F486258

General Info

Members Datasets Scaffolds Average Seq Length
938 393 1876 98

Family's Representative Sequence

Representative Sequence 3300044706|Ga0466964_0105434|Ga0466964_0105434_59_418
Length 119
Sequence VGALARRERGRAAAGAGKGGVMSLHPAQILIKPVVSEKSYHQITENRYTFKVHKDAHKTQIRQAVEELFEVKVVSVNVVKMPAKPKRRGMTKGTQSGWKKAIVELKAGDTIEIFEGAQL

Samples

Sample ID Description Type Environment
1 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
99 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
102 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
161 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
162 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
163 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
164 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
165 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
166 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
169 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
170 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
171 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
172 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
173 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
174 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
175 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
176 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
195 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
196 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
197 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
198 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
199 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
200 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
201 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
202 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
203 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
204 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
205 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
206 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
220 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
221 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
222 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
223 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
224 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
225 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
226 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
227 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
228 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
229 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
230 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
231 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
232 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
233 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
234 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
235 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
236 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
237 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
238 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
239 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
240 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
241 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
242 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
243 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
244 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
245 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
246 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
247 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
248 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
249 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
250 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
251 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
252 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
253 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
254 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
255 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
256 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
257 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
258 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
259 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
260 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
261 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
262 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
263 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
264 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
265 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
266 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
267 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
268 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
269 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
272 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
273 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
274 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
275 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
276 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
277 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
278 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
279 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
280 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
281 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
282 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
283 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
284 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
285 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
286 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
287 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
288 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
289 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
290 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
291 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
292 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
293 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
294 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
295 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
296 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
297 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
298 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
299 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
300 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
301 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
302 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
303 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
304 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
305 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
306 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
307 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
308 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
309 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
310 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
311 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
312 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
313 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
314 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
315 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
316 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
317 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
318 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
319 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
320 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
321 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
322 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
323 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
324 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
325 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
326 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
327 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
328 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
329 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
330 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
343 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
344 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
345 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
346 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
347 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
348 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
349 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
350 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
351 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
352 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
353 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
354 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
355 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
356 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
357 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
358 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
361 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
362 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
363 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
364 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
365 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
366 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
367 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
368 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
369 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
