F486262

General Info

Members Datasets Scaffolds Average Seq Length
938 315 938 205

Family's Representative Sequence

Representative Sequence 3300046675|Ga0495657_0193567|Ga0495657_0193567_65_751
Length 228
Sequence MQTEATLAQSDVSELDLVKRCQAGDTEAFDELVTRYRTRVFGMIYNMVHSEQDAWDLAQDSFLKAWKSIGRFRGQSSFYTWIYRIVMNVTIDWLRKKKIKGGDAEFDDAIQLREIDPASKTVPKTEALPHQAMERDEIRARIEKAISQLSPEHRAVILMKEIDDMQYHEIAEALECSIGTVMSRLFYARKKLQSLLRDVYENVRGKMDGVAGRPAWRARVIGIRSGAA

Samples

Sample ID Description Type Environment
1 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
2 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
98 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
126 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
129 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
131 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
202 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
203 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
204 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
206 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
207 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
208 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
209 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
210 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
211 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
212 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
213 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
214 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
215 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
217 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
220 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
221 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
229 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
230 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
231 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
232 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
233 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
234 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
235 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
236 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
237 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
238 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
239 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
240 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
241 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
242 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
243 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
244 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
245 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
246 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
249 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
250 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
251 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
252 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
253 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
254 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
255 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
256 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
257 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
258 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
259 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
260 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
261 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
262 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
263 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
264 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
265 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
266 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
267 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
268 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
269 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
270 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
271 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
272 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
273 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
274 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
275 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
276 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
277 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
278 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
279 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
280 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
281 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
282 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
300 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
301 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
302 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
303 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
306 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
307 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
308 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
309 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
310 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
311 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
312 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
313 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
314 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
315 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.03
Nodule 0
Rhizoplane 6.18
Rhizosphere 89.98
Stem 0
Stem Tuber 0
Unclassified 1.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000206 3300000545 Bacteria 8432
2 JGI24032J14994_101162 3300001430 Unclassified 1185
3 JGI24737J22298_10012645 3300001990 Bacteria 2751
4 JGI24744J21845_10012038 3300002077 Unclassified 1760
5 JGI24035J26624_1000141 3300002126 Bacteria 6413
6 JGI24035J26624_1007613 3300002126 Bacteria 1054
7 JGI24035J26624_1011137 3300002126 Bacteria 898
8 JGI25406J46586_10000087 3300003203 Bacteria 42198
9 JGI25406J46586_10095645 3300003203 Unclassified 891
10 JGI25404J52841_10004829 3300003659 Unclassified 2760
11 JGI25405J52794_10000412 3300003911 Bacteria 6018
12 JGI25405J52794_10002813 3300003911 Bacteria 3019
13 Ga0065714_10094929 3300005288 Bacteria 1801
14 Ga0065704_10004850 3300005289 Bacteria 3990
15 Ga0065704_10009573 3300005289 Bacteria 3061
16 Ga0065704_10022829 3300005289 Unclassified 1004
17 Ga0065704_10073950 3300005289 Bacteria 6644
18 Ga0065704_10091739 3300005289 Bacteria 2696
19 Ga0065712_10001692 3300005290 Bacteria 6372
20 Ga0065712_10004664 3300005290 Bacteria 5980
21 Ga0065712_10006386 3300005290 Bacteria 4869
22 Ga0065712_10016478 3300005290 Unclassified 1439
23 Ga0065712_10026337 3300005290 Unclassified 1166
24 Ga0065712_10116148 3300005290 Bacteria 1740
25 Ga0065712_10137998 3300005290 Unclassified 1478
26 Ga0065712_10205871 3300005290 Unclassified 1091
27 Ga0065712_10227849 3300005290 Bacteria 1020
28 Ga0065712_10266013 3300005290 Unclassified 923
29 Ga0065715_10000709 3300005293 Bacteria 10157
30 Ga0065715_10001727 3300005293 Bacteria 5692
31 Ga0065715_10089933 3300005293 Bacteria 8092
32 Ga0065715_10119901 3300005293 Unclassified 2274
33 Ga0065715_10167516 3300005293 Bacteria 1574
34 Ga0065715_10174334 3300005293 Unclassified 1523
35 Ga0065715_10255269 3300005293 Bacteria 1154
36 Ga0065715_10298847 3300005293 Unclassified 1017
37 Ga0065715_10327626 3300005293 Unclassified 976
38 Ga0065715_10368088 3300005293 Bacteria 913
39 Ga0065715_10369071 3300005293 Unclassified 924
40 Ga0065715_10426084 3300005293 Bacteria 852
41 Ga0065707_10003005 3300005295 Bacteria 4384
42 Ga0065707_10005953 3300005295 Unclassified 2700
43 Ga0065707_10013106 3300005295 Unclassified 2268
44 Ga0070658_10005882 3300005327 Bacteria 9948
45 Ga0070658_10136660 3300005327 Bacteria 2046
46 Ga0070658_10314682 3300005327 Unclassified 1336
47 Ga0070658_10598176 3300005327 Bacteria 956
48 Ga0070676_10007273 3300005328 Bacteria 5939
49 Ga0070676_10013117 3300005328 Bacteria 4539
50 Ga0070676_10025549 3300005328 Bacteria 3339
51 Ga0070676_10171591 3300005328 Bacteria 1403
52 Ga0070676_10392529 3300005328 Bacteria 964
53 Ga0070676_10875274 3300005328 Unclassified 668
54 Ga0070683_100006008 3300005329 Bacteria 10172
55 Ga0070683_100010449 3300005329 Bacteria 7982
56 Ga0070683_100114079 3300005329 Bacteria 2550
57 Ga0070683_100359518 3300005329 Unclassified 1387
58 Ga0070690_100027697 3300005330 Bacteria 3504
59 Ga0070690_100236802 3300005330 Bacteria 1286
60 Ga0070690_100582137 3300005330 Bacteria 847
61 Ga0070690_100637363 3300005330 Bacteria 812
62 Ga0070670_100014931 3300005331 Bacteria 6665
63 Ga0070670_100023992 3300005331 Bacteria 5247
64 Ga0070670_100052927 3300005331 Unclassified 3487
65 Ga0070670_100122580 3300005331 Bacteria 2242
66 Ga0070670_100547513 3300005331 Bacteria 1032
67 Ga0070677_10003178 3300005333 Bacteria 5284
68 Ga0070677_10118311 3300005333 Bacteria 1193
69 Ga0068869_100061991 3300005334 Bacteria 2744
70 Ga0070666_10009111 3300005335 Bacteria 6188
71 Ga0070666_10014419 3300005335 Bacteria 5032
72 Ga0070666_10063078 3300005335 Bacteria 2511
73 Ga0070666_10115524 3300005335 Bacteria 1858
74 Ga0070666_10156365 3300005335 Unclassified 1592
75 Ga0070680_100026698 3300005336 Bacteria 4619
76 Ga0070680_100558357 3300005336 Unclassified 981
77 Ga0070682_100075346 3300005337 Bacteria 2170
78 Ga0068868_100099890 3300005338 Bacteria 2348
79 Ga0068868_100109169 3300005338 Bacteria 2247
80 Ga0068868_100144993 3300005338 Bacteria 1952
81 Ga0070660_100083058 3300005339 Bacteria 2516
82 Ga0070660_100123059 3300005339 Bacteria 2071
83 Ga0070660_100138468 3300005339 Bacteria 1951
84 Ga0070660_100306739 3300005339 Unclassified 1302
85 Ga0070660_100436038 3300005339 Bacteria 1086
86 Ga0070689_100000978 3300005340 Bacteria 17870
87 Ga0070689_100075259 3300005340 Bacteria 2643
88 Ga0070689_100085949 3300005340 Bacteria 2473
89 Ga0070689_100128485 3300005340 Bacteria 2031
90 Ga0070691_10242126 3300005341 Bacteria 964
91 Ga0070687_100013691 3300005343 Bacteria 3622
92 Ga0070687_100027127 3300005343 Bacteria 2763
93 Ga0070661_100087820 3300005344 Bacteria 2301
94 Ga0070661_100211272 3300005344 Bacteria 1486
95 Ga0070661_100343187 3300005344 Unclassified 1170
96 Ga0070668_100007657 3300005347 Bacteria 8015
97 Ga0070668_100023570 3300005347 Bacteria 4656
98 Ga0070668_100051505 3300005347 Bacteria 3172
99 Ga0070668_100165243 3300005347 Bacteria 1798
100 Ga0070669_100002655 3300005353 Bacteria 12882
101 Ga0070669_100002855 3300005353 Bacteria 12482
102 Ga0070669_100078802 3300005353 Bacteria 2449
103 Ga0070669_100149960 3300005353 Bacteria 1804
104 Ga0070675_100003712 3300005354 Bacteria 11603
105 Ga0070675_100009595 3300005354 Bacteria 7533
106 Ga0070675_100012255 3300005354 Bacteria 6720
107 Ga0070675_100051731 3300005354 Bacteria 3376
108 Ga0070675_100063293 3300005354 Bacteria 3058
109 Ga0070675_100071895 3300005354 Bacteria 2871
110 Ga0070675_100092059 3300005354 Bacteria 2541
111 Ga0070675_100333325 3300005354 Bacteria 1342
112 Ga0070675_100380263 3300005354 Unclassified 1257
113 Ga0070675_100527999 3300005354 Bacteria 1065
114 Ga0070671_100022030 3300005355 Bacteria 5205
115 Ga0070671_100027480 3300005355 Bacteria 4683
116 Ga0070671_100095441 3300005355 Bacteria 2493
117 Ga0070671_100119176 3300005355 Bacteria 2220
118 Ga0070671_100159825 3300005355 Bacteria 1905
119 Ga0070671_100214880 3300005355 Bacteria 1631
120 Ga0070671_100416101 3300005355 Bacteria 1151
121 Ga0070671_100813306 3300005355 Bacteria 814
122 Ga0070674_100027776 3300005356 Bacteria 3711
123 Ga0070674_100033088 3300005356 Bacteria 3439
124 Ga0070674_100184196 3300005356 Unclassified 1602
125 Ga0070674_100935327 3300005356 Unclassified 757
126 Ga0070674_101058546 3300005356 Unclassified 714
127 Ga0070673_100000434 3300005364 Bacteria 22067
128 Ga0070673_100016374 3300005364 Bacteria 5240
129 Ga0070673_100022537 3300005364 Bacteria 4586
130 Ga0070673_100186455 3300005364 Unclassified 1779
131 Ga0070673_100294201 3300005364 Unclassified 1428
132 Ga0070688_100007537 3300005365 Bacteria 5872
133 Ga0070688_100021992 3300005365 Bacteria 3731
134 Ga0070688_100030150 3300005365 Bacteria 3253
135 Ga0070688_100076237 3300005365 Bacteria 2157
136 Ga0070688_100118777 3300005365 Bacteria 1768
137 Ga0070688_100184754 3300005365 Bacteria 1448
138 Ga0070688_100206680 3300005365 Bacteria 1376
139 Ga0070688_100249770 3300005365 Unclassified 1263
140 Ga0070688_100376408 3300005365 Bacteria 1045
141 Ga0070659_100000971 3300005366 Bacteria 21095
142 Ga0070659_100052792 3300005366 Bacteria 3198
143 Ga0070667_100006762 3300005367 Bacteria 9523
144 Ga0070667_100055129 3300005367 Bacteria 3357
145 Ga0070667_100108365 3300005367 Bacteria 2406
146 Ga0070667_100137433 3300005367 Bacteria 2137
147 Ga0070667_100247302 3300005367 Unclassified 1594
148 Ga0070667_100272922 3300005367 Unclassified 1517
149 Ga0070667_100664626 3300005367 Bacteria 962
150 Ga0070709_10217629 3300005434 Bacteria 1360
151 Ga0070709_10349913 3300005434 Bacteria 1091
152 Ga0070709_10410699 3300005434 Bacteria 1013
153 Ga0070714_100022318 3300005435 Bacteria 5190
154 Ga0070714_100050890 3300005435 Bacteria 3531
155 Ga0070714_100112238 3300005435 Bacteria 2415
156 Ga0070714_100561150 3300005435 Bacteria 1094
157 Ga0070714_100834323 3300005435 Unclassified 893
158 Ga0070713_100037190 3300005436 Bacteria 3935
159 Ga0070713_100115542 3300005436 Unclassified 2346
160 Ga0070713_100226852 3300005436 Bacteria 1696
161 Ga0070713_100258111 3300005436 Unclassified 1592
162 Ga0070713_100293681 3300005436 Bacteria 1494
163 Ga0070713_100560086 3300005436 Bacteria 1083
164 Ga0070710_10075475 3300005437 Bacteria 1954
165 Ga0070710_10082369 3300005437 Bacteria 1881
166 Ga0070710_10148035 3300005437 Unclassified 1446
167 Ga0070710_10234718 3300005437 Bacteria 1172
168 Ga0070710_10315938 3300005437 Unclassified 1024
169 Ga0070701_10153599 3300005438 Bacteria 1327
170 Ga0070711_100012799 3300005439 Bacteria 5254
171 Ga0070711_100020670 3300005439 Unclassified 4247
172 Ga0070711_100201434 3300005439 Unclassified 1536
173 Ga0070705_100128756 3300005440 Bacteria 1648
174 Ga0070705_100146728 3300005440 Bacteria 1560
175 Ga0070705_100196055 3300005440 Bacteria 1381
176 Ga0070705_100276395 3300005440 Unclassified 1192
177 Ga0070700_100039609 3300005441 Bacteria 2880
178 Ga0070694_100024137 3300005444 Bacteria 3922
179 Ga0070708_100012016 3300005445 Bacteria 7057
180 Ga0070708_100047427 3300005445 Bacteria 3795
181 Ga0070708_100072775 3300005445 Bacteria 3097
182 Ga0070708_100085529 3300005445 Bacteria 2862
183 Ga0070708_100090982 3300005445 Unclassified 2778
184 Ga0070708_100220325 3300005445 Unclassified 1779
185 Ga0070708_100242041 3300005445 Bacteria 1694
186 Ga0070708_100291344 3300005445 Bacteria 1537
187 Ga0070708_100966426 3300005445 Unclassified 799
188 Ga0070663_100007018 3300005455 Bacteria 6824
189 Ga0070663_100147391 3300005455 Bacteria 1802
190 Ga0070663_100502859 3300005455 Unclassified 1007
191 Ga0070678_100014316 3300005456 Bacteria 4999
192 Ga0070678_100096894 3300005456 Bacteria 2277
193 Ga0070678_100588886 3300005456 Unclassified 992
194 Ga0070662_100003832 3300005457 Bacteria 9417
195 Ga0070662_100043784 3300005457 Bacteria 3204
196 Ga0070662_100131592 3300005457 Bacteria 1930
197 Ga0070662_100146136 3300005457 Bacteria 1837
198 Ga0070662_100375863 3300005457 Unclassified 1169
199 Ga0070662_101040614 3300005457 Bacteria 701
200 Ga0068867_100032843 3300005459 Bacteria 3755
201 Ga0068867_100086414 3300005459 Bacteria 2373
202 Ga0068867_100109459 3300005459 Unclassified 2121
203 Ga0068867_100860567 3300005459 Bacteria 813
204 Ga0070685_10067747 3300005466 Unclassified 2106
205 Ga0070706_100000311 3300005467 Bacteria 59149
206 Ga0070706_100001900 3300005467 Bacteria 21581
207 Ga0070706_100004096 3300005467 Bacteria 14178
208 Ga0070706_100013504 3300005467 Bacteria 7554
209 Ga0070706_100014263 3300005467 Bacteria 7344
210 Ga0070706_100042062 3300005467 Bacteria 4220
211 Ga0070706_100083975 3300005467 Bacteria 2951
212 Ga0070706_100117340 3300005467 Bacteria 2479
213 Ga0070706_100132337 3300005467 Bacteria 2328
214 Ga0070706_100300489 3300005467 Unclassified 1498
215 Ga0070706_100513346 3300005467 Unclassified 1115
216 Ga0070706_100590980 3300005467 Unclassified 1032
217 Ga0070706_101010697 3300005467 Bacteria 767
218 Ga0070707_100022786 3300005468 Bacteria 5922
219 Ga0070707_100052961 3300005468 Bacteria 3891
220 Ga0070707_100062513 3300005468 Bacteria 3572
221 Ga0070707_100082066 3300005468 Unclassified 3113
222 Ga0070707_100126280 3300005468 Bacteria 2486
223 Ga0070707_100284961 3300005468 Unclassified 1605
224 Ga0070707_100329039 3300005468 Unclassified 1485
225 Ga0070707_100511374 3300005468 Bacteria 1163
226 Ga0070707_100597627 3300005468 Unclassified 1066
227 Ga0070698_100003506 3300005471 Bacteria 17260
228 Ga0070698_100025039 3300005471 Bacteria 6220
229 Ga0070698_100077092 3300005471 Unclassified 3334
230 Ga0070698_100083823 3300005471 Bacteria 3177
231 Ga0070698_100258988 3300005471 Unclassified 1672
232 Ga0070698_100263776 3300005471 Bacteria 1655
233 Ga0070699_100010688 3300005518 Bacteria 7945
