025932 | Ga0207690_10040362 | Ga0207690_100403623 | 255 |
| 651 | 3300025933 | Ga0207706_10017526 | Ga0207706_100175263 | 255 |
| 652 | 3300025933 | Ga0207706_10088991 | Ga0207706_100889913 | 255 |
| 653 | 3300025934 | Ga0207686_10035002 | Ga0207686_100350022 | 255 |
| 654 | 3300025935 | Ga0207709_10070620 | Ga0207709_100706202 | 255 |
| 655 | 3300025936 | Ga0207670_10112784 | Ga0207670_101127842 | 255 |
| 656 | 3300025937 | Ga0207669_10119421 | Ga0207669_101194211 | 255 |
| 657 | 3300025938 | Ga0207704_10024045 | Ga0207704_100240453 | 255 |
| 658 | 3300025939 | Ga0207665_10000631 | Ga0207665_1000063125 | 255 |
| 659 | 3300025939 | Ga0207665_10265993 | Ga0207665_102659932 | 255 |
| 660 | 3300025939 | Ga0207665_10267406 | Ga0207665_102674062 | 255 |
| 661 | 3300025940 | Ga0207691_10055482 | Ga0207691_100554824 | 255 |
| 662 | 3300025941 | Ga0207711_10016598 | Ga0207711_100165983 | 255 |
| 663 | 3300025941 | Ga0207711_10054868 | Ga0207711_100548683 | 255 |
| 664 | 3300025941 | Ga0207711_10455513 | Ga0207711_104555131 | 255 |
| 665 | 3300025942 | Ga0207689_10036982 | Ga0207689_100369822 | 255 |
| 666 | 3300025945 | Ga0207679_10066279 | Ga0207679_100662792 | 255 |
| 667 | 3300025945 | Ga0207679_10126399 | Ga0207679_101263991 | 255 |
| 668 | 3300025960 | Ga0207651_10037972 | Ga0207651_100379724 | 255 |
| 669 | 3300025960 | Ga0207651_10691524 | Ga0207651_106915241 | 255 |
| 670 | 3300025961 | Ga0207712_10037284 | Ga0207712_100372842 | 255 |
| 671 | 3300025961 | Ga0207712_10126500 | Ga0207712_101265002 | 255 |
| 672 | 3300025961 | Ga0207712_10535035 | Ga0207712_105350352 | 255 |
| 673 | 3300025972 | Ga0207668_10090761 | Ga0207668_100907612 | 255 |
| 674 | 3300025981 | Ga0207640_10061221 | Ga0207640_100612213 | 255 |
| 675 | 3300025986 | Ga0207658_10015437 | Ga0207658_100154373 | 255 |
| 676 | 3300025986 | Ga0207658_10399165 | Ga0207658_103991652 | 255 |
| 677 | 3300026067 | Ga0207678_10014489 | Ga0207678_100144895 | 255 |
| 678 | 3300026067 | Ga0207678_10027526 | Ga0207678_100275265 | 255 |
| 679 | 3300026075 | Ga0207708_10002641 | Ga0207708_1000264110 | 255 |
| 680 | 3300026088 | Ga0207641_10118183 | Ga0207641_101181832 | 255 |
| 681 | 3300026088 | Ga0207641_10161900 | Ga0207641_101619003 | 255 |
| 682 | 3300026088 | Ga0207641_10190827 | Ga0207641_101908271 | 255 |
| 683 | 3300026089 | Ga0207648_10038868 | Ga0207648_100388683 | 255 |
| 684 | 3300026089 | Ga0207648_10289894 | Ga0207648_102898942 | 255 |
| 685 | 3300026095 | Ga0207676_10072633 | Ga0207676_100726333 | 255 |
| 686 | 3300026116 | Ga0207674_10301720 | Ga0207674_103017202 | 255 |
| 687 | 3300026118 | Ga0207675_100028481 | Ga0207675_1000284813 | 255 |
| 688 | 3300026121 | Ga0207683_10045639 | Ga0207683_100456394 | 255 |
| 689 | 3300026121 | Ga0207683_10054532 | Ga0207683_100545323 | 255 |
| 690 | 3300026142 | Ga0207698_10126915 | Ga0207698_101269152 | 255 |
| 691 | 3300027695 | Ga0209966_1001251 | Ga0209966_10012513 | 255 |
| 692 | 3300027695 | Ga0209966_1001450 | Ga0209966_10014503 | 255 |