370 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
371 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
372 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
373 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
374 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
392 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
393 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.7
Metatranscriptomes 3.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 7.36
Rhizosphere 91.9
Stem 0
Stem Tuber 0
Unclassified 1.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466964_0105434 3300044706 Bacteria 1249
2 Ga0058862_12513208 3300004803 Bacteria 648
3 Ga0070658_10129125 3300005327 Bacteria 2105
4 Ga0070683_100370415 3300005329 Bacteria 1364
5 Ga0070683_100896320 3300005329 Bacteria 851
6 Ga0070666_10792227 3300005335 Bacteria 698
7 Ga0070680_100102008 3300005336 Bacteria 2382
8 Ga0070680_100235830 3300005336 Bacteria 1546
9 Ga0070682_100432012 3300005337 Bacteria 1004
10 Ga0070682_100442268 3300005337 Bacteria 994
11 Ga0068868_100363719 3300005338 Bacteria 1242
12 Ga0068868_100748772 3300005338 Bacteria 878
13 Ga0068868_100908393 3300005338 Bacteria 801
14 Ga0068868_101006419 3300005338 Bacteria 763
15 Ga0070660_100197424 3300005339 Bacteria 1631
16 Ga0070691_10061930 3300005341 Bacteria 1801
17 Ga0070691_10218997 3300005341 Bacteria 1008
18 Ga0070691_10270110 3300005341 Bacteria 919
19 Ga0070687_100078432 3300005343 Bacteria 1795
20 Ga0070687_100777720 3300005343 Bacteria 676
21 Ga0070661_100294553 3300005344 Bacteria 1262
22 Ga0070661_100435253 3300005344 Bacteria 1041
23 Ga0070661_101887956 3300005344 Bacteria 508
24 Ga0070669_101141892 3300005353 Bacteria 672
25 Ga0070669_101953349 3300005353 Bacteria 513
26 Ga0070671_101222235 3300005355 Bacteria 662
27 Ga0070674_101170412 3300005356 Bacteria 681
28 Ga0070688_100725808 3300005365 Bacteria 771
29 Ga0070659_100110245 3300005366 Bacteria 2221
30 Ga0070659_100501127 3300005366 Bacteria 1035
31 Ga0070667_101452144 3300005367 Bacteria 644
32 Ga0070709_10028862 3300005434 Bacteria 3312
33 Ga0070709_10164035 3300005434 Bacteria 1547
34 Ga0070709_10188355 3300005434 Bacteria 1454
35 Ga0070714_100056543 3300005435 Bacteria 3356
36 Ga0070714_100059769 3300005435 Bacteria 3269
37 Ga0070714_100077238 3300005435 Bacteria 2892
38 Ga0070714_100105023 3300005435 Bacteria 2493
39 Ga0070714_100283994 3300005435 Bacteria 1539
40 Ga0070714_100555310 3300005435 Bacteria 1100
41 Ga0070714_100770655 3300005435 Bacteria 931
42 Ga0070714_100960920 3300005435 Bacteria 831
43 Ga0070713_100097613 3300005436 Bacteria 2539
44 Ga0070713_100459845 3300005436 Bacteria 1196
45 Ga0070710_10005822 3300005437 Bacteria 5879
46 Ga0070710_10167643 3300005437 Bacteria 1366
47 Ga0070701_11144916 3300005438 Bacteria 550
48 Ga0070711_100043043 3300005439 Bacteria 3056
49 Ga0070711_100709271 3300005439 Bacteria 848
50 Ga0070711_101042357 3300005439 Bacteria 703
51 Ga0070711_101472117 3300005439 Bacteria 594
52 Ga0070705_100649209 3300005440 Bacteria 822
53 Ga0070700_100084563 3300005441 Bacteria 2056
54 Ga0070708_101302718 3300005445 Bacteria 679
55 Ga0070663_100234715 3300005455 Bacteria 1445
56 Ga0070663_100795047 3300005455 Bacteria 811
57 Ga0070678_100421481 3300005456 Bacteria 1164
58 Ga0070678_100957821 3300005456 Unclassified 785
59 Ga0070662_101055438 3300005457 Bacteria 696
60 Ga0070662_101234788 3300005457 Bacteria 643
61 Ga0070681_10127620 3300005458 Bacteria 2476
62 Ga0070681_10168346 3300005458 Bacteria 2113
63 Ga0070681_10223330 3300005458 Bacteria 1799
64 Ga0070681_10223401 3300005458 Bacteria 1798
65 Ga0068867_100405633 3300005459 Bacteria 1151
66 Ga0070685_10637400 3300005466 Unclassified 771
67 Ga0070685_10861543 3300005466 Bacteria 672
68 Ga0070707_100001557 3300005468 Bacteria 22299
69 Ga0070707_100266830 3300005468 Bacteria 1665
70 Ga0070698_100849043 3300005471 Bacteria 858
71 Ga0070679_100324484 3300005530 Bacteria 1488
72 Ga0070679_100392558 3300005530 Bacteria 1334
73 Ga0070684_100218577 3300005535 Bacteria 1738
74 Ga0070684_100352112 3300005535 Bacteria 1355
75 Ga0070684_100553428 3300005535 Bacteria 1068
76 Ga0070684_100864220 3300005535 Bacteria 847
77 Ga0070684_101183869 3300005535 Bacteria 719
78 Ga0070695_100001595 3300005545 Bacteria 12688
79 Ga0070665_100427482 3300005548 Bacteria 1333
80 Ga0068855_100177324 3300005563 Bacteria 2410
81 Ga0068855_100718550 3300005563 Bacteria 1068
82 Ga0068855_102429229 3300005563 Bacteria 523
83 Ga0070664_100072110 3300005564 Bacteria 2961
84 Ga0070664_100810128 3300005564 Bacteria 876
85 Ga0070664_101987995 3300005564 Bacteria 552
86 Ga0068854_100330579 3300005578 Bacteria 1242
87 Ga0068856_100225532 3300005614 Bacteria 1889
88 Ga0068856_100267427 3300005614 Bacteria 1725
89 Ga0068856_100515783 3300005614 Bacteria 1216
90 Ga0070702_100005631 3300005615 Bacteria 5858
91 Ga0070702_100253720 3300005615 Bacteria 1194
92 Ga0070702_101450514 3300005615 Bacteria 563
93 Ga0068852_100227666 3300005616 Bacteria 1776
94 Ga0068859_100119417 3300005617 Bacteria 2703
95 Ga0068864_100096261 3300005618 Bacteria 2619
96 Ga0068866_10057880 3300005718 Bacteria 1999
97 Ga0068861_101533561 3300005719 Bacteria 655
98 Ga0068870_10062303 3300005840 Bacteria 2008
99 Ga0068863_100353207 3300005841 Bacteria 1432
100 Ga0068858_100115450 3300005842 Bacteria 2509
101 Ga0068858_100949432 3300005842 Bacteria 842
102 Ga0068860_102073695 3300005843 Bacteria 590
103 Ga0081455_10074026 3300005937 Bacteria 2814
104 Ga0081455_10096946 3300005937 Bacteria 2377
105 Ga0081455_10353406 3300005937 Bacteria 1036
106 Ga0081538_10030998 3300005981 Bacteria 3617
107 Ga0081538_10034025 3300005981 Bacteria 3379
108 Ga0081539_10161609 3300005985 Bacteria 1067
109 Ga0070717_10026635 3300006028 Bacteria 4614
110 Ga0070717_10096339 3300006028 Bacteria 2506
111 Ga0070717_10096495 3300006028 Bacteria 2504
112 Ga0070717_10442590 3300006028 Bacteria 1170
113 Ga0075365_10212128 3300006038 Bacteria 1357
114 Ga0075364_10511503 3300006051 Bacteria 821
115 Ga0075432_10169267 3300006058 Bacteria 849
116 Ga0070715_10005967 3300006163 Bacteria 4108
117 Ga0070715_10113250 3300006163 Bacteria 1283
118 Ga0070716_100070921 3300006173 Bacteria 2047
119 Ga0070716_100104618 3300006173 Bacteria 1743
120 Ga0070716_100682625 3300006173 Bacteria 782
121 Ga0070716_101081207 3300006173 Bacteria 639
122 Ga0070716_101257302 3300006173 Bacteria 597
123 Ga0070712_100047985 3300006175 Bacteria 2958
124 Ga0070712_100063501 3300006175 Bacteria 2615
125 Ga0070712_100882128 3300006175 Bacteria 771
126 Ga0070712_101187638 3300006175 Bacteria 663
127 Ga0097621_100653875 3300006237 Bacteria 965
128 Ga0097621_100763387 3300006237 Bacteria 894
129 Ga0068871_100415161 3300006358 Bacteria 1201
130 Ga0068871_101478047 3300006358 Bacteria 642
131 Ga0075428_101458411 3300006844 Bacteria 717
132 Ga0075431_101685743 3300006847 Bacteria 591
133 Ga0075433_10153434 3300006852 Bacteria 2049
134 Ga0075429_101874775 3300006880 Bacteria 520
135 Ga0068865_100421386 3300006881 Bacteria 1098
136 Ga0097620_100119408 3300006931 Bacteria 2703
137 Ga0075435_101006573 3300007076 Bacteria 728
138 Ga0105240_10128107 3300009093 Bacteria 3047
139 Ga0111539_10217483 3300009094 Bacteria 2225
140 Ga0111539_11694447 3300009094 Bacteria 733
141 Ga0105245_10091016 3300009098 Bacteria 2807
142 Ga0105245_11052678 3300009098 Bacteria 859
143 Ga0105245_12076983 3300009098 Bacteria 622
144 Ga0105245_12327919 3300009098 Bacteria 589
145 Ga0105245_12976242 3300009098 Bacteria 525
146 Ga0105247_10230852 3300009101 Bacteria 1256
147 Ga0105247_11287676 3300009101 Bacteria 586
148 Ga0114129_11008000 3300009147 Bacteria 1048
149 Ga0114129_11010623 3300009147 Bacteria 1047
150 Ga0105243_10085476 3300009148 Bacteria 2586
151 Ga0105243_10555802 3300009148 Bacteria 1097
152 Ga0105241_10772790 3300009174 Bacteria 883
153 Ga0105241_11810639 3300009174 Bacteria 596
154 Ga0105242_10689819 3300009176 Bacteria 998
155 Ga0105242_10967178 3300009176 Bacteria 857
156 Ga0105248_10181619 3300009177 Bacteria 2371
157 Ga0105248_11188175 3300009177 Bacteria 862
158 Ga0105248_11533987 3300009177 Bacteria 754
159 Ga0105237_10288496 3300009545 Bacteria 1644
160 Ga0105237_12161344 3300009545 Bacteria 566
161 Ga0105237_12189820 3300009545 Bacteria 562
162 Ga0105238_10078095 3300009551 Bacteria 3301
163 Ga0105238_10363513 3300009551 Bacteria 1437
164 Ga0105249_11103273 3300009553 Bacteria 864
165 Ga0105249_12291076 3300009553 Bacteria 613
166 Ga0105239_12001561 3300010375 Bacteria 672
167 Ga0105239_12107478 3300010375 Bacteria 655
168 Ga0105239_12689728 3300010375 Bacteria 580
169 Ga0105239_13607146 3300010375 Bacteria 503
170 Ga0105246_10050833 3300011119 Bacteria 2844
171 Ga0105246_11976188 3300011119 Bacteria 562
172 Ga0157373_10489500 3300013100 Bacteria 888
173 Ga0157371_10627397 3300013102 Bacteria 801
174 Ga0157370_11176455 3300013104 Bacteria 692
175 Ga0157369_10745475 3300013105 Bacteria 1008
176 Ga0157369_10893379 3300013105 Bacteria 911
177 Ga0157374_10218951 3300013296 Bacteria 1868
178 Ga0157374_11330808 3300013296 Bacteria 741
179 Ga0157374_12727037 3300013296 Bacteria 522
180 Ga0163162_10235751 3300013306 Bacteria 1960
181 Ga0163162_10421942 3300013306 Bacteria 1466
182 Ga0157372_10092283 3300013307 Bacteria 3444
183 Ga0157372_10394922 3300013307 Bacteria 1612
184 Ga0157372_10579413 3300013307 Bacteria 1308
185 Ga0157372_10720578 3300013307 Bacteria 1160
186 Ga0157372_11284238 3300013307 Bacteria 845
187 Ga0157375_12023917 3300013308 Bacteria 685
188 Ga0157380_10513528 3300014326 Bacteria 1167
189 Ga0157380_10637294 3300014326 Bacteria 1061
190 Ga0157379_11136506 3300014968 Bacteria 749
191 Ga0157379_12015990 3300014968 Bacteria 570
192 Ga0157376_10217879 3300014969 Bacteria 1766
193 Ga0157376_11619526 3300014969 Bacteria 682