234 Ga0070699_100036437 3300005518 Unclassified 4255
235 Ga0070699_100077573 3300005518 Bacteria 2892
236 Ga0070699_100135107 3300005518 Bacteria 2176
237 Ga0070679_100701639 3300005530 Bacteria 955
238 Ga0070684_100006663 3300005535 Bacteria 8952
239 Ga0070684_100041434 3300005535 Bacteria 3970
240 Ga0070684_100099186 3300005535 Unclassified 2599
241 Ga0070684_100268320 3300005535 Unclassified 1562
242 Ga0070684_100597902 3300005535 Bacteria 1025
243 Ga0070697_100002917 3300005536 Bacteria 13156
244 Ga0070697_100003353 3300005536 Bacteria 12307
245 Ga0070697_100012443 3300005536 Bacteria 6668
246 Ga0070697_100071365 3300005536 Bacteria 2848
247 Ga0070697_100074750 3300005536 Bacteria 2784
248 Ga0070697_100098708 3300005536 Bacteria 2423
249 Ga0070697_100126546 3300005536 Bacteria 2140
250 Ga0070697_100152290 3300005536 Bacteria 1949
251 Ga0070697_100242102 3300005536 Unclassified 1541
252 Ga0070697_100409997 3300005536 Bacteria 1177
253 Ga0070697_100642290 3300005536 Bacteria 934
254 Ga0068853_100000002 3300005539 Bacteria 485323
255 Ga0068853_100371264 3300005539 Unclassified 1334
256 Ga0070672_100006356 3300005543 Bacteria 7934
257 Ga0070672_100021583 3300005543 Bacteria 4715
258 Ga0070672_100189510 3300005543 Bacteria 1716
259 Ga0070672_100270691 3300005543 Unclassified 1434
260 Ga0070672_100544384 3300005543 Bacteria 1007
261 Ga0070696_100070536 3300005546 Bacteria 2458
262 Ga0070665_100033364 3300005548 Bacteria 5180
263 Ga0070665_100048215 3300005548 Bacteria 4277
264 Ga0070665_100094465 3300005548 Bacteria 2995
265 Ga0070665_100126059 3300005548 Bacteria 2563
266 Ga0070665_100539402 3300005548 Bacteria 1178
267 Ga0070704_100002924 3300005549 Bacteria 9704
268 Ga0070704_100074513 3300005549 Bacteria 2476
269 Ga0070704_100576357 3300005549 Bacteria 986
270 Ga0068855_100013156 3300005563 Bacteria 9980
271 Ga0068855_100281988 3300005563 Bacteria 1845
272 Ga0068854_100266766 3300005578 Bacteria 1373
273 Ga0068854_100541044 3300005578 Bacteria 986
274 Ga0068856_100096159 3300005614 Bacteria 2950
275 Ga0068856_100246292 3300005614 Bacteria 1802
276 Ga0068856_101426804 3300005614 Unclassified 707
277 Ga0068856_101546904 3300005614 Unclassified 677
278 Ga0070702_100086753 3300005615 Bacteria 1888
279 Ga0068859_100990974 3300005617 Bacteria 923
280 Ga0068859_101132319 3300005617 Unclassified 861
281 Ga0068864_100274762 3300005618 Bacteria 1571
282 Ga0068864_101170157 3300005618 Unclassified 767
283 Ga0068866_10112301 3300005718 Unclassified 1523
284 Ga0068863_100003600 3300005841 Bacteria 15293
285 Ga0068863_100180547 3300005841 Unclassified 2026
286 Ga0068863_100240893 3300005841 Bacteria 1746
287 Ga0068863_100536375 3300005841 Bacteria 1154
288 Ga0068858_100010197 3300005842 Bacteria 8917
289 Ga0068858_100068419 3300005842 Bacteria 3291
290 Ga0068858_100320271 3300005842 Bacteria 1482
291 Ga0068860_100000576 3300005843 Bacteria 44149
292 Ga0068860_100037757 3300005843 Bacteria 4622
293 Ga0068860_100111877 3300005843 Bacteria 2611
294 Ga0068860_100350199 3300005843 Unclassified 1453
295 Ga0068860_100400993 3300005843 Bacteria 1357
296 Ga0068860_100889964 3300005843 Bacteria 906
297 Ga0068862_100267237 3300005844 Bacteria 1563
298 Ga0081455_10001872 3300005937 Bacteria 25307
299 Ga0081455_10016935 3300005937 Bacteria 7007
300 Ga0081455_10044602 3300005937 Bacteria 3866
301 Ga0081455_10049102 3300005937 Unclassified 3640
302 Ga0081540_1000036 3300005983 Bacteria 140805
303 Ga0081540_1020870 3300005983 Bacteria 3923
304 Ga0081540_1034481 3300005983 Bacteria 2728
305 Ga0081539_10000671 3300005985 Bacteria 68678
306 Ga0081539_10001132 3300005985 Bacteria 48398
307 Ga0081539_10040243 3300005985 Bacteria 2746
308 Ga0081539_10175139 3300005985 Unclassified 1011
309 Ga0070717_10091589 3300006028 Bacteria 2567
310 Ga0070717_10093046 3300006028 Unclassified 2547
311 Ga0070717_10119455 3300006028 Bacteria 2256
312 Ga0070717_10143413 3300006028 Bacteria 2061
313 Ga0070717_10171272 3300006028 Bacteria 1888
314 Ga0070717_10183786 3300006028 Bacteria 1823
315 Ga0070717_10216627 3300006028 Unclassified 1682
316 Ga0075363_100028247 3300006048 Bacteria 2883
317 Ga0070715_10047133 3300006163 Bacteria 1835
318 Ga0070715_10052209 3300006163 Bacteria 1762
319 Ga0070716_100016121 3300006173 Unclassified 3852
320 Ga0070716_100071096 3300006173 Bacteria 2045
321 Ga0070716_100187760 3300006173 Bacteria 1363
322 Ga0070716_100326689 3300006173 Bacteria 1077
323 Ga0070716_100356862 3300006173 Unclassified 1037
324 Ga0070716_100496278 3300006173 Unclassified 899
325 Ga0070712_100103548 3300006175 Bacteria 2110
326 Ga0070712_100103973 3300006175 Unclassified 2106
327 Ga0070712_100122575 3300006175 Bacteria 1958
328 Ga0070712_100217983 3300006175 Bacteria 1509
329 Ga0070712_100302264 3300006175 Bacteria 1295
330 Ga0070712_100350858 3300006175 Unclassified 1207
331 Ga0070712_100382815 3300006175 Unclassified 1158
332 Ga0070712_100432168 3300006175 Bacteria 1093
333 Ga0070712_100537545 3300006175 Bacteria 984
334 Ga0070712_101037270 3300006175 Bacteria 710
335 Ga0075362_10000662 3300006177 Bacteria 10150
336 Ga0075362_10018163 3300006177 Unclassified 2906
337 Ga0075369_10062924 3300006186 Bacteria 1622
338 Ga0097621_100014680 3300006237 Bacteria 5869
339 Ga0097621_100035139 3300006237 Bacteria 4003
340 Ga0097621_100097958 3300006237 Bacteria 2463
341 Ga0097621_100257754 3300006237 Bacteria 1529
342 Ga0097621_100713517 3300006237 Unclassified 924
343 Ga0075370_10004090 3300006353 Bacteria 7022
344 Ga0068871_100012306 3300006358 Bacteria 6304
345 Ga0068871_100035252 3300006358 Bacteria 3974
346 Ga0068871_100097947 3300006358 Unclassified 2453
347 Ga0075428_100210081 3300006844 Unclassified 2103
348 Ga0075433_10296210 3300006852 Bacteria 1432
349 Ga0075433_10390907 3300006852 Unclassified 1227
350 Ga0075434_100698607 3300006871 Unclassified 1032
351 Ga0075434_100839157 3300006871 Bacteria 935
352 Ga0075434_100933005 3300006871 Unclassified 883
353 Ga0068865_100020657 3300006881 Bacteria 4273
354 Ga0068865_100063909 3300006881 Unclassified 2589
355 Ga0075436_100115767 3300006914 Unclassified 1873
356 Ga0075436_100464806 3300006914 Unclassified 922
357 Ga0097620_100990952 3300006931 Bacteria 923
358 Ga0097620_101132438 3300006931 Unclassified 861
359 Ga0075435_100261554 3300007076 Bacteria 1474
360 Ga0075435_100334131 3300007076 Unclassified 1298
361 Ga0099794_10060393 3300007265 Bacteria 1841
362 Ga0099795_10003178 3300007788 Bacteria 4031
363 Ga0099795_10041176 3300007788 Bacteria 1644
364 Ga0099795_10075838 3300007788 Bacteria 1277
365 Ga0099795_10199188 3300007788 Unclassified 844
366 Ga0105240_10000412 3300009093 Bacteria 79783
367 Ga0105240_10401552 3300009093 Unclassified 1543
368 Ga0111539_10172555 3300009094 Bacteria 2526
369 Ga0111539_10249144 3300009094 Bacteria 2068
370 Ga0111539_10796145 3300009094 Unclassified 1100
371 Ga0105245_10026583 3300009098 Bacteria 5096
372 Ga0105245_10283623 3300009098 Unclassified 1620
373 Ga0105245_10568739 3300009098 Unclassified 1157
374 Ga0105247_10191930 3300009101 Unclassified 1368
375 Ga0114129_10007418 3300009147 Bacteria 15610
376 Ga0114129_10162066 3300009147 Bacteria 3054
377 Ga0114129_10244078 3300009147 Bacteria 2413
378 Ga0114129_10598948 3300009147 Unclassified 1428
379 Ga0105243_10047154 3300009148 Bacteria 3391
380 Ga0105241_10118065 3300009174 Bacteria 2132
381 Ga0105241_10341507 3300009174 Unclassified 1297
382 Ga0105241_10688375 3300009174 Unclassified 932
383 Ga0105242_10086583 3300009176 Bacteria 2629
384 Ga0105242_11341877 3300009176 Bacteria 740
385 Ga0105237_10006408 3300009545 Bacteria 13060
386 Ga0105237_10215473 3300009545 Bacteria 1920
387 Ga0105237_10387062 3300009545 Bacteria 1403
388 Ga0105237_10580387 3300009545 Bacteria 1128
389 Ga0105249_10074161 3300009553 Bacteria 3149
390 Ga0099796_10029945 3300010159 Bacteria 1761
391 Ga0099796_10239664 3300010159 Bacteria 749
392 Ga0105239_10086420 3300010375 Bacteria 3457
393 Ga0105239_10134580 3300010375 Bacteria 2751
394 Ga0105239_10135294 3300010375 Bacteria 2743
395 Ga0105239_10155992 3300010375 Bacteria 2549
396 Ga0105239_10217548 3300010375 Bacteria 2142
397 Ga0105239_11156063 3300010375 Bacteria 891
398 Ga0157371_10227161 3300013102 Bacteria 1341
399 Ga0157370_10516754 3300013104 Bacteria 1096
400 Ga0157369_10441889 3300013105 Bacteria 1347
401 Ga0157369_10644028 3300013105 Bacteria 1093
402 Ga0157374_10000160 3300013296 Bacteria 62026
403 Ga0157374_10016198 3300013296 Bacteria 6549
404 Ga0157374_10033371 3300013296 Bacteria 4696
405 Ga0157374_10083550 3300013296 Unclassified 3034
406 Ga0157374_10111000 3300013296 Bacteria 2637
407 Ga0157374_10230839 3300013296 Bacteria 1818
408 Ga0157374_10267638 3300013296 Bacteria 1685
409 Ga0157374_10600091 3300013296 Unclassified 1111
410 Ga0157374_11118901 3300013296 Bacteria 808
411 Ga0157374_11437729 3300013296 Unclassified 712
412 Ga0157378_10006750 3300013297 Bacteria 10028
413 Ga0157378_10023174 3300013297 Bacteria 5464
414 Ga0157378_10033296 3300013297 Unclassified 4555
415 Ga0157378_10077204 3300013297 Bacteria 3002
416 Ga0157378_10097175 3300013297 Bacteria 2684
417 Ga0157378_10108165 3300013297 Unclassified 2545
418 Ga0157378_10202123 3300013297 Bacteria 1880
419 Ga0157378_10231751 3300013297 Unclassified 1760
420 Ga0157378_10231898 3300013297 Bacteria 1760
421 Ga0157378_10567103 3300013297 Unclassified 1143
422 Ga0157378_10616943 3300013297 Bacteria 1097
423 Ga0157378_10689553 3300013297 Unclassified 1040
424 Ga0157378_10991161 3300013297 Bacteria 874
425 Ga0163162_10008629 3300013306 Bacteria 9930
426 Ga0163162_10013145 3300013306 Bacteria 8083
427 Ga0163162_10021558 3300013306 Bacteria 6346
428 Ga0163162_10021637 3300013306 Bacteria 6334
429 Ga0163162_10043308 3300013306 Bacteria 4507
430 Ga0163162_10057606 3300013306 Bacteria 3914
431 Ga0163162_10074321 3300013306 Bacteria 3457
432 Ga0163162_10224840 3300013306 Bacteria 2006
433 Ga0163162_10351894 3300013306 Unclassified 1606
434 Ga0157372_10414364 3300013307 Bacteria 1570
435 Ga0157372_10429439 3300013307 Bacteria 1540
436 Ga0157372_11358471 3300013307 Bacteria 819
437 Ga0157375_10002485 3300013308 Bacteria 15970
438 Ga0157375_10011674 3300013308 Bacteria 7761
439 Ga0157375_10052405 3300013308 Bacteria 4011
440 Ga0157375_10063296 3300013308 Bacteria 3679
441 Ga0157375_10115628 3300013308 Bacteria 2786
442 Ga0157375_11130186 3300013308 Bacteria 918
443 Ga0157375_11380639 3300013308 Bacteria 830
444 Ga0157375_11598394 3300013308 Unclassified 771
445 Ga0163163_10119296 3300014325 Unclassified 2671
446 Ga0163163_10141245 3300014325 Bacteria 2450
447 Ga0163163_10269781 3300014325 Bacteria 1753
448 Ga0163163_10273312 3300014325 Bacteria 1741
449 Ga0157377_10048614 3300014745 Bacteria 2381
450 Ga0157379_10343869 3300014968 Bacteria 1365
451 Ga0157376_10018271 3300014969 Bacteria 5370
452 Ga0157376_10081124 3300014969 Unclassified 2784
453 Ga0157376_10091651 3300014969 Bacteria 2633
454 Ga0157376_10135143 3300014969 Bacteria 2206
455 Ga0157376_10508681 3300014969 Bacteria 1185
456 Ga0157376_10584334 3300014969 Unclassified 1110
457 Ga0163161_10005833 3300017792 Bacteria 8533
458 Ga0163161_10119730 3300017792 Unclassified 1977
459 Ga0163161_10203079 3300017792 Unclassified 1528
460 Ga0163161_10529095 3300017792 Bacteria 964
461 Ga0206350_11555172 3300020080 Unclassified 929
462 Ga0213873_10081446 3300021358 Unclassified 907
463 Ga0213872_10002738 3300021361 Bacteria 10119
464 Ga0213872_10016657 3300021361 Bacteria 3409
465 Ga0213872_10095450 3300021361 Bacteria 1328
466 Ga0213876_10000779 3300021384 Bacteria 21764
467 Ga0213876_10044348 3300021384 Bacteria 2350
468 Ga0213876_10055287 3300021384 Unclassified 2096
469 Ga0213871_10055446 3300021441 Unclassified 1095
470 Ga0207666_1001627 3300025271 Unclassified 2662
471 Ga0207666_1003597 3300025271 Bacteria 1909
472 Ga0207666_1005596 3300025271 Bacteria 1609
473 Ga0207673_1004302 3300025290 Bacteria 1697
474 Ga0209050_1006977 3300025298 Bacteria 6505
475 Ga0207697_10000116 3300025315 Bacteria 37551
476 Ga0207697_10000348 3300025315 Bacteria 25805
477 Ga0207697_10001294 3300025315 Bacteria 13739
478 Ga0207697_10001541 3300025315 Bacteria 12483
479 Ga0207697_10002095 3300025315 Bacteria 10492
480 Ga0207697_10012438 3300025315 Bacteria 3567
481 Ga0207697_10025316 3300025315 Unclassified 2426
482 Ga0207653_10026242 3300025885 Bacteria 1867
483 Ga0207682_10044496 3300025893 Bacteria 1820
484 Ga0207692_10035612 3300025898 Bacteria 2419
485 Ga0207692_10118584 3300025898 Bacteria 1478
486 Ga0207692_10165832 3300025898 Unclassified 1276
487 Ga0207692_10374500 3300025898 Unclassified 882
488 Ga0207642_10296466 3300025899 Unclassified 936
489 Ga0207688_10006712 3300025901 Bacteria 6262
490 Ga0207688_10016999 3300025901 Bacteria 3952
491 Ga0207688_10028348 3300025901 Bacteria 3080
492 Ga0207688_10091145 3300025901 Bacteria 1751
493 Ga0207680_10006888 3300025903 Bacteria 5512
494 Ga0207680_10070344 3300025903 Unclassified 2165
495 Ga0207680_10640881 3300025903 Unclassified 760
496 Ga0207647_10004861 3300025904 Bacteria 9931
497 Ga0207685_10022911 3300025905 Bacteria 2118
498 Ga0207699_10023294 3300025906 Bacteria 3368
499 Ga0207645_10001573 3300025907 Bacteria 18629
500 Ga0207645_10004457 3300025907 Bacteria 10365
501 Ga0207645_10006861 3300025907 Bacteria 8125
502 Ga0207645_10036418 3300025907 Bacteria 3159
503 Ga0207645_10175933 3300025907 Bacteria 1403
504 Ga0207645_10178030 3300025907 Bacteria 1395
505 Ga0207643_10194845 3300025908 Unclassified 1231
506 Ga0207643_10476174 3300025908 Bacteria 796
507 Ga0207705_10075617 3300025909 Bacteria 2446
508 Ga0207684_10000337 3300025910 Bacteria 65590
509 Ga0207684_10004700 3300025910 Bacteria 12810
510 Ga0207684_10011043 3300025910 Bacteria 7911
511 Ga0207684_10024895 3300025910 Bacteria 5100
512 Ga0207684_10075011 3300025910 Unclassified 2874
513 Ga0207684_10102137 3300025910 Unclassified 2451
514 Ga0207684_10104691 3300025910 Unclassified 2420
515 Ga0207684_10107589 3300025910 Bacteria 2386
516 Ga0207684_10111774 3300025910 Bacteria 2338
517 Ga0207684_10149719 3300025910 Bacteria 2008
518 Ga0207684_10194513 3300025910 Bacteria 1749
519 Ga0207684_10440190 3300025910 Unclassified 1119
520 Ga0207684_10509917 3300025910 Unclassified 1031
521 Ga0207684_10755332 3300025910 Unclassified 824
522 Ga0207654_10196502 3300025911 Bacteria 1325
523 Ga0207707_10066916 3300025912 Bacteria 3129
524 Ga0207695_10000783 3300025913 Bacteria 60141
525 Ga0207671_10020513 3300025914 Bacteria 5029
526 Ga0207671_10669159 3300025914 Bacteria 826
527 Ga0207693_10008693 3300025915 Bacteria 8305
528 Ga0207693_10015810 3300025915 Bacteria 6046
529 Ga0207693_10035674 3300025915 Bacteria 3921
530 Ga0207693_10038294 3300025915 Bacteria 3777
531 Ga0207693_10063349 3300025915 Bacteria 2896
532 Ga0207693_10084225 3300025915 Unclassified 2491
533 Ga0207693_10094418 3300025915 Bacteria 2344
534 Ga0207693_10213180 3300025915 Bacteria 1518
535 Ga0207693_10241245 3300025915 Bacteria 1419
536 Ga0207693_10382709 3300025915 Bacteria 1100
537 Ga0207693_10659598 3300025915 Bacteria 812
538 Ga0207663_10029098 3300025916 Bacteria 3240
539 Ga0207663_10031762 3300025916 Bacteria 3128
540 Ga0207663_10055206 3300025916 Bacteria 2491
541 Ga0207663_10177341 3300025916 Bacteria 1519
542 Ga0207663_10375080 3300025916 Unclassified 1082
543 Ga0207663_10743878 3300025916 Bacteria 778
544 Ga0207660_10022146 3300025917 Bacteria 4280
545 Ga0207660_10211559 3300025917 Bacteria 1519
546 Ga0207662_10042413 3300025918 Bacteria 2682
547 Ga0207662_10047832 3300025918 Bacteria 2533
548 Ga0207662_10298144 3300025918 Bacteria 1071
549 Ga0207657_10100597 3300025919 Bacteria 2400
550 Ga0207657_10204362 3300025919 Unclassified 1588
551 Ga0207657_10308443 3300025919 Bacteria 1253
552 Ga0207657_10417350 3300025919 Unclassified 1055
553 Ga0207649_10042935 3300025920 Bacteria 2761
554 Ga0207649_10249863 3300025920 Unclassified 1277
555 Ga0207652_10068891 3300025921 Unclassified 3071
556 Ga0207646_10004682 3300025922 Bacteria 14739
557 Ga0207646_10008619 3300025922 Bacteria 10191
558 Ga0207646_10053741 3300025922 Bacteria 3603
559 Ga0207646_10060600 3300025922 Bacteria 3379
560 Ga0207646_10066819 3300025922 Bacteria 3210
561 Ga0207646_10074837 3300025922 Unclassified 3025
562 Ga0207646_10113228 3300025922 Bacteria 2435
563 Ga0207646_10183571 3300025922 Unclassified 1889
564 Ga0207646_10191083 3300025922 Bacteria 1849
565 Ga0207646_10208566 3300025922 Bacteria 1764
566 Ga0207646_10258704 3300025922 Unclassified 1573
567 Ga0207646_10334473 3300025922 Bacteria 1368
568 Ga0207681_10008466 3300025923 Bacteria 6286
569 Ga0207681_10027254 3300025923 Bacteria 3693
570 Ga0207681_10038451 3300025923 Bacteria 3170
571 Ga0207681_10048813 3300025923 Bacteria 2858
572 Ga0207681_10057878 3300025923 Bacteria 2651
573 Ga0207681_10466460 3300025923 Unclassified 1029
574 Ga0207650_10045346 3300025925 Bacteria 3234
575 Ga0207650_10073429 3300025925 Bacteria 2576
576 Ga0207650_10154225 3300025925 Bacteria 1815
577 Ga0207650_10469961 3300025925 Bacteria 1048
578 Ga0207650_10576425 3300025925 Bacteria 945
579 Ga0207659_10003753 3300025926 Bacteria 9156
580 Ga0207659_10011396 3300025926 Bacteria 5615
581 Ga0207659_10028169 3300025926 Bacteria 3815
582 Ga0207659_10166408 3300025926 Unclassified 1736
583 Ga0207659_10224742 3300025926 Bacteria 1511
584 Ga0207659_10372495 3300025926 Bacteria 1189