| 693 | 3300027717 | Ga0209998_10000949 | Ga0209998_100009495 | 255 |
| 694 | 3300027717 | Ga0209998_10009395 | Ga0209998_100093952 | 255 |
| 695 | 3300027876 | Ga0209974_10001910 | Ga0209974_100019102 | 255 |
| 696 | 3300027876 | Ga0209974_10087552 | Ga0209974_100875522 | 255 |
| 697 | 3300027907 | Ga0207428_10000308 | Ga0207428_1000030854 | 255 |
| 698 | 3300027907 | Ga0207428_10000474 | Ga0207428_1000047430 | 255 |
| 699 | 3300028379 | Ga0268266_10051110 | Ga0268266_100511103 | 255 |
| 700 | 3300028380 | Ga0268265_10026332 | Ga0268265_100263324 | 255 |
| 701 | 3300028381 | Ga0268264_10359016 | Ga0268264_103590161 | 255 |
| 702 | 3300028800 | Ga0265338_10064148 | Ga0265338_100641483 | 255 |
| 703 | 3300030760 | Ga0265762_1006598 | Ga0265762_10065982 | 255 |
| 704 | 3300031238 | Ga0265332_10001070 | Ga0265332_1000107010 | 255 |
| 705 | 3300031241 | Ga0265325_10000352 | Ga0265325_1000035219 | 255 |
| 706 | 3300031241 | Ga0265325_10052644 | Ga0265325_100526441 | 255 |
| 707 | 3300031247 | Ga0265340_10006050 | Ga0265340_100060507 | 255 |
| 708 | 3300031247 | Ga0265340_10034466 | Ga0265340_100344662 | 255 |
| 709 | 3300031249 | Ga0265339_10000979 | Ga0265339_1000097919 | 255 |
| 710 | 3300031249 | Ga0265339_10005391 | Ga0265339_100053917 | 255 |
| 711 | 3300031344 | Ga0265316_10044436 | Ga0265316_100444363 | 255 |
| 712 | 3300031595 | Ga0265313_10000686 | Ga0265313_1000068615 | 255 |
| 713 | 3300031691 | Ga0316579_10024922 | Ga0316579_100249223 | 255 |
| 714 | 3300031711 | Ga0265314_10003780 | Ga0265314_100037806 | 255 |
| 715 | 3300031711 | Ga0265314_10005573 | Ga0265314_100055734 | 255 |
| 716 | 3300031712 | Ga0265342_10000031 | Ga0265342_10000031149 | 255 |
| 717 | 3300034816 | Ga0373930_0000020 | Ga0373930_0000020_7483_8250 | 255 |
| 718 | 3300034816 | Ga0373930_0012248 | Ga0373930_0012248_106_873 | 255 |
| 719 | 3300034817 | Ga0373948_0000371 | Ga0373948_0000371_3146_3913 | 255 |
| 720 | 3300034817 | Ga0373948_0012850 | Ga0373948_0012850_471_1238 | 255 |
| 721 | 3300034818 | Ga0373950_0000266 | Ga0373950_0000266_1799_2566 | 255 |
| 722 | 3300034819 | Ga0373958_0000533 | Ga0373958_0000533_3311_4078 | 255 |
| 723 | 3300034820 | Ga0373959_0000539 | Ga0373959_0000539_3498_4265 | 255 |
| 724 | 3300034957 | Ga0373938_0000748 | Ga0373938_0000748_3386_4153 | 255 |
| 725 | 3300035084 | Ga0373928_0004305 | Ga0373928_0004305_869_1636 | 255 |
| 726 | 3300035085 | Ga0373929_0000042 | Ga0373929_0000042_27071_27838 | 255 |
| 727 | 3300035086 | Ga0373934_0042312 | Ga0373934_0042312_673_1443 | 255 |
| 728 | 3300035088 | Ga0373940_0000325 | Ga0373940_0000325_2490_3257 | 255 |
| 729 | 3300035090 | Ga0373949_0001117 | Ga0373949_0001117_4545_5312 | 255 |
| 730 | 3300035091 | Ga0373951_0000547 | Ga0373951_0000547_6316_7083 | 255 |
| 731 | 3300035092 | Ga0373952_0000713 | Ga0373952_0000713_1982_2749 | 255 |
| 732 | 3300035092 | Ga0373952_0021568 | Ga0373952_0021568_153_920 | 255 |