194 Ga0182005_1051686 3300015265 Bacteria 1118
195 Ga0197907_10026626 3300020069 Bacteria 1330
196 Ga0197907_10678466 3300020069 Bacteria 1297
197 Ga0206356_10605300 3300020070 Bacteria 774
198 Ga0206355_1424902 3300020076 Bacteria 737
199 Ga0206355_1506274 3300020076 Bacteria 537
200 Ga0206352_10068973 3300020078 Bacteria 667
201 Ga0206350_11082515 3300020080 Bacteria 797
202 Ga0206353_10705410 3300020082 Bacteria 998
203 Ga0206353_10963865 3300020082 Bacteria 1252
204 Ga0224712_10017227 3300022467 Bacteria 2392
205 Ga0224712_10390005 3300022467 Bacteria 663
206 Ga0207692_10004596 3300025898 Bacteria 5474
207 Ga0207692_10098877 3300025898 Bacteria 1598
208 Ga0207642_10225697 3300025899 Bacteria 1049
209 Ga0207688_10079443 3300025901 Bacteria 1871
210 Ga0207688_10820376 3300025901 Bacteria 589
211 Ga0207647_10401665 3300025904 Bacteria 772
212 Ga0207699_10002466 3300025906 Bacteria 8728
213 Ga0207699_10169674 3300025906 Bacteria 1459
214 Ga0207699_10420751 3300025906 Bacteria 954
215 Ga0207699_10793224 3300025906 Bacteria 696
216 Ga0207645_11147044 3300025907 Bacteria 523
217 Ga0207643_10134240 3300025908 Bacteria 1474
218 Ga0207643_10913133 3300025908 Bacteria 569
219 Ga0207705_10013304 3300025909 Bacteria 5938
220 Ga0207705_10106205 3300025909 Bacteria 2070
221 Ga0207705_10207196 3300025909 Bacteria 1487
222 Ga0207654_10584402 3300025911 Bacteria 796
223 Ga0207707_10431618 3300025912 Bacteria 1128
224 Ga0207707_10597725 3300025912 Bacteria 934
225 Ga0207707_11506543 3300025912 Bacteria 533
226 Ga0207695_10019365 3300025913 Bacteria 7837
227 Ga0207695_10235810 3300025913 Bacteria 1732
228 Ga0207695_10372458 3300025913 Bacteria 1314
229 Ga0207671_10076739 3300025914 Bacteria 2501
230 Ga0207693_10010040 3300025915 Bacteria 7692
231 Ga0207693_10013941 3300025915 Bacteria 6473
232 Ga0207693_10487206 3300025915 Bacteria 963
233 Ga0207693_10859425 3300025915 Bacteria 697
234 Ga0207663_10001658 3300025916 Bacteria 10492
235 Ga0207663_10035718 3300025916 Bacteria 2984
236 Ga0207663_10405578 3300025916 Bacteria 1043
237 Ga0207663_11256590 3300025916 Bacteria 596
238 Ga0207660_10084392 3300025917 Bacteria 2341
239 Ga0207660_10424304 3300025917 Bacteria 1073
240 Ga0207662_10155303 3300025918 Bacteria 1458
241 Ga0207657_10102802 3300025919 Bacteria 2369
242 Ga0207657_10255329 3300025919 Bacteria 1396
243 Ga0207657_10371965 3300025919 Bacteria 1126
244 Ga0207649_10142620 3300025920 Bacteria 1641
245 Ga0207652_10187288 3300025921 Bacteria 1861
246 Ga0207652_10436119 3300025921 Bacteria 1181
247 Ga0207652_10674724 3300025921 Bacteria 923
248 Ga0207646_10000851 3300025922 Bacteria 39515
249 Ga0207646_10195739 3300025922 Bacteria 1825
250 Ga0207681_10306243 3300025923 Bacteria 1259
251 Ga0207681_10598453 3300025923 Bacteria 911
252 Ga0207694_10781720 3300025924 Bacteria 806
253 Ga0207650_11638263 3300025925 Bacteria 546
254 Ga0207687_10030470 3300025927 Bacteria 3638
255 Ga0207687_10096683 3300025927 Bacteria 2165
256 Ga0207687_10666309 3300025927 Bacteria 881
257 Ga0207700_10017072 3300025928 Bacteria 4837
258 Ga0207700_10399445 3300025928 Bacteria 1204
259 Ga0207700_10412395 3300025928 Bacteria 1185
260 Ga0207664_10007639 3300025929 Bacteria 7500
261 Ga0207664_10034818 3300025929 Bacteria 3881
262 Ga0207664_10115407 3300025929 Bacteria 2239
263 Ga0207664_10138735 3300025929 Bacteria 2054
264 Ga0207664_10164713 3300025929 Bacteria 1893
265 Ga0207664_10229497 3300025929 Bacteria 1613
266 Ga0207664_10328891 3300025929 Bacteria 1349
267 Ga0207664_10496599 3300025929 Bacteria 1092
268 Ga0207664_10561840 3300025929 Bacteria 1024
269 Ga0207664_11206491 3300025929 Bacteria 675
270 Ga0207644_10072450 3300025931 Bacteria 2523
271 Ga0207644_10410772 3300025931 Bacteria 1108
272 Ga0207644_11411791 3300025931 Bacteria 585
273 Ga0207690_10468740 3300025932 Bacteria 1015
274 Ga0207706_10482306 3300025933 Bacteria 1071
275 Ga0207706_10800498 3300025933 Bacteria 801
276 Ga0207686_10401199 3300025934 Bacteria 1044
277 Ga0207686_10533676 3300025934 Bacteria 915
278 Ga0207709_10082076 3300025935 Bacteria 2081
279 Ga0207709_11464786 3300025935 Bacteria 566
280 Ga0207704_10051212 3300025938 Bacteria 2495
281 Ga0207665_10006320 3300025939 Bacteria 7857
282 Ga0207665_10473919 3300025939 Bacteria 964
283 Ga0207665_10518986 3300025939 Bacteria 922
284 Ga0207711_10169015 3300025941 Bacteria 1983
285 Ga0207711_10955081 3300025941 Bacteria 796
286 Ga0207689_10091239 3300025942 Bacteria 2503
287 Ga0207689_11381585 3300025942 Bacteria 591
288 Ga0207661_10276162 3300025944 Bacteria 1501
289 Ga0207661_10443483 3300025944 Bacteria 1182
290 Ga0207661_10591414 3300025944 Bacteria 1018
291 Ga0207661_11016368 3300025944 Bacteria 763
292 Ga0207661_11046840 3300025944 Bacteria 751
293 Ga0207667_10429595 3300025949 Bacteria 1344
294 Ga0207667_11422283 3300025949 Bacteria 666
295 Ga0207712_10530389 3300025961 Bacteria 1010
296 Ga0207677_10344246 3300026023 Bacteria 1247
297 Ga0207677_10797360 3300026023 Bacteria 845
298 Ga0207677_10960308 3300026023 Bacteria 773
299 Ga0207703_10065761 3300026035 Bacteria 2980
300 Ga0207703_10837358 3300026035 Bacteria 879
301 Ga0207703_10967563 3300026035 Bacteria 816
302 Ga0207678_10100762 3300026067 Bacteria 2467
303 Ga0207678_10415995 3300026067 Bacteria 1165
304 Ga0207678_10766858 3300026067 Bacteria 851
305 Ga0207678_10859714 3300026067 Bacteria 801
306 Ga0207708_10087705 3300026075 Bacteria 2396
307 Ga0207708_10625417 3300026075 Bacteria 914
308 Ga0207708_11781913 3300026075 Bacteria 540
309 Ga0207702_10190079 3300026078 Bacteria 1896
310 Ga0207702_11213915 3300026078 Bacteria 748
311 Ga0207641_10042697 3300026088 Bacteria 3805
312 Ga0207676_10054566 3300026095 Bacteria 3133
313 Ga0207676_10812390 3300026095 Bacteria 913
314 Ga0207674_10435556 3300026116 Bacteria 1267
315 Ga0207674_11648572 3300026116 Bacteria 610
316 Ga0207675_100246022 3300026118 Bacteria 1729
317 Ga0207675_101047703 3300026118 Bacteria 835
318 Ga0207675_101057331 3300026118 Bacteria 831
319 Ga0207675_101876437 3300026118 Bacteria 618
320 Ga0207683_10117278 3300026121 Bacteria 2387
321 Ga0207683_10427006 3300026121 Bacteria 1221
322 Ga0207683_10588768 3300026121 Bacteria 1029
323 Ga0207683_10733875 3300026121 Bacteria 916
324 Ga0209981_1020297 3300027378 Bacteria 947
325 Ga0209974_10424135 3300027876 Bacteria 525
326 Ga0207428_10228085 3300027907 Bacteria 1394
327 Ga0268266_10431066 3300028379 Bacteria 1251
328 Ga0268266_10701170 3300028379 Bacteria 976
329 Ga0268265_11163717 3300028380 Bacteria 768
330 Ga0268264_12539093 3300028381 Bacteria 517
331 Ga0265337_1021431 3300028556 Bacteria 2014
332 Ga0265337_1084356 3300028556 Bacteria 868
333 Ga0265326_10073608 3300028558 Bacteria 966
334 Ga0265319_1001715 3300028563 Bacteria 12639
335 Ga0265334_10036178 3300028573 Bacteria 1950
336 Ga0265334_10147650 3300028573 Bacteria 830
337 Ga0265318_10047830 3300028577 Bacteria 1612
338 Ga0265318_10255532 3300028577 Bacteria 639
339 Ga0265322_10025674 3300028654 Bacteria 1684
340 Ga0265322_10182142 3300028654 Bacteria 601
341 Ga0265336_10122894 3300028666 Bacteria 773
342 Ga0265336_10147394 3300028666 Bacteria 700
343 Ga0265338_10006529 3300028800 Bacteria 14826
344 Ga0265338_10045626 3300028800 Bacteria 4026
345 Ga0265338_10083592 3300028800 Bacteria 2669
346 Ga0265338_10099744 3300028800 Bacteria 2370
347 Ga0265330_10045559 3300031235 Bacteria 1934
348 Ga0265330_10098668 3300031235 Bacteria 1251
349 Ga0265328_10092750 3300031239 Bacteria 1116
350 Ga0265320_10017023 3300031240 Bacteria 4050
351 Ga0265325_10016452 3300031241 Bacteria 4136
352 Ga0265325_10085494 3300031241 Bacteria 1562
353 Ga0265325_10283961 3300031241 Bacteria 742
354 Ga0265329_10138024 3300031242 Bacteria 787
355 Ga0265329_10219597 3300031242 Bacteria 629
356 Ga0265340_10038019 3300031247 Bacteria 2382
357 Ga0265339_10014606 3300031249 Bacteria 4728
358 Ga0265331_10367553 3300031250 Bacteria 644
359 Ga0265327_10096947 3300031251 Bacteria 1429
360 Ga0265327_10123635 3300031251 Bacteria 1224
361 Ga0265316_10042776 3300031344 Bacteria 3617
362 Ga0265316_10092509 3300031344 Bacteria 2305
363 Ga0307408_100545538 3300031548 Bacteria 1022
364 Ga0265313_10006544 3300031595 Bacteria 8218
365 Ga0265313_10127195 3300031595 Bacteria 1107
366 Ga0265314_10006724 3300031711 Bacteria 10096
367 Ga0265314_10008726 3300031711 Bacteria 8664
368 Ga0265314_10422702 3300031711 Bacteria 716
369 Ga0265314_10443618 3300031711 Bacteria 693
370 Ga0265342_10025010 3300031712 Bacteria 3760
371 Ga0265342_10202846 3300031712 Bacteria 1076
372 Ga0307405_10074269 3300031731 Bacteria 2198
373 Ga0307405_10123693 3300031731 Bacteria 1775
374 Ga0307405_10204622 3300031731 Bacteria 1436
375 Ga0307413_10097915 3300031824 Bacteria 1930
376 Ga0307413_10188484 3300031824 Bacteria 1478
377 Ga0307413_10717449 3300031824 Bacteria 832
378 Ga0307413_10839512 3300031824 Bacteria 775
379 Ga0307410_10270296 3300031852 Bacteria 1329
380 Ga0307410_10311301 3300031852 Bacteria 1246
381 Ga0307410_10858627 3300031852 Bacteria 775
382 Ga0326468_10109920 3300031889 Unclassified 521
383 Ga0326468_10126297 3300031889 Bacteria 504
384 Ga0307406_10407586 3300031901 Bacteria 1079
385 Ga0307406_10868431 3300031901 Unclassified 766
386 Ga0307406_12096958 3300031901 Bacteria 506
387 Ga0307407_10969741 3300031903 Bacteria 655
388 Ga0307412_10343235 3300031911 Bacteria 1196
389 Ga0307409_100056567 3300031995 Bacteria 3034
390 Ga0307409_100096173 3300031995 Bacteria 2442
391 Ga0307409_100860291 3300031995 Bacteria 918
392 Ga0307409_102072944 3300031995 Bacteria 598
393 Ga0307409_102646222 3300031995 Bacteria 530
394 Ga0307416_100089639 3300032002 Bacteria 2634
395 Ga0307416_100530152 3300032002 Bacteria 1247
396 Ga0307416_100888673 3300032002 Bacteria 990
397 Ga0307416_101306845 3300032002 Bacteria 831
398 Ga0307414_10073335 3300032004 Bacteria 2476
399 Ga0307411_10030391 3300032005 Bacteria 3311