585 Ga0207659_11132218 3300025926 Unclassified 673
586 Ga0207687_10242269 3300025927 Bacteria 1430
587 Ga0207687_10483870 3300025927 Unclassified 1031
588 Ga0207687_10756201 3300025927 Bacteria 827
589 Ga0207700_10039447 3300025928 Unclassified 3438
590 Ga0207700_10546316 3300025928 Bacteria 1028
591 Ga0207700_11091293 3300025928 Unclassified 714
592 Ga0207664_10085388 3300025929 Bacteria 2576
593 Ga0207664_10121339 3300025929 Bacteria 2187
594 Ga0207644_10009749 3300025931 Bacteria 6314
595 Ga0207644_10039292 3300025931 Bacteria 3340
596 Ga0207644_10159115 3300025931 Bacteria 1754
597 Ga0207644_10463191 3300025931 Unclassified 1042
598 Ga0207644_10504218 3300025931 Unclassified 998
599 Ga0207690_10001481 3300025932 Bacteria 14676
600 Ga0207690_10025115 3300025932 Bacteria 3737
601 Ga0207706_10008614 3300025933 Bacteria 9399
602 Ga0207706_10049321 3300025933 Bacteria 3721
603 Ga0207706_10091217 3300025933 Bacteria 2679
604 Ga0207686_10144712 3300025934 Bacteria 1647
605 Ga0207670_10003100 3300025936 Bacteria 8793
606 Ga0207670_10047628 3300025936 Bacteria 2857
607 Ga0207670_10097423 3300025936 Bacteria 2094
608 Ga0207670_10128534 3300025936 Bacteria 1852
609 Ga0207670_10150698 3300025936 Bacteria 1725
610 Ga0207669_10003408 3300025937 Bacteria 6875
611 Ga0207669_10010427 3300025937 Bacteria 4473
612 Ga0207669_10102661 3300025937 Unclassified 1895
613 Ga0207669_10151515 3300025937 Unclassified 1625
614 Ga0207669_10281672 3300025937 Bacteria 1254
615 Ga0207669_10334333 3300025937 Unclassified 1164
616 Ga0207704_10022744 3300025938 Unclassified 3365
617 Ga0207704_10118581 3300025938 Bacteria 1805
618 Ga0207704_10211105 3300025938 Unclassified 1429
619 Ga0207665_10011275 3300025939 Bacteria 5866
620 Ga0207665_10026896 3300025939 Unclassified 3800
621 Ga0207665_10035745 3300025939 Bacteria 3300
622 Ga0207665_10050971 3300025939 Bacteria 2785
623 Ga0207665_10064244 3300025939 Bacteria 2494
624 Ga0207665_10079786 3300025939 Bacteria 2250
625 Ga0207665_10117148 3300025939 Bacteria 1878
626 Ga0207691_10000945 3300025940 Bacteria 28782
627 Ga0207691_10001082 3300025940 Bacteria 27131
628 Ga0207691_10032280 3300025940 Bacteria 4883
629 Ga0207691_10227062 3300025940 Bacteria 1617
630 Ga0207711_10418830 3300025941 Bacteria 1246
631 Ga0207689_10064409 3300025942 Bacteria 3016
632 Ga0207689_10284739 3300025942 Bacteria 1369
633 Ga0207661_10007132 3300025944 Bacteria 7940
634 Ga0207661_10026830 3300025944 Unclassified 4394
635 Ga0207661_10383409 3300025944 Bacteria 1272
636 Ga0207661_10394984 3300025944 Bacteria 1253
637 Ga0207679_10308419 3300025945 Bacteria 1367
638 Ga0207679_10612049 3300025945 Bacteria 982
639 Ga0207679_11140952 3300025945 Unclassified 715
640 Ga0207667_10024015 3300025949 Bacteria 6705
641 Ga0207667_10425115 3300025949 Bacteria 1351
642 Ga0207667_10535635 3300025949 Bacteria 1185
643 Ga0207651_10020043 3300025960 Bacteria 4025
644 Ga0207651_10028201 3300025960 Bacteria 3538
645 Ga0207651_10277099 3300025960 Unclassified 1384
646 Ga0207651_10389769 3300025960 Bacteria 1183
647 Ga0207651_10775826 3300025960 Bacteria 848
648 Ga0207712_10012291 3300025961 Bacteria 5471
649 Ga0207712_10040060 3300025961 Bacteria 3213
650 Ga0207668_10011932 3300025972 Bacteria 5301
651 Ga0207668_10056103 3300025972 Bacteria 2742
652 Ga0207668_10057537 3300025972 Unclassified 2713
653 Ga0207668_10133557 3300025972 Unclassified 1898
654 Ga0207668_10186846 3300025972 Bacteria 1639
655 Ga0207668_10321354 3300025972 Bacteria 1284
656 Ga0207668_10583611 3300025972 Bacteria 972
657 Ga0207668_10937950 3300025972 Bacteria 771
658 Ga0207658_10004701 3300025986 Bacteria 9459
659 Ga0207658_10022282 3300025986 Bacteria 4409
660 Ga0207658_10067376 3300025986 Bacteria 2696
661 Ga0207658_10108410 3300025986 Bacteria 2190
662 Ga0207658_10136796 3300025986 Bacteria 1977
663 Ga0207658_10208729 3300025986 Unclassified 1635
664 Ga0207658_10241487 3300025986 Unclassified 1530
665 Ga0207658_10412705 3300025986 Bacteria 1189
666 Ga0207677_10018031 3300026023 Bacteria 4228
667 Ga0207677_10133745 3300026023 Unclassified 1887
668 Ga0207677_10218686 3300026023 Bacteria 1526
669 Ga0207677_10445762 3300026023 Bacteria 1108
670 Ga0207677_10902842 3300026023 Unclassified 796
671 Ga0207703_10009368 3300026035 Bacteria 7696
672 Ga0207703_10015594 3300026035 Bacteria 5927
673 Ga0207703_10200678 3300026035 Bacteria 1772
674 Ga0207639_10000009 3300026041 Bacteria 432727
675 Ga0207678_10001585 3300026067 Bacteria 20917
676 Ga0207708_10038619 3300026075 Bacteria 3637
677 Ga0207702_10210848 3300026078 Bacteria 1806
678 Ga0207702_10777103 3300026078 Bacteria 946
679 Ga0207641_10012427 3300026088 Bacteria 6981
680 Ga0207641_10064327 3300026088 Bacteria 3135
681 Ga0207641_10084465 3300026088 Bacteria 2764
682 Ga0207641_11067914 3300026088 Unclassified 805
683 Ga0207648_10024504 3300026089 Bacteria 5385
684 Ga0207648_10094602 3300026089 Bacteria 2613
685 Ga0207648_10122198 3300026089 Bacteria 2290
686 Ga0207648_10131773 3300026089 Bacteria 2200
687 Ga0207648_10791194 3300026089 Unclassified 882
688 Ga0207676_10582979 3300026095 Bacteria 1072
689 Ga0207675_100154766 3300026118 Bacteria 2184
690 Ga0207683_10017209 3300026121 Bacteria 6157
691 Ga0207683_10032547 3300026121 Bacteria 4529
692 Ga0207683_10086586 3300026121 Bacteria 2785
693 Ga0207683_10206441 3300026121 Bacteria 1787
694 Ga0207683_10235777 3300026121 Bacteria 1669
695 Ga0207698_10719248 3300026142 Bacteria 995
696 Ga0209179_1021633 3300027512 Bacteria 1256
697 Ga0209971_1085204 3300027682 Unclassified 770
698 Ga0209998_10023187 3300027717 Unclassified 1341
699 Ga0209974_10009094 3300027876 Bacteria 3377
700 Ga0209974_10014068 3300027876 Unclassified 2666
701 Ga0209974_10036286 3300027876 Unclassified 1637
702 Ga0268266_10008218 3300028379 Bacteria 9302
703 Ga0268266_10012253 3300028379 Bacteria 7418
704 Ga0268266_10141314 3300028379 Bacteria 2161
705 Ga0268266_10188497 3300028379 Bacteria 1882
706 Ga0268266_10331437 3300028379 Bacteria 1426
707 Ga0268265_10303422 3300028380 Bacteria 1439
708 Ga0268265_10536243 3300028380 Bacteria 1109
709 Ga0268265_10654136 3300028380 Unclassified 1010
710 Ga0268264_10001424 3300028381 Bacteria 22372
711 Ga0268264_10016515 3300028381 Bacteria 6044
712 Ga0268264_10324411 3300028381 Unclassified 1457
713 Ga0307513_10052043 3300031456 Unclassified 4412
714 Ga0307414_10133466 3300032004 Bacteria 1931
715 Ga0373929_0024211 3300035085 Unclassified 1253
716 Ga0373923_0126460 3300035111 Unclassified 1146
717 Ga0373923_0266310 3300035111 Unclassified 805
718 Ga0373945_0020838 3300035116 Bacteria 2248
719 Ga0373953_0336164 3300035117 Unclassified 661
720 Ga0373954_0262604 3300035118 Bacteria 850
721 Ga0373956_0091350 3300035119 Bacteria 1405
722 Ga0373957_0230837 3300035120 Bacteria 776
723 Ga0373943_0033870 3300035170 Bacteria 2435
724 Ga0373943_0101304 3300035170 Bacteria 1507
725 Ga0373946_0040914 3300035171 Bacteria 1899
726 Ga0373946_0064944 3300035171 Bacteria 1562
727 Ga0373946_0254646 3300035171 Bacteria 857
728 Ga0373955_0055517 3300035172 Bacteria 2170
729 Ga0373942_0139937 3300035207 Unclassified 770
730 Ga0373962_0058122 3300035242 Unclassified 1130
731 Ga0373924_0084042 3300035410 Bacteria 1357
732 Ga0373924_0109499 3300035410 Unclassified 1193
733 Ga0373931_0015102 3300035691 Bacteria 3785
734 Ga0373931_0043088 3300035691 Unclassified 2375
735 Ga0373931_0130682 3300035691 Unclassified 1445
736 Ga0373931_0667840 3300035691 Bacteria 684
737 Ga0373935_0091805 3300035692 Bacteria 1989
738 Ga0373935_0173486 3300035692 Bacteria 1476
739 Ga0373935_0256526 3300035692 Bacteria 1225
740 Ga0373927_0076041 3300035695 Bacteria 2175
741 Ga0373927_0100471 3300035695 Bacteria 1881
742 Ga0373927_0117968 3300035695 Bacteria 1731
743 Ga0373927_0180641 3300035695 Unclassified 1384
744 Ga0373927_0246803 3300035695 Bacteria 1174
745 Ga0373933_0082536 3300035724 Unclassified 1973
746 Ga0373933_0124804 3300035724 Unclassified 1615
747 Ga0373947_0143887 3300035725 Unclassified 1531
748 Ga0373947_0169472 3300035725 Bacteria 1416
749 Ga0373937_0114240 3300036401 Bacteria 2513
750 Ga0373937_0423624 3300036401 Bacteria 1263
751 Ga0373937_0502707 3300036401 Unclassified 1152
752 Ga0373925_0010936 3300037068 Bacteria 6588
753 Ga0373925_0173166 3300037068 Bacteria 1705
754 Ga0395899_0202269 3300037312 Bacteria 1384
755 Ga0395899_0207320 3300037312 Unclassified 1364
756 Ga0395900_0090143 3300037418 Bacteria 3152
757 Ga0395900_0124762 3300037418 Bacteria 2641
758 Ga0395898_0032973 3300037466 Bacteria 5170
759 Ga0395898_0426733 3300037466 Unclassified 1263
760 Ga0436364_0573940 3300037853 Bacteria 1251
761 Ga0436364_1204737 3300037853 Unclassified 1153
762 Ga0436364_1459403 3300037853 Bacteria 1703
763 Ga0395901_0001548 3300038443 Bacteria 23830
764 Ga0395901_0003735 3300038443 Bacteria 15340
765 Ga0395901_0378666 3300038443 Bacteria 1457
766 Ga0395901_0501158 3300038443 Unclassified 1236
767 Ga0395901_0724371 3300038443 Bacteria 990
768 Ga0395901_1135387 3300038443 Bacteria 750
769 Ga0436365_0379833 3300039437 Bacteria 8140
770 Ga0436365_0530931 3300039437 Bacteria 35243
771 Ga0436365_0659259 3300039437 Unclassified 3531
772 Ga0436365_0960797 3300039437 Bacteria 5182
773 Ga0436365_1112867 3300039437 Bacteria 50005
774 Ga0436365_1117644 3300039437 Bacteria 5030
775 Ga0436360_0155647 3300039438 Bacteria 2151
776 Ga0436360_1341574 3300039438 Bacteria 2674
777 Ga0436361_0589004 3300039447 Bacteria 3064
778 Ga0436361_0591984 3300039447 Bacteria 1659
779 Ga0436361_0627296 3300039447 Unclassified 1186
780 Ga0436361_0756631 3300039447 Bacteria 4682
781 Ga0436361_0765849 3300039447 Bacteria 3663
782 Ga0436363_1091559 3300039450 Bacteria 2915
783 Ga0436362_0090010 3300039453 Unclassified 897
784 Ga0436362_1255536 3300039453 Unclassified 2543
785 Ga0451798_1030054 3300041458 Bacteria 853
786 Ga0451807_1769662 3300041486 Bacteria 873
787 Ga0451839_1404823 3300041496 Unclassified 1219
788 Ga0451853_0577735 3300041512 Bacteria 2215
789 Ga0451853_4098400 3300041512 Unclassified 900
790 Ga0439448_0018515 3300042005 Bacteria 2136
791 Ga0439450_075403 3300042008 Bacteria 833
792 Ga0439451_040672 3300042009 Bacteria 933
793 Ga0439455_0000520 3300042012 Bacteria 5374
794 Ga0439455_0015615 3300042012 Bacteria 1747
795 Ga0439458_0014766 3300042157 Unclassified 1765
796 Ga0439464_0017248 3300042439 Unclassified 1957
797 Ga0466959_0483443 3300045049 Unclassified 838
798 Ga0451576_0279364 3300045051 Unclassified 1746
799 Ga0466967_0563433 3300045976 Bacteria 1122
800 Ga0466967_0870977 3300045976 Unclassified 895
801 Ga0495592_0221815 3300046454 Bacteria 1263
802 Ga0495651_0014117 3300046462 Bacteria 6176
803 Ga0495580_0250338 3300046472 Bacteria 1213
804 Ga0495605_0090490 3300046474 Unclassified 1419
805 Ga0495662_0272770 3300046476 Bacteria 833
806 Ga0495584_0108807 3300046491 Bacteria 1402
807 Ga0495584_0161081 3300046491 Unclassified 1140
808 Ga0495584_0303464 3300046491 Unclassified 811
809 Ga0495584_0361714 3300046491 Unclassified 737
810 Ga0495585_0028725 3300046492 Bacteria 3170
811 Ga0495628_0123486 3300046516 Unclassified 1984
812 Ga0495630_0142315 3300046517 Bacteria 1824
813 Ga0495643_0000443 3300046522 Bacteria 53481
814 Ga0495663_0037248 3300046525 Bacteria 1467
815 Ga0495642_0077726 3300046528 Bacteria 1394
816 Ga0495652_0048747 3300046529 Bacteria 3628
817 Ga0495587_0147204 3300046536 Unclassified 1343
818 Ga0495598_0009934 3300046537 Bacteria 2265
819 Ga0495598_0012805 3300046537 Bacteria 2067
820 Ga0495598_0122913 3300046537 Unclassified 882
821 Ga0495645_0006709 3300046543 Bacteria 7998
822 Ga0495645_0094370 3300046543 Unclassified 2134
823 Ga0495667_0087550 3300046559 Unclassified 2020
824 Ga0495667_0214586 3300046559 Bacteria 1229
825 Ga0495634_0029418 3300046642 Bacteria 3803
826 Ga0495635_0357877 3300046663 Bacteria 973
827 Ga0495659_0022858 3300046664 Unclassified 2119
828 Ga0495659_0191686 3300046664 Unclassified 836
829 Ga0495661_0216664 3300046665 Unclassified 994
830 Ga0495588_0176558 3300046674 Bacteria 1129
831 Ga0495657_0193567 3300046675 Bacteria 1242
832 Ga0495657_0354579 3300046675 Bacteria 868
833 Ga0495599_0002744 3300046678 Bacteria 10272
834 Ga0495623_0042456 3300046679 Bacteria 2896
835 Ga0495647_0099853 3300046681 Unclassified 1201
836 Ga0495658_0083075 3300046683 Bacteria 1883
837 Ga0495669_0017438 3300046684 Unclassified 3083
838 Ga0495669_0047039 3300046684 Unclassified 1926
839 Ga0495669_0074203 3300046684 Bacteria 1555
840 Ga0495669_0192932 3300046684 Unclassified 972
841 Ga0495613_0501925 3300046689 Bacteria 817
842 Ga0495624_0122878 3300046690 Bacteria 1594
843 Ga0495674_0231750 3300047319 Unclassified 1524
844 Ga0495674_0583287 3300047319 Bacteria 887
845 Ga0495680_0297735 3300047322 Bacteria 1133
846 Ga0495680_0393522 3300047322 Bacteria 958
847 Ga0495683_0153094 3300047323 Bacteria 1072
848 Ga0495675_0059492 3300047444 Bacteria 2422
849 Ga0495675_0154776 3300047444 Bacteria 1414
850 Ga0495681_0108882 3300047470 Unclassified 1202
851 Ga0495684_0010873 3300047471 Bacteria 7037
852 Ga0495684_0037920 3300047471 Bacteria 3697
853 Ga0495602_0107304 3300048088 Unclassified 2277
854 Ga0496100_0046887 3300048903 Bacteria 2782
855 Ga0496100_0063145 3300048903 Bacteria 2447
856 Ga0496100_0443269 3300048903 Bacteria 994
857 Ga0496101_0000422 3300048904 Bacteria 27267
858 Ga0496101_0124446 3300048904 Bacteria 1953
859 Ga0496102_0054945 3300048905 Bacteria 3631
860 Ga0496102_0097697 3300048905 Bacteria 2724
861 Ga0496102_0291428 3300048905 Unclassified 1538
862 Ga0496102_0389554 3300048905 Bacteria 1311
863 Ga0496103_0031615 3300048906 Bacteria 3226
864 Ga0496104_0054985 3300048907 Unclassified 3763
865 Ga0496104_0065707 3300048907 Bacteria 3443
866 Ga0496104_0166797 3300048907 Bacteria 2112
867 Ga0496104_0228305 3300048907 Bacteria 1774
868 Ga0496104_0265953 3300048907 Bacteria 1627
869 Ga0496105_0133891 3300048908 Bacteria 2042
870 Ga0496105_0142286 3300048908 Bacteria 1974
871 Ga0496105_0212441 3300048908 Bacteria 1577
872 Ga0496105_0420953 3300048908 Bacteria 1057
873 Ga0496106_0234696 3300048909 Bacteria 1465
874 Ga0496106_0298970 3300048909 Bacteria 1291
875 Ga0496106_0327013 3300048909 Bacteria 1231
876 Ga0496106_0421414 3300048909 Bacteria 1073
877 Ga0496107_0010651 3300048910 Bacteria 6393
878 Ga0496107_0187658 3300048910 Bacteria 1536
879 Ga0496107_0845781 3300048910 Bacteria 669
880 Ga0496108_0334790 3300048911 Unclassified 1320
881 Ga0496108_0521243 3300048911 Bacteria 1038
882 Ga0496108_0990047 3300048911 Bacteria 718
883 Ga0496109_0005026 3300048912 Bacteria 11049
884 Ga0496109_0246726 3300048912 Unclassified 1681
885 Ga0496109_0254926 3300048912 Unclassified 1652
886 Ga0496109_0352420 3300048912 Unclassified 1390
887 Ga0496109_0458599 3300048912 Unclassified 1204
888 Ga0496109_0533444 3300048912 Unclassified 1107
889 Ga0496109_0745718 3300048912 Bacteria 917
890 Ga0496110_0064443 3300048913 Bacteria 3239
891 Ga0496110_0076702 3300048913 Bacteria 2972
892 Ga0496110_0237909 3300048913 Bacteria 1657
893 Ga0496110_0586688 3300048913 Unclassified 1012
894 Ga0496111_0078935 3300048914 Bacteria 2401
895 Ga0496111_0216760 3300048914 Unclassified 1422
896 Ga0496112_0020455 3300048915 Bacteria 6274
897 Ga0496112_0034027 3300048915 Bacteria 4958
898 Ga0496112_0096332 3300048915 Unclassified 2929
899 Ga0496112_0205981 3300048915 Unclassified 1925
900 Ga0496112_0276295 3300048915 Bacteria 1627
901 Ga0496112_0298988 3300048915 Bacteria 1555
902 Ga0496112_0676835 3300048915 Unclassified 960
903 Ga0496113_0040430 3300048916 Bacteria 3437
904 Ga0496113_0152026 3300048916 Unclassified 1827
905 Ga0496115_0006139 3300048918 Bacteria 8784
906 Ga0496115_0059623 3300048918 Bacteria 3073
907 Ga0496115_0098738 3300048918 Unclassified 2392
908 Ga0496115_0208927 3300048918 Bacteria 1612
909 Ga0496115_0288015 3300048918 Unclassified 1348
910 Ga0501080_0109190 3300049742 Bacteria 2564
911 nmdc:mga00v17_478168_c1 3300050491 Bacteria 808
912 nmdc:mga0k408_137531_c1 3300050493 Unclassified 1452
913 nmdc:mga0k408_236189_c1 3300050493 Unclassified 1091
914 nmdc:mga0k408_351_c1 3300050493 Bacteria 25242
915 nmdc:mga0k408_437_c1 3300050493 Bacteria 22803
916 nmdc:mga0k408_600297_c1 3300050493 Unclassified 649
917 nmdc:mga07m45_16569_c1 3300050496 Bacteria 3945
918 nmdc:mga07m45_377399_c1 3300050496 Unclassified 823
919 nmdc:mga05p37_160571_c1 3300050507 Bacteria 2745
920 nmdc:mga05p37_4003_c1 3300050507 Bacteria 17226
921 nmdc:mga09592_503002_c1 3300050508 Bacteria 1043
922 nmdc:mga08y16_570412_c1 3300050511 Bacteria 1143
923 nmdc:mga0rr50_1021417_c1 3300050513 Bacteria 704
924 nmdc:mga0rr50_285548_c1 3300050513 Unclassified 1378
925 nmdc:mga0rr50_570701_c1 3300050513 Unclassified 964
926 nmdc:mga08x19_148929_c1 3300050514 Unclassified 1584
927 nmdc:mga08x19_215332_c1 3300050514 Unclassified 1319
928 nmdc:mga0a205_881180_c1 3300050515 Unclassified 742
929 nmdc:mga0a205_938600_c1 3300050515 Unclassified 712
930 nmdc:mga0sz30_59259_c1 3300050516 Bacteria 1282
931 Ga0495601_0003313 3300053077 Bacteria 9215
932 Ga0495601_0035889 3300053077 Bacteria 3096
933 Ga0500610_0164417 3300053079 Bacteria 1101
934 Ga0495595_0344038 3300053084 Bacteria 752
935 Ga0495619_0616924 3300053085 Bacteria 741
936 Ga0500556_0001824 3300053104 Bacteria 7800
937 Ga0500642_0002353 3300053130 Bacteria 5534
938 Ga0500616_0003203 3300053153 Bacteria 12709