| 733 | 3300035112 | Ga0373932_0001186 | Ga0373932_0001186_3171_3938 | 255 |
| 734 | 3300035112 | Ga0373932_0002300 | Ga0373932_0002300_669_1436 | 255 |
| 735 | 3300035113 | Ga0373936_0019802 | Ga0373936_0019802_772_1542 | 255 |
| 736 | 3300035114 | Ga0373939_0000360 | Ga0373939_0000360_9263_10030 | 255 |
| 737 | 3300035114 | Ga0373939_0011935 | Ga0373939_0011935_712_1479 | 255 |
| 738 | 3300035115 | Ga0373941_0001805 | Ga0373941_0001805_2612_3379 | 255 |
| 739 | 3300035115 | Ga0373941_0005933 | Ga0373941_0005933_617_1384 | 255 |
| 740 | 3300035117 | Ga0373953_0048465 | Ga0373953_0048465_98_865 | 255 |
| 741 | 3300035118 | Ga0373954_0057832 | Ga0373954_0057832_827_1597 | 255 |
| 742 | 3300035119 | Ga0373956_0024246 | Ga0373956_0024246_1807_2577 | 255 |
| 743 | 3300035120 | Ga0373957_0005912 | Ga0373957_0005912_2384_3154 | 255 |
| 744 | 3300035120 | Ga0373957_0133632 | Ga0373957_0133632_70_837 | 255 |
| 745 | 3300035121 | Ga0373960_0003891 | Ga0373960_0003891_142_909 | 255 |
| 746 | 3300035121 | Ga0373960_0019041 | Ga0373960_0019041_537_1304 | 255 |
| 747 | 3300035121 | Ga0373960_0036289 | Ga0373960_0036289_14_781 | 255 |
| 748 | 3300035170 | Ga0373943_0027110 | Ga0373943_0027110_1570_2340 | 255 |
| 749 | 3300035172 | Ga0373955_0129552 | Ga0373955_0129552_521_1288 | 255 |
| 750 | 3300035207 | Ga0373942_0001477 | Ga0373942_0001477_732_1499 | 255 |
| 751 | 3300035207 | Ga0373942_0003320 | Ga0373942_0003320_2811_3578 | 255 |
| 752 | 3300035207 | Ga0373942_0018232 | Ga0373942_0018232_239_1009 | 255 |
| 753 | 3300035241 | Ga0373961_0003189 | Ga0373961_0003189_2070_2837 | 255 |
| 754 | 3300035242 | Ga0373962_0000354 | Ga0373962_0000354_4103_4870 | 255 |
| 755 | 3300035242 | Ga0373962_0013857 | Ga0373962_0013857_885_1652 | 255 |
| 756 | 3300035691 | Ga0373931_0030133 | Ga0373931_0030133_1354_2121 | 255 |
| 757 | 3300035691 | Ga0373931_0053231 | Ga0373931_0053231_163_930 | 255 |
| 758 | 3300035692 | Ga0373935_0003255 | Ga0373935_0003255_2675_3442 | 255 |
| 759 | 3300035724 | Ga0373933_0024531 | Ga0373933_0024531_963_1733 | 255 |
| 760 | 3300035725 | Ga0373947_0030383 | Ga0373947_0030383_1185_1952 | 255 |
| 761 | 3300036401 | Ga0373937_0005292 | Ga0373937_0005292_4492_5262 | 255 |
| 762 | 3300036401 | Ga0373937_0011036 | Ga0373937_0011036_4534_5301 | 255 |
| 763 | 3300036401 | Ga0373937_0073445 | Ga0373937_0073445_605_1372 | 255 |
| 764 | 3300037068 | Ga0373925_0008940 | Ga0373925_0008940_4119_4886 | 255 |
| 765 | 3300037068 | Ga0373925_0150446 | Ga0373925_0150446_777_1544 | 255 |
| 766 | 3300037853 | Ga0436364_1177974 | Ga0436364_1177974_6915_7685 | 255 |
| 767 | 3300039437 | Ga0436365_0592364 | Ga0436365_0592364_824_1594 | 255 |
| 768 | 3300039447 | Ga0436361_0944607 | Ga0436361_0944607_1223_1993 | 255 |
| 769 | 3300039453 | Ga0436362_0454806 | Ga0436362_0454806_246_1016 | 255 |
| 770 | 3300042461 | Ga0439460_0014322 | Ga0439460_0014322_1007_1786 | 255 |
| 771 | 3300045051 | Ga0451576_0056338 | Ga0451576_0056338_2283_3050 | 255 |