400 Ga0307411_10262825 3300032005 Bacteria 1364
401 Ga0307411_10896739 3300032005 Bacteria 787
402 Ga0307415_100127028 3300032126 Bacteria 1923
403 Ga0307415_100736408 3300032126 Bacteria 893
404 Ga0373948_0139519 3300034817 Bacteria 599
405 Ga0373926_0006000 3300035083 Bacteria 4021
406 Ga0373951_0142164 3300035091 Bacteria 667
407 Ga0373952_0082783 3300035092 Bacteria 822
408 Ga0373939_0168584 3300035114 Bacteria 809
409 Ga0373941_0150692 3300035115 Bacteria 853
410 Ga0373945_0023155 3300035116 Bacteria 2144
411 Ga0373956_0183074 3300035119 Bacteria 991
412 Ga0373956_0513584 3300035119 Bacteria 572
413 Ga0373943_0125938 3300035170 Bacteria 1366
414 Ga0373943_0151187 3300035170 Bacteria 1258
415 Ga0373946_0020441 3300035171 Bacteria 2559
416 Ga0373946_0236626 3300035171 Bacteria 887
417 Ga0373946_0664180 3300035171 Bacteria 543
418 Ga0373955_0377954 3300035172 Bacteria 860
419 Ga0373942_0370355 3300035207 Bacteria 510
420 Ga0373962_0117593 3300035242 Bacteria 845
421 Ga0373931_0059336 3300035691 Bacteria 2057
422 Ga0373931_0259014 3300035691 Bacteria 1061
423 Ga0373931_0503773 3300035691 Bacteria 781
424 Ga0373935_0090520 3300035692 Bacteria 2002
425 Ga0373935_0604723 3300035692 Bacteria 802
426 Ga0373927_0546312 3300035695 Bacteria 766
427 Ga0373927_0599879 3300035695 Bacteria 728
428 Ga0373933_0089134 3300035724 Bacteria 1901
429 Ga0373933_0136788 3300035724 Bacteria 1544
430 Ga0373947_0005312 3300035725 Bacteria 7531
431 Ga0373937_0001944 3300036401 Bacteria 17289
432 Ga0373937_0073336 3300036401 Bacteria 3158
433 Ga0373937_0270361 3300036401 Bacteria 1604
434 Ga0373937_0548141 3300036401 Bacteria 1098
435 Ga0373937_1283235 3300036401 Bacteria 680
436 Ga0373925_0052441 3300037068 Bacteria 3047
437 Ga0373925_0359065 3300037068 Bacteria 1184
438 Ga0373925_0979215 3300037068 Bacteria 697
439 Ga0395899_0166213 3300037312 Bacteria 1556
440 Ga0395900_0011178 3300037418 Bacteria 9178
441 Ga0395900_0146861 3300037418 Bacteria 2411
442 Ga0395900_0676842 3300037418 Bacteria 967
443 Ga0395898_0018787 3300037466 Bacteria 7044
444 Ga0395898_0265711 3300037466 Bacteria 1636
445 Ga0395898_0397597 3300037466 Bacteria 1314
446 Ga0395898_0531182 3300037466 Bacteria 1118
447 Ga0395905_0050090 3300037471 Bacteria 3914
448 Ga0395905_0369375 3300037471 Bacteria 1328
449 Ga0395905_0457870 3300037471 Bacteria 1174
450 Ga0395901_0010536 3300038443 Bacteria 9364
451 Ga0395901_0125050 3300038443 Bacteria 2702
452 Ga0395901_0481896 3300038443 Bacteria 1265
453 Ga0395901_0542906 3300038443 Bacteria 1179
454 Ga0436360_1056459 3300039438 Bacteria 3205
455 Ga0436360_1119388 3300039438 Bacteria 2689
456 Ga0436363_1310716 3300039450 Bacteria 900
457 Ga0436362_0027807 3300039453 Bacteria 969
458 Ga0439438_017736 3300041405 Bacteria 2041
459 Ga0439461_0016834 3300041410 Bacteria 1415
460 Ga0439466_0036002 3300041411 Bacteria 1673
461 Ga0451802_0689958 3300041460 Bacteria 567
462 Ga0451853_3622250 3300041512 Bacteria 536
463 Ga0439431_0101146 3300041997 Bacteria 792
464 Ga0450915_008079 3300042119 Bacteria 698
465 Ga0450920_041655 3300042122 Bacteria 916
466 Ga0450896_061610 3300042133 Bacteria 611
467 Ga0450898_116236 3300042134 Bacteria 569
468 Ga0439446_0023933 3300042156 Bacteria 1739
469 Ga0439434_0121539 3300042435 Bacteria 852
470 Ga0450916_033609 3300042530 Bacteria 756
471 Ga0450918_004776 3300042531 Bacteria 2456
472 Ga0451577_1753020 3300042876 Bacteria 546
473 Ga0466969_0006133 3300044656 Bacteria 6399
474 Ga0466969_0023380 3300044656 Bacteria 3186
475 Ga0466972_0034041 3300044658 Bacteria 2498
476 Ga0466965_0074448 3300044683 Bacteria 1711
477 Ga0466965_0252957 3300044683 Bacteria 945
478 Ga0466965_0291117 3300044683 Bacteria 884
479 Ga0466965_0388413 3300044683 Bacteria 770
480 Ga0466966_0024593 3300044684 Bacteria 3939
481 Ga0466966_0052870 3300044684 Bacteria 2578
482 Ga0466961_0009749 3300044693 Bacteria 6112
483 Ga0466961_0011634 3300044693 Bacteria 5624
484 Ga0466961_0037779 3300044693 Bacteria 3097
485 Ga0466961_0130266 3300044693 Bacteria 1576
486 Ga0466961_0163835 3300044693 Bacteria 1385
487 Ga0466961_0177224 3300044693 Bacteria 1324
488 Ga0466963_0002044 3300044694 Bacteria 11114
489 Ga0466963_0003206 3300044694 Bacteria 9303
490 Ga0466963_0009978 3300044694 Bacteria 5738
491 Ga0466963_0012830 3300044694 Bacteria 5133
492 Ga0466963_0015028 3300044694 Bacteria 4784
493 Ga0466963_0021764 3300044694 Bacteria 4049
494 Ga0466963_0024321 3300044694 Bacteria 3855
495 Ga0466963_0043303 3300044694 Bacteria 2959
496 Ga0466963_0053690 3300044694 Bacteria 2676
497 Ga0466963_0059333 3300044694 Bacteria 2553
498 Ga0466963_0063099 3300044694 Bacteria 2479
499 Ga0466963_0134375 3300044694 Bacteria 1711
500 Ga0466963_0159747 3300044694 Bacteria 1568
501 Ga0466963_0202023 3300044694 Bacteria 1390
502 Ga0466963_0214431 3300044694 Bacteria 1347
503 Ga0466963_0513648 3300044694 Bacteria 846
504 Ga0466963_1146383 3300044694 Bacteria 547
505 Ga0466964_0002221 3300044706 Bacteria 6874
506 Ga0466964_0010956 3300044706 Bacteria 3425
507 Ga0466964_0038807 3300044706 Bacteria 1916
508 Ga0466964_0059035 3300044706 Bacteria 1592
509 Ga0466964_0110190 3300044706 Bacteria 1226
510 Ga0466964_0152954 3300044706 Bacteria 1071
511 Ga0453684_0774690 3300044712 Bacteria 1037
512 Ga0466971_0000811 3300044719 Bacteria 12589
513 Ga0466971_0034283 3300044719 Bacteria 2275
514 Ga0466971_0034812 3300044719 Bacteria 2257
515 Ga0466971_0095466 3300044719 Bacteria 1363
516 Ga0466968_0001383 3300044735 Bacteria 8679
517 Ga0466968_0009900 3300044735 Bacteria 3680
518 Ga0466968_0089730 3300044735 Bacteria 1360
519 Ga0466968_0126221 3300044735 Bacteria 1161
520 Ga0466970_0038989 3300044765 Bacteria 2521
521 Ga0466970_0555848 3300044765 Bacteria 663
522 Ga0466957_0011431 3300044842 Bacteria 5123
523 Ga0466957_0014656 3300044842 Bacteria 4567
524 Ga0466957_0039094 3300044842 Bacteria 2861
525 Ga0466957_0043235 3300044842 Bacteria 2728
526 Ga0466957_0043431 3300044842 Bacteria 2722
527 Ga0466957_0050574 3300044842 Bacteria 2529
528 Ga0466957_0127925 3300044842 Bacteria 1624
529 Ga0466957_0141542 3300044842 Bacteria 1550
530 Ga0466957_0378501 3300044842 Bacteria 965
531 Ga0466960_0019584 3300044901 Bacteria 2985
532 Ga0466960_0044711 3300044901 Bacteria 2112
533 Ga0466960_0280714 3300044901 Bacteria 933
534 Ga0466959_0000761 3300045049 Bacteria 18843
535 Ga0466959_0005947 3300045049 Bacteria 8413
536 Ga0466959_0010572 3300045049 Bacteria 6605
537 Ga0466959_0040467 3300045049 Bacteria 3443
538 Ga0466958_0011877 3300045836 Bacteria 4916
539 Ga0466958_0019527 3300045836 Bacteria 3946
540 Ga0466958_0029055 3300045836 Bacteria 3279
541 Ga0466958_0037650 3300045836 Bacteria 2898
542 Ga0466958_0044163 3300045836 Bacteria 2685
543 Ga0466958_0061728 3300045836 Bacteria 2283
544 Ga0466958_0357637 3300045836 Bacteria 940
545 Ga0466967_0002348 3300045976 Bacteria 11708
546 Ga0466967_0008064 3300045976 Bacteria 7678
547 Ga0466967_0027506 3300045976 Bacteria 4732
548 Ga0466967_0039466 3300045976 Bacteria 4059
549 Ga0466967_0074534 3300045976 Bacteria 3048
550 Ga0466967_0087787 3300045976 Bacteria 2820
551 Ga0466967_0091601 3300045976 Bacteria 2763
552 Ga0466967_0104215 3300045976 Bacteria 2596
553 Ga0466967_0135518 3300045976 Bacteria 2289
554 Ga0466967_0197542 3300045976 Bacteria 1903
555 Ga0466967_0225216 3300045976 Bacteria 1783
556 Ga0466967_0286864 3300045976 Bacteria 1580
557 Ga0466967_0309574 3300045976 Bacteria 1521
558 Ga0466967_0310629 3300045976 Bacteria 1518
559 Ga0466967_0340817 3300045976 Bacteria 1449
560 Ga0466967_0376555 3300045976 Bacteria 1378
561 Ga0466967_0407941 3300045976 Bacteria 1323
562 Ga0466967_0466275 3300045976 Bacteria 1236
563 Ga0466967_0498769 3300045976 Bacteria 1194
564 Ga0466967_1007435 3300045976 Bacteria 829
565 Ga0466967_1022476 3300045976 Bacteria 823
566 Ga0466967_1284834 3300045976 Unclassified 729
567 Ga0495592_0000082 3300046454 Bacteria 83312
568 Ga0495592_0005470 3300046454 Bacteria 9382
569 Ga0495592_0078369 3300046454 Bacteria 2393
570 Ga0495592_0110113 3300046454 Bacteria 1950
571 Ga0495592_0169612 3300046454 Bacteria 1495
572 Ga0495603_0026915 3300046455 Bacteria 3473
573 Ga0495603_0054621 3300046455 Bacteria 2367
574 Ga0495603_0209415 3300046455 Bacteria 1126
575 Ga0495603_0267484 3300046455 Bacteria 984
576 Ga0495590_0375566 3300046457 Bacteria 543
577 Ga0495629_0057569 3300046459 Bacteria 2717
578 Ga0495629_0254100 3300046459 Bacteria 1209
579 Ga0495629_0438158 3300046459 Bacteria 886
580 Ga0495629_0484862 3300046459 Bacteria 835
581 Ga0495641_0021128 3300046461 Bacteria 3282
582 Ga0495641_0026211 3300046461 Bacteria 2847
583 Ga0495641_0033988 3300046461 Bacteria 2414
584 Ga0495641_0114119 3300046461 Bacteria 1205
585 Ga0495641_0140930 3300046461 Bacteria 1077
586 Ga0495641_0143146 3300046461 Bacteria 1068
587 Ga0495641_0174278 3300046461 Bacteria 962
588 Ga0495651_0000254 3300046462 Bacteria 41379
589 Ga0495651_0147265 3300046462 Bacteria 1701
590 Ga0495651_0233596 3300046462 Bacteria 1265
591 Ga0495651_0859931 3300046462 Bacteria 557
592 Ga0495653_0008090 3300046463 Bacteria 8614
593 Ga0495653_0019537 3300046463 Bacteria 5493
594 Ga0495653_0036185 3300046463 Bacteria 3890
595 Ga0495653_0049166 3300046463 Bacteria 3251
596 Ga0495653_0052428 3300046463 Bacteria 3126
597 Ga0495653_0171551 3300046463 Bacteria 1497
598 Ga0495653_0619901 3300046463 Bacteria 663
599 Ga0495653_0886785 3300046463 Bacteria 532
600 Ga0495580_0027920 3300046472 Bacteria 4105
601 Ga0495580_0384454 3300046472 Bacteria 948
602 Ga0495582_0021125 3300046473 Bacteria 3565
603 Ga0495582_0166217 3300046473 Bacteria 1255
604 Ga0495582_0247464 3300046473 Bacteria 1022
605 Ga0495639_0021259 3300046475 Bacteria 2839
606 Ga0495639_0114549 3300046475 Bacteria 1282
607 Ga0495662_0002737 3300046476 Bacteria 8908
608 Ga0495664_0023352 3300046477 Bacteria 3590
609 Ga0495664_0048325 3300046477 Bacteria 2525