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005985 Ga0081539_10000671 Ga0081539_1000067118 182
2 3300013296 Ga0157374_10600091 Ga0157374_106000912 186
3 3300048918 Ga0496115_0098738 Ga0496115_0098738_1621_2193 190
4 3300039438 Ga0436360_0155647 Ga0436360_0155647_45_626 191
5 3300045976 Ga0466967_0870977 Ga0466967_0870977_12_623 191
6 3300050493 nmdc:mga0k408_600297_c1 nmdc:mga0k408_600297_c1_26_604 191
7 3300046491 Ga0495584_0361714 Ga0495584_0361714_97_675 192
8 3300048908 Ga0496105_0420953 Ga0496105_0420953_10_588 192
9 3300005290 Ga0065712_10266013 Ga0065712_102660131 194
10 3300005293 Ga0065715_10089933 Ga0065715_100899333 194
11 3300005539 Ga0068853_100000002 Ga0068853_100000002305 194
12 3300007788 Ga0099795_10199188 Ga0099795_101991882 194
13 3300026041 Ga0207639_10000009 Ga0207639_10000009260 194
14 3300005335 Ga0070666_10156365 Ga0070666_101563652 195
15 3300005347 Ga0070668_100165243 Ga0070668_1001652432 195
16 3300013308 Ga0157375_11380639 Ga0157375_113806392 195
17 3300025972 Ga0207668_10186846 Ga0207668_101868462 195
18 3300005338 Ga0068868_100109169 Ga0068868_1001091692 197
19 3300005367 Ga0070667_100247302 Ga0070667_1002473022 197
20 3300005843 Ga0068860_100111877 Ga0068860_1001118774 197
21 3300013297 Ga0157378_10202123 Ga0157378_102021233 197
22 3300013306 Ga0163162_10074321 Ga0163162_100743212 197
23 3300025298 Ga0209050_1006977 Ga0209050_10069773 197
24 3300025923 Ga0207681_10008466 Ga0207681_100084663 197
25 3300025986 Ga0207658_10136796 Ga0207658_101367962 197
26 3300026023 Ga0207677_10445762 Ga0207677_104457622 197
27 3300021384 Ga0213876_10055287 Ga0213876_100552874 198
28 3300039437 Ga0436365_1117644 Ga0436365_1117644_434_1039 198
29 3300005327 Ga0070658_10314682 Ga0070658_103146822 199
30 3300009094 Ga0111539_10172555 Ga0111539_101725551 199
31 3300020080 Ga0206350_11555172 Ga0206350_115551721 199
32 3300021384 Ga0213876_10044348 Ga0213876_100443482 199
33 3300039437 Ga0436365_0530931 Ga0436365_0530931_4113_4727 199
34 3300041458 Ga0451798_1030054 Ga0451798_1030054_137_769 199
35 3300045049 Ga0466959_0483443 Ga0466959_0483443_228_827 199
36 3300050508 nmdc:mga09592_503002_c1 nmdc:mga09592_503002_c1_35_664 199
37 3300005339 Ga0070660_100123059 Ga0070660_1001230592 200
38 3300009174 Ga0105241_10341507 Ga0105241_103415072 200
39 3300038443 Ga0395901_0501158 Ga0395901_0501158_364_966 200
40 3300053153 Ga0500616_0003203 Ga0500616_0003203_2506_3144 200
41 3300005327 Ga0070658_10005882 Ga0070658_100058824 201
42 3300005327 Ga0070658_10598176 Ga0070658_105981761 201
43 3300005339 Ga0070660_100083058 Ga0070660_1000830582 201
44 3300005339 Ga0070660_100436038 Ga0070660_1004360382 201
45 3300005563 Ga0068855_100013156 Ga0068855_1000131567 201
46 3300005842 Ga0068858_100010197 Ga0068858_1000101978 201
47 3300005843 Ga0068860_100889964 Ga0068860_1008899642 201
48 3300009093 Ga0105240_10000412 Ga0105240_1000041223 201
49 3300009545 Ga0105237_10006408 Ga0105237_1000640810 201
50 3300010375 Ga0105239_10086420 Ga0105239_100864204 201
51 3300010375 Ga0105239_11156063 Ga0105239_111560632 201
52 3300025913 Ga0207695_10000783 Ga0207695_1000078332 201
53 3300025914 Ga0207671_10020513 Ga0207671_100205132 201
54 3300025919 Ga0207657_10417350 Ga0207657_104173502 201
55 3300025949 Ga0207667_10024015 Ga0207667_100240154 201
56 3300026035 Ga0207703_10015594 Ga0207703_100155945 201
57 3300032004 Ga0307414_10133466 Ga0307414_101334662 201
58 3300037853 Ga0436364_0573940 Ga0436364_0573940_131_736 201
59 3300042439 Ga0439464_0017248 Ga0439464_0017248_738_1343 201
60 3300046522 Ga0495643_0000443 Ga0495643_0000443_45768_46409 201
61 3300049742 Ga0501080_0109190 Ga0501080_0109190_1265_1894 201
62 3300053079 Ga0500610_0164417 Ga0500610_0164417_432_1073 201
63 3300053104 Ga0500556_0001824 Ga0500556_0001824_3169_3807 201
64 3300053130 Ga0500642_0002353 Ga0500642_0002353_1265_1903 201
65 3300005331 Ga0070670_100052927 Ga0070670_1000529271 202
66 3300005331 Ga0070670_100122580 Ga0070670_1001225802 202
67 3300005435 Ga0070714_100112238 Ga0070714_1001122384 202
68 3300005436 Ga0070713_100037190 Ga0070713_1000371904 202
69 3300005437 Ga0070710_10082369 Ga0070710_100823692 202
70 3300005439 Ga0070711_100201434 Ga0070711_1002014342 202
71 3300005445 Ga0070708_100220325 Ga0070708_1002203253 202
72 3300005467 Ga0070706_100001900 Ga0070706_1000019009 202
73 3300005467 Ga0070706_100117340 Ga0070706_1001173403 202
74 3300005467 Ga0070706_100300489 Ga0070706_1003004892 202
75 3300005467 Ga0070706_100513346 Ga0070706_1005133461 202
76 3300005468 Ga0070707_100284961 Ga0070707_1002849611 202
77 3300005471 Ga0070698_100003506 Ga0070698_10000350614 202
78 3300005471 Ga0070698_100025039 Ga0070698_1000250393 202
79 3300005518 Ga0070699_100077573 Ga0070699_1000775733 202
80 3300005536 Ga0070697_100152290 Ga0070697_1001522902 202
81 3300005543 Ga0070672_100270691 Ga0070672_1002706911 202
82 3300005578 Ga0068854_100541044 Ga0068854_1005410442 202
83 3300005843 Ga0068860_100000576 Ga0068860_10000057634 202
84 3300006028 Ga0070717_10183786 Ga0070717_101837862 202
85 3300006048 Ga0075363_100028247 Ga0075363_1000282474 202
86 3300006175 Ga0070712_100432168 Ga0070712_1004321681 202
87 3300006177 Ga0075362_10000662 Ga0075362_100006629 202
88 3300006177 Ga0075362_10018163 Ga0075362_100181634 202
89 3300006186 Ga0075369_10062924 Ga0075369_100629243 202
90 3300006237 Ga0097621_100257754 Ga0097621_1002577542 202
91 3300006353 Ga0075370_10004090 Ga0075370_100040904 202
92 3300007076 Ga0075435_100261554 Ga0075435_1002615541 202
93 3300007788 Ga0099795_10075838 Ga0099795_100758382 202
94 3300009093 Ga0105240_10401552 Ga0105240_104015523 202
95 3300013296 Ga0157374_10000160 Ga0157374_1000016043 202
96 3300014969 Ga0157376_10018271 Ga0157376_100182715 202
97 3300021358 Ga0213873_10081446 Ga0213873_100814461 202
98 3300021361 Ga0213872_10002738 Ga0213872_1000273817 202
99 3300021361 Ga0213872_10016657 Ga0213872_100166572 202
100 3300021361 Ga0213872_10095450 Ga0213872_100954502 202
101 3300021384 Ga0213876_10000779 Ga0213876_1000077911 202
102 3300021441 Ga0213871_10055446 Ga0213871_100554461 202
103 3300025898 Ga0207692_10374500 Ga0207692_103745001 202
104 3300025910 Ga0207684_10004700 Ga0207684_1000470013 202
105 3300025910 Ga0207684_10194513 Ga0207684_101945133 202
106 3300025910 Ga0207684_10440190 Ga0207684_104401902 202
107 3300025915 Ga0207693_10382709 Ga0207693_103827091 202
108 3300025916 Ga0207663_10375080 Ga0207663_103750802 202
109 3300025922 Ga0207646_10183571 Ga0207646_101835712 202
110 3300025922 Ga0207646_10258704 Ga0207646_102587042 202
111 3300025925 Ga0207650_10469961 Ga0207650_104699611 202
112 3300025928 Ga0207700_10546316 Ga0207700_105463162 202
113 3300027512 Ga0209179_1021633 Ga0209179_10216332 202
114 3300028380 Ga0268265_10536243 Ga0268265_105362431 202
115 3300028381 Ga0268264_10001424 Ga0268264_1000142411 202
116 3300037853 Ga0436364_1204737 Ga0436364_1204737_303_944 202
117 3300037853 Ga0436364_1459403 Ga0436364_1459403_263_904 202
118 3300039437 Ga0436365_0379833 Ga0436365_0379833_2981_3622 202
119 3300039437 Ga0436365_0659259 Ga0436365_0659259_963_1610 202
120 3300039437 Ga0436365_0960797 Ga0436365_0960797_977_1627 202
121 3300039437 Ga0436365_1112867 Ga0436365_1112867_30728_31369 202
122 3300039438 Ga0436360_1341574 Ga0436360_1341574_892_1533 202
123 3300039447 Ga0436361_0589004 Ga0436361_0589004_2265_2906 202
124 3300039447 Ga0436361_0591984 Ga0436361_0591984_217_864 202
125 3300039447 Ga0436361_0627296 Ga0436361_0627296_513_1154 202
126 3300039447 Ga0436361_0756631 Ga0436361_0756631_2218_2859 202
127 3300039447 Ga0436361_0765849 Ga0436361_0765849_236_877 202
128 3300039450 Ga0436363_1091559 Ga0436363_1091559_747_1388 202
129 3300039453 Ga0436362_0090010 Ga0436362_0090010_154_795 202
130 3300039453 Ga0436362_1255536 Ga0436362_1255536_633_1280 202
131 3300050491 nmdc:mga00v17_478168_c1 nmdc:mga00v17_478168_c1_55_696 202
132 3300050493 nmdc:mga0k408_137531_c1 nmdc:mga0k408_137531_c1_160_819 202
133 3300050493 nmdc:mga0k408_236189_c1 nmdc:mga0k408_236189_c1_25_684 202
134 3300050493 nmdc:mga0k408_351_c1 nmdc:mga0k408_351_c1_6900_7541 202
135 3300050493 nmdc:mga0k408_437_c1 nmdc:mga0k408_437_c1_21735_22445 202
136 3300050496 nmdc:mga07m45_16569_c1 nmdc:mga07m45_16569_c1_546_1187 202
137 3300050496 nmdc:mga07m45_377399_c1 nmdc:mga07m45_377399_c1_90_749 202
138 3300050513 nmdc:mga0rr50_570701_c1 nmdc:mga0rr50_570701_c1_228_845 202
139 3300050516 nmdc:mga0sz30_59259_c1 nmdc:mga0sz30_59259_c1_621_1262 202
140 3300000545 CNXas_1000206 CNXas_100020612 203
141 3300001430 JGI24032J14994_101162 JGI24032J14994_1011622 203
142 3300001990 JGI24737J22298_10012645 JGI24737J22298_100126452 203
143 3300002077 JGI24744J21845_10012038 JGI24744J21845_100120382 203
144 3300002126 JGI24035J26624_1000141 JGI24035J26624_10001412 203
145 3300002126 JGI24035J26624_1007613 JGI24035J26624_10076132 203
146 3300002126 JGI24035J26624_1011137 JGI24035J26624_10111372 203
147 3300003203 JGI25406J46586_10000087 JGI25406J46586_1000008736 203
148 3300003203 JGI25406J46586_10095645 JGI25406J46586_100956452 203
149 3300003659 JGI25404J52841_10004829 JGI25404J52841_100048292 203
150 3300003911 JGI25405J52794_10000412 JGI25405J52794_100004124 203
151 3300003911 JGI25405J52794_10002813 JGI25405J52794_100028134 203
152 3300005288 Ga0065714_10094929 Ga0065714_100949291 203
153 3300005289 Ga0065704_10004850 Ga0065704_100048502 203
154 3300005289 Ga0065704_10009573 Ga0065704_100095733 203
155 3300005289 Ga0065704_10022829 Ga0065704_100228291 203
156 3300005289 Ga0065704_10073950 Ga0065704_100739504 203
157 3300005289 Ga0065704_10091739 Ga0065704_100917393 203
158 3300005290 Ga0065712_10001692 Ga0065712_100016924 203
159 3300005290 Ga0065712_10004664 Ga0065712_100046644 203
160 3300005290 Ga0065712_10006386 Ga0065712_100063864 203
161 3300005290 Ga0065712_10016478 Ga0065712_100164782 203
162 3300005290 Ga0065712_10026337 Ga0065712_100263372 203
163 3300005290 Ga0065712_10116148 Ga0065712_101161483 203
164 3300005290 Ga0065712_10137998 Ga0065712_101379982 203
165 3300005290 Ga0065712_10205871 Ga0065712_102058712 203
166 3300005290 Ga0065712_10227849 Ga0065712_102278492 203
167 3300005293 Ga0065715_10000709 Ga0065715_100007093 203
168 3300005293 Ga0065715_10001727 Ga0065715_100017274 203
169 3300005293 Ga0065715_10119901 Ga0065715_101199012 203
170 3300005293 Ga0065715_10167516 Ga0065715_101675161 203
171 3300005293 Ga0065715_10174334 Ga0065715_101743341 203
172 3300005293 Ga0065715_10255269 Ga0065715_102552692 203
173 3300005293 Ga0065715_10298847 Ga0065715_102988471 203
174 3300005293 Ga0065715_10327626 Ga0065715_103276261 203
175 3300005293 Ga0065715_10368088 Ga0065715_103680881 203
176 3300005293 Ga0065715_10369071 Ga0065715_103690712 203
177 3300005293 Ga0065715_10426084 Ga0065715_104260841 203
178 3300005295 Ga0065707_10003005 Ga0065707_100030054 203
179 3300005295 Ga0065707_10005953 Ga0065707_100059534 203
180 3300005295 Ga0065707_10013106 Ga0065707_100131061 203
181 3300005327 Ga0070658_10136660 Ga0070658_101366603 203
182 3300005328 Ga0070676_10007273 Ga0070676_100072734 203
183 3300005328 Ga0070676_10013117 Ga0070676_100131172 203
184 3300005328 Ga0070676_10025549 Ga0070676_100255492 203
185 3300005328 Ga0070676_10171591 Ga0070676_101715912 203
186 3300005328 Ga0070676_10392529 Ga0070676_103925292 203
187 3300005328 Ga0070676_10875274 Ga0070676_108752741 203
188 3300005329 Ga0070683_100006008 Ga0070683_1000060082 203
189 3300005329 Ga0070683_100010449 Ga0070683_10001044911 203
190 3300005329 Ga0070683_100114079 Ga0070683_1001140794 203
191 3300005329 Ga0070683_100359518 Ga0070683_1003595182 203
192 3300005330 Ga0070690_100027697 Ga0070690_1000276973 203
193 3300005330 Ga0070690_100236802 Ga0070690_1002368022 203
194 3300005330 Ga0070690_100582137 Ga0070690_1005821372 203
195 3300005330 Ga0070690_100637363 Ga0070690_1006373631 203
196 3300005331 Ga0070670_100014931 Ga0070670_1000149314 203
197 3300005331 Ga0070670_100023992 Ga0070670_1000239922 203
198 3300005331 Ga0070670_100547513 Ga0070670_1005475132 203
199 3300005333 Ga0070677_10003178 Ga0070677_100031781 203
200 3300005333 Ga0070677_10118311 Ga0070677_101183112 203
201 3300005334 Ga0068869_100061991 Ga0068869_1000619912 203
202 3300005335 Ga0070666_10009111 Ga0070666_100091116 203
203 3300005335 Ga0070666_10014419 Ga0070666_100144198 203
204 3300005335 Ga0070666_10063078 Ga0070666_100630784 203
205 3300005335 Ga0070666_10115524 Ga0070666_101155243 203
206 3300005336 Ga0070680_100026698 Ga0070680_1000266984 203
207 3300005336 Ga0070680_100558357 Ga0070680_1005583571 203
208 3300005337 Ga0070682_100075346 Ga0070682_1000753462 203
209 3300005338 Ga0068868_100099890 Ga0068868_1000998903 203
210 3300005338 Ga0068868_100144993 Ga0068868_1001449933 203
211 3300005339 Ga0070660_100138468 Ga0070660_1001384681 203
212 3300005339 Ga0070660_100306739 Ga0070660_1003067392 203
213 3300005340 Ga0070689_100000978 Ga0070689_10000097812 203
214 3300005340 Ga0070689_100075259 Ga0070689_1000752592 203
215 3300005340 Ga0070689_100085949 Ga0070689_1000859492 203
216 3300005340 Ga0070689_100128485 Ga0070689_1001284851 203
217 3300005341 Ga0070691_10242126 Ga0070691_102421261 203
218 3300005343 Ga0070687_100013691 Ga0070687_1000136914 203
219 3300005343 Ga0070687_100027127 Ga0070687_1000271274 203
220 3300005344 Ga0070661_100087820 Ga0070661_1000878204 203
221 3300005344 Ga0070661_100211272 Ga0070661_1002112722 203
222 3300005344 Ga0070661_100343187 Ga0070661_1003431872 203
223 3300005347 Ga0070668_100007657 Ga0070668_1000076577 203
224 3300005347 Ga0070668_100023570 Ga0070668_1000235705 203
225 3300005347 Ga0070668_100051505 Ga0070668_1000515052 203
226 3300005353 Ga0070669_100002655 Ga0070669_10000265513 203
227 3300005353 Ga0070669_100002855 Ga0070669_10000285513 203
228 3300005353 Ga0070669_100078802 Ga0070669_1000788024 203
229 3300005353 Ga0070669_100149960 Ga0070669_1001499602 203
230 3300005354 Ga0070675_100003712 Ga0070675_1000037124 203
231 3300005354 Ga0070675_100009595 Ga0070675_1000095956 203
232 3300005354 Ga0070675_100012255 Ga0070675_1000122554 203
233 3300005354 Ga0070675_100051731 Ga0070675_1000517314 203
234 3300005354 Ga0070675_100063293 Ga0070675_1000632932 203