| 772 | 3300045976 | Ga0466967_0450012 | Ga0466967_0450012_413_1180 | 255 |
| 773 | 3300046454 | Ga0495592_0067404 | Ga0495592_0067404_1049_1819 | 255 |
| 774 | 3300046455 | Ga0495603_0015554 | Ga0495603_0015554_2541_3308 | 255 |
| 775 | 3300046459 | Ga0495629_0000222 | Ga0495629_0000222_20203_20970 | 255 |
| 776 | 3300046459 | Ga0495629_0092397 | Ga0495629_0092397_373_1143 | 255 |
| 777 | 3300046459 | Ga0495629_0101992 | Ga0495629_0101992_147_914 | 255 |
| 778 | 3300046461 | Ga0495641_0013226 | Ga0495641_0013226_911_1678 | 255 |
| 779 | 3300046462 | Ga0495651_0014733 | Ga0495651_0014733_3151_3921 | 255 |
| 780 | 3300046462 | Ga0495651_0142149 | Ga0495651_0142149_385_1152 | 255 |
| 781 | 3300046462 | Ga0495651_0149293 | Ga0495651_0149293_706_1473 | 255 |
| 782 | 3300046462 | Ga0495651_0164873 | Ga0495651_0164873_300_1067 | 255 |
| 783 | 3300046463 | Ga0495653_0027955 | Ga0495653_0027955_2127_2897 | 255 |
| 784 | 3300046475 | Ga0495639_0137851 | Ga0495639_0137851_377_1144 | 255 |
| 785 | 3300046476 | Ga0495662_0096654 | Ga0495662_0096654_399_1169 | 255 |
| 786 | 3300046491 | Ga0495584_0077382 | Ga0495584_0077382_221_988 | 255 |
| 787 | 3300046511 | Ga0495608_0002323 | Ga0495608_0002323_5042_5812 | 255 |
| 788 | 3300046514 | Ga0495618_0060945 | Ga0495618_0060945_632_1399 | 255 |
| 789 | 3300046516 | Ga0495628_0011343 | Ga0495628_0011343_2094_2861 | 255 |
| 790 | 3300046516 | Ga0495628_0014516 | Ga0495628_0014516_1608_2378 | 255 |
| 791 | 3300046517 | Ga0495630_0057444 | Ga0495630_0057444_1832_2602 | 255 |
| 792 | 3300046517 | Ga0495630_0065524 | Ga0495630_0065524_1431_2198 | 255 |
| 793 | 3300046526 | Ga0495666_0033500 | Ga0495666_0033500_53_820 | 255 |
| 794 | 3300046529 | Ga0495652_0020572 | Ga0495652_0020572_983_1753 | 255 |
| 795 | 3300046529 | Ga0495652_0098442 | Ga0495652_0098442_128_895 | 255 |
| 796 | 3300046531 | Ga0495665_0052758 | Ga0495665_0052758_565_1335 | 255 |
| 797 | 3300046533 | Ga0495640_0022097 | Ga0495640_0022097_3819_4586 | 255 |
| 798 | 3300046533 | Ga0495640_0090755 | Ga0495640_0090755_898_1668 | 255 |
| 799 | 3300046535 | Ga0495586_0039975 | Ga0495586_0039975_416_1186 | 255 |
| 800 | 3300046536 | Ga0495587_0006576 | Ga0495587_0006576_1202_1972 | 255 |
| 801 | 3300046543 | Ga0495645_0070637 | Ga0495645_0070637_1338_2108 | 255 |
| 802 | 3300046559 | Ga0495667_0002675 | Ga0495667_0002675_4700_5470 | 255 |
| 803 | 3300046559 | Ga0495667_0034249 | Ga0495667_0034249_1870_2637 | 255 |
| 804 | 3300046642 | Ga0495634_0131359 | Ga0495634_0131359_411_1181 | 255 |
| 805 | 3300046642 | Ga0495634_0135142 | Ga0495634_0135142_535_1302 | 255 |
| 806 | 3300046663 | Ga0495635_0002537 | Ga0495635_0002537_8116_8886 | 255 |
| 807 | 3300046674 | Ga0495588_0093201 | Ga0495588_0093201_649_1416 | 255 |
| 808 | 3300046675 | Ga0495657_0004771 | Ga0495657_0004771_4441_5211 | 255 |
| 809 | 3300046678 | Ga0495599_0025159 | Ga0495599_0025159_1754_2524 | 255 |
| 810 | 3300046679 | Ga0495623_0001394 | Ga0495623_0001394_8117_8887 | 255 |