610 Ga0495664_0281496 3300046477 Bacteria 1005
611 Ga0495664_0340710 3300046477 Bacteria 903
612 Ga0495664_0366013 3300046477 Bacteria 867
613 Ga0495664_0454089 3300046477 Bacteria 767
614 Ga0495664_0905223 3300046477 Bacteria 516
615 Ga0495584_0029054 3300046491 Bacteria 2802
616 Ga0495585_0225901 3300046492 Bacteria 943
617 Ga0495596_0111430 3300046500 Bacteria 1062
618 Ga0495596_0131101 3300046500 Bacteria 973
619 Ga0495608_0003029 3300046511 Bacteria 11991
620 Ga0495608_0024374 3300046511 Bacteria 4138
621 Ga0495608_0105999 3300046511 Bacteria 1810
622 Ga0495608_0728423 3300046511 Bacteria 589
623 Ga0495608_0843316 3300046511 Bacteria 539
624 Ga0495618_0025188 3300046514 Bacteria 3691
625 Ga0495618_0045188 3300046514 Bacteria 2778
626 Ga0495618_0065034 3300046514 Bacteria 2318
627 Ga0495618_0154761 3300046514 Bacteria 1463
628 Ga0495618_0173072 3300046514 Bacteria 1373
629 Ga0495618_0255145 3300046514 Bacteria 1099
630 Ga0495620_0186565 3300046515 Bacteria 801
631 Ga0495628_0008466 3300046516 Bacteria 8819
632 Ga0495628_0025414 3300046516 Bacteria 4837
633 Ga0495628_0229084 3300046516 Bacteria 1393
634 Ga0495630_0047973 3300046517 Bacteria 3195
635 Ga0495630_0127048 3300046517 Bacteria 1935
636 Ga0495630_0353097 3300046517 Bacteria 1125
637 Ga0495630_0371840 3300046517 Bacteria 1095
638 Ga0495630_1008805 3300046517 Bacteria 632
639 Ga0495644_0059168 3300046523 Bacteria 1440
640 Ga0495666_0000309 3300046526 Bacteria 21203
641 Ga0495652_0000144 3300046529 Bacteria 80486
642 Ga0495652_0098296 3300046529 Bacteria 2379
643 Ga0495652_0101405 3300046529 Bacteria 2333
644 Ga0495652_0202452 3300046529 Bacteria 1505
645 Ga0495652_0310045 3300046529 Bacteria 1144
646 Ga0495652_0526687 3300046529 Bacteria 816
647 Ga0495652_0939203 3300046529 Bacteria 569
648 Ga0495665_0046576 3300046531 Bacteria 2302
649 Ga0495640_0068005 3300046533 Bacteria 2398
650 Ga0495640_0153332 3300046533 Bacteria 1479
651 Ga0495640_0430155 3300046533 Bacteria 808
652 Ga0495640_0536709 3300046533 Bacteria 710
653 Ga0495586_0052192 3300046535 Bacteria 2213
654 Ga0495586_0087870 3300046535 Bacteria 1714
655 Ga0495586_0099724 3300046535 Bacteria 1611
656 Ga0495586_0168258 3300046535 Bacteria 1238
657 Ga0495586_0231059 3300046535 Bacteria 1052
658 Ga0495587_0000060 3300046536 Bacteria 93780
659 Ga0495587_0054748 3300046536 Bacteria 2351
660 Ga0495587_0130539 3300046536 Bacteria 1436
661 Ga0495621_0186462 3300046539 Bacteria 830
662 Ga0495645_0000038 3300046543 Bacteria 96124
663 Ga0495645_0026009 3300046543 Bacteria 4247
664 Ga0495645_0065208 3300046543 Bacteria 2634
665 Ga0495645_0108382 3300046543 Bacteria 1967
666 Ga0495645_0425074 3300046543 Bacteria 842
667 Ga0495667_0041480 3300046559 Bacteria 3052
668 Ga0495667_0063361 3300046559 Bacteria 2420
669 Ga0495667_0147787 3300046559 Bacteria 1513
670 Ga0495667_0269832 3300046559 Bacteria 1081
671 Ga0495667_0311179 3300046559 Bacteria 997
672 Ga0495667_0327687 3300046559 Bacteria 969
673 Ga0495667_0544390 3300046559 Bacteria 725
674 Ga0495667_0670775 3300046559 Bacteria 643
675 Ga0495667_0734070 3300046559 Bacteria 611
676 Ga0495656_0004882 3300046615 Bacteria 4617
677 Ga0495656_0414786 3300046615 Bacteria 706
678 Ga0495668_0127931 3300046616 Bacteria 1391
679 Ga0495634_0097102 3300046642 Bacteria 1908
680 Ga0495634_0108667 3300046642 Bacteria 1785
681 Ga0495634_0170122 3300046642 Bacteria 1369
682 Ga0495634_0260784 3300046642 Bacteria 1057
683 Ga0495634_0300388 3300046642 Bacteria 971
684 Ga0495634_0705950 3300046642 Bacteria 580
685 Ga0495635_0061455 3300046663 Bacteria 2580
686 Ga0495635_0093282 3300046663 Bacteria 2058
687 Ga0495635_0169001 3300046663 Bacteria 1487
688 Ga0495635_0229115 3300046663 Bacteria 1255
689 Ga0495659_0235092 3300046664 Bacteria 760
690 Ga0495661_0216592 3300046665 Bacteria 994
691 Ga0495588_0499315 3300046674 Bacteria 638
692 Ga0495657_0017146 3300046675 Bacteria 5263
693 Ga0495657_0074538 3300046675 Bacteria 2208
694 Ga0495657_0130787 3300046675 Bacteria 1572
695 Ga0495657_0409629 3300046675 Bacteria 797
696 Ga0495657_0651169 3300046675 Bacteria 607
697 Ga0495599_0007761 3300046678 Bacteria 6512
698 Ga0495599_0022857 3300046678 Bacteria 3905
699 Ga0495599_0148173 3300046678 Bacteria 1454
700 Ga0495623_0001647 3300046679 Bacteria 15000
701 Ga0495623_0462693 3300046679 Bacteria 674
702 Ga0495646_0018814 3300046680 Bacteria 4374
703 Ga0495646_0049372 3300046680 Bacteria 2554
704 Ga0495646_0116807 3300046680 Bacteria 1513
705 Ga0495647_0008741 3300046681 Bacteria 3410
706 Ga0495647_0017159 3300046681 Bacteria 2558
707 Ga0495647_0056840 3300046681 Bacteria 1535
708 Ga0495647_0596353 3300046681 Bacteria 518
709 Ga0495658_0027649 3300046683 Bacteria 3054
710 Ga0495658_0244638 3300046683 Bacteria 1127
711 Ga0495658_0653294 3300046683 Bacteria 674
712 Ga0495658_0997222 3300046683 Bacteria 535
713 Ga0495613_0015955 3300046689 Bacteria 5593
714 Ga0495613_0260787 3300046689 Bacteria 1207
715 Ga0495613_0353040 3300046689 Bacteria 1010
716 Ga0495613_0385974 3300046689 Bacteria 957
717 Ga0495624_0009825 3300046690 Bacteria 6618
718 Ga0495624_0032420 3300046690 Bacteria 3388
719 Ga0495624_0045373 3300046690 Bacteria 2798
720 Ga0495624_0346354 3300046690 Bacteria 894
721 Ga0495624_0399900 3300046690 Bacteria 825
722 Ga0495600_0022116 3300046809 Bacteria 4081
723 Ga0495600_0197659 3300046809 Bacteria 1292
724 Ga0495600_0215664 3300046809 Bacteria 1229
725 Ga0495660_0286114 3300046810 Bacteria 752
726 Ga0495660_0507468 3300046810 Bacteria 515
727 Ga0495581_0063679 3300047315 Bacteria 2130
728 Ga0495581_0285930 3300047315 Bacteria 964
729 Ga0495604_0000043 3300047317 Bacteria 116335
730 Ga0495604_0148690 3300047317 Bacteria 1667
731 Ga0495604_0284317 3300047317 Bacteria 1116
732 Ga0495636_0112191 3300047318 Bacteria 1200
733 Ga0495674_0039854 3300047319 Bacteria 4206
734 Ga0495674_0133281 3300047319 Bacteria 2092
735 Ga0495674_0165119 3300047319 Bacteria 1851
736 Ga0495674_0187393 3300047319 Bacteria 1721
737 Ga0495674_0275727 3300047319 Bacteria 1379
738 Ga0495674_0328482 3300047319 Bacteria 1244
739 Ga0495674_1035486 3300047319 Unclassified 627
740 Ga0495676_0103965 3300047321 Bacteria 2096
741 Ga0495676_0111905 3300047321 Bacteria 2002
742 Ga0495676_0309857 3300047321 Bacteria 1062
743 Ga0495680_0010993 3300047322 Bacteria 8042
744 Ga0495680_0047309 3300047322 Bacteria 3384
745 Ga0495680_0128449 3300047322 Bacteria 1864
746 Ga0495680_0208519 3300047322 Bacteria 1399
747 Ga0495680_0409729 3300047322 Bacteria 934
748 Ga0495680_0487979 3300047322 Bacteria 838
749 Ga0495680_0600625 3300047322 Bacteria 736
750 Ga0495683_0164235 3300047323 Bacteria 1025
751 Ga0495675_0000413 3300047444 Bacteria 29216
752 Ga0495677_0215595 3300047445 Bacteria 747
753 Ga0495679_057747 3300047446 Bacteria 1147
754 Ga0495684_0001111 3300047471 Bacteria 21659
755 Ga0495684_0006437 3300047471 Bacteria 9114
756 Ga0495684_0193268 3300047471 Bacteria 1503
757 Ga0495684_0249687 3300047471 Bacteria 1291
758 Ga0495684_0540914 3300047471 Bacteria 795
759 Ga0495684_0852706 3300047471 Bacteria 591
760 Ga0495684_0881902 3300047471 Bacteria 578
761 Ga0495593_0027939 3300047673 Bacteria 3101
762 Ga0495593_0104572 3300047673 Bacteria 1450
763 Ga0495602_0043043 3300048088 Bacteria 4109
764 Ga0495602_0053415 3300048088 Bacteria 3578
765 Ga0495602_0217072 3300048088 Bacteria 1446
766 Ga0495602_0342351 3300048088 Bacteria 1081
767 Ga0495614_0009758 3300048089 Bacteria 4242
768 Ga0495614_0073037 3300048089 Bacteria 1481
769 Ga0495615_0147763 3300048090 Bacteria 698
770 Ga0496100_0028219 3300048903 Bacteria 3460
771 Ga0496100_1434127 3300048903 Bacteria 545
772 Ga0496101_0039194 3300048904 Bacteria 3368
773 Ga0496101_0081933 3300048904 Bacteria 2387
774 Ga0496101_0300984 3300048904 Bacteria 1256
775 Ga0496101_1021589 3300048904 Bacteria 650
776 Ga0496101_1061894 3300048904 Bacteria 636
777 Ga0496101_1511711 3300048904 Bacteria 523
778 Ga0496102_0003464 3300048905 Bacteria 13382
779 Ga0496102_0008253 3300048905 Bacteria 8919
780 Ga0496102_0143115 3300048905 Bacteria 2243
781 Ga0496102_0189821 3300048905 Bacteria 1936
782 Ga0496103_0005471 3300048906 Bacteria 7594
783 Ga0496103_0023207 3300048906 Bacteria 3740
784 Ga0496103_0358114 3300048906 Bacteria 938
785 Ga0496104_0016980 3300048907 Bacteria 6621
786 Ga0496104_0059067 3300048907 Bacteria 3630
787 Ga0496104_0150580 3300048907 Bacteria 2233
788 Ga0496104_0196248 3300048907 Bacteria 1930
789 Ga0496104_0320571 3300048907 Bacteria 1463
790 Ga0496104_1276829 3300048907 Bacteria 637
791 Ga0496105_0015128 3300048908 Bacteria 6140
792 Ga0496105_0065644 3300048908 Bacteria 2995
793 Ga0496105_0161150 3300048908 Bacteria 1841
794 Ga0496105_0440379 3300048908 Bacteria 1030
795 Ga0496105_0629891 3300048908 Bacteria 829
796 Ga0496106_0017267 3300048909 Bacteria 5340
797 Ga0496106_0183614 3300048909 Bacteria 1661
798 Ga0496106_0235757 3300048909 Bacteria 1462
799 Ga0496106_0419118 3300048909 Bacteria 1076
800 Ga0496107_0005952 3300048910 Bacteria 8355
801 Ga0496107_0133461 3300048910 Bacteria 1834
802 Ga0496107_0421448 3300048910 Bacteria 992
803 Ga0496107_0579130 3300048910 Bacteria 830
804 Ga0496107_1250802 3300048910 Bacteria 532
805 Ga0496108_0037409 3300048911 Bacteria 4042
806 Ga0496108_0110191 3300048911 Bacteria 2353
807 Ga0496108_0221375 3300048911 Bacteria 1644
808 Ga0496108_0240228 3300048911 Bacteria 1576
809 Ga0496108_0302977 3300048911 Bacteria 1392
810 Ga0496109_0053795 3300048912 Bacteria 3673
811 Ga0496109_0102132 3300048912 Bacteria 2661
812 Ga0496109_0119789 3300048912 Bacteria 2451
813 Ga0496109_0129522 3300048912 Bacteria 2354
814 Ga0496109_0289311 3300048912 Bacteria 1544
815 Ga0496110_0169177 3300048913 Bacteria 1982
816 Ga0496110_0628038 3300048913 Bacteria 973
817 Ga0496110_1338264 3300048913 Bacteria 625
818 Ga0496111_0117258 3300048914 Bacteria 1964
819 Ga0496111_0120767 3300048914 Bacteria 1935