235 3300005354 Ga0070675_100071895 Ga0070675_1000718953 203
236 3300005354 Ga0070675_100092059 Ga0070675_1000920593 203
237 3300005354 Ga0070675_100333325 Ga0070675_1003333251 203
238 3300005354 Ga0070675_100380263 Ga0070675_1003802632 203
239 3300005354 Ga0070675_100527999 Ga0070675_1005279992 203
240 3300005355 Ga0070671_100022030 Ga0070671_1000220305 203
241 3300005355 Ga0070671_100027480 Ga0070671_1000274804 203
242 3300005355 Ga0070671_100095441 Ga0070671_1000954412 203
243 3300005355 Ga0070671_100119176 Ga0070671_1001191762 203
244 3300005355 Ga0070671_100159825 Ga0070671_1001598253 203
245 3300005355 Ga0070671_100214880 Ga0070671_1002148802 203
246 3300005355 Ga0070671_100416101 Ga0070671_1004161011 203
247 3300005355 Ga0070671_100813306 Ga0070671_1008133061 203
248 3300005356 Ga0070674_100027776 Ga0070674_1000277763 203
249 3300005356 Ga0070674_100033088 Ga0070674_1000330882 203
250 3300005356 Ga0070674_100184196 Ga0070674_1001841962 203
251 3300005356 Ga0070674_100935327 Ga0070674_1009353271 203
252 3300005356 Ga0070674_101058546 Ga0070674_1010585461 203
253 3300005364 Ga0070673_100000434 Ga0070673_10000043415 203
254 3300005364 Ga0070673_100016374 Ga0070673_1000163746 203
255 3300005364 Ga0070673_100022537 Ga0070673_1000225374 203
256 3300005364 Ga0070673_100186455 Ga0070673_1001864552 203
257 3300005364 Ga0070673_100294201 Ga0070673_1002942012 203
258 3300005365 Ga0070688_100007537 Ga0070688_1000075374 203
259 3300005365 Ga0070688_100021992 Ga0070688_1000219924 203
260 3300005365 Ga0070688_100030150 Ga0070688_1000301502 203
261 3300005365 Ga0070688_100076237 Ga0070688_1000762373 203
262 3300005365 Ga0070688_100118777 Ga0070688_1001187772 203
263 3300005365 Ga0070688_100184754 Ga0070688_1001847542 203
264 3300005365 Ga0070688_100206680 Ga0070688_1002066801 203
265 3300005365 Ga0070688_100249770 Ga0070688_1002497701 203
266 3300005365 Ga0070688_100376408 Ga0070688_1003764081 203
267 3300005366 Ga0070659_100000971 Ga0070659_10000097110 203
268 3300005366 Ga0070659_100052792 Ga0070659_1000527924 203
269 3300005367 Ga0070667_100006762 Ga0070667_10000676210 203
270 3300005367 Ga0070667_100055129 Ga0070667_1000551292 203
271 3300005367 Ga0070667_100108365 Ga0070667_1001083651 203
272 3300005367 Ga0070667_100137433 Ga0070667_1001374333 203
273 3300005367 Ga0070667_100272922 Ga0070667_1002729222 203
274 3300005367 Ga0070667_100664626 Ga0070667_1006646262 203
275 3300005434 Ga0070709_10217629 Ga0070709_102176292 203
276 3300005434 Ga0070709_10349913 Ga0070709_103499132 203
277 3300005434 Ga0070709_10410699 Ga0070709_104106992 203
278 3300005435 Ga0070714_100022318 Ga0070714_1000223183 203
279 3300005435 Ga0070714_100050890 Ga0070714_1000508903 203
280 3300005435 Ga0070714_100561150 Ga0070714_1005611502 203
281 3300005435 Ga0070714_100834323 Ga0070714_1008343232 203
282 3300005436 Ga0070713_100115542 Ga0070713_1001155423 203
283 3300005436 Ga0070713_100226852 Ga0070713_1002268522 203
284 3300005436 Ga0070713_100258111 Ga0070713_1002581112 203
285 3300005436 Ga0070713_100293681 Ga0070713_1002936812 203
286 3300005436 Ga0070713_100560086 Ga0070713_1005600862 203
287 3300005437 Ga0070710_10075475 Ga0070710_100754753 203
288 3300005437 Ga0070710_10148035 Ga0070710_101480352 203
289 3300005437 Ga0070710_10234718 Ga0070710_102347182 203
290 3300005437 Ga0070710_10315938 Ga0070710_103159382 203
291 3300005438 Ga0070701_10153599 Ga0070701_101535992 203
292 3300005439 Ga0070711_100012799 Ga0070711_1000127993 203
293 3300005439 Ga0070711_100020670 Ga0070711_1000206704 203
294 3300005440 Ga0070705_100128756 Ga0070705_1001287562 203
295 3300005440 Ga0070705_100146728 Ga0070705_1001467283 203
296 3300005440 Ga0070705_100196055 Ga0070705_1001960551 203
297 3300005440 Ga0070705_100276395 Ga0070705_1002763952 203
298 3300005441 Ga0070700_100039609 Ga0070700_1000396092 203
299 3300005444 Ga0070694_100024137 Ga0070694_1000241372 203
300 3300005445 Ga0070708_100012016 Ga0070708_1000120167 203
301 3300005445 Ga0070708_100047427 Ga0070708_1000474273 203
302 3300005445 Ga0070708_100072775 Ga0070708_1000727752 203
303 3300005445 Ga0070708_100085529 Ga0070708_1000855293 203
304 3300005445 Ga0070708_100090982 Ga0070708_1000909823 203
305 3300005445 Ga0070708_100242041 Ga0070708_1002420412 203
306 3300005445 Ga0070708_100291344 Ga0070708_1002913442 203
307 3300005445 Ga0070708_100966426 Ga0070708_1009664262 203
308 3300005455 Ga0070663_100007018 Ga0070663_1000070189 203
309 3300005455 Ga0070663_100147391 Ga0070663_1001473911 203
310 3300005455 Ga0070663_100502859 Ga0070663_1005028591 203
311 3300005456 Ga0070678_100014316 Ga0070678_1000143166 203
312 3300005456 Ga0070678_100096894 Ga0070678_1000968943 203
313 3300005456 Ga0070678_100588886 Ga0070678_1005888861 203
314 3300005457 Ga0070662_100003832 Ga0070662_1000038324 203
315 3300005457 Ga0070662_100043784 Ga0070662_1000437844 203
316 3300005457 Ga0070662_100131592 Ga0070662_1001315923 203
317 3300005457 Ga0070662_100146136 Ga0070662_1001461362 203
318 3300005457 Ga0070662_100375863 Ga0070662_1003758631 203
319 3300005457 Ga0070662_101040614 Ga0070662_1010406141 203
320 3300005459 Ga0068867_100032843 Ga0068867_1000328433 203
321 3300005459 Ga0068867_100086414 Ga0068867_1000864143 203
322 3300005459 Ga0068867_100109459 Ga0068867_1001094593 203
323 3300005459 Ga0068867_100860567 Ga0068867_1008605671 203
324 3300005466 Ga0070685_10067747 Ga0070685_100677474 203
325 3300005467 Ga0070706_100000311 Ga0070706_1000003115 203
326 3300005467 Ga0070706_100004096 Ga0070706_1000040966 203
327 3300005467 Ga0070706_100013504 Ga0070706_10001350411 203
328 3300005467 Ga0070706_100014263 Ga0070706_1000142634 203
329 3300005467 Ga0070706_100042062 Ga0070706_1000420621 203
330 3300005467 Ga0070706_100083975 Ga0070706_1000839753 203
331 3300005467 Ga0070706_100132337 Ga0070706_1001323373 203
332 3300005467 Ga0070706_100590980 Ga0070706_1005909802 203
333 3300005467 Ga0070706_101010697 Ga0070706_1010106971 203
334 3300005468 Ga0070707_100022786 Ga0070707_1000227864 203
335 3300005468 Ga0070707_100052961 Ga0070707_1000529614 203
336 3300005468 Ga0070707_100062513 Ga0070707_1000625134 203
337 3300005468 Ga0070707_100082066 Ga0070707_1000820664 203
338 3300005468 Ga0070707_100126280 Ga0070707_1001262803 203
339 3300005468 Ga0070707_100329039 Ga0070707_1003290392 203
340 3300005468 Ga0070707_100511374 Ga0070707_1005113742 203
341 3300005468 Ga0070707_100597627 Ga0070707_1005976272 203
342 3300005471 Ga0070698_100077092 Ga0070698_1000770922 203
343 3300005471 Ga0070698_100083823 Ga0070698_1000838234 203
344 3300005471 Ga0070698_100258988 Ga0070698_1002589883 203
345 3300005471 Ga0070698_100263776 Ga0070698_1002637763 203
346 3300005518 Ga0070699_100010688 Ga0070699_1000106882 203
347 3300005518 Ga0070699_100036437 Ga0070699_1000364373 203
348 3300005518 Ga0070699_100135107 Ga0070699_1001351071 203
349 3300005530 Ga0070679_100701639 Ga0070679_1007016392 203
350 3300005535 Ga0070684_100006663 Ga0070684_1000066634 203
351 3300005535 Ga0070684_100041434 Ga0070684_1000414343 203
352 3300005535 Ga0070684_100099186 Ga0070684_1000991864 203
353 3300005535 Ga0070684_100268320 Ga0070684_1002683202 203
354 3300005535 Ga0070684_100597902 Ga0070684_1005979022 203
355 3300005536 Ga0070697_100002917 Ga0070697_1000029177 203
356 3300005536 Ga0070697_100003353 Ga0070697_1000033538 203
357 3300005536 Ga0070697_100012443 Ga0070697_1000124434 203
358 3300005536 Ga0070697_100071365 Ga0070697_1000713651 203
359 3300005536 Ga0070697_100074750 Ga0070697_1000747502 203
360 3300005536 Ga0070697_100098708 Ga0070697_1000987083 203
361 3300005536 Ga0070697_100126546 Ga0070697_1001265463 203
362 3300005536 Ga0070697_100242102 Ga0070697_1002421022 203
363 3300005536 Ga0070697_100409997 Ga0070697_1004099972 203
364 3300005536 Ga0070697_100642290 Ga0070697_1006422902 203
365 3300005539 Ga0068853_100371264 Ga0068853_1003712642 203
366 3300005543 Ga0070672_100006356 Ga0070672_1000063566 203
367 3300005543 Ga0070672_100021583 Ga0070672_1000215834 203
368 3300005543 Ga0070672_100189510 Ga0070672_1001895103 203
369 3300005543 Ga0070672_100544384 Ga0070672_1005443842 203
370 3300005546 Ga0070696_100070536 Ga0070696_1000705362 203
371 3300005548 Ga0070665_100033364 Ga0070665_1000333641 203
372 3300005548 Ga0070665_100048215 Ga0070665_1000482154 203
373 3300005548 Ga0070665_100094465 Ga0070665_1000944651 203
374 3300005548 Ga0070665_100126059 Ga0070665_1001260593 203
375 3300005548 Ga0070665_100539402 Ga0070665_1005394022 203
376 3300005549 Ga0070704_100002924 Ga0070704_1000029246 203
377 3300005549 Ga0070704_100074513 Ga0070704_1000745133 203
378 3300005549 Ga0070704_100576357 Ga0070704_1005763572 203
379 3300005563 Ga0068855_100281988 Ga0068855_1002819881 203
380 3300005578 Ga0068854_100266766 Ga0068854_1002667662 203
381 3300005614 Ga0068856_100096159 Ga0068856_1000961594 203
382 3300005614 Ga0068856_100246292 Ga0068856_1002462922 203
383 3300005614 Ga0068856_101426804 Ga0068856_1014268041 203
384 3300005614 Ga0068856_101546904 Ga0068856_1015469041 203
385 3300005615 Ga0070702_100086753 Ga0070702_1000867532 203
386 3300005617 Ga0068859_100990974 Ga0068859_1009909741 203
387 3300005617 Ga0068859_101132319 Ga0068859_1011323192 203
388 3300005618 Ga0068864_100274762 Ga0068864_1002747621 203
389 3300005618 Ga0068864_101170157 Ga0068864_1011701572 203
390 3300005718 Ga0068866_10112301 Ga0068866_101123013 203
391 3300005841 Ga0068863_100003600 Ga0068863_1000036008 203
392 3300005841 Ga0068863_100180547 Ga0068863_1001805473 203
393 3300005841 Ga0068863_100240893 Ga0068863_1002408932 203
394 3300005841 Ga0068863_100536375 Ga0068863_1005363751 203
395 3300005842 Ga0068858_100068419 Ga0068858_1000684192 203
396 3300005842 Ga0068858_100320271 Ga0068858_1003202712 203
397 3300005843 Ga0068860_100037757 Ga0068860_1000377574 203
398 3300005843 Ga0068860_100350199 Ga0068860_1003501992 203
399 3300005843 Ga0068860_100400993 Ga0068860_1004009932 203
400 3300005844 Ga0068862_100267237 Ga0068862_1002672373 203
401 3300005937 Ga0081455_10001872 Ga0081455_1000187211 203
402 3300005937 Ga0081455_10016935 Ga0081455_100169354 203
403 3300005937 Ga0081455_10044602 Ga0081455_100446024 203
404 3300005937 Ga0081455_10049102 Ga0081455_100491025 203
405 3300005983 Ga0081540_1000036 Ga0081540_100003691 203
406 3300005983 Ga0081540_1020870 Ga0081540_10208705 203
407 3300005983 Ga0081540_1034481 Ga0081540_10344812 203
408 3300005985 Ga0081539_10001132 Ga0081539_1000113236 203
409 3300005985 Ga0081539_10040243 Ga0081539_100402433 203
410 3300005985 Ga0081539_10175139 Ga0081539_101751392 203
411 3300006028 Ga0070717_10091589 Ga0070717_100915892 203
412 3300006028 Ga0070717_10093046 Ga0070717_100930463 203
413 3300006028 Ga0070717_10119455 Ga0070717_101194554 203
414 3300006028 Ga0070717_10143413 Ga0070717_101434134 203
415 3300006028 Ga0070717_10171272 Ga0070717_101712722 203
416 3300006028 Ga0070717_10216627 Ga0070717_102166272 203
417 3300006163 Ga0070715_10047133 Ga0070715_100471332 203
418 3300006163 Ga0070715_10052209 Ga0070715_100522092 203
419 3300006173 Ga0070716_100016121 Ga0070716_1000161214 203
420 3300006173 Ga0070716_100071096 Ga0070716_1000710962 203
421 3300006173 Ga0070716_100187760 Ga0070716_1001877602 203
422 3300006173 Ga0070716_100326689 Ga0070716_1003266892 203
423 3300006173 Ga0070716_100356862 Ga0070716_1003568622 203
424 3300006173 Ga0070716_100496278 Ga0070716_1004962781 203
425 3300006175 Ga0070712_100103548 Ga0070712_1001035482 203
426 3300006175 Ga0070712_100103973 Ga0070712_1001039732 203
427 3300006175 Ga0070712_100122575 Ga0070712_1001225752 203
428 3300006175 Ga0070712_100217983 Ga0070712_1002179832 203
429 3300006175 Ga0070712_100302264 Ga0070712_1003022642 203
430 3300006175 Ga0070712_100350858 Ga0070712_1003508582 203
431 3300006175 Ga0070712_100382815 Ga0070712_1003828151 203
432 3300006175 Ga0070712_100537545 Ga0070712_1005375452 203
433 3300006175 Ga0070712_101037270 Ga0070712_1010372701 203
434 3300006237 Ga0097621_100014680 Ga0097621_1000146806 203
435 3300006237 Ga0097621_100035139 Ga0097621_1000351394 203
436 3300006237 Ga0097621_100097958 Ga0097621_1000979581 203
437 3300006237 Ga0097621_100713517 Ga0097621_1007135171 203
438 3300006358 Ga0068871_100012306 Ga0068871_1000123064 203
439 3300006358 Ga0068871_100035252 Ga0068871_1000352524 203
440 3300006358 Ga0068871_100097947 Ga0068871_1000979472 203
441 3300006844 Ga0075428_100210081 Ga0075428_1002100813 203
442 3300006852 Ga0075433_10296210 Ga0075433_102962102 203
443 3300006852 Ga0075433_10390907 Ga0075433_103909072 203
444 3300006871 Ga0075434_100698607 Ga0075434_1006986072 203
445 3300006871 Ga0075434_100839157 Ga0075434_1008391572 203
446 3300006871 Ga0075434_100933005 Ga0075434_1009330051 203
447 3300006881 Ga0068865_100020657 Ga0068865_1000206575 203
448 3300006881 Ga0068865_100063909 Ga0068865_1000639094 203
449 3300006914 Ga0075436_100115767 Ga0075436_1001157674 203
450 3300006914 Ga0075436_100464806 Ga0075436_1004648062 203
451 3300006931 Ga0097620_100990952 Ga0097620_1009909521 203
452 3300006931 Ga0097620_101132438 Ga0097620_1011324382 203
453 3300007076 Ga0075435_100334131 Ga0075435_1003341312 203
454 3300007265 Ga0099794_10060393 Ga0099794_100603932 203
455 3300007788 Ga0099795_10003178 Ga0099795_100031783 203
456 3300007788 Ga0099795_10041176 Ga0099795_100411762 203
457 3300009094 Ga0111539_10249144 Ga0111539_102491442 203
458 3300009094 Ga0111539_10796145 Ga0111539_107961451 203
459 3300009098 Ga0105245_10026583 Ga0105245_100265834 203
460 3300009098 Ga0105245_10283623 Ga0105245_102836233 203
461 3300009098 Ga0105245_10568739 Ga0105245_105687392 203
462 3300009101 Ga0105247_10191930 Ga0105247_101919303 203
463 3300009147 Ga0114129_10007418 Ga0114129_100074188 203
464 3300009147 Ga0114129_10162066 Ga0114129_101620664 203
465 3300009147 Ga0114129_10244078 Ga0114129_102440782 203
466 3300009147 Ga0114129_10598948 Ga0114129_105989482 203
467 3300009148 Ga0105243_10047154 Ga0105243_100471542 203
468 3300009174 Ga0105241_10118065 Ga0105241_101180653 203
469 3300009174 Ga0105241_10688375 Ga0105241_106883752 203
470 3300009176 Ga0105242_10086583 Ga0105242_100865832 203