| 811 | 3300046679 | Ga0495623_0119546 | Ga0495623_0119546_624_1391 | 255 |
| 812 | 3300046680 | Ga0495646_0001135 | Ga0495646_0001135_10244_11014 | 255 |
| 813 | 3300046681 | Ga0495647_0003047 | Ga0495647_0003047_2043_2810 | 255 |
| 814 | 3300046683 | Ga0495658_0000656 | Ga0495658_0000656_7360_8127 | 255 |
| 815 | 3300046683 | Ga0495658_0013420 | Ga0495658_0013420_1438_2205 | 255 |
| 816 | 3300046689 | Ga0495613_0004890 | Ga0495613_0004890_5072_5839 | 255 |
| 817 | 3300046689 | Ga0495613_0132259 | Ga0495613_0132259_566_1336 | 255 |
| 818 | 3300046690 | Ga0495624_0073691 | Ga0495624_0073691_399_1166 | 255 |
| 819 | 3300046809 | Ga0495600_0000708 | Ga0495600_0000708_5561_6331 | 255 |
| 820 | 3300047315 | Ga0495581_0052490 | Ga0495581_0052490_446_1213 | 255 |
| 821 | 3300047319 | Ga0495674_0002023 | Ga0495674_0002023_18923_19693 | 255 |
| 822 | 3300047319 | Ga0495674_0007365 | Ga0495674_0007365_9326_10096 | 255 |
| 823 | 3300047321 | Ga0495676_0042309 | Ga0495676_0042309_267_1034 | 255 |
| 824 | 3300047322 | Ga0495680_0005048 | Ga0495680_0005048_3660_4427 | 255 |
| 825 | 3300047322 | Ga0495680_0008971 | Ga0495680_0008971_6475_7245 | 255 |
| 826 | 3300047322 | Ga0495680_0009889 | Ga0495680_0009889_3818_4585 | 255 |
| 827 | 3300047444 | Ga0495675_0003495 | Ga0495675_0003495_3826_4596 | 255 |
| 828 | 3300047673 | Ga0495593_0039987 | Ga0495593_0039987_1340_2107 | 255 |
| 829 | 3300048089 | Ga0495614_0171943 | Ga0495614_0171943_98_868 | 255 |
| 830 | 3300048903 | Ga0496100_0029850 | Ga0496100_0029850_14_781 | 255 |
| 831 | 3300048903 | Ga0496100_0112447 | Ga0496100_0112447_652_1419 | 255 |
| 832 | 3300048904 | Ga0496101_0036257 | Ga0496101_0036257_1228_1995 | 255 |
| 833 | 3300048904 | Ga0496101_0364461 | Ga0496101_0364461_185_952 | 255 |
| 834 | 3300048905 | Ga0496102_0005220 | Ga0496102_0005220_5035_5805 | 255 |
| 835 | 3300048905 | Ga0496102_0250040 | Ga0496102_0250040_627_1394 | 255 |
| 836 | 3300048905 | Ga0496102_0537203 | Ga0496102_0537203_241_1008 | 255 |
| 837 | 3300048906 | Ga0496103_0024207 | Ga0496103_0024207_1597_2367 | 255 |
| 838 | 3300048906 | Ga0496103_0297315 | Ga0496103_0297315_258_1025 | 255 |
| 839 | 3300048907 | Ga0496104_0000116 | Ga0496104_0000116_32760_33527 | 255 |
| 840 | 3300048907 | Ga0496104_0063343 | Ga0496104_0063343_2191_2958 | 255 |
| 841 | 3300048907 | Ga0496104_0138651 | Ga0496104_0138651_717_1484 | 255 |
| 842 | 3300048907 | Ga0496104_0440187 | Ga0496104_0440187_365_1132 | 255 |
| 843 | 3300048908 | Ga0496105_0000550 | Ga0496105_0000550_3449_4216 | 255 |
| 844 | 3300048908 | Ga0496105_0133733 | Ga0496105_0133733_377_1144 | 255 |
| 845 | 3300048908 | Ga0496105_0134925 | Ga0496105_0134925_847_1617 | 255 |
| 846 | 3300048908 | Ga0496105_0676823 | Ga0496105_0676823_15_782 | 255 |
| 847 | 3300048909 | Ga0496106_0014148 | Ga0496106_0014148_691_1461 | 255 |
| 848 | 3300048910 | Ga0496107_0018580 | Ga0496107_0018580_277_1044 | 255 |
| 849 | 3300048910 | Ga0496107_0205083 | Ga0496107_0205083_373_1143 | 255 |