820 Ga0496111_0161779 3300048914 Bacteria 1662
821 Ga0496111_0221098 3300048914 Bacteria 1407
822 Ga0496111_0758520 3300048914 Bacteria 704
823 Ga0496112_0158987 3300048915 Bacteria 2226
824 Ga0496112_0204957 3300048915 Bacteria 1930
825 Ga0496112_1296300 3300048915 Unclassified 644
826 Ga0496113_0071897 3300048916 Bacteria 2631
827 Ga0496113_0113339 3300048916 Bacteria 2113
828 Ga0496113_0246479 3300048916 Bacteria 1426
829 Ga0496114_0004956 3300048917 Bacteria 10381
830 Ga0496114_0006185 3300048917 Bacteria 9424
831 Ga0496114_0033807 3300048917 Bacteria 4215
832 Ga0496114_0164281 3300048917 Bacteria 1932
833 Ga0496115_0009112 3300048918 Bacteria 7365
834 Ga0496115_0033955 3300048918 Bacteria 4031
835 Ga0496115_0194322 3300048918 Bacteria 1676
836 Ga0496115_0329984 3300048918 Bacteria 1246
837 Ga0496115_0382445 3300048918 Bacteria 1144
838 Ga0501031_0003238 3300049568 Bacteria 10464
839 Ga0501031_0755708 3300049568 Unclassified 624
840 Ga0501032_0016731 3300049569 Bacteria 5152
841 Ga0501033_0011156 3300049570 Bacteria 6883
842 Ga0501036_0013212 3300049572 Bacteria 6856
843 Ga0501036_1137596 3300049572 Bacteria 637
844 Ga0501037_0001718 3300049573 Bacteria 15893
845 Ga0501038_0071959 3300049574 Bacteria 2931
846 Ga0501039_0033420 3300049575 Bacteria 3965
847 Ga0501040_0177164 3300049576 Bacteria 1510
848 Ga0501040_1096012 3300049576 Bacteria 578
849 Ga0501041_0052787 3300049577 Bacteria 2478
850 Ga0501042_0790184 3300049578 Bacteria 691
851 Ga0501043_0005046 3300049579 Bacteria 10678
852 Ga0501046_0226491 3300049580 Bacteria 1382
853 Ga0501067_0070774 3300049583 Bacteria 1931
854 Ga0501067_0260907 3300049583 Bacteria 964
855 Ga0501069_0000281 3300049585 Bacteria 23211
856 Ga0501069_0012970 3300049585 Bacteria 4439
857 Ga0501069_0109884 3300049585 Bacteria 1569
858 Ga0501070_0096580 3300049586 Bacteria 2444
859 Ga0501070_0134827 3300049586 Bacteria 2039
860 Ga0501071_0006860 3300049587 Bacteria 7420
861 Ga0501071_0082451 3300049587 Bacteria 2355
862 Ga0501071_0701119 3300049587 Unclassified 779
863 Ga0501071_0744459 3300049587 Bacteria 755
864 Ga0501072_0001268 3300049588 Bacteria 18858
865 Ga0501072_1346898 3300049588 Bacteria 553
866 Ga0501073_0004422 3300049589 Bacteria 10567
867 Ga0501074_0060889 3300049590 Bacteria 2719
868 Ga0501075_0026770 3300049591 Bacteria 4247
869 Ga0501076_0221178 3300049592 Bacteria 1547
870 Ga0501076_0255360 3300049592 Bacteria 1435
871 Ga0501077_0006117 3300049593 Bacteria 7349
872 Ga0501077_0197370 3300049593 Unclassified 1278
873 Ga0501255_029548 3300049684 Bacteria 756
874 Ga0501225_0356133 3300049705 Bacteria 507
875 Ga0501079_0135066 3300049741 Bacteria 1920
876 Ga0501079_0225222 3300049741 Bacteria 1465
877 Ga0501081_0095144 3300049743 Bacteria 2099
878 Ga0501083_0059072 3300049744 Bacteria 2565
879 Ga0501268_076747 3300049765 Bacteria 684
880 Ga0501035_0023192 3300049822 Bacteria 5692
881 Ga0501044_0047525 3300049823 Bacteria 4438
882 Ga0501045_0004644 3300049824 Bacteria 9481
883 Ga0501045_0977297 3300049824 Bacteria 621
884 nmdc:mga00v17_672439_c1 3300050491 Bacteria 665
885 nmdc:mga06r32_1620144_c1 3300050510 Bacteria 585
886 nmdc:mga08y16_1377811_c1 3300050511 Bacteria 669
887 nmdc:mga08y16_201893_c1 3300050511 Bacteria 2060
888 nmdc:mga08y16_503294_c1 3300050511 Bacteria 1230
889 nmdc:mga08y16_529562_c1 3300050511 Bacteria 1194
890 nmdc:mga0n895_104711_c1 3300050512 Bacteria 2842
891 nmdc:mga08x19_498856_c1 3300050514 Bacteria 859
892 nmdc:mga0a205_53821_c1 3300050515 Bacteria 3885
893 Ga0495601_0016127 3300053077 Bacteria 4523
894 Ga0495601_0106723 3300053077 Bacteria 1811
895 Ga0495601_0121354 3300053077 Bacteria 1697
896 Ga0495601_0132228 3300053077 Bacteria 1625
897 Ga0495601_0219668 3300053077 Bacteria 1241
898 Ga0495601_0298539 3300053077 Bacteria 1049
899 Ga0495601_0383161 3300053077 Bacteria 912
900 Ga0495612_0048056 3300053078 Bacteria 1749
901 Ga0495612_0104624 3300053078 Bacteria 1207
902 Ga0495595_0037657 3300053084 Bacteria 2200
903 Ga0495595_0077821 3300053084 Bacteria 1576
904 Ga0495595_0126829 3300053084 Bacteria 1245
905 Ga0495619_0005446 3300053085 Bacteria 8067
906 Ga0495619_0065883 3300053085 Bacteria 2417
907 Ga0495619_0168655 3300053085 Bacteria 1513
908 Ga0495619_0268750 3300053085 Bacteria 1182
909 Ga0495619_0628109 3300053085 Bacteria 734
910 Ga0500641_0121656 3300053096 Bacteria 1125
911 Ga0500608_320245 3300053122 Bacteria 565
912 Ga0501084_0076562 3300054114 Bacteria 2804
913 Ga0501084_0128730 3300054114 Bacteria 2131
914 Ga0587066_048692 3300059490 Bacteria 826
915 Ga0587070_050497 3300059491 Bacteria 829
916 Ga0587073_0179480 3300059492 Bacteria 620
917 Ga0587073_0280482 3300059492 Bacteria 534
918 Ga0587080_042143 3300059503 Bacteria 835
919 Ga0587082_121217 3300059504 Bacteria 591
920 Ga0587083_0111320 3300059505 Bacteria 696
921 Ga0587085_085882 3300059506 Bacteria 642
922 Ga0587088_151590 3300059508 Bacteria 561
923 Ga0587113_026351 3300059625 Bacteria 640
924 Ga0587122_061945 3300059628 Bacteria 504
925 Ga0587067_200294 3300059640 Bacteria 530
926 Ga0587069_101856 3300059642 Bacteria 588
927 Ga0587069_113803 3300059642 Bacteria 566
928 Ga0587075_142988 3300059644 Bacteria 512
929 Ga0587079_189283 3300059647 Bacteria 555
930 Ga0587114_079903 3300059655 Bacteria 607
931 Ga0587119_041929 3300059658 Bacteria 659
932 Ga0587071_072219 3300060344 Bacteria 754
933 Ga0501082_0080589 3300060353 Bacteria 2809
934 Ga0501082_0854572 3300060353 Bacteria 796
935 Ga0466962_0032916 3300061719 Bacteria 2480
936 Ga0466962_0193151 3300061719 Bacteria 993
937 Ga0530510_0087455 3300061734 Bacteria 2270
938 Ga0530510_0255315 3300061734 Bacteria 1307
939 Ga0466964_0105434
940 Ga0058862_12513208
941 Ga0070658_10129125
942 Ga0070683_100370415
943 Ga0070683_100896320
944 Ga0070666_10792227
945 Ga0070680_100102008
946 Ga0070680_100235830
947 Ga0070682_100432012
948 Ga0070682_100442268
949 Ga0068868_100363719
950 Ga0068868_100748772
951 Ga0068868_100908393
952 Ga0068868_101006419
953 Ga0070660_100197424
954 Ga0070691_10061930
955 Ga0070691_10218997
956 Ga0070691_10270110
957 Ga0070687_100078432
958 Ga0070687_100777720
959 Ga0070661_100294553
960 Ga0070661_100435253
961 Ga0070661_101887956
962 Ga0070669_101141892
963 Ga0070669_101953349
964 Ga0070671_101222235
965 Ga0070674_101170412
966 Ga0070688_100725808
967 Ga0070659_100110245
968 Ga0070659_100501127
969 Ga0070667_101452144
970 Ga0070709_10028862
971 Ga0070709_10164035
972 Ga0070709_10188355
973 Ga0070714_100056543
974 Ga0070714_100059769
975 Ga0070714_100077238
976 Ga0070714_100105023
977 Ga0070714_100283994
978 Ga0070714_100555310
979 Ga0070714_100770655
980 Ga0070714_100960920
981 Ga0070713_100097613
982 Ga0070713_100459845
983 Ga0070710_10005822
984 Ga0070710_10167643
985 Ga0070701_11144916
986 Ga0070711_100043043
987 Ga0070711_100709271
988 Ga0070711_101042357
989 Ga0070711_101472117
990 Ga0070705_100649209
991 Ga0070700_100084563
992 Ga0070708_101302718
993 Ga0070663_100234715
994 Ga0070663_100795047
995 Ga0070678_100421481
996 Ga0070678_100957821
997 Ga0070662_101055438
998 Ga0070662_101234788
999 Ga0070681_10127620
1000 Ga0070681_10168346
1001 Ga0070681_10223330
1002 Ga0070681_10223401
1003 Ga0068867_100405633
1004 Ga0070685_10637400
1005 Ga0070685_10861543
1006 Ga0070707_100001557
1007 Ga0070707_100266830
1008 Ga0070698_100849043
1009 Ga0070679_100324484
1010 Ga0070679_100392558
1011 Ga0070684_100218577
1012 Ga0070684_100352112
1013 Ga0070684_100553428
1014 Ga0070684_100864220
1015 Ga0070684_101183869
1016 Ga0070695_100001595
1017 Ga0070665_100427482
1018 Ga0068855_100177324
1019 Ga0068855_100718550
1020 Ga0068855_102429229
1021 Ga0070664_100072110
1022 Ga0070664_100810128
1023 Ga0070664_101987995
1024 Ga0068854_100330579
1025 Ga0068856_100225532
1026 Ga0068856_100267427
1027 Ga0068856_100515783
1028 Ga0070702_100005631
1029 Ga0070702_100253720
1030 Ga0070702_101450514
1031 Ga0068852_100227666
1032 Ga0068859_100119417
1033 Ga0068864_100096261
1034 Ga0068866_10057880
1035 Ga0068861_101533561
1036 Ga0068870_10062303
1037 Ga0068863_100353207
1038 Ga0068858_100115450
1039 Ga0068858_100949432
1040 Ga0068860_102073695
1041 Ga0081455_10074026
1042 Ga0081455_10096946
1043 Ga0081455_10353406
1044 Ga0081538_10030998
1045 Ga0081538_10034025
1046 Ga0081539_10161609
1047 Ga0070717_10026635
1048 Ga0070717_10096339
1049 Ga0070717_10096495
1050 Ga0070717_10442590
1051 Ga0075365_10212128
1052 Ga0075364_10511503
1053 Ga0075432_10169267
1054 Ga0070715_10005967
1055 Ga0070715_10113250
1056 Ga0070716_100070921
1057 Ga0070716_100104618
1058 Ga0070716_100682625
1059 Ga0070716_101081207
1060 Ga0070716_101257302
1061 Ga0070712_100047985
1062 Ga0070712_100063501
1063 Ga0070712_100882128
1064 Ga0070712_101187638
1065 Ga0097621_100653875
1066 Ga0097621_100763387
1067 Ga0068871_100415161
1068 Ga0068871_101478047
1069 Ga0075428_101458411
1070 Ga0075431_101685743
1071 Ga0075433_10153434
1072 Ga0075429_101874775
1073 Ga0068865_100421386
1074 Ga0097620_100119408
1075 Ga0075435_101006573
1076 Ga0105240_10128107
1077 Ga0111539_10217483
1078 Ga0111539_11694447
1079 Ga0105245_10091016
1080 Ga0105245_11052678
1081 Ga0105245_12076983
1082 Ga0105245_12327919
1083 Ga0105245_12976242
1084 Ga0105247_10230852
1085 Ga0105247_11287676
1086 Ga0114129_11008000
1087 Ga0114129_11010623
1088 Ga0105243_10085476
1089 Ga0105243_10555802
1090 Ga0105241_10772790
1091 Ga0105241_11810639
1092 Ga0105242_10689819
1093 Ga0105242_10967178
1094 Ga0105248_10181619
1095 Ga0105248_11188175
1096 Ga0105248_11533987
1097 Ga0105237_10288496
1098 Ga0105237_12161344
1099 Ga0105237_12189820
1100 Ga0105238_10078095
1101 Ga0105238_10363513
1102 Ga0105249_11103273
1103 Ga0105249_12291076
1104 Ga0105239_12001561
1105 Ga0105239_12107478
1106 Ga0105239_12689728
1107 Ga0105239_13607146
1108 Ga0105246_10050833
1109 Ga0105246_11976188
1110 Ga0157373_10489500
1111 Ga0157371_10627397