471 3300009176 Ga0105242_11341877 Ga0105242_113418771 203
472 3300009545 Ga0105237_10215473 Ga0105237_102154733 203
473 3300009545 Ga0105237_10387062 Ga0105237_103870622 203
474 3300009545 Ga0105237_10580387 Ga0105237_105803872 203
475 3300009553 Ga0105249_10074161 Ga0105249_100741614 203
476 3300010159 Ga0099796_10029945 Ga0099796_100299452 203
477 3300010159 Ga0099796_10239664 Ga0099796_102396641 203
478 3300010375 Ga0105239_10134580 Ga0105239_101345804 203
479 3300010375 Ga0105239_10135294 Ga0105239_101352942 203
480 3300010375 Ga0105239_10155992 Ga0105239_101559922 203
481 3300010375 Ga0105239_10217548 Ga0105239_102175484 203
482 3300013102 Ga0157371_10227161 Ga0157371_102271612 203
483 3300013104 Ga0157370_10516754 Ga0157370_105167542 203
484 3300013105 Ga0157369_10441889 Ga0157369_104418892 203
485 3300013105 Ga0157369_10644028 Ga0157369_106440282 203
486 3300013296 Ga0157374_10016198 Ga0157374_100161986 203
487 3300013296 Ga0157374_10033371 Ga0157374_100333712 203
488 3300013296 Ga0157374_10083550 Ga0157374_100835502 203
489 3300013296 Ga0157374_10111000 Ga0157374_101110004 203
490 3300013296 Ga0157374_10230839 Ga0157374_102308392 203
491 3300013296 Ga0157374_10267638 Ga0157374_102676382 203
492 3300013296 Ga0157374_11118901 Ga0157374_111189011 203
493 3300013296 Ga0157374_11437729 Ga0157374_114377291 203
494 3300013297 Ga0157378_10006750 Ga0157378_1000675010 203
495 3300013297 Ga0157378_10023174 Ga0157378_100231742 203
496 3300013297 Ga0157378_10033296 Ga0157378_100332966 203
497 3300013297 Ga0157378_10077204 Ga0157378_100772043 203
498 3300013297 Ga0157378_10097175 Ga0157378_100971753 203
499 3300013297 Ga0157378_10108165 Ga0157378_101081653 203
500 3300013297 Ga0157378_10231751 Ga0157378_102317512 203
501 3300013297 Ga0157378_10231898 Ga0157378_102318982 203
502 3300013297 Ga0157378_10567103 Ga0157378_105671032 203
503 3300013297 Ga0157378_10616943 Ga0157378_106169432 203
504 3300013297 Ga0157378_10689553 Ga0157378_106895532 203
505 3300013297 Ga0157378_10991161 Ga0157378_109911611 203
506 3300013306 Ga0163162_10008629 Ga0163162_1000862910 203
507 3300013306 Ga0163162_10013145 Ga0163162_100131456 203
508 3300013306 Ga0163162_10021558 Ga0163162_100215588 203
509 3300013306 Ga0163162_10021637 Ga0163162_100216374 203
510 3300013306 Ga0163162_10043308 Ga0163162_100433084 203
511 3300013306 Ga0163162_10057606 Ga0163162_100576063 203
512 3300013306 Ga0163162_10224840 Ga0163162_102248403 203
513 3300013306 Ga0163162_10351894 Ga0163162_103518943 203
514 3300013307 Ga0157372_10414364 Ga0157372_104143641 203
515 3300013307 Ga0157372_10429439 Ga0157372_104294392 203
516 3300013307 Ga0157372_11358471 Ga0157372_113584712 203
517 3300013308 Ga0157375_10002485 Ga0157375_1000248511 203
518 3300013308 Ga0157375_10011674 Ga0157375_100116745 203
519 3300013308 Ga0157375_10052405 Ga0157375_100524054 203
520 3300013308 Ga0157375_10063296 Ga0157375_100632963 203
521 3300013308 Ga0157375_10115628 Ga0157375_101156284 203
522 3300013308 Ga0157375_11130186 Ga0157375_111301862 203
523 3300013308 Ga0157375_11598394 Ga0157375_115983941 203
524 3300014325 Ga0163163_10119296 Ga0163163_101192961 203
525 3300014325 Ga0163163_10141245 Ga0163163_101412454 203
526 3300014325 Ga0163163_10269781 Ga0163163_102697812 203
527 3300014325 Ga0163163_10273312 Ga0163163_102733122 203
528 3300014745 Ga0157377_10048614 Ga0157377_100486143 203
529 3300014968 Ga0157379_10343869 Ga0157379_103438692 203
530 3300014969 Ga0157376_10081124 Ga0157376_100811245 203
531 3300014969 Ga0157376_10091651 Ga0157376_100916512 203
532 3300014969 Ga0157376_10135143 Ga0157376_101351432 203
533 3300014969 Ga0157376_10508681 Ga0157376_105086812 203
534 3300014969 Ga0157376_10584334 Ga0157376_105843341 203
535 3300017792 Ga0163161_10005833 Ga0163161_100058334 203
536 3300017792 Ga0163161_10119730 Ga0163161_101197302 203
537 3300017792 Ga0163161_10203079 Ga0163161_102030793 203
538 3300017792 Ga0163161_10529095 Ga0163161_105290952 203
539 3300025271 Ga0207666_1001627 Ga0207666_10016274 203
540 3300025271 Ga0207666_1003597 Ga0207666_10035972 203
541 3300025271 Ga0207666_1005596 Ga0207666_10055962 203
542 3300025290 Ga0207673_1004302 Ga0207673_10043022 203
543 3300025315 Ga0207697_10000116 Ga0207697_1000011628 203
544 3300025315 Ga0207697_10000348 Ga0207697_100003485 203
545 3300025315 Ga0207697_10001294 Ga0207697_1000129412 203
546 3300025315 Ga0207697_10001541 Ga0207697_1000154113 203
547 3300025315 Ga0207697_10002095 Ga0207697_100020953 203
548 3300025315 Ga0207697_10012438 Ga0207697_100124384 203
549 3300025315 Ga0207697_10025316 Ga0207697_100253161 203
550 3300025885 Ga0207653_10026242 Ga0207653_100262422 203
551 3300025893 Ga0207682_10044496 Ga0207682_100444962 203
552 3300025898 Ga0207692_10035612 Ga0207692_100356122 203
553 3300025898 Ga0207692_10118584 Ga0207692_101185842 203
554 3300025898 Ga0207692_10165832 Ga0207692_101658322 203
555 3300025899 Ga0207642_10296466 Ga0207642_102964662 203
556 3300025901 Ga0207688_10006712 Ga0207688_100067122 203
557 3300025901 Ga0207688_10016999 Ga0207688_100169994 203
558 3300025901 Ga0207688_10028348 Ga0207688_100283484 203
559 3300025901 Ga0207688_10091145 Ga0207688_100911452 203
560 3300025903 Ga0207680_10006888 Ga0207680_100068883 203
561 3300025903 Ga0207680_10070344 Ga0207680_100703442 203
562 3300025903 Ga0207680_10640881 Ga0207680_106408812 203
563 3300025904 Ga0207647_10004861 Ga0207647_1000486111 203
564 3300025905 Ga0207685_10022911 Ga0207685_100229111 203
565 3300025906 Ga0207699_10023294 Ga0207699_100232943 203
566 3300025907 Ga0207645_10001573 Ga0207645_1000157324 203
567 3300025907 Ga0207645_10004457 Ga0207645_100044577 203
568 3300025907 Ga0207645_10006861 Ga0207645_100068618 203
569 3300025907 Ga0207645_10036418 Ga0207645_100364183 203
570 3300025907 Ga0207645_10175933 Ga0207645_101759332 203
571 3300025907 Ga0207645_10178030 Ga0207645_101780301 203
572 3300025908 Ga0207643_10194845 Ga0207643_101948452 203
573 3300025908 Ga0207643_10476174 Ga0207643_104761742 203
574 3300025909 Ga0207705_10075617 Ga0207705_100756172 203
575 3300025910 Ga0207684_10000337 Ga0207684_100003377 203
576 3300025910 Ga0207684_10011043 Ga0207684_100110434 203
577 3300025910 Ga0207684_10024895 Ga0207684_100248954 203
578 3300025910 Ga0207684_10075011 Ga0207684_100750114 203
579 3300025910 Ga0207684_10102137 Ga0207684_101021374 203
580 3300025910 Ga0207684_10104691 Ga0207684_101046912 203
581 3300025910 Ga0207684_10107589 Ga0207684_101075892 203
582 3300025910 Ga0207684_10111774 Ga0207684_101117742 203
583 3300025910 Ga0207684_10149719 Ga0207684_101497193 203
584 3300025910 Ga0207684_10509917 Ga0207684_105099172 203
585 3300025910 Ga0207684_10755332 Ga0207684_107553321 203
586 3300025911 Ga0207654_10196502 Ga0207654_101965022 203
587 3300025912 Ga0207707_10066916 Ga0207707_100669162 203
588 3300025914 Ga0207671_10669159 Ga0207671_106691592 203
589 3300025915 Ga0207693_10008693 Ga0207693_100086936 203
590 3300025915 Ga0207693_10015810 Ga0207693_100158103 203
591 3300025915 Ga0207693_10035674 Ga0207693_100356744 203
592 3300025915 Ga0207693_10038294 Ga0207693_100382944 203
593 3300025915 Ga0207693_10063349 Ga0207693_100633494 203
594 3300025915 Ga0207693_10084225 Ga0207693_100842252 203
595 3300025915 Ga0207693_10094418 Ga0207693_100944182 203
596 3300025915 Ga0207693_10213180 Ga0207693_102131802 203
597 3300025915 Ga0207693_10241245 Ga0207693_102412452 203
598 3300025915 Ga0207693_10659598 Ga0207693_106595981 203
599 3300025916 Ga0207663_10029098 Ga0207663_100290983 203
600 3300025916 Ga0207663_10031762 Ga0207663_100317622 203
601 3300025916 Ga0207663_10055206 Ga0207663_100552062 203
602 3300025916 Ga0207663_10177341 Ga0207663_101773412 203
603 3300025916 Ga0207663_10743878 Ga0207663_107438781 203
604 3300025917 Ga0207660_10022146 Ga0207660_100221464 203
605 3300025917 Ga0207660_10211559 Ga0207660_102115592 203
606 3300025918 Ga0207662_10042413 Ga0207662_100424132 203
607 3300025918 Ga0207662_10047832 Ga0207662_100478322 203
608 3300025918 Ga0207662_10298144 Ga0207662_102981442 203
609 3300025919 Ga0207657_10100597 Ga0207657_101005973 203
610 3300025919 Ga0207657_10204362 Ga0207657_102043622 203
611 3300025919 Ga0207657_10308443 Ga0207657_103084432 203
612 3300025920 Ga0207649_10042935 Ga0207649_100429352 203
613 3300025920 Ga0207649_10249863 Ga0207649_102498632 203
614 3300025921 Ga0207652_10068891 Ga0207652_100688913 203
615 3300025922 Ga0207646_10004682 Ga0207646_100046823 203
616 3300025922 Ga0207646_10008619 Ga0207646_1000861911 203
617 3300025922 Ga0207646_10053741 Ga0207646_100537414 203
618 3300025922 Ga0207646_10060600 Ga0207646_100606002 203
619 3300025922 Ga0207646_10066819 Ga0207646_100668193 203
620 3300025922 Ga0207646_10074837 Ga0207646_100748374 203
621 3300025922 Ga0207646_10113228 Ga0207646_101132281 203
622 3300025922 Ga0207646_10191083 Ga0207646_101910832 203
623 3300025922 Ga0207646_10208566 Ga0207646_102085661 203
624 3300025922 Ga0207646_10334473 Ga0207646_103344732 203
625 3300025923 Ga0207681_10027254 Ga0207681_100272543 203
626 3300025923 Ga0207681_10038451 Ga0207681_100384513 203
627 3300025923 Ga0207681_10048813 Ga0207681_100488134 203
628 3300025923 Ga0207681_10057878 Ga0207681_100578782 203
629 3300025923 Ga0207681_10466460 Ga0207681_104664602 203
630 3300025925 Ga0207650_10045346 Ga0207650_100453465 203
631 3300025925 Ga0207650_10073429 Ga0207650_100734293 203
632 3300025925 Ga0207650_10154225 Ga0207650_101542253 203
633 3300025925 Ga0207650_10576425 Ga0207650_105764251 203
634 3300025926 Ga0207659_10003753 Ga0207659_100037538 203
635 3300025926 Ga0207659_10011396 Ga0207659_100113966 203
636 3300025926 Ga0207659_10028169 Ga0207659_100281695 203
637 3300025926 Ga0207659_10166408 Ga0207659_101664083 203
638 3300025926 Ga0207659_10224742 Ga0207659_102247422 203
639 3300025926 Ga0207659_10372495 Ga0207659_103724952 203
640 3300025926 Ga0207659_11132218 Ga0207659_111322181 203
641 3300025927 Ga0207687_10242269 Ga0207687_102422692 203
642 3300025927 Ga0207687_10483870 Ga0207687_104838702 203
643 3300025927 Ga0207687_10756201 Ga0207687_107562012 203
644 3300025928 Ga0207700_10039447 Ga0207700_100394473 203
645 3300025928 Ga0207700_11091293 Ga0207700_110912931 203
646 3300025929 Ga0207664_10085388 Ga0207664_100853882 203
647 3300025929 Ga0207664_10121339 Ga0207664_101213392 203
648 3300025931 Ga0207644_10009749 Ga0207644_100097493 203
649 3300025931 Ga0207644_10039292 Ga0207644_100392922 203
650 3300025931 Ga0207644_10159115 Ga0207644_101591151 203
651 3300025931 Ga0207644_10463191 Ga0207644_104631912 203
652 3300025931 Ga0207644_10504218 Ga0207644_105042182 203
653 3300025932 Ga0207690_10001481 Ga0207690_1000148110 203
654 3300025932 Ga0207690_10025115 Ga0207690_100251154 203
655 3300025933 Ga0207706_10008614 Ga0207706_1000861410 203
656 3300025933 Ga0207706_10049321 Ga0207706_100493213 203
657 3300025933 Ga0207706_10091217 Ga0207706_100912173 203
658 3300025934 Ga0207686_10144712 Ga0207686_101447122 203
659 3300025936 Ga0207670_10003100 Ga0207670_100031007 203
660 3300025936 Ga0207670_10047628 Ga0207670_100476284 203
661 3300025936 Ga0207670_10097423 Ga0207670_100974234 203
662 3300025936 Ga0207670_10128534 Ga0207670_101285342 203
663 3300025936 Ga0207670_10150698 Ga0207670_101506983 203
664 3300025937 Ga0207669_10003408 Ga0207669_100034085 203
665 3300025937 Ga0207669_10010427 Ga0207669_100104275 203
666 3300025937 Ga0207669_10102661 Ga0207669_101026613 203
667 3300025937 Ga0207669_10151515 Ga0207669_101515152 203
668 3300025937 Ga0207669_10281672 Ga0207669_102816722 203
669 3300025937 Ga0207669_10334333 Ga0207669_103343332 203
670 3300025938 Ga0207704_10022744 Ga0207704_100227442 203
671 3300025938 Ga0207704_10118581 Ga0207704_101185811 203
672 3300025938 Ga0207704_10211105 Ga0207704_102111052 203
673 3300025939 Ga0207665_10011275 Ga0207665_100112754 203
674 3300025939 Ga0207665_10026896 Ga0207665_100268964 203
675 3300025939 Ga0207665_10035745 Ga0207665_100357452 203
676 3300025939 Ga0207665_10050971 Ga0207665_100509713 203
677 3300025939 Ga0207665_10064244 Ga0207665_100642443 203
678 3300025939 Ga0207665_10079786 Ga0207665_100797862 203
679 3300025939 Ga0207665_10117148 Ga0207665_101171483 203
680 3300025940 Ga0207691_10000945 Ga0207691_1000094523 203
681 3300025940 Ga0207691_10001082 Ga0207691_1000108226 203
682 3300025940 Ga0207691_10032280 Ga0207691_100322804 203
683 3300025940 Ga0207691_10227062 Ga0207691_102270621 203
684 3300025941 Ga0207711_10418830 Ga0207711_104188302 203
685 3300025942 Ga0207689_10064409 Ga0207689_100644094 203
686 3300025942 Ga0207689_10284739 Ga0207689_102847392 203
687 3300025944 Ga0207661_10007132 Ga0207661_1000713211 203
688 3300025944 Ga0207661_10026830 Ga0207661_100268304 203
689 3300025944 Ga0207661_10383409 Ga0207661_103834092 203
690 3300025944 Ga0207661_10394984 Ga0207661_103949842 203
691 3300025945 Ga0207679_10308419 Ga0207679_103084192 203
692 3300025945 Ga0207679_10612049 Ga0207679_106120492 203
693 3300025945 Ga0207679_11140952 Ga0207679_111409521 203
694 3300025949 Ga0207667_10425115 Ga0207667_104251152 203
695 3300025949 Ga0207667_10535635 Ga0207667_105356352 203
696 3300025960 Ga0207651_10020043 Ga0207651_100200434 203
697 3300025960 Ga0207651_10028201 Ga0207651_100282012 203
698 3300025960 Ga0207651_10277099 Ga0207651_102770992 203
699 3300025960 Ga0207651_10389769 Ga0207651_103897692 203
700 3300025960 Ga0207651_10775826 Ga0207651_107758261 203
701 3300025961 Ga0207712_10012291 Ga0207712_100122914 203
702 3300025961 Ga0207712_10040060 Ga0207712_100400604 203
703 3300025972 Ga0207668_10011932 Ga0207668_100119323 203
704 3300025972 Ga0207668_10056103 Ga0207668_100561032 203
705 3300025972 Ga0207668_10057537 Ga0207668_100575373 203
706 3300025972 Ga0207668_10133557 Ga0207668_101335573 203
707 3300025972 Ga0207668_10321354 Ga0207668_103213542 203
708 3300025972 Ga0207668_10583611 Ga0207668_105836111 203
709 3300025972 Ga0207668_10937950 Ga0207668_109379501 203
710 3300025986 Ga0207658_10004701 Ga0207658_100047014 203
711 3300025986 Ga0207658_10022282 Ga0207658_100222823 203
712 3300025986 Ga0207658_10067376 Ga0207658_100673762 203
713 3300025986 Ga0207658_10108410 Ga0207658_101084103 203
714 3300025986 Ga0207658_10208729 Ga0207658_102087293 203