| 850 | 3300048911 | Ga0496108_0004997 | Ga0496108_0004997_6603_7370 | 255 |
| 851 | 3300048911 | Ga0496108_0064653 | Ga0496108_0064653_1870_2637 | 255 |
| 852 | 3300048911 | Ga0496108_0084202 | Ga0496108_0084202_513_1280 | 255 |
| 853 | 3300048911 | Ga0496108_0488539 | Ga0496108_0488539_93_863 | 255 |
| 854 | 3300048912 | Ga0496109_0014904 | Ga0496109_0014904_1045_1812 | 255 |
| 855 | 3300048912 | Ga0496109_0143348 | Ga0496109_0143348_1114_1881 | 255 |
| 856 | 3300048912 | Ga0496109_0144684 | Ga0496109_0144684_14_781 | 255 |
| 857 | 3300048912 | Ga0496109_0168587 | Ga0496109_0168587_325_1092 | 255 |
| 858 | 3300048913 | Ga0496110_0062381 | Ga0496110_0062381_2394_3161 | 255 |
| 859 | 3300048913 | Ga0496110_0098569 | Ga0496110_0098569_967_1734 | 255 |
| 860 | 3300048914 | Ga0496111_0101271 | Ga0496111_0101271_464_1231 | 255 |
| 861 | 3300048914 | Ga0496111_0564802 | Ga0496111_0564802_54_821 | 255 |
| 862 | 3300048915 | Ga0496112_0006007 | Ga0496112_0006007_3005_3772 | 255 |
| 863 | 3300048915 | Ga0496112_0077584 | Ga0496112_0077584_448_1215 | 255 |
| 864 | 3300048915 | Ga0496112_0329436 | Ga0496112_0329436_476_1246 | 255 |
| 865 | 3300048916 | Ga0496113_0000721 | Ga0496113_0000721_4578_5345 | 255 |
| 866 | 3300048916 | Ga0496113_0121831 | Ga0496113_0121831_939_1706 | 255 |
| 867 | 3300048916 | Ga0496113_0143331 | Ga0496113_0143331_940_1707 | 255 |
| 868 | 3300048916 | Ga0496113_0171033 | Ga0496113_0171033_900_1667 | 255 |
| 869 | 3300048917 | Ga0496114_0072297 | Ga0496114_0072297_740_1510 | 255 |
| 870 | 3300048917 | Ga0496114_0098697 | Ga0496114_0098697_583_1350 | 255 |
| 871 | 3300048917 | Ga0496114_0162064 | Ga0496114_0162064_386_1153 | 255 |
| 872 | 3300048918 | Ga0496115_0009214 | Ga0496115_0009214_1392_2162 | 255 |
| 873 | 3300048918 | Ga0496115_0164148 | Ga0496115_0164148_638_1408 | 255 |
| 874 | 3300048918 | Ga0496115_0177654 | Ga0496115_0177654_625_1392 | 255 |
| 875 | 3300049568 | Ga0501031_0078386 | Ga0501031_0078386_820_1587 | 255 |
| 876 | 3300049570 | Ga0501033_0016275 | Ga0501033_0016275_3797_4564 | 255 |
| 877 | 3300049571 | Ga0501034_0078119 | Ga0501034_0078119_622_1401 | 255 |
| 878 | 3300049572 | Ga0501036_0001338 | Ga0501036_0001338_2259_3026 | 255 |
| 879 | 3300049573 | Ga0501037_0020100 | Ga0501037_0020100_914_1681 | 255 |
| 880 | 3300049574 | Ga0501038_0019214 | Ga0501038_0019214_3066_3833 | 255 |
| 881 | 3300049575 | Ga0501039_0014409 | Ga0501039_0014409_3241_4008 | 255 |
| 882 | 3300049577 | Ga0501041_0000199 | Ga0501041_0000199_18121_18888 | 255 |
| 883 | 3300049578 | Ga0501042_0001962 | Ga0501042_0001962_2287_3054 | 255 |
| 884 | 3300049580 | Ga0501046_0009502 | Ga0501046_0009502_1633_2400 | 255 |
| 885 | 3300049582 | Ga0501048_0023681 | Ga0501048_0023681_1062_1829 | 255 |
| 886 | 3300049583 | Ga0501067_0206532 | Ga0501067_0206532_283_1050 | 255 |
| 887 | 3300049584 | Ga0501068_0015810 | Ga0501068_0015810_3110_3877 | 255 |
| 888 | 3300049587 | Ga0501071_0017834 | Ga0501071_0017834_348_1115 | 255 |