1112 Ga0157370_11176455
1113 Ga0157369_10745475
1114 Ga0157369_10893379
1115 Ga0157374_10218951
1116 Ga0157374_11330808
1117 Ga0157374_12727037
1118 Ga0163162_10235751
1119 Ga0163162_10421942
1120 Ga0157372_10092283
1121 Ga0157372_10394922
1122 Ga0157372_10579413
1123 Ga0157372_10720578
1124 Ga0157372_11284238
1125 Ga0157375_12023917
1126 Ga0157380_10513528
1127 Ga0157380_10637294
1128 Ga0157379_11136506
1129 Ga0157379_12015990
1130 Ga0157376_10217879
1131 Ga0157376_11619526
1132 Ga0182005_1051686
1133 Ga0197907_10026626
1134 Ga0197907_10678466
1135 Ga0206356_10605300
1136 Ga0206355_1424902
1137 Ga0206355_1506274
1138 Ga0206352_10068973
1139 Ga0206350_11082515
1140 Ga0206353_10705410
1141 Ga0206353_10963865
1142 Ga0224712_10017227
1143 Ga0224712_10390005
1144 Ga0207692_10004596
1145 Ga0207692_10098877
1146 Ga0207642_10225697
1147 Ga0207688_10079443
1148 Ga0207688_10820376
1149 Ga0207647_10401665
1150 Ga0207699_10002466
1151 Ga0207699_10169674
1152 Ga0207699_10420751
1153 Ga0207699_10793224
1154 Ga0207645_11147044
1155 Ga0207643_10134240
1156 Ga0207643_10913133
1157 Ga0207705_10013304
1158 Ga0207705_10106205
1159 Ga0207705_10207196
1160 Ga0207654_10584402
1161 Ga0207707_10431618
1162 Ga0207707_10597725
1163 Ga0207707_11506543
1164 Ga0207695_10019365
1165 Ga0207695_10235810
1166 Ga0207695_10372458
1167 Ga0207671_10076739
1168 Ga0207693_10010040
1169 Ga0207693_10013941
1170 Ga0207693_10487206
1171 Ga0207693_10859425
1172 Ga0207663_10001658
1173 Ga0207663_10035718
1174 Ga0207663_10405578
1175 Ga0207663_11256590
1176 Ga0207660_10084392
1177 Ga0207660_10424304
1178 Ga0207662_10155303
1179 Ga0207657_10102802
1180 Ga0207657_10255329
1181 Ga0207657_10371965
1182 Ga0207649_10142620
1183 Ga0207652_10187288
1184 Ga0207652_10436119
1185 Ga0207652_10674724
1186 Ga0207646_10000851
1187 Ga0207646_10195739
1188 Ga0207681_10306243
1189 Ga0207681_10598453
1190 Ga0207694_10781720
1191 Ga0207650_11638263
1192 Ga0207687_10030470
1193 Ga0207687_10096683
1194 Ga0207687_10666309
1195 Ga0207700_10017072
1196 Ga0207700_10399445
1197 Ga0207700_10412395
1198 Ga0207664_10007639
1199 Ga0207664_10034818
1200 Ga0207664_10115407
1201 Ga0207664_10138735
1202 Ga0207664_10164713
1203 Ga0207664_10229497
1204 Ga0207664_10328891
1205 Ga0207664_10496599
1206 Ga0207664_10561840
1207 Ga0207664_11206491
1208 Ga0207644_10072450
1209 Ga0207644_10410772
1210 Ga0207644_11411791
1211 Ga0207690_10468740
1212 Ga0207706_10482306
1213 Ga0207706_10800498
1214 Ga0207686_10401199
1215 Ga0207686_10533676
1216 Ga0207709_10082076
1217 Ga0207709_11464786
1218 Ga0207704_10051212
1219 Ga0207665_10006320
1220 Ga0207665_10473919
1221 Ga0207665_10518986
1222 Ga0207711_10169015
1223 Ga0207711_10955081
1224 Ga0207689_10091239
1225 Ga0207689_11381585
1226 Ga0207661_10276162
1227 Ga0207661_10443483
1228 Ga0207661_10591414
1229 Ga0207661_11016368
1230 Ga0207661_11046840
1231 Ga0207667_10429595
1232 Ga0207667_11422283
1233 Ga0207712_10530389
1234 Ga0207677_10344246
1235 Ga0207677_10797360
1236 Ga0207677_10960308
1237 Ga0207703_10065761
1238 Ga0207703_10837358
1239 Ga0207703_10967563
1240 Ga0207678_10100762
1241 Ga0207678_10415995
1242 Ga0207678_10766858
1243 Ga0207678_10859714
1244 Ga0207708_10087705
1245 Ga0207708_10625417
1246 Ga0207708_11781913
1247 Ga0207702_10190079
1248 Ga0207702_11213915
1249 Ga0207641_10042697
1250 Ga0207676_10054566
1251 Ga0207676_10812390
1252 Ga0207674_10435556
1253 Ga0207674_11648572
1254 Ga0207675_100246022
1255 Ga0207675_101047703
1256 Ga0207675_101057331
1257 Ga0207675_101876437
1258 Ga0207683_10117278
1259 Ga0207683_10427006
1260 Ga0207683_10588768
1261 Ga0207683_10733875
1262 Ga0209981_1020297
1263 Ga0209974_10424135
1264 Ga0207428_10228085
1265 Ga0268266_10431066
1266 Ga0268266_10701170
1267 Ga0268265_11163717
1268 Ga0268264_12539093
1269 Ga0265337_1021431
1270 Ga0265337_1084356
1271 Ga0265326_10073608
1272 Ga0265319_1001715
1273 Ga0265334_10036178
1274 Ga0265334_10147650
1275 Ga0265318_10047830
1276 Ga0265318_10255532
1277 Ga0265322_10025674
1278 Ga0265322_10182142
1279 Ga0265336_10122894
1280 Ga0265336_10147394
1281 Ga0265338_10006529
1282 Ga0265338_10045626
1283 Ga0265338_10083592
1284 Ga0265338_10099744
1285 Ga0265330_10045559
1286 Ga0265330_10098668
1287 Ga0265328_10092750
1288 Ga0265320_10017023
1289 Ga0265325_10016452
1290 Ga0265325_10085494
1291 Ga0265325_10283961
1292 Ga0265329_10138024
1293 Ga0265329_10219597
1294 Ga0265340_10038019
1295 Ga0265339_10014606
1296 Ga0265331_10367553
1297 Ga0265327_10096947
1298 Ga0265327_10123635
1299 Ga0265316_10042776
1300 Ga0265316_10092509
1301 Ga0307408_100545538
1302 Ga0265313_10006544
1303 Ga0265313_10127195
1304 Ga0265314_10006724
1305 Ga0265314_10008726
1306 Ga0265314_10422702
1307 Ga0265314_10443618
1308 Ga0265342_10025010
1309 Ga0265342_10202846
1310 Ga0307405_10074269
1311 Ga0307405_10123693
1312 Ga0307405_10204622
1313 Ga0307413_10097915
1314 Ga0307413_10188484
1315 Ga0307413_10717449
1316 Ga0307413_10839512
1317 Ga0307410_10270296
1318 Ga0307410_10311301
1319 Ga0307410_10858627
1320 Ga0326468_10109920
1321 Ga0326468_10126297
1322 Ga0307406_10407586
1323 Ga0307406_10868431
1324 Ga0307406_12096958
1325 Ga0307407_10969741
1326 Ga0307412_10343235
1327 Ga0307409_100056567
1328 Ga0307409_100096173
1329 Ga0307409_100860291
1330 Ga0307409_102072944
1331 Ga0307409_102646222
1332 Ga0307416_100089639
1333 Ga0307416_100530152
1334 Ga0307416_100888673
1335 Ga0307416_101306845
1336 Ga0307414_10073335
1337 Ga0307411_10030391
1338 Ga0307411_10262825
1339 Ga0307411_10896739
1340 Ga0307415_100127028
1341 Ga0307415_100736408
1342 Ga0373948_0139519
1343 Ga0373926_0006000
1344 Ga0373951_0142164
1345 Ga0373952_0082783
1346 Ga0373939_0168584
1347 Ga0373941_0150692
1348 Ga0373945_0023155
1349 Ga0373956_0183074
1350 Ga0373956_0513584
1351 Ga0373943_0125938
1352 Ga0373943_0151187
1353 Ga0373946_0020441
1354 Ga0373946_0236626
1355 Ga0373946_0664180
1356 Ga0373955_0377954
1357 Ga0373942_0370355
1358 Ga0373962_0117593
1359 Ga0373931_0059336
1360 Ga0373931_0259014
1361 Ga0373931_0503773
1362 Ga0373935_0090520
1363 Ga0373935_0604723
1364 Ga0373927_0546312
1365 Ga0373927_0599879
1366 Ga0373933_0089134
1367 Ga0373933_0136788
1368 Ga0373947_0005312
1369 Ga0373937_0001944
1370 Ga0373937_0073336
1371 Ga0373937_0270361
1372 Ga0373937_0548141
1373 Ga0373937_1283235
1374 Ga0373925_0052441
1375 Ga0373925_0359065
1376 Ga0373925_0979215
1377 Ga0395899_0166213
1378 Ga0395900_0011178
1379 Ga0395900_0146861
1380 Ga0395900_0676842
1381 Ga0395898_0018787
1382 Ga0395898_0265711
1383 Ga0395898_0397597
1384 Ga0395898_0531182
1385 Ga0395905_0050090
1386 Ga0395905_0369375
1387 Ga0395905_0457870
1388 Ga0395901_0010536
1389 Ga0395901_0125050
1390 Ga0395901_0481896
1391 Ga0395901_0542906
1392 Ga0436360_1056459
1393 Ga0436360_1119388
1394 Ga0436363_1310716
1395 Ga0436362_0027807
1396 Ga0439438_017736
1397 Ga0439461_0016834
1398 Ga0439466_0036002
1399 Ga0451802_0689958
1400 Ga0451853_3622250
1401 Ga0439431_0101146
1402 Ga0450915_008079
1403 Ga0450920_041655
1404 Ga0450896_061610
1405 Ga0450898_116236
1406 Ga0439446_0023933
1407 Ga0439434_0121539
1408 Ga0450916_033609
1409 Ga0450918_004776
1410 Ga0451577_1753020
1411 Ga0466969_0006133
1412 Ga0466969_0023380
1413 Ga0466972_0034041
1414 Ga0466965_0074448
1415 Ga0466965_0252957
1416 Ga0466965_0291117
1417 Ga0466965_0388413
1418 Ga0466966_0024593
1419 Ga0466966_0052870
1420 Ga0466961_0009749
1421 Ga0466961_0011634
1422 Ga0466961_0037779
1423 Ga0466961_0130266
1424 Ga0466961_0163835
1425 Ga0466961_0177224
1426 Ga0466963_0002044
1427 Ga0466963_0003206
1428 Ga0466963_0009978
1429 Ga0466963_0012830
1430 Ga0466963_0015028
1431 Ga0466963_0021764
1432 Ga0466963_0024321
1433 Ga0466963_0043303
1434 Ga0466963_0053690
1435 Ga0466963_0059333
1436 Ga0466963_0063099
1437 Ga0466963_0134375
1438 Ga0466963_0159747
1439 Ga0466963_0202023
1440 Ga0466963_0214431
1441 Ga0466963_0513648
1442 Ga0466963_1146383
1443 Ga0466964_0002221
1444 Ga0466964_0010956
1445 Ga0466964_0038807
1446 Ga0466964_0059035
1447 Ga0466964_0110190
1448 Ga0466964_0152954
1449 Ga0453684_0774690
1450 Ga0466971_0000811
1451 Ga0466971_0034283
1452 Ga0466971_0034812
1453 Ga0466971_0095466
1454 Ga0466968_0001383
1455 Ga0466968_0009900
1456 Ga0466968_0089730
1457 Ga0466968_0126221
1458 Ga0466970_0038989
1459 Ga0466970_0555848
1460 Ga0466957_0011431
1461 Ga0466957_0014656
1462 Ga0466957_0039094
1463 Ga0466957_0043235
1464 Ga0466957_0043431
1465 Ga0466957_0050574
1466 Ga0466957_0127925
1467 Ga0466957_0141542
1468 Ga0466957_0378501
1469 Ga0466960_0019584
1470 Ga0466960_0044711
1471 Ga0466960_0280714
1472 Ga0466959_0000761
1473 Ga0466959_0005947
1474 Ga0466959_0010572
1475 Ga0466959_0040467
1476 Ga0466958_0011877
1477 Ga0466958_0019527
1478 Ga0466958_0029055
1479 Ga0466958_0037650
1480 Ga0466958_0044163
1481 Ga0466958_0061728
1482 Ga0466958_0357637
1483 Ga0466967_0002348
1484 Ga0466967_0008064
1485 Ga0466967_0027506
1486 Ga0466967_0039466
1487 Ga0466967_0074534
1488 Ga0466967_0087787
1489 Ga0466967_0091601
1490 Ga0466967_0104215
1491 Ga0466967_0135518
1492 Ga0466967_0197542
1493 Ga0466967_0225216
1494 Ga0466967_0286864
1495 Ga0466967_0309574
1496 Ga0466967_0310629
1497 Ga0466967_0340817
1498 Ga0466967_0376555
1499 Ga0466967_0407941
1500 Ga0466967_0466275
1501 Ga0466967_0498769
1502 Ga0466967_1007435
1503 Ga0466967_1022476
1504 Ga0466967_1284834
1505 Ga0495592_0000082
1506 Ga0495592_0005470
1507 Ga0495592_0078369
1508 Ga0495592_0110113
1509 Ga0495592_0169612
1510 Ga0495603_0026915
1511 Ga0495603_0054621
1512 Ga0495603_0209415
1513 Ga0495603_0267484
1514 Ga0495590_0375566
1515 Ga0495629_0057569
1516 Ga0495629_0254100
1517 Ga0495629_0438158
1518 Ga0495629_0484862
1519 Ga0495641_0021128
1520 Ga0495641_0026211
1521 Ga0495641_0033988
1522 Ga0495641_0114119
1523 Ga0495641_0140930
1524 Ga0495641_0143146
1525 Ga0495641_0174278
1526 Ga0495651_0000254
1527 Ga0495651_0147265