715 3300025986 Ga0207658_10241487 Ga0207658_102414871 203
716 3300025986 Ga0207658_10412705 Ga0207658_104127052 203
717 3300026023 Ga0207677_10018031 Ga0207677_100180313 203
718 3300026023 Ga0207677_10133745 Ga0207677_101337452 203
719 3300026023 Ga0207677_10218686 Ga0207677_102186862 203
720 3300026023 Ga0207677_10902842 Ga0207677_109028422 203
721 3300026035 Ga0207703_10009368 Ga0207703_100093687 203
722 3300026035 Ga0207703_10200678 Ga0207703_102006782 203
723 3300026067 Ga0207678_10001585 Ga0207678_1000158518 203
724 3300026075 Ga0207708_10038619 Ga0207708_100386193 203
725 3300026078 Ga0207702_10210848 Ga0207702_102108482 203
726 3300026078 Ga0207702_10777103 Ga0207702_107771032 203
727 3300026088 Ga0207641_10012427 Ga0207641_100124274 203
728 3300026088 Ga0207641_10064327 Ga0207641_100643273 203
729 3300026088 Ga0207641_10084465 Ga0207641_100844654 203
730 3300026088 Ga0207641_11067914 Ga0207641_110679142 203
731 3300026089 Ga0207648_10024504 Ga0207648_100245046 203
732 3300026089 Ga0207648_10094602 Ga0207648_100946023 203
733 3300026089 Ga0207648_10122198 Ga0207648_101221981 203
734 3300026089 Ga0207648_10131773 Ga0207648_101317731 203
735 3300026089 Ga0207648_10791194 Ga0207648_107911941 203
736 3300026095 Ga0207676_10582979 Ga0207676_105829792 203
737 3300026118 Ga0207675_100154766 Ga0207675_1001547662 203
738 3300026121 Ga0207683_10017209 Ga0207683_100172093 203
739 3300026121 Ga0207683_10032547 Ga0207683_100325474 203
740 3300026121 Ga0207683_10086586 Ga0207683_100865862 203
741 3300026121 Ga0207683_10206441 Ga0207683_102064412 203
742 3300026121 Ga0207683_10235777 Ga0207683_102357772 203
743 3300026142 Ga0207698_10719248 Ga0207698_107192482 203
744 3300027682 Ga0209971_1085204 Ga0209971_10852041 203
745 3300027717 Ga0209998_10023187 Ga0209998_100231871 203
746 3300027876 Ga0209974_10009094 Ga0209974_100090942 203
747 3300027876 Ga0209974_10014068 Ga0209974_100140684 203
748 3300027876 Ga0209974_10036286 Ga0209974_100362862 203
749 3300028379 Ga0268266_10008218 Ga0268266_100082182 203
750 3300028379 Ga0268266_10012253 Ga0268266_100122537 203
751 3300028379 Ga0268266_10141314 Ga0268266_101413144 203
752 3300028379 Ga0268266_10188497 Ga0268266_101884972 203
753 3300028379 Ga0268266_10331437 Ga0268266_103314372 203
754 3300028380 Ga0268265_10303422 Ga0268265_103034222 203
755 3300028380 Ga0268265_10654136 Ga0268265_106541361 203
756 3300028381 Ga0268264_10016515 Ga0268264_100165152 203
757 3300028381 Ga0268264_10324411 Ga0268264_103244112 203
758 3300031456 Ga0307513_10052043 Ga0307513_100520434 203
759 3300035085 Ga0373929_0024211 Ga0373929_0024211_44_682 203
760 3300035111 Ga0373923_0126460 Ga0373923_0126460_27_638 203
761 3300035111 Ga0373923_0266310 Ga0373923_0266310_51_662 203
762 3300035116 Ga0373945_0020838 Ga0373945_0020838_296_907 203
763 3300035117 Ga0373953_0336164 Ga0373953_0336164_19_630 203
764 3300035118 Ga0373954_0262604 Ga0373954_0262604_153_764 203
765 3300035119 Ga0373956_0091350 Ga0373956_0091350_486_1097 203
766 3300035120 Ga0373957_0230837 Ga0373957_0230837_74_685 203
767 3300035170 Ga0373943_0033870 Ga0373943_0033870_1093_1704 203
768 3300035170 Ga0373943_0101304 Ga0373943_0101304_273_884 203
769 3300035171 Ga0373946_0040914 Ga0373946_0040914_731_1342 203
770 3300035171 Ga0373946_0064944 Ga0373946_0064944_296_907 203
771 3300035171 Ga0373946_0254646 Ga0373946_0254646_73_684 203
772 3300035172 Ga0373955_0055517 Ga0373955_0055517_1439_2050 203
773 3300035207 Ga0373942_0139937 Ga0373942_0139937_147_758 203
774 3300035242 Ga0373962_0058122 Ga0373962_0058122_55_666 203
775 3300035410 Ga0373924_0084042 Ga0373924_0084042_413_1024 203
776 3300035410 Ga0373924_0109499 Ga0373924_0109499_260_871 203
777 3300035691 Ga0373931_0015102 Ga0373931_0015102_2289_2900 203
778 3300035691 Ga0373931_0043088 Ga0373931_0043088_872_1510 203
779 3300035691 Ga0373931_0130682 Ga0373931_0130682_603_1214 203
780 3300035691 Ga0373931_0667840 Ga0373931_0667840_35_646 203
781 3300035692 Ga0373935_0091805 Ga0373935_0091805_624_1235 203
782 3300035692 Ga0373935_0173486 Ga0373935_0173486_659_1270 203
783 3300035692 Ga0373935_0256526 Ga0373935_0256526_492_1103 203
784 3300035695 Ga0373927_0076041 Ga0373927_0076041_1432_2043 203
785 3300035695 Ga0373927_0100471 Ga0373927_0100471_1165_1776 203
786 3300035695 Ga0373927_0117968 Ga0373927_0117968_442_1053 203
787 3300035695 Ga0373927_0180641 Ga0373927_0180641_34_645 203
788 3300035695 Ga0373927_0246803 Ga0373927_0246803_453_1064 203
789 3300035724 Ga0373933_0082536 Ga0373933_0082536_564_1175 203
790 3300035724 Ga0373933_0124804 Ga0373933_0124804_466_1077 203
791 3300035725 Ga0373947_0143887 Ga0373947_0143887_465_1076 203
792 3300035725 Ga0373947_0169472 Ga0373947_0169472_137_748 203
793 3300036401 Ga0373937_0114240 Ga0373937_0114240_1322_1933 203
794 3300036401 Ga0373937_0423624 Ga0373937_0423624_372_983 203
795 3300036401 Ga0373937_0502707 Ga0373937_0502707_426_1037 203
796 3300037068 Ga0373925_0010936 Ga0373925_0010936_3599_4210 203
797 3300037068 Ga0373925_0173166 Ga0373925_0173166_787_1398 203
798 3300037312 Ga0395899_0202269 Ga0395899_0202269_138_749 203
799 3300037312 Ga0395899_0207320 Ga0395899_0207320_681_1292 203
800 3300037418 Ga0395900_0090143 Ga0395900_0090143_1447_2058 203
801 3300037418 Ga0395900_0124762 Ga0395900_0124762_1936_2547 203
802 3300037466 Ga0395898_0032973 Ga0395898_0032973_2116_2727 203
803 3300037466 Ga0395898_0426733 Ga0395898_0426733_640_1251 203
804 3300038443 Ga0395901_0001548 Ga0395901_0001548_6754_7365 203
805 3300038443 Ga0395901_0003735 Ga0395901_0003735_883_1494 203
806 3300038443 Ga0395901_0378666 Ga0395901_0378666_834_1445 203
807 3300038443 Ga0395901_0724371 Ga0395901_0724371_276_887 203
808 3300038443 Ga0395901_1135387 Ga0395901_1135387_98_709 203
809 3300041486 Ga0451807_1769662 Ga0451807_1769662_237_848 203
810 3300041496 Ga0451839_1404823 Ga0451839_1404823_176_787 203
811 3300041512 Ga0451853_0577735 Ga0451853_0577735_523_1134 203
812 3300041512 Ga0451853_4098400 Ga0451853_4098400_218_829 203
813 3300042005 Ga0439448_0018515 Ga0439448_0018515_223_834 203
814 3300042008 Ga0439450_075403 Ga0439450_075403_130_741 203
815 3300042009 Ga0439451_040672 Ga0439451_040672_163_774 203
816 3300042012 Ga0439455_0000520 Ga0439455_0000520_122_733 203
817 3300042012 Ga0439455_0015615 Ga0439455_0015615_767_1378 203
818 3300042157 Ga0439458_0014766 Ga0439458_0014766_597_1208 203
819 3300045051 Ga0451576_0279364 Ga0451576_0279364_945_1556 203
820 3300045976 Ga0466967_0563433 Ga0466967_0563433_435_1046 203
821 3300046454 Ga0495592_0221815 Ga0495592_0221815_67_678 203
822 3300046462 Ga0495651_0014117 Ga0495651_0014117_4477_5088 203
823 3300046472 Ga0495580_0250338 Ga0495580_0250338_249_860 203
824 3300046474 Ga0495605_0090490 Ga0495605_0090490_189_800 203
825 3300046476 Ga0495662_0272770 Ga0495662_0272770_159_770 203
826 3300046491 Ga0495584_0108807 Ga0495584_0108807_759_1370 203
827 3300046491 Ga0495584_0161081 Ga0495584_0161081_442_1053 203
828 3300046491 Ga0495584_0303464 Ga0495584_0303464_121_732 203
829 3300046492 Ga0495585_0028725 Ga0495585_0028725_89_700 203
830 3300046516 Ga0495628_0123486 Ga0495628_0123486_327_938 203
831 3300046517 Ga0495630_0142315 Ga0495630_0142315_1141_1752 203
832 3300046525 Ga0495663_0037248 Ga0495663_0037248_161_772 203
833 3300046528 Ga0495642_0077726 Ga0495642_0077726_662_1273 203
834 3300046529 Ga0495652_0048747 Ga0495652_0048747_2399_3010 203
835 3300046536 Ga0495587_0147204 Ga0495587_0147204_351_962 203
836 3300046537 Ga0495598_0009934 Ga0495598_0009934_1332_1970 203
837 3300046537 Ga0495598_0012805 Ga0495598_0012805_1007_1618 203
838 3300046537 Ga0495598_0122913 Ga0495598_0122913_94_705 203
839 3300046543 Ga0495645_0006709 Ga0495645_0006709_2470_3081 203
840 3300046543 Ga0495645_0094370 Ga0495645_0094370_1391_2002 203
841 3300046559 Ga0495667_0087550 Ga0495667_0087550_362_973 203
842 3300046559 Ga0495667_0214586 Ga0495667_0214586_173_784 203
843 3300046642 Ga0495634_0029418 Ga0495634_0029418_2604_3215 203
844 3300046663 Ga0495635_0357877 Ga0495635_0357877_219_860 203
845 3300046664 Ga0495659_0022858 Ga0495659_0022858_204_815 203
846 3300046664 Ga0495659_0191686 Ga0495659_0191686_91_729 203
847 3300046665 Ga0495661_0216664 Ga0495661_0216664_123_734 203
848 3300046674 Ga0495588_0176558 Ga0495588_0176558_61_672 203
849 3300046675 Ga0495657_0193567 Ga0495657_0193567_65_751 203
850 3300046675 Ga0495657_0354579 Ga0495657_0354579_193_804 203
851 3300046678 Ga0495599_0002744 Ga0495599_0002744_6037_6648 203
852 3300046679 Ga0495623_0042456 Ga0495623_0042456_907_1518 203
853 3300046681 Ga0495647_0099853 Ga0495647_0099853_522_1160 203
854 3300046683 Ga0495658_0083075 Ga0495658_0083075_297_908 203
855 3300046684 Ga0495669_0017438 Ga0495669_0017438_1502_2113 203
856 3300046684 Ga0495669_0047039 Ga0495669_0047039_816_1427 203
857 3300046684 Ga0495669_0074203 Ga0495669_0074203_378_989 203
858 3300046684 Ga0495669_0192932 Ga0495669_0192932_56_694 203
859 3300046689 Ga0495613_0501925 Ga0495613_0501925_126_737 203
860 3300046690 Ga0495624_0122878 Ga0495624_0122878_328_939 203
861 3300047319 Ga0495674_0231750 Ga0495674_0231750_441_1052 203
862 3300047319 Ga0495674_0583287 Ga0495674_0583287_105_716 203
863 3300047322 Ga0495680_0297735 Ga0495680_0297735_270_881 203
864 3300047322 Ga0495680_0393522 Ga0495680_0393522_257_868 203
865 3300047323 Ga0495683_0153094 Ga0495683_0153094_427_1038 203
866 3300047444 Ga0495675_0059492 Ga0495675_0059492_1289_1900 203
867 3300047444 Ga0495675_0154776 Ga0495675_0154776_753_1364 203
868 3300047470 Ga0495681_0108882 Ga0495681_0108882_293_904 203
869 3300047471 Ga0495684_0010873 Ga0495684_0010873_253_864 203
870 3300047471 Ga0495684_0037920 Ga0495684_0037920_1003_1614 203
871 3300048088 Ga0495602_0107304 Ga0495602_0107304_1164_1775 203
872 3300048903 Ga0496100_0046887 Ga0496100_0046887_318_929 203
873 3300048903 Ga0496100_0063145 Ga0496100_0063145_401_1012 203
874 3300048903 Ga0496100_0443269 Ga0496100_0443269_148_759 203
875 3300048904 Ga0496101_0000422 Ga0496101_0000422_1863_2474 203
876 3300048904 Ga0496101_0124446 Ga0496101_0124446_248_859 203
877 3300048905 Ga0496102_0054945 Ga0496102_0054945_364_975 203
878 3300048905 Ga0496102_0097697 Ga0496102_0097697_1539_2150 203
879 3300048905 Ga0496102_0291428 Ga0496102_0291428_506_1117 203
880 3300048905 Ga0496102_0389554 Ga0496102_0389554_30_641 203
881 3300048906 Ga0496103_0031615 Ga0496103_0031615_575_1186 203
882 3300048907 Ga0496104_0054985 Ga0496104_0054985_3014_3625 203
883 3300048907 Ga0496104_0065707 Ga0496104_0065707_1670_2281 203
884 3300048907 Ga0496104_0166797 Ga0496104_0166797_1086_1724 203
885 3300048907 Ga0496104_0228305 Ga0496104_0228305_878_1489 203
886 3300048907 Ga0496104_0265953 Ga0496104_0265953_207_818 203
887 3300048908 Ga0496105_0133891 Ga0496105_0133891_1076_1687 203
888 3300048908 Ga0496105_0142286 Ga0496105_0142286_48_659 203
889 3300048908 Ga0496105_0212441 Ga0496105_0212441_361_999 203
890 3300048909 Ga0496106_0234696 Ga0496106_0234696_379_990 203
891 3300048909 Ga0496106_0298970 Ga0496106_0298970_65_676 203
892 3300048909 Ga0496106_0327013 Ga0496106_0327013_367_978 203
893 3300048909 Ga0496106_0421414 Ga0496106_0421414_356_967 203
894 3300048910 Ga0496107_0010651 Ga0496107_0010651_4399_5010 203
895 3300048910 Ga0496107_0187658 Ga0496107_0187658_485_1096 203
896 3300048910 Ga0496107_0845781 Ga0496107_0845781_26_637 203
897 3300048911 Ga0496108_0334790 Ga0496108_0334790_88_699 203
898 3300048911 Ga0496108_0521243 Ga0496108_0521243_10_621 203
899 3300048911 Ga0496108_0990047 Ga0496108_0990047_50_661 203
900 3300048912 Ga0496109_0005026 Ga0496109_0005026_8561_9172 203
901 3300048912 Ga0496109_0246726 Ga0496109_0246726_752_1363 203
902 3300048912 Ga0496109_0254926 Ga0496109_0254926_389_1000 203
903 3300048912 Ga0496109_0352420 Ga0496109_0352420_312_923 203
904 3300048912 Ga0496109_0458599 Ga0496109_0458599_489_1100 203
905 3300048912 Ga0496109_0533444 Ga0496109_0533444_431_1042 203
906 3300048912 Ga0496109_0745718 Ga0496109_0745718_274_885 203
907 3300048913 Ga0496110_0064443 Ga0496110_0064443_1057_1668 203
908 3300048913 Ga0496110_0076702 Ga0496110_0076702_33_644 203
909 3300048913 Ga0496110_0237909 Ga0496110_0237909_963_1574 203
910 3300048913 Ga0496110_0586688 Ga0496110_0586688_50_661 203
911 3300048914 Ga0496111_0078935 Ga0496111_0078935_148_759 203
912 3300048914 Ga0496111_0216760 Ga0496111_0216760_563_1174 203
913 3300048915 Ga0496112_0020455 Ga0496112_0020455_825_1436 203
914 3300048915 Ga0496112_0034027 Ga0496112_0034027_582_1193 203
915 3300048915 Ga0496112_0096332 Ga0496112_0096332_1715_2326 203
916 3300048915 Ga0496112_0205981 Ga0496112_0205981_793_1404 203
917 3300048915 Ga0496112_0276295 Ga0496112_0276295_459_1070 203
918 3300048915 Ga0496112_0298988 Ga0496112_0298988_239_850 203
919 3300048915 Ga0496112_0676835 Ga0496112_0676835_17_628 203
920 3300048916 Ga0496113_0040430 Ga0496113_0040430_1071_1682 203
921 3300048916 Ga0496113_0152026 Ga0496113_0152026_220_831 203
922 3300048918 Ga0496115_0006139 Ga0496115_0006139_2521_3132 203
923 3300048918 Ga0496115_0059623 Ga0496115_0059623_2072_2683 203
924 3300048918 Ga0496115_0208927 Ga0496115_0208927_983_1594 203
925 3300048918 Ga0496115_0288015 Ga0496115_0288015_696_1307 203
926 3300050507 nmdc:mga05p37_160571_c1 nmdc:mga05p37_160571_c1_432_1070 203
927 3300050507 nmdc:mga05p37_4003_c1 nmdc:mga05p37_4003_c1_6389_7000 203
928 3300050511 nmdc:mga08y16_570412_c1 nmdc:mga08y16_570412_c1_216_827 203
929 3300050513 nmdc:mga0rr50_1021417_c1 nmdc:mga0rr50_1021417_c1_68_679 203
930 3300050513 nmdc:mga0rr50_285548_c1 nmdc:mga0rr50_285548_c1_650_1261 203
931 3300050514 nmdc:mga08x19_148929_c1 nmdc:mga08x19_148929_c1_836_1447 203
932 3300050514 nmdc:mga08x19_215332_c1 nmdc:mga08x19_215332_c1_454_1065 203
933 3300050515 nmdc:mga0a205_881180_c1 nmdc:mga0a205_881180_c1_118_729 203
934 3300050515 nmdc:mga0a205_938600_c1 nmdc:mga0a205_938600_c1_79_690 203
935 3300053077 Ga0495601_0003313 Ga0495601_0003313_8276_8887 203
936 3300053077 Ga0495601_0035889 Ga0495601_0035889_1245_1856 203
937 3300053084 Ga0495595_0344038 Ga0495595_0344038_70_681 203
938 3300053085 Ga0495619_0616924 Ga0495619_0616924_93_704 203