| 889 | 3300049587 | Ga0501071_0067829 | Ga0501071_0067829_652_1431 | 255 |
| 890 | 3300049589 | Ga0501073_0115989 | Ga0501073_0115989_853_1620 | 255 |
| 891 | 3300049591 | Ga0501075_0000297 | Ga0501075_0000297_8582_9349 | 255 |
| 892 | 3300049592 | Ga0501076_0001204 | Ga0501076_0001204_1529_2296 | 255 |
| 893 | 3300049741 | Ga0501079_0375507 | Ga0501079_0375507_138_917 | 255 |
| 894 | 3300049742 | Ga0501080_0467639 | Ga0501080_0467639_145_924 | 255 |
| 895 | 3300049743 | Ga0501081_0001439 | Ga0501081_0001439_6132_6899 | 255 |
| 896 | 3300049822 | Ga0501035_0035392 | Ga0501035_0035392_2156_2923 | 255 |
| 897 | 3300049823 | Ga0501044_0299869 | Ga0501044_0299869_89_856 | 255 |
| 898 | 3300049824 | Ga0501045_0000711 | Ga0501045_0000711_16104_16871 | 255 |
| 899 | 3300050507 | nmdc:mga05p37_46780_c1 | nmdc:mga05p37_46780_c1_676_1455 | 255 |
| 900 | 3300050507 | nmdc:mga05p37_5632_c1 | nmdc:mga05p37_5632_c1_4330_5109 | 255 |
| 901 | 3300050508 | nmdc:mga09592_1148_c1 | nmdc:mga09592_1148_c1_7108_7887 | 255 |
| 902 | 3300050509 | nmdc:mga0qj67_2133_c1 | nmdc:mga0qj67_2133_c1_8894_9673 | 255 |
| 903 | 3300050510 | nmdc:mga06r32_4222_c1 | nmdc:mga06r32_4222_c1_7526_8305 | 255 |
| 904 | 3300050511 | nmdc:mga08y16_4316_c1 | nmdc:mga08y16_4316_c1_2812_3579 | 255 |
| 905 | 3300050511 | nmdc:mga08y16_693078_c1 | nmdc:mga08y16_693078_c1_60_827 | 255 |
| 906 | 3300050511 | nmdc:mga08y16_93450_c1 | nmdc:mga08y16_93450_c1_1379_2158 | 255 |
| 907 | 3300050512 | nmdc:mga0n895_15640_c1 | nmdc:mga0n895_15640_c1_5379_6158 | 255 |
| 908 | 3300050512 | nmdc:mga0n895_268497_c1 | nmdc:mga0n895_268497_c1_611_1378 | 255 |
| 909 | 3300050512 | nmdc:mga0n895_562_c1 | nmdc:mga0n895_562_c1_15935_16714 | 255 |
| 910 | 3300050512 | nmdc:mga0n895_803338_c1 | nmdc:mga0n895_803338_c1_141_908 | 255 |
| 911 | 3300050513 | nmdc:mga0rr50_24709_c1 | nmdc:mga0rr50_24709_c1_2217_2996 | 255 |
| 912 | 3300050513 | nmdc:mga0rr50_35896_c1 | nmdc:mga0rr50_35896_c1_618_1385 | 255 |
| 913 | 3300050513 | nmdc:mga0rr50_9218_c1 | nmdc:mga0rr50_9218_c1_5019_5798 | 255 |
| 914 | 3300050514 | nmdc:mga08x19_215736_c1 | nmdc:mga08x19_215736_c1_467_1234 | 255 |
| 915 | 3300050515 | nmdc:mga0a205_1040_c1 | nmdc:mga0a205_1040_c1_16979_17758 | 255 |
| 916 | 3300050515 | nmdc:mga0a205_10488_c1 | nmdc:mga0a205_10488_c1_4016_4795 | 255 |
| 917 | 3300050515 | nmdc:mga0a205_214998_c1 | nmdc:mga0a205_214998_c1_503_1270 | 255 |
| 918 | 3300050515 | nmdc:mga0a205_32568_c1 | nmdc:mga0a205_32568_c1_1209_1976 | 255 |
| 919 | 3300053077 | Ga0495601_0001381 | Ga0495601_0001381_11692_12462 | 255 |
| 920 | 3300053077 | Ga0495601_0005715 | Ga0495601_0005715_1608_2378 | 255 |
| 921 | 3300053078 | Ga0495612_0001058 | Ga0495612_0001058_5662_6432 | 255 |
| 922 | 3300053078 | Ga0495612_0050948 | Ga0495612_0050948_399_1169 | 255 |
| 923 | 3300053084 | Ga0495595_0000762 | Ga0495595_0000762_6599_7369 | 255 |
| 924 | 3300053084 | Ga0495595_0010966 | Ga0495595_0010966_2528_3295 | 255 |