1528 Ga0495651_0233596
1529 Ga0495651_0859931
1530 Ga0495653_0008090
1531 Ga0495653_0019537
1532 Ga0495653_0036185
1533 Ga0495653_0049166
1534 Ga0495653_0052428
1535 Ga0495653_0171551
1536 Ga0495653_0619901
1537 Ga0495653_0886785
1538 Ga0495580_0027920
1539 Ga0495580_0384454
1540 Ga0495582_0021125
1541 Ga0495582_0166217
1542 Ga0495582_0247464
1543 Ga0495639_0021259
1544 Ga0495639_0114549
1545 Ga0495662_0002737
1546 Ga0495664_0023352
1547 Ga0495664_0048325
1548 Ga0495664_0281496
1549 Ga0495664_0340710
1550 Ga0495664_0366013
1551 Ga0495664_0454089
1552 Ga0495664_0905223
1553 Ga0495584_0029054
1554 Ga0495585_0225901
1555 Ga0495596_0111430
1556 Ga0495596_0131101
1557 Ga0495608_0003029
1558 Ga0495608_0024374
1559 Ga0495608_0105999
1560 Ga0495608_0728423
1561 Ga0495608_0843316
1562 Ga0495618_0025188
1563 Ga0495618_0045188
1564 Ga0495618_0065034
1565 Ga0495618_0154761
1566 Ga0495618_0173072
1567 Ga0495618_0255145
1568 Ga0495620_0186565
1569 Ga0495628_0008466
1570 Ga0495628_0025414
1571 Ga0495628_0229084
1572 Ga0495630_0047973
1573 Ga0495630_0127048
1574 Ga0495630_0353097
1575 Ga0495630_0371840
1576 Ga0495630_1008805
1577 Ga0495644_0059168
1578 Ga0495666_0000309
1579 Ga0495652_0000144
1580 Ga0495652_0098296
1581 Ga0495652_0101405
1582 Ga0495652_0202452
1583 Ga0495652_0310045
1584 Ga0495652_0526687
1585 Ga0495652_0939203
1586 Ga0495665_0046576
1587 Ga0495640_0068005
1588 Ga0495640_0153332
1589 Ga0495640_0430155
1590 Ga0495640_0536709
1591 Ga0495586_0052192
1592 Ga0495586_0087870
1593 Ga0495586_0099724
1594 Ga0495586_0168258
1595 Ga0495586_0231059
1596 Ga0495587_0000060
1597 Ga0495587_0054748
1598 Ga0495587_0130539
1599 Ga0495621_0186462
1600 Ga0495645_0000038
1601 Ga0495645_0026009
1602 Ga0495645_0065208
1603 Ga0495645_0108382
1604 Ga0495645_0425074
1605 Ga0495667_0041480
1606 Ga0495667_0063361
1607 Ga0495667_0147787
1608 Ga0495667_0269832
1609 Ga0495667_0311179
1610 Ga0495667_0327687
1611 Ga0495667_0544390
1612 Ga0495667_0670775
1613 Ga0495667_0734070
1614 Ga0495656_0004882
1615 Ga0495656_0414786
1616 Ga0495668_0127931
1617 Ga0495634_0097102
1618 Ga0495634_0108667
1619 Ga0495634_0170122
1620 Ga0495634_0260784
1621 Ga0495634_0300388
1622 Ga0495634_0705950
1623 Ga0495635_0061455
1624 Ga0495635_0093282
1625 Ga0495635_0169001
1626 Ga0495635_0229115
1627 Ga0495659_0235092
1628 Ga0495661_0216592
1629 Ga0495588_0499315
1630 Ga0495657_0017146
1631 Ga0495657_0074538
1632 Ga0495657_0130787
1633 Ga0495657_0409629
1634 Ga0495657_0651169
1635 Ga0495599_0007761
1636 Ga0495599_0022857
1637 Ga0495599_0148173
1638 Ga0495623_0001647
1639 Ga0495623_0462693
1640 Ga0495646_0018814
1641 Ga0495646_0049372
1642 Ga0495646_0116807
1643 Ga0495647_0008741
1644 Ga0495647_0017159
1645 Ga0495647_0056840
1646 Ga0495647_0596353
1647 Ga0495658_0027649
1648 Ga0495658_0244638
1649 Ga0495658_0653294
1650 Ga0495658_0997222
1651 Ga0495613_0015955
1652 Ga0495613_0260787
1653 Ga0495613_0353040
1654 Ga0495613_0385974
1655 Ga0495624_0009825
1656 Ga0495624_0032420
1657 Ga0495624_0045373
1658 Ga0495624_0346354
1659 Ga0495624_0399900
1660 Ga0495600_0022116
1661 Ga0495600_0197659
1662 Ga0495600_0215664
1663 Ga0495660_0286114
1664 Ga0495660_0507468
1665 Ga0495581_0063679
1666 Ga0495581_0285930
1667 Ga0495604_0000043
1668 Ga0495604_0148690
1669 Ga0495604_0284317
1670 Ga0495636_0112191
1671 Ga0495674_0039854
1672 Ga0495674_0133281
1673 Ga0495674_0165119
1674 Ga0495674_0187393
1675 Ga0495674_0275727
1676 Ga0495674_0328482
1677 Ga0495674_1035486
1678 Ga0495676_0103965
1679 Ga0495676_0111905
1680 Ga0495676_0309857
1681 Ga0495680_0010993
1682 Ga0495680_0047309
1683 Ga0495680_0128449
1684 Ga0495680_0208519
1685 Ga0495680_0409729
1686 Ga0495680_0487979
1687 Ga0495680_0600625
1688 Ga0495683_0164235
1689 Ga0495675_0000413
1690 Ga0495677_0215595
1691 Ga0495679_057747
1692 Ga0495684_0001111
1693 Ga0495684_0006437
1694 Ga0495684_0193268
1695 Ga0495684_0249687
1696 Ga0495684_0540914
1697 Ga0495684_0852706
1698 Ga0495684_0881902
1699 Ga0495593_0027939
1700 Ga0495593_0104572
1701 Ga0495602_0043043
1702 Ga0495602_0053415
1703 Ga0495602_0217072
1704 Ga0495602_0342351
1705 Ga0495614_0009758
1706 Ga0495614_0073037
1707 Ga0495615_0147763
1708 Ga0496100_0028219
1709 Ga0496100_1434127
1710 Ga0496101_0039194
1711 Ga0496101_0081933
1712 Ga0496101_0300984
1713 Ga0496101_1021589
1714 Ga0496101_1061894
1715 Ga0496101_1511711
1716 Ga0496102_0003464
1717 Ga0496102_0008253
1718 Ga0496102_0143115
1719 Ga0496102_0189821
1720 Ga0496103_0005471
1721 Ga0496103_0023207
1722 Ga0496103_0358114
1723 Ga0496104_0016980
1724 Ga0496104_0059067
1725 Ga0496104_0150580
1726 Ga0496104_0196248
1727 Ga0496104_0320571
1728 Ga0496104_1276829
1729 Ga0496105_0015128
1730 Ga0496105_0065644
1731 Ga0496105_0161150
1732 Ga0496105_0440379
1733 Ga0496105_0629891
1734 Ga0496106_0017267
1735 Ga0496106_0183614
1736 Ga0496106_0235757
1737 Ga0496106_0419118
1738 Ga0496107_0005952
1739 Ga0496107_0133461
1740 Ga0496107_0421448
1741 Ga0496107_0579130
1742 Ga0496107_1250802
1743 Ga0496108_0037409
1744 Ga0496108_0110191
1745 Ga0496108_0221375
1746 Ga0496108_0240228
1747 Ga0496108_0302977
1748 Ga0496109_0053795
1749 Ga0496109_0102132
1750 Ga0496109_0119789
1751 Ga0496109_0129522
1752 Ga0496109_0289311
1753 Ga0496110_0169177
1754 Ga0496110_0628038
1755 Ga0496110_1338264
1756 Ga0496111_0117258
1757 Ga0496111_0120767
1758 Ga0496111_0161779
1759 Ga0496111_0221098
1760 Ga0496111_0758520
1761 Ga0496112_0158987
1762 Ga0496112_0204957
1763 Ga0496112_1296300
1764 Ga0496113_0071897
1765 Ga0496113_0113339
1766 Ga0496113_0246479
1767 Ga0496114_0004956
1768 Ga0496114_0006185
1769 Ga0496114_0033807
1770 Ga0496114_0164281
1771 Ga0496115_0009112
1772 Ga0496115_0033955
1773 Ga0496115_0194322
1774 Ga0496115_0329984
1775 Ga0496115_0382445
1776 Ga0501031_0003238
1777 Ga0501031_0755708
1778 Ga0501032_0016731
1779 Ga0501033_0011156
1780 Ga0501036_0013212
1781 Ga0501036_1137596
1782 Ga0501037_0001718
1783 Ga0501038_0071959
1784 Ga0501039_0033420
1785 Ga0501040_0177164
1786 Ga0501040_1096012
1787 Ga0501041_0052787
1788 Ga0501042_0790184
1789 Ga0501043_0005046
1790 Ga0501046_0226491
1791 Ga0501067_0070774
1792 Ga0501067_0260907
1793 Ga0501069_0000281
1794 Ga0501069_0012970
1795 Ga0501069_0109884
1796 Ga0501070_0096580
1797 Ga0501070_0134827
1798 Ga0501071_0006860
1799 Ga0501071_0082451
1800 Ga0501071_0701119
1801 Ga0501071_0744459
1802 Ga0501072_0001268
1803 Ga0501072_1346898
1804 Ga0501073_0004422
1805 Ga0501074_0060889
1806 Ga0501075_0026770
1807 Ga0501076_0221178
1808 Ga0501076_0255360
1809 Ga0501077_0006117
1810 Ga0501077_0197370
1811 Ga0501255_029548
1812 Ga0501225_0356133
1813 Ga0501079_0135066
1814 Ga0501079_0225222
1815 Ga0501081_0095144
1816 Ga0501083_0059072
1817 Ga0501268_076747
1818 Ga0501035_0023192
1819 Ga0501044_0047525
1820 Ga0501045_0004644
1821 Ga0501045_0977297
1822 nmdc:mga00v17_672439_c1
1823 nmdc:mga06r32_1620144_c1
1824 nmdc:mga08y16_1377811_c1
1825 nmdc:mga08y16_201893_c1
1826 nmdc:mga08y16_503294_c1
1827 nmdc:mga08y16_529562_c1
1828 nmdc:mga0n895_104711_c1
1829 nmdc:mga08x19_498856_c1
1830 nmdc:mga0a205_53821_c1
1831 Ga0495601_0016127
1832 Ga0495601_0106723
1833 Ga0495601_0121354
1834 Ga0495601_0132228
1835 Ga0495601_0219668
1836 Ga0495601_0298539
1837 Ga0495601_0383161
1838 Ga0495612_0048056
1839 Ga0495612_0104624
1840 Ga0495595_0037657
1841 Ga0495595_0077821
1842 Ga0495595_0126829
1843 Ga0495619_0005446
1844 Ga0495619_0065883
1845 Ga0495619_0168655
1846 Ga0495619_0268750
1847 Ga0495619_0628109
1848 Ga0500641_0121656
1849 Ga0500608_320245
1850 Ga0501084_0076562
1851 Ga0501084_0128730
1852 Ga0587066_048692
1853 Ga0587070_050497
1854 Ga0587073_0179480
1855 Ga0587073_0280482
1856 Ga0587080_042143
1857 Ga0587082_121217
1858 Ga0587083_0111320
1859 Ga0587085_085882
1860 Ga0587088_151590
1861 Ga0587113_026351
1862 Ga0587122_061945
1863 Ga0587067_200294
1864 Ga0587069_101856
1865 Ga0587069_113803
1866 Ga0587075_142988
1867 Ga0587079_189283
1868 Ga0587114_079903
1869 Ga0587119_041929
1870 Ga0587071_072219
1871 Ga0501082_0080589
1872 Ga0501082_0854572
1873 Ga0466962_0032916
1874 Ga0466962_0193151
1875 Ga0530510_0087455
1876 Ga0530510_0255315

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

28

113

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v5d-assembly1.cif.gz_BX structure of the thermus thermophilus 70s ribosome in complex with mrna, paromomycin, acylated a- and p-site trnas, and e-site trna. 0.9471 4 95
8cgd-assembly1.cif.gz_s clindamycin bound to the 50s subunit 0.9431 5 85
6ppf-assembly1.cif.gz_T bacterial 45srbga ribosomal particle class b 0.943 4 89
7nhn-assembly1.cif.gz_W vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9403 4 90
6enj-assembly1.cif.gz_T polyproline-stalled ribosome in the presence of a+p site trna and elongation-factor p (ef-p) 0.9381 5 90
ID Description Score Start End Superfamily
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9377 4 89 3.30.70.330
af_P61845_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9225 9 90 3.30.70.330
4ukhK00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9161 3 86 3.30.70.330
4qs3X00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9075 7 95 3.30.70.330
4garT00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9016 5 90 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A7V9P4G8-F1-model_v4 Large ribosomal subunit protein uL23 0.973 1 98 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A348WVJ9-F1-model_v4 Large ribosomal subunit protein uL23 0.9716 3 93 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A6B1CUX1-F1-model_v4 Large ribosomal subunit protein uL23 0.9712 3 91 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7G6E5U1-F1-model_v4 Large ribosomal subunit protein uL23 0.9707 3 95 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1G2LQR1-F1-model_v4 Large ribosomal subunit protein uL23 0.9706 7 91 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map