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04542

Sigma70_r2

Sigma-70 region 2

32

100

0.98

PF04545

Sigma70_r4

Sigma-70, region 4

145

194

0.98

PF08281

Sigma70_r4_2

Sigma-70, region 4

139

192

0.97

PF07638

Sigma70_ECF

ECF sigma factor

9

198

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bhy-assembly1.cif.gz_B dna-binding domain of deor in complex with the dna operator 0.974 156 191
3vep-assembly4.cif.gz_H crystal structure of sigd4 in complex with its negative regulator rsda 0.9619 140 194
4lup-assembly2.cif.gz_C crystal structure of the complex formed by region of e. coli sigmae bound to its -10 element non template strand 0.9609 10 102
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9586 137 192
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9556 137 192
ID Description Score Start End Superfamily
1or7B01 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9806 15 96 1.10.1740.10
3vepH00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9682 143 194 1.10.10.10
2o8xC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9672 140 192 1.10.10.10
4lupA00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9672 12 102 1.10.1740.10
3vepE00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9634 143 196 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V6H3B2-F1-model_v4 RNA polymerase subunit sigma 0.9331 1 97 GO:0006352
GO:0016987
AF-A0A2V6H3B2-F1-model_v4 RNA polymerase subunit sigma 0.9143 1 97 GO:0006352
GO:0016987
AF-A0A2V5L354-F1-model_v4 RNA polymerase subunit sigma 0.8487 1 112 GO:0006352
GO:0016987
AF-A0A2V5L354-F1-model_v4 RNA polymerase subunit sigma 0.8414 1 112 GO:0006352
GO:0016987
AF-A0A534N7F4-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.761 7 126 GO:0006352
GO:0016987

Feature Viewer

pLDDT pTM Quality
83.35 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map