| 925 | 3300053084 | Ga0495595_0061228 | Ga0495595_0061228_674_1441 | 255 |
| 926 | 3300053085 | Ga0495619_0000271 | Ga0495619_0000271_21200_21967 | 255 |
| 927 | 3300053085 | Ga0495619_0002564 | Ga0495619_0002564_5553_6323 | 255 |
| 928 | 3300053085 | Ga0495619_0007587 | Ga0495619_0007587_5178_5945 | 255 |
| 929 | 3300053085 | Ga0495619_0019964 | Ga0495619_0019964_1133_1900 | 255 |
| 930 | 3300053085 | Ga0495619_0037127 | Ga0495619_0037127_429_1199 | 255 |
| 931 | 3300053085 | Ga0495619_0226106 | Ga0495619_0226106_54_821 | 255 |
| 932 | 3300053087 | Ga0500643_019657 | Ga0500643_019657_205_987 | 255 |
| 933 | 3300053088 | Ga0500644_0004254 | Ga0500644_0004254_857_1639 | 255 |
| 934 | 3300053093 | Ga0500651_0001961 | Ga0500651_0001961_9231_10013 | 255 |
| 935 | 3300053119 | Ga0500595_000062 | Ga0500595_000062_73963_74745 | 255 |
| 936 | 3300053131 | Ga0500652_005922 | Ga0500652_005922_2040_2822 | 255 |
| 937 | 3300053730 | Ga0500645_000282 | Ga0500645_000282_8284_9066 | 255 |
| 938 | 3300054114 | Ga0501084_0044968 | Ga0501084_0044968_1982_2749 | 255 |
| 939 | 3300060353 | Ga0501082_0002630 | Ga0501082_0002630_12830_13597 | 255 |
| 940 | 3300060353 | Ga0501082_0247390 | Ga0501082_0247390_521_1300 | 255 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2awo-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.9296 | 5 | 232 |
| 7cad-assembly1.cif.gz_D | mycobacterium smegmatis sugabc complex | 0.9156 | 5 | 232 |
| 7caf-assembly1.cif.gz_C | mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state | 0.9141 | 5 | 232 |
| 6b89-assembly1.cif.gz_A | e. coli lptb in complex with adp and novobiocin | 0.9124 | 5 | 243 |
| 4yer-assembly1.cif.gz_A | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.9068 | 1 | 232 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.931 | 1 | 228 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9288 | 5 | 227 | 3.40.50.300 |
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.927 | 1 | 228 | 3.40.50.300 |
| af_P0A9S7_4_254_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9196 | 4 | 245 | 3.40.50.300 |
| af_P31548_12_228_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9109 | 16 | 233 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M1RA33-F1-model_v4 | ABC transporter ATP-binding protein | 0.9784 | 5 | 244 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-U4Q7P7-F1-model_v4 | Branched-chain amino acid ABC transporter, ATP-binding component | 0.9782 | 2 | 244 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-F6FZX2-F1-model_v4 | Amino-acid ATP-binding ABC transporter protein | 0.972 | 3 | 248 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-N6TX83-F1-model_v4 | Putative ATP-binding protein component of ABC transporter | 0.9712 | 1 | 244 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A6H2H6E5-F1-model_v4 | Lipopolysaccharide export system ATP-binding protein LptB (EC 3.6.3.-) | 0.9669 | 3 | 244 |
GO:0005524
GO:0005886 GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar