F486258
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 938 | 393 | 1876 | 98 |
Family's Representative Sequence
| Representative Sequence | 3300044706|Ga0466964_0105434|Ga0466964_0105434_59_418 |
| Length | 119 |
| Sequence | VGALARRERGRAAAGAGKGGVMSLHPAQILIKPVVSEKSYHQITENRYTFKVHKDAHKTQIRQAVEELFEVKVVSVNVVKMPAKPKRRGMTKGTQSGWKKAIVELKAGDTIEIFEGAQL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 2 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 59 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 60 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 102 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 161 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 162 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 163 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 165 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 166 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 167 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 170 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 171 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 172 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 174 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 175 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 177 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 179 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 180 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 184 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 185 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 186 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 187 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 188 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 190 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 191 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 192 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 193 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 194 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 195 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 196 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 198 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 199 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 207 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 210 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 211 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 212 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 215 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 216 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 217 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 218 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 219 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 220 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 221 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 222 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 223 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 224 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 225 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 227 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 228 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 229 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 230 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 231 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 232 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 233 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 234 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 235 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 236 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 237 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 238 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 239 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 240 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 241 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 242 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 243 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 244 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 245 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 246 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 247 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 248 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 249 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 250 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 251 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 252 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 317 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 318 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 319 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 320 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 321 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 322 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 325 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 326 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 327 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 328 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 329 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 330 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 353 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 354 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 358 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 362 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 372 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 373 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 393 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.7 |
| Metatranscriptomes | 3.3 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.53 |
| Nodule | 0 |
| Rhizoplane | 7.36 |
| Rhizosphere | 91.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466964_0105434 | 3300044706 | Bacteria | 1249 |
| 2 | Ga0058862_12513208 | 3300004803 | Bacteria | 648 |
| 3 | Ga0070658_10129125 | 3300005327 | Bacteria | 2105 |
| 4 | Ga0070683_100370415 | 3300005329 | Bacteria | 1364 |
| 5 | Ga0070683_100896320 | 3300005329 | Bacteria | 851 |
| 6 | Ga0070666_10792227 | 3300005335 | Bacteria | 698 |
| 7 | Ga0070680_100102008 | 3300005336 | Bacteria | 2382 |
| 8 | Ga0070680_100235830 | 3300005336 | Bacteria | 1546 |
| 9 | Ga0070682_100432012 | 3300005337 | Bacteria | 1004 |
| 10 | Ga0070682_100442268 | 3300005337 | Bacteria | 994 |
| 11 | Ga0068868_100363719 | 3300005338 | Bacteria | 1242 |
| 12 | Ga0068868_100748772 | 3300005338 | Bacteria | 878 |
| 13 | Ga0068868_100908393 | 3300005338 | Bacteria | 801 |
| 14 | Ga0068868_101006419 | 3300005338 | Bacteria | 763 |
| 15 | Ga0070660_100197424 | 3300005339 | Bacteria | 1631 |
| 16 | Ga0070691_10061930 | 3300005341 | Bacteria | 1801 |
| 17 | Ga0070691_10218997 | 3300005341 | Bacteria | 1008 |
| 18 | Ga0070691_10270110 | 3300005341 | Bacteria | 919 |
| 19 | Ga0070687_100078432 | 3300005343 | Bacteria | 1795 |
| 20 | Ga0070687_100777720 | 3300005343 | Bacteria | 676 |
| 21 | Ga0070661_100294553 | 3300005344 | Bacteria | 1262 |
| 22 | Ga0070661_100435253 | 3300005344 | Bacteria | 1041 |
| 23 | Ga0070661_101887956 | 3300005344 | Bacteria | 508 |
| 24 | Ga0070669_101141892 | 3300005353 | Bacteria | 672 |
| 25 | Ga0070669_101953349 | 3300005353 | Bacteria | 513 |
| 26 | Ga0070671_101222235 | 3300005355 | Bacteria | 662 |
| 27 | Ga0070674_101170412 | 3300005356 | Bacteria | 681 |
| 28 | Ga0070688_100725808 | 3300005365 | Bacteria | 771 |
| 29 | Ga0070659_100110245 | 3300005366 | Bacteria | 2221 |
| 30 | Ga0070659_100501127 | 3300005366 | Bacteria | 1035 |
| 31 | Ga0070667_101452144 | 3300005367 | Bacteria | 644 |
| 32 | Ga0070709_10028862 | 3300005434 | Bacteria | 3312 |
| 33 | Ga0070709_10164035 | 3300005434 | Bacteria | 1547 |
| 34 | Ga0070709_10188355 | 3300005434 | Bacteria | 1454 |
| 35 | Ga0070714_100056543 | 3300005435 | Bacteria | 3356 |
| 36 | Ga0070714_100059769 | 3300005435 | Bacteria | 3269 |
| 37 | Ga0070714_100077238 | 3300005435 | Bacteria | 2892 |
| 38 | Ga0070714_100105023 | 3300005435 | Bacteria | 2493 |
| 39 | Ga0070714_100283994 | 3300005435 | Bacteria | 1539 |
| 40 | Ga0070714_100555310 | 3300005435 | Bacteria | 1100 |
| 41 | Ga0070714_100770655 | 3300005435 | Bacteria | 931 |
| 42 | Ga0070714_100960920 | 3300005435 | Bacteria | 831 |
| 43 | Ga0070713_100097613 | 3300005436 | Bacteria | 2539 |
| 44 | Ga0070713_100459845 | 3300005436 | Bacteria | 1196 |
| 45 | Ga0070710_10005822 | 3300005437 | Bacteria | 5879 |
| 46 | Ga0070710_10167643 | 3300005437 | Bacteria | 1366 |
| 47 | Ga0070701_11144916 | 3300005438 | Bacteria | 550 |
| 48 | Ga0070711_100043043 | 3300005439 | Bacteria | 3056 |
| 49 | Ga0070711_100709271 | 3300005439 | Bacteria | 848 |
| 50 | Ga0070711_101042357 | 3300005439 | Bacteria | 703 |
| 51 | Ga0070711_101472117 | 3300005439 | Bacteria | 594 |
| 52 | Ga0070705_100649209 | 3300005440 | Bacteria | 822 |
| 53 | Ga0070700_100084563 | 3300005441 | Bacteria | 2056 |
| 54 | Ga0070708_101302718 | 3300005445 | Bacteria | 679 |
| 55 | Ga0070663_100234715 | 3300005455 | Bacteria | 1445 |
| 56 | Ga0070663_100795047 | 3300005455 | Bacteria | 811 |
| 57 | Ga0070678_100421481 | 3300005456 | Bacteria | 1164 |
| 58 | Ga0070678_100957821 | 3300005456 | Unclassified | 785 |
| 59 | Ga0070662_101055438 | 3300005457 | Bacteria | 696 |
| 60 | Ga0070662_101234788 | 3300005457 | Bacteria | 643 |
| 61 | Ga0070681_10127620 | 3300005458 | Bacteria | 2476 |
| 62 | Ga0070681_10168346 | 3300005458 | Bacteria | 2113 |
| 63 | Ga0070681_10223330 | 3300005458 | Bacteria | 1799 |
| 64 | Ga0070681_10223401 | 3300005458 | Bacteria | 1798 |
| 65 | Ga0068867_100405633 | 3300005459 | Bacteria | 1151 |
| 66 | Ga0070685_10637400 | 3300005466 | Unclassified | 771 |
| 67 | Ga0070685_10861543 | 3300005466 | Bacteria | 672 |
| 68 | Ga0070707_100001557 | 3300005468 | Bacteria | 22299 |
| 69 | Ga0070707_100266830 | 3300005468 | Bacteria | 1665 |
| 70 | Ga0070698_100849043 | 3300005471 | Bacteria | 858 |
| 71 | Ga0070679_100324484 | 3300005530 | Bacteria | 1488 |
| 72 | Ga0070679_100392558 | 3300005530 | Bacteria | 1334 |
| 73 | Ga0070684_100218577 | 3300005535 | Bacteria | 1738 |
| 74 | Ga0070684_100352112 | 3300005535 | Bacteria | 1355 |
| 75 | Ga0070684_100553428 | 3300005535 | Bacteria | 1068 |
| 76 | Ga0070684_100864220 | 3300005535 | Bacteria | 847 |
| 77 | Ga0070684_101183869 | 3300005535 | Bacteria | 719 |
| 78 | Ga0070695_100001595 | 3300005545 | Bacteria | 12688 |
| 79 | Ga0070665_100427482 | 3300005548 | Bacteria | 1333 |
| 80 | Ga0068855_100177324 | 3300005563 | Bacteria | 2410 |
| 81 | Ga0068855_100718550 | 3300005563 | Bacteria | 1068 |
| 82 | Ga0068855_102429229 | 3300005563 | Bacteria | 523 |
| 83 | Ga0070664_100072110 | 3300005564 | Bacteria | 2961 |
| 84 | Ga0070664_100810128 | 3300005564 | Bacteria | 876 |
| 85 | Ga0070664_101987995 | 3300005564 | Bacteria | 552 |
| 86 | Ga0068854_100330579 | 3300005578 | Bacteria | 1242 |
| 87 | Ga0068856_100225532 | 3300005614 | Bacteria | 1889 |
| 88 | Ga0068856_100267427 | 3300005614 | Bacteria | 1725 |
| 89 | Ga0068856_100515783 | 3300005614 | Bacteria | 1216 |
| 90 | Ga0070702_100005631 | 3300005615 | Bacteria | 5858 |
| 91 | Ga0070702_100253720 | 3300005615 | Bacteria | 1194 |
| 92 | Ga0070702_101450514 | 3300005615 | Bacteria | 563 |
| 93 | Ga0068852_100227666 | 3300005616 | Bacteria | 1776 |
| 94 | Ga0068859_100119417 | 3300005617 | Bacteria | 2703 |
| 95 | Ga0068864_100096261 | 3300005618 | Bacteria | 2619 |
| 96 | Ga0068866_10057880 | 3300005718 | Bacteria | 1999 |
| 97 | Ga0068861_101533561 | 3300005719 | Bacteria | 655 |
| 98 | Ga0068870_10062303 | 3300005840 | Bacteria | 2008 |
| 99 | Ga0068863_100353207 | 3300005841 | Bacteria | 1432 |
| 100 | Ga0068858_100115450 | 3300005842 | Bacteria | 2509 |
| 101 | Ga0068858_100949432 | 3300005842 | Bacteria | 842 |
| 102 | Ga0068860_102073695 | 3300005843 | Bacteria | 590 |
| 103 | Ga0081455_10074026 | 3300005937 | Bacteria | 2814 |
| 104 | Ga0081455_10096946 | 3300005937 | Bacteria | 2377 |
| 105 | Ga0081455_10353406 | 3300005937 | Bacteria | 1036 |
| 106 | Ga0081538_10030998 | 3300005981 | Bacteria | 3617 |
| 107 | Ga0081538_10034025 | 3300005981 | Bacteria | 3379 |
| 108 | Ga0081539_10161609 | 3300005985 | Bacteria | 1067 |
| 109 | Ga0070717_10026635 | 3300006028 | Bacteria | 4614 |
| 110 | Ga0070717_10096339 | 3300006028 | Bacteria | 2506 |
| 111 | Ga0070717_10096495 | 3300006028 | Bacteria | 2504 |
| 112 | Ga0070717_10442590 | 3300006028 | Bacteria | 1170 |
| 113 | Ga0075365_10212128 | 3300006038 | Bacteria | 1357 |
| 114 | Ga0075364_10511503 | 3300006051 | Bacteria | 821 |
| 115 | Ga0075432_10169267 | 3300006058 | Bacteria | 849 |
| 116 | Ga0070715_10005967 | 3300006163 | Bacteria | 4108 |
| 117 | Ga0070715_10113250 | 3300006163 | Bacteria | 1283 |
| 118 | Ga0070716_100070921 | 3300006173 | Bacteria | 2047 |
| 119 | Ga0070716_100104618 | 3300006173 | Bacteria | 1743 |
| 120 | Ga0070716_100682625 | 3300006173 | Bacteria | 782 |
| 121 | Ga0070716_101081207 | 3300006173 | Bacteria | 639 |
| 122 | Ga0070716_101257302 | 3300006173 | Bacteria | 597 |
| 123 | Ga0070712_100047985 | 3300006175 | Bacteria | 2958 |
| 124 | Ga0070712_100063501 | 3300006175 | Bacteria | 2615 |
| 125 | Ga0070712_100882128 | 3300006175 | Bacteria | 771 |
| 126 | Ga0070712_101187638 | 3300006175 | Bacteria | 663 |
| 127 | Ga0097621_100653875 | 3300006237 | Bacteria | 965 |
| 128 | Ga0097621_100763387 | 3300006237 | Bacteria | 894 |
| 129 | Ga0068871_100415161 | 3300006358 | Bacteria | 1201 |
| 130 | Ga0068871_101478047 | 3300006358 | Bacteria | 642 |
| 131 | Ga0075428_101458411 | 3300006844 | Bacteria | 717 |
| 132 | Ga0075431_101685743 | 3300006847 | Bacteria | 591 |
| 133 | Ga0075433_10153434 | 3300006852 | Bacteria | 2049 |
| 134 | Ga0075429_101874775 | 3300006880 | Bacteria | 520 |
| 135 | Ga0068865_100421386 | 3300006881 | Bacteria | 1098 |
| 136 | Ga0097620_100119408 | 3300006931 | Bacteria | 2703 |
| 137 | Ga0075435_101006573 | 3300007076 | Bacteria | 728 |
| 138 | Ga0105240_10128107 | 3300009093 | Bacteria | 3047 |
| 139 | Ga0111539_10217483 | 3300009094 | Bacteria | 2225 |
| 140 | Ga0111539_11694447 | 3300009094 | Bacteria | 733 |
| 141 | Ga0105245_10091016 | 3300009098 | Bacteria | 2807 |
| 142 | Ga0105245_11052678 | 3300009098 | Bacteria | 859 |
| 143 | Ga0105245_12076983 | 3300009098 | Bacteria | 622 |
| 144 | Ga0105245_12327919 | 3300009098 | Bacteria | 589 |
| 145 | Ga0105245_12976242 | 3300009098 | Bacteria | 525 |
| 146 | Ga0105247_10230852 | 3300009101 | Bacteria | 1256 |
| 147 | Ga0105247_11287676 | 3300009101 | Bacteria | 586 |
| 148 | Ga0114129_11008000 | 3300009147 | Bacteria | 1048 |
| 149 | Ga0114129_11010623 | 3300009147 | Bacteria | 1047 |
| 150 | Ga0105243_10085476 | 3300009148 | Bacteria | 2586 |
| 151 | Ga0105243_10555802 | 3300009148 | Bacteria | 1097 |
| 152 | Ga0105241_10772790 | 3300009174 | Bacteria | 883 |
| 153 | Ga0105241_11810639 | 3300009174 | Bacteria | 596 |
| 154 | Ga0105242_10689819 | 3300009176 | Bacteria | 998 |
| 155 | Ga0105242_10967178 | 3300009176 | Bacteria | 857 |
| 156 | Ga0105248_10181619 | 3300009177 | Bacteria | 2371 |
| 157 | Ga0105248_11188175 | 3300009177 | Bacteria | 862 |
| 158 | Ga0105248_11533987 | 3300009177 | Bacteria | 754 |
| 159 | Ga0105237_10288496 | 3300009545 | Bacteria | 1644 |
| 160 | Ga0105237_12161344 | 3300009545 | Bacteria | 566 |
| 161 | Ga0105237_12189820 | 3300009545 | Bacteria | 562 |
| 162 | Ga0105238_10078095 | 3300009551 | Bacteria | 3301 |
| 163 | Ga0105238_10363513 | 3300009551 | Bacteria | 1437 |
| 164 | Ga0105249_11103273 | 3300009553 | Bacteria | 864 |
| 165 | Ga0105249_12291076 | 3300009553 | Bacteria | 613 |
| 166 | Ga0105239_12001561 | 3300010375 | Bacteria | 672 |
| 167 | Ga0105239_12107478 | 3300010375 | Bacteria | 655 |
| 168 | Ga0105239_12689728 | 3300010375 | Bacteria | 580 |
| 169 | Ga0105239_13607146 | 3300010375 | Bacteria | 503 |
| 170 | Ga0105246_10050833 | 3300011119 | Bacteria | 2844 |
| 171 | Ga0105246_11976188 | 3300011119 | Bacteria | 562 |
| 172 | Ga0157373_10489500 | 3300013100 | Bacteria | 888 |
| 173 | Ga0157371_10627397 | 3300013102 | Bacteria | 801 |
| 174 | Ga0157370_11176455 | 3300013104 | Bacteria | 692 |
| 175 | Ga0157369_10745475 | 3300013105 | Bacteria | 1008 |
| 176 | Ga0157369_10893379 | 3300013105 | Bacteria | 911 |
| 177 | Ga0157374_10218951 | 3300013296 | Bacteria | 1868 |
| 178 | Ga0157374_11330808 | 3300013296 | Bacteria | 741 |
| 179 | Ga0157374_12727037 | 3300013296 | Bacteria | 522 |
| 180 | Ga0163162_10235751 | 3300013306 | Bacteria | 1960 |
| 181 | Ga0163162_10421942 | 3300013306 | Bacteria | 1466 |
| 182 | Ga0157372_10092283 | 3300013307 | Bacteria | 3444 |
| 183 | Ga0157372_10394922 | 3300013307 | Bacteria | 1612 |
| 184 | Ga0157372_10579413 | 3300013307 | Bacteria | 1308 |
| 185 | Ga0157372_10720578 | 3300013307 | Bacteria | 1160 |
| 186 | Ga0157372_11284238 | 3300013307 | Bacteria | 845 |
| 187 | Ga0157375_12023917 | 3300013308 | Bacteria | 685 |
| 188 | Ga0157380_10513528 | 3300014326 | Bacteria | 1167 |
| 189 | Ga0157380_10637294 | 3300014326 | Bacteria | 1061 |
| 190 | Ga0157379_11136506 | 3300014968 | Bacteria | 749 |
| 191 | Ga0157379_12015990 | 3300014968 | Bacteria | 570 |
| 192 | Ga0157376_10217879 | 3300014969 | Bacteria | 1766 |
| 193 | Ga0157376_11619526 | 3300014969 | Bacteria | 682 |
| 194 | Ga0182005_1051686 | 3300015265 | Bacteria | 1118 |
| 195 | Ga0197907_10026626 | 3300020069 | Bacteria | 1330 |
| 196 | Ga0197907_10678466 | 3300020069 | Bacteria | 1297 |
| 197 | Ga0206356_10605300 | 3300020070 | Bacteria | 774 |
| 198 | Ga0206355_1424902 | 3300020076 | Bacteria | 737 |
| 199 | Ga0206355_1506274 | 3300020076 | Bacteria | 537 |
| 200 | Ga0206352_10068973 | 3300020078 | Bacteria | 667 |
| 201 | Ga0206350_11082515 | 3300020080 | Bacteria | 797 |
| 202 | Ga0206353_10705410 | 3300020082 | Bacteria | 998 |
| 203 | Ga0206353_10963865 | 3300020082 | Bacteria | 1252 |
| 204 | Ga0224712_10017227 | 3300022467 | Bacteria | 2392 |
| 205 | Ga0224712_10390005 | 3300022467 | Bacteria | 663 |
| 206 | Ga0207692_10004596 | 3300025898 | Bacteria | 5474 |
| 207 | Ga0207692_10098877 | 3300025898 | Bacteria | 1598 |
| 208 | Ga0207642_10225697 | 3300025899 | Bacteria | 1049 |
| 209 | Ga0207688_10079443 | 3300025901 | Bacteria | 1871 |
| 210 | Ga0207688_10820376 | 3300025901 | Bacteria | 589 |
| 211 | Ga0207647_10401665 | 3300025904 | Bacteria | 772 |
| 212 | Ga0207699_10002466 | 3300025906 | Bacteria | 8728 |
| 213 | Ga0207699_10169674 | 3300025906 | Bacteria | 1459 |
| 214 | Ga0207699_10420751 | 3300025906 | Bacteria | 954 |
| 215 | Ga0207699_10793224 | 3300025906 | Bacteria | 696 |
| 216 | Ga0207645_11147044 | 3300025907 | Bacteria | 523 |
| 217 | Ga0207643_10134240 | 3300025908 | Bacteria | 1474 |
| 218 | Ga0207643_10913133 | 3300025908 | Bacteria | 569 |
| 219 | Ga0207705_10013304 | 3300025909 | Bacteria | 5938 |
| 220 | Ga0207705_10106205 | 3300025909 | Bacteria | 2070 |
| 221 | Ga0207705_10207196 | 3300025909 | Bacteria | 1487 |
| 222 | Ga0207654_10584402 | 3300025911 | Bacteria | 796 |
| 223 | Ga0207707_10431618 | 3300025912 | Bacteria | 1128 |
| 224 | Ga0207707_10597725 | 3300025912 | Bacteria | 934 |
| 225 | Ga0207707_11506543 | 3300025912 | Bacteria | 533 |
| 226 | Ga0207695_10019365 | 3300025913 | Bacteria | 7837 |
| 227 | Ga0207695_10235810 | 3300025913 | Bacteria | 1732 |
| 228 | Ga0207695_10372458 | 3300025913 | Bacteria | 1314 |
| 229 | Ga0207671_10076739 | 3300025914 | Bacteria | 2501 |
| 230 | Ga0207693_10010040 | 3300025915 | Bacteria | 7692 |
| 231 | Ga0207693_10013941 | 3300025915 | Bacteria | 6473 |
| 232 | Ga0207693_10487206 | 3300025915 | Bacteria | 963 |
| 233 | Ga0207693_10859425 | 3300025915 | Bacteria | 697 |
| 234 | Ga0207663_10001658 | 3300025916 | Bacteria | 10492 |
| 235 | Ga0207663_10035718 | 3300025916 | Bacteria | 2984 |
| 236 | Ga0207663_10405578 | 3300025916 | Bacteria | 1043 |
| 237 | Ga0207663_11256590 | 3300025916 | Bacteria | 596 |
| 238 | Ga0207660_10084392 | 3300025917 | Bacteria | 2341 |
| 239 | Ga0207660_10424304 | 3300025917 | Bacteria | 1073 |
| 240 | Ga0207662_10155303 | 3300025918 | Bacteria | 1458 |
| 241 | Ga0207657_10102802 | 3300025919 | Bacteria | 2369 |
| 242 | Ga0207657_10255329 | 3300025919 | Bacteria | 1396 |
| 243 | Ga0207657_10371965 | 3300025919 | Bacteria | 1126 |
| 244 | Ga0207649_10142620 | 3300025920 | Bacteria | 1641 |
| 245 | Ga0207652_10187288 | 3300025921 | Bacteria | 1861 |
| 246 | Ga0207652_10436119 | 3300025921 | Bacteria | 1181 |
| 247 | Ga0207652_10674724 | 3300025921 | Bacteria | 923 |
| 248 | Ga0207646_10000851 | 3300025922 | Bacteria | 39515 |
| 249 | Ga0207646_10195739 | 3300025922 | Bacteria | 1825 |
| 250 | Ga0207681_10306243 | 3300025923 | Bacteria | 1259 |
| 251 | Ga0207681_10598453 | 3300025923 | Bacteria | 911 |
| 252 | Ga0207694_10781720 | 3300025924 | Bacteria | 806 |
| 253 | Ga0207650_11638263 | 3300025925 | Bacteria | 546 |
| 254 | Ga0207687_10030470 | 3300025927 | Bacteria | 3638 |
| 255 | Ga0207687_10096683 | 3300025927 | Bacteria | 2165 |
| 256 | Ga0207687_10666309 | 3300025927 | Bacteria | 881 |
| 257 | Ga0207700_10017072 | 3300025928 | Bacteria | 4837 |
| 258 | Ga0207700_10399445 | 3300025928 | Bacteria | 1204 |
| 259 | Ga0207700_10412395 | 3300025928 | Bacteria | 1185 |
| 260 | Ga0207664_10007639 | 3300025929 | Bacteria | 7500 |
| 261 | Ga0207664_10034818 | 3300025929 | Bacteria | 3881 |
| 262 | Ga0207664_10115407 | 3300025929 | Bacteria | 2239 |
| 263 | Ga0207664_10138735 | 3300025929 | Bacteria | 2054 |
| 264 | Ga0207664_10164713 | 3300025929 | Bacteria | 1893 |
| 265 | Ga0207664_10229497 | 3300025929 | Bacteria | 1613 |
| 266 | Ga0207664_10328891 | 3300025929 | Bacteria | 1349 |
| 267 | Ga0207664_10496599 | 3300025929 | Bacteria | 1092 |
| 268 | Ga0207664_10561840 | 3300025929 | Bacteria | 1024 |
| 269 | Ga0207664_11206491 | 3300025929 | Bacteria | 675 |
| 270 | Ga0207644_10072450 | 3300025931 | Bacteria | 2523 |
| 271 | Ga0207644_10410772 | 3300025931 | Bacteria | 1108 |
| 272 | Ga0207644_11411791 | 3300025931 | Bacteria | 585 |
| 273 | Ga0207690_10468740 | 3300025932 | Bacteria | 1015 |
| 274 | Ga0207706_10482306 | 3300025933 | Bacteria | 1071 |
| 275 | Ga0207706_10800498 | 3300025933 | Bacteria | 801 |
| 276 | Ga0207686_10401199 | 3300025934 | Bacteria | 1044 |
| 277 | Ga0207686_10533676 | 3300025934 | Bacteria | 915 |
| 278 | Ga0207709_10082076 | 3300025935 | Bacteria | 2081 |
| 279 | Ga0207709_11464786 | 3300025935 | Bacteria | 566 |
| 280 | Ga0207704_10051212 | 3300025938 | Bacteria | 2495 |
| 281 | Ga0207665_10006320 | 3300025939 | Bacteria | 7857 |
| 282 | Ga0207665_10473919 | 3300025939 | Bacteria | 964 |
| 283 | Ga0207665_10518986 | 3300025939 | Bacteria | 922 |
| 284 | Ga0207711_10169015 | 3300025941 | Bacteria | 1983 |
| 285 | Ga0207711_10955081 | 3300025941 | Bacteria | 796 |
| 286 | Ga0207689_10091239 | 3300025942 | Bacteria | 2503 |
| 287 | Ga0207689_11381585 | 3300025942 | Bacteria | 591 |
| 288 | Ga0207661_10276162 | 3300025944 | Bacteria | 1501 |
| 289 | Ga0207661_10443483 | 3300025944 | Bacteria | 1182 |
| 290 | Ga0207661_10591414 | 3300025944 | Bacteria | 1018 |
| 291 | Ga0207661_11016368 | 3300025944 | Bacteria | 763 |
| 292 | Ga0207661_11046840 | 3300025944 | Bacteria | 751 |
| 293 | Ga0207667_10429595 | 3300025949 | Bacteria | 1344 |
| 294 | Ga0207667_11422283 | 3300025949 | Bacteria | 666 |
| 295 | Ga0207712_10530389 | 3300025961 | Bacteria | 1010 |
| 296 | Ga0207677_10344246 | 3300026023 | Bacteria | 1247 |
| 297 | Ga0207677_10797360 | 3300026023 | Bacteria | 845 |
| 298 | Ga0207677_10960308 | 3300026023 | Bacteria | 773 |
| 299 | Ga0207703_10065761 | 3300026035 | Bacteria | 2980 |
| 300 | Ga0207703_10837358 | 3300026035 | Bacteria | 879 |
| 301 | Ga0207703_10967563 | 3300026035 | Bacteria | 816 |
| 302 | Ga0207678_10100762 | 3300026067 | Bacteria | 2467 |
| 303 | Ga0207678_10415995 | 3300026067 | Bacteria | 1165 |
| 304 | Ga0207678_10766858 | 3300026067 | Bacteria | 851 |
| 305 | Ga0207678_10859714 | 3300026067 | Bacteria | 801 |
| 306 | Ga0207708_10087705 | 3300026075 | Bacteria | 2396 |
| 307 | Ga0207708_10625417 | 3300026075 | Bacteria | 914 |
| 308 | Ga0207708_11781913 | 3300026075 | Bacteria | 540 |
| 309 | Ga0207702_10190079 | 3300026078 | Bacteria | 1896 |
| 310 | Ga0207702_11213915 | 3300026078 | Bacteria | 748 |
| 311 | Ga0207641_10042697 | 3300026088 | Bacteria | 3805 |
| 312 | Ga0207676_10054566 | 3300026095 | Bacteria | 3133 |
| 313 | Ga0207676_10812390 | 3300026095 | Bacteria | 913 |
| 314 | Ga0207674_10435556 | 3300026116 | Bacteria | 1267 |
| 315 | Ga0207674_11648572 | 3300026116 | Bacteria | 610 |
| 316 | Ga0207675_100246022 | 3300026118 | Bacteria | 1729 |
| 317 | Ga0207675_101047703 | 3300026118 | Bacteria | 835 |
| 318 | Ga0207675_101057331 | 3300026118 | Bacteria | 831 |
| 319 | Ga0207675_101876437 | 3300026118 | Bacteria | 618 |
| 320 | Ga0207683_10117278 | 3300026121 | Bacteria | 2387 |
| 321 | Ga0207683_10427006 | 3300026121 | Bacteria | 1221 |
| 322 | Ga0207683_10588768 | 3300026121 | Bacteria | 1029 |
| 323 | Ga0207683_10733875 | 3300026121 | Bacteria | 916 |
| 324 | Ga0209981_1020297 | 3300027378 | Bacteria | 947 |
| 325 | Ga0209974_10424135 | 3300027876 | Bacteria | 525 |
| 326 | Ga0207428_10228085 | 3300027907 | Bacteria | 1394 |
| 327 | Ga0268266_10431066 | 3300028379 | Bacteria | 1251 |
| 328 | Ga0268266_10701170 | 3300028379 | Bacteria | 976 |
| 329 | Ga0268265_11163717 | 3300028380 | Bacteria | 768 |
| 330 | Ga0268264_12539093 | 3300028381 | Bacteria | 517 |
| 331 | Ga0265337_1021431 | 3300028556 | Bacteria | 2014 |
| 332 | Ga0265337_1084356 | 3300028556 | Bacteria | 868 |
| 333 | Ga0265326_10073608 | 3300028558 | Bacteria | 966 |
| 334 | Ga0265319_1001715 | 3300028563 | Bacteria | 12639 |
| 335 | Ga0265334_10036178 | 3300028573 | Bacteria | 1950 |
| 336 | Ga0265334_10147650 | 3300028573 | Bacteria | 830 |
| 337 | Ga0265318_10047830 | 3300028577 | Bacteria | 1612 |
| 338 | Ga0265318_10255532 | 3300028577 | Bacteria | 639 |
| 339 | Ga0265322_10025674 | 3300028654 | Bacteria | 1684 |
| 340 | Ga0265322_10182142 | 3300028654 | Bacteria | 601 |
| 341 | Ga0265336_10122894 | 3300028666 | Bacteria | 773 |
| 342 | Ga0265336_10147394 | 3300028666 | Bacteria | 700 |
| 343 | Ga0265338_10006529 | 3300028800 | Bacteria | 14826 |
| 344 | Ga0265338_10045626 | 3300028800 | Bacteria | 4026 |
| 345 | Ga0265338_10083592 | 3300028800 | Bacteria | 2669 |
| 346 | Ga0265338_10099744 | 3300028800 | Bacteria | 2370 |
| 347 | Ga0265330_10045559 | 3300031235 | Bacteria | 1934 |
| 348 | Ga0265330_10098668 | 3300031235 | Bacteria | 1251 |
| 349 | Ga0265328_10092750 | 3300031239 | Bacteria | 1116 |
| 350 | Ga0265320_10017023 | 3300031240 | Bacteria | 4050 |
| 351 | Ga0265325_10016452 | 3300031241 | Bacteria | 4136 |
| 352 | Ga0265325_10085494 | 3300031241 | Bacteria | 1562 |
| 353 | Ga0265325_10283961 | 3300031241 | Bacteria | 742 |
| 354 | Ga0265329_10138024 | 3300031242 | Bacteria | 787 |
| 355 | Ga0265329_10219597 | 3300031242 | Bacteria | 629 |
| 356 | Ga0265340_10038019 | 3300031247 | Bacteria | 2382 |
| 357 | Ga0265339_10014606 | 3300031249 | Bacteria | 4728 |
| 358 | Ga0265331_10367553 | 3300031250 | Bacteria | 644 |
| 359 | Ga0265327_10096947 | 3300031251 | Bacteria | 1429 |
| 360 | Ga0265327_10123635 | 3300031251 | Bacteria | 1224 |
| 361 | Ga0265316_10042776 | 3300031344 | Bacteria | 3617 |
| 362 | Ga0265316_10092509 | 3300031344 | Bacteria | 2305 |
| 363 | Ga0307408_100545538 | 3300031548 | Bacteria | 1022 |
| 364 | Ga0265313_10006544 | 3300031595 | Bacteria | 8218 |
| 365 | Ga0265313_10127195 | 3300031595 | Bacteria | 1107 |
| 366 | Ga0265314_10006724 | 3300031711 | Bacteria | 10096 |
| 367 | Ga0265314_10008726 | 3300031711 | Bacteria | 8664 |
| 368 | Ga0265314_10422702 | 3300031711 | Bacteria | 716 |
| 369 | Ga0265314_10443618 | 3300031711 | Bacteria | 693 |
| 370 | Ga0265342_10025010 | 3300031712 | Bacteria | 3760 |
| 371 | Ga0265342_10202846 | 3300031712 | Bacteria | 1076 |
| 372 | Ga0307405_10074269 | 3300031731 | Bacteria | 2198 |
| 373 | Ga0307405_10123693 | 3300031731 | Bacteria | 1775 |
| 374 | Ga0307405_10204622 | 3300031731 | Bacteria | 1436 |
| 375 | Ga0307413_10097915 | 3300031824 | Bacteria | 1930 |
| 376 | Ga0307413_10188484 | 3300031824 | Bacteria | 1478 |
| 377 | Ga0307413_10717449 | 3300031824 | Bacteria | 832 |
| 378 | Ga0307413_10839512 | 3300031824 | Bacteria | 775 |
| 379 | Ga0307410_10270296 | 3300031852 | Bacteria | 1329 |
| 380 | Ga0307410_10311301 | 3300031852 | Bacteria | 1246 |
| 381 | Ga0307410_10858627 | 3300031852 | Bacteria | 775 |
| 382 | Ga0326468_10109920 | 3300031889 | Unclassified | 521 |
| 383 | Ga0326468_10126297 | 3300031889 | Bacteria | 504 |
| 384 | Ga0307406_10407586 | 3300031901 | Bacteria | 1079 |
| 385 | Ga0307406_10868431 | 3300031901 | Unclassified | 766 |
| 386 | Ga0307406_12096958 | 3300031901 | Bacteria | 506 |
| 387 | Ga0307407_10969741 | 3300031903 | Bacteria | 655 |
| 388 | Ga0307412_10343235 | 3300031911 | Bacteria | 1196 |
| 389 | Ga0307409_100056567 | 3300031995 | Bacteria | 3034 |
| 390 | Ga0307409_100096173 | 3300031995 | Bacteria | 2442 |
| 391 | Ga0307409_100860291 | 3300031995 | Bacteria | 918 |
| 392 | Ga0307409_102072944 | 3300031995 | Bacteria | 598 |
| 393 | Ga0307409_102646222 | 3300031995 | Bacteria | 530 |
| 394 | Ga0307416_100089639 | 3300032002 | Bacteria | 2634 |
| 395 | Ga0307416_100530152 | 3300032002 | Bacteria | 1247 |
| 396 | Ga0307416_100888673 | 3300032002 | Bacteria | 990 |
| 397 | Ga0307416_101306845 | 3300032002 | Bacteria | 831 |
| 398 | Ga0307414_10073335 | 3300032004 | Bacteria | 2476 |
| 399 | Ga0307411_10030391 | 3300032005 | Bacteria | 3311 |
| 400 | Ga0307411_10262825 | 3300032005 | Bacteria | 1364 |
| 401 | Ga0307411_10896739 | 3300032005 | Bacteria | 787 |
| 402 | Ga0307415_100127028 | 3300032126 | Bacteria | 1923 |
| 403 | Ga0307415_100736408 | 3300032126 | Bacteria | 893 |
| 404 | Ga0373948_0139519 | 3300034817 | Bacteria | 599 |
| 405 | Ga0373926_0006000 | 3300035083 | Bacteria | 4021 |
| 406 | Ga0373951_0142164 | 3300035091 | Bacteria | 667 |
| 407 | Ga0373952_0082783 | 3300035092 | Bacteria | 822 |
| 408 | Ga0373939_0168584 | 3300035114 | Bacteria | 809 |
| 409 | Ga0373941_0150692 | 3300035115 | Bacteria | 853 |
| 410 | Ga0373945_0023155 | 3300035116 | Bacteria | 2144 |
| 411 | Ga0373956_0183074 | 3300035119 | Bacteria | 991 |
| 412 | Ga0373956_0513584 | 3300035119 | Bacteria | 572 |
| 413 | Ga0373943_0125938 | 3300035170 | Bacteria | 1366 |
| 414 | Ga0373943_0151187 | 3300035170 | Bacteria | 1258 |
| 415 | Ga0373946_0020441 | 3300035171 | Bacteria | 2559 |
| 416 | Ga0373946_0236626 | 3300035171 | Bacteria | 887 |
| 417 | Ga0373946_0664180 | 3300035171 | Bacteria | 543 |
| 418 | Ga0373955_0377954 | 3300035172 | Bacteria | 860 |
| 419 | Ga0373942_0370355 | 3300035207 | Bacteria | 510 |
| 420 | Ga0373962_0117593 | 3300035242 | Bacteria | 845 |
| 421 | Ga0373931_0059336 | 3300035691 | Bacteria | 2057 |
| 422 | Ga0373931_0259014 | 3300035691 | Bacteria | 1061 |
| 423 | Ga0373931_0503773 | 3300035691 | Bacteria | 781 |
| 424 | Ga0373935_0090520 | 3300035692 | Bacteria | 2002 |
| 425 | Ga0373935_0604723 | 3300035692 | Bacteria | 802 |
| 426 | Ga0373927_0546312 | 3300035695 | Bacteria | 766 |
| 427 | Ga0373927_0599879 | 3300035695 | Bacteria | 728 |
| 428 | Ga0373933_0089134 | 3300035724 | Bacteria | 1901 |
| 429 | Ga0373933_0136788 | 3300035724 | Bacteria | 1544 |
| 430 | Ga0373947_0005312 | 3300035725 | Bacteria | 7531 |
| 431 | Ga0373937_0001944 | 3300036401 | Bacteria | 17289 |
| 432 | Ga0373937_0073336 | 3300036401 | Bacteria | 3158 |
| 433 | Ga0373937_0270361 | 3300036401 | Bacteria | 1604 |
| 434 | Ga0373937_0548141 | 3300036401 | Bacteria | 1098 |
| 435 | Ga0373937_1283235 | 3300036401 | Bacteria | 680 |
| 436 | Ga0373925_0052441 | 3300037068 | Bacteria | 3047 |
| 437 | Ga0373925_0359065 | 3300037068 | Bacteria | 1184 |
| 438 | Ga0373925_0979215 | 3300037068 | Bacteria | 697 |
| 439 | Ga0395899_0166213 | 3300037312 | Bacteria | 1556 |
| 440 | Ga0395900_0011178 | 3300037418 | Bacteria | 9178 |
| 441 | Ga0395900_0146861 | 3300037418 | Bacteria | 2411 |
| 442 | Ga0395900_0676842 | 3300037418 | Bacteria | 967 |
| 443 | Ga0395898_0018787 | 3300037466 | Bacteria | 7044 |
| 444 | Ga0395898_0265711 | 3300037466 | Bacteria | 1636 |
| 445 | Ga0395898_0397597 | 3300037466 | Bacteria | 1314 |
| 446 | Ga0395898_0531182 | 3300037466 | Bacteria | 1118 |
| 447 | Ga0395905_0050090 | 3300037471 | Bacteria | 3914 |
| 448 | Ga0395905_0369375 | 3300037471 | Bacteria | 1328 |
| 449 | Ga0395905_0457870 | 3300037471 | Bacteria | 1174 |
| 450 | Ga0395901_0010536 | 3300038443 | Bacteria | 9364 |
| 451 | Ga0395901_0125050 | 3300038443 | Bacteria | 2702 |
| 452 | Ga0395901_0481896 | 3300038443 | Bacteria | 1265 |
| 453 | Ga0395901_0542906 | 3300038443 | Bacteria | 1179 |
| 454 | Ga0436360_1056459 | 3300039438 | Bacteria | 3205 |
| 455 | Ga0436360_1119388 | 3300039438 | Bacteria | 2689 |
| 456 | Ga0436363_1310716 | 3300039450 | Bacteria | 900 |
| 457 | Ga0436362_0027807 | 3300039453 | Bacteria | 969 |
| 458 | Ga0439438_017736 | 3300041405 | Bacteria | 2041 |
| 459 | Ga0439461_0016834 | 3300041410 | Bacteria | 1415 |
| 460 | Ga0439466_0036002 | 3300041411 | Bacteria | 1673 |
| 461 | Ga0451802_0689958 | 3300041460 | Bacteria | 567 |
| 462 | Ga0451853_3622250 | 3300041512 | Bacteria | 536 |
| 463 | Ga0439431_0101146 | 3300041997 | Bacteria | 792 |
| 464 | Ga0450915_008079 | 3300042119 | Bacteria | 698 |
| 465 | Ga0450920_041655 | 3300042122 | Bacteria | 916 |
| 466 | Ga0450896_061610 | 3300042133 | Bacteria | 611 |
| 467 | Ga0450898_116236 | 3300042134 | Bacteria | 569 |
| 468 | Ga0439446_0023933 | 3300042156 | Bacteria | 1739 |
| 469 | Ga0439434_0121539 | 3300042435 | Bacteria | 852 |
| 470 | Ga0450916_033609 | 3300042530 | Bacteria | 756 |
| 471 | Ga0450918_004776 | 3300042531 | Bacteria | 2456 |
| 472 | Ga0451577_1753020 | 3300042876 | Bacteria | 546 |
| 473 | Ga0466969_0006133 | 3300044656 | Bacteria | 6399 |
| 474 | Ga0466969_0023380 | 3300044656 | Bacteria | 3186 |
| 475 | Ga0466972_0034041 | 3300044658 | Bacteria | 2498 |
| 476 | Ga0466965_0074448 | 3300044683 | Bacteria | 1711 |
| 477 | Ga0466965_0252957 | 3300044683 | Bacteria | 945 |
| 478 | Ga0466965_0291117 | 3300044683 | Bacteria | 884 |
| 479 | Ga0466965_0388413 | 3300044683 | Bacteria | 770 |
| 480 | Ga0466966_0024593 | 3300044684 | Bacteria | 3939 |
| 481 | Ga0466966_0052870 | 3300044684 | Bacteria | 2578 |
| 482 | Ga0466961_0009749 | 3300044693 | Bacteria | 6112 |
| 483 | Ga0466961_0011634 | 3300044693 | Bacteria | 5624 |
| 484 | Ga0466961_0037779 | 3300044693 | Bacteria | 3097 |
| 485 | Ga0466961_0130266 | 3300044693 | Bacteria | 1576 |
| 486 | Ga0466961_0163835 | 3300044693 | Bacteria | 1385 |
| 487 | Ga0466961_0177224 | 3300044693 | Bacteria | 1324 |
| 488 | Ga0466963_0002044 | 3300044694 | Bacteria | 11114 |
| 489 | Ga0466963_0003206 | 3300044694 | Bacteria | 9303 |
| 490 | Ga0466963_0009978 | 3300044694 | Bacteria | 5738 |
| 491 | Ga0466963_0012830 | 3300044694 | Bacteria | 5133 |
| 492 | Ga0466963_0015028 | 3300044694 | Bacteria | 4784 |
| 493 | Ga0466963_0021764 | 3300044694 | Bacteria | 4049 |
| 494 | Ga0466963_0024321 | 3300044694 | Bacteria | 3855 |
| 495 | Ga0466963_0043303 | 3300044694 | Bacteria | 2959 |
| 496 | Ga0466963_0053690 | 3300044694 | Bacteria | 2676 |
| 497 | Ga0466963_0059333 | 3300044694 | Bacteria | 2553 |
| 498 | Ga0466963_0063099 | 3300044694 | Bacteria | 2479 |
| 499 | Ga0466963_0134375 | 3300044694 | Bacteria | 1711 |
| 500 | Ga0466963_0159747 | 3300044694 | Bacteria | 1568 |
| 501 | Ga0466963_0202023 | 3300044694 | Bacteria | 1390 |
| 502 | Ga0466963_0214431 | 3300044694 | Bacteria | 1347 |
| 503 | Ga0466963_0513648 | 3300044694 | Bacteria | 846 |
| 504 | Ga0466963_1146383 | 3300044694 | Bacteria | 547 |
| 505 | Ga0466964_0002221 | 3300044706 | Bacteria | 6874 |
| 506 | Ga0466964_0010956 | 3300044706 | Bacteria | 3425 |
| 507 | Ga0466964_0038807 | 3300044706 | Bacteria | 1916 |
| 508 | Ga0466964_0059035 | 3300044706 | Bacteria | 1592 |
| 509 | Ga0466964_0110190 | 3300044706 | Bacteria | 1226 |
| 510 | Ga0466964_0152954 | 3300044706 | Bacteria | 1071 |
| 511 | Ga0453684_0774690 | 3300044712 | Bacteria | 1037 |
| 512 | Ga0466971_0000811 | 3300044719 | Bacteria | 12589 |
| 513 | Ga0466971_0034283 | 3300044719 | Bacteria | 2275 |
| 514 | Ga0466971_0034812 | 3300044719 | Bacteria | 2257 |
| 515 | Ga0466971_0095466 | 3300044719 | Bacteria | 1363 |
| 516 | Ga0466968_0001383 | 3300044735 | Bacteria | 8679 |
| 517 | Ga0466968_0009900 | 3300044735 | Bacteria | 3680 |
| 518 | Ga0466968_0089730 | 3300044735 | Bacteria | 1360 |
| 519 | Ga0466968_0126221 | 3300044735 | Bacteria | 1161 |
| 520 | Ga0466970_0038989 | 3300044765 | Bacteria | 2521 |
| 521 | Ga0466970_0555848 | 3300044765 | Bacteria | 663 |
| 522 | Ga0466957_0011431 | 3300044842 | Bacteria | 5123 |
| 523 | Ga0466957_0014656 | 3300044842 | Bacteria | 4567 |
| 524 | Ga0466957_0039094 | 3300044842 | Bacteria | 2861 |
| 525 | Ga0466957_0043235 | 3300044842 | Bacteria | 2728 |
| 526 | Ga0466957_0043431 | 3300044842 | Bacteria | 2722 |
| 527 | Ga0466957_0050574 | 3300044842 | Bacteria | 2529 |
| 528 | Ga0466957_0127925 | 3300044842 | Bacteria | 1624 |
| 529 | Ga0466957_0141542 | 3300044842 | Bacteria | 1550 |
| 530 | Ga0466957_0378501 | 3300044842 | Bacteria | 965 |
| 531 | Ga0466960_0019584 | 3300044901 | Bacteria | 2985 |
| 532 | Ga0466960_0044711 | 3300044901 | Bacteria | 2112 |
| 533 | Ga0466960_0280714 | 3300044901 | Bacteria | 933 |
| 534 | Ga0466959_0000761 | 3300045049 | Bacteria | 18843 |
| 535 | Ga0466959_0005947 | 3300045049 | Bacteria | 8413 |
| 536 | Ga0466959_0010572 | 3300045049 | Bacteria | 6605 |
| 537 | Ga0466959_0040467 | 3300045049 | Bacteria | 3443 |
| 538 | Ga0466958_0011877 | 3300045836 | Bacteria | 4916 |
| 539 | Ga0466958_0019527 | 3300045836 | Bacteria | 3946 |
| 540 | Ga0466958_0029055 | 3300045836 | Bacteria | 3279 |
| 541 | Ga0466958_0037650 | 3300045836 | Bacteria | 2898 |
| 542 | Ga0466958_0044163 | 3300045836 | Bacteria | 2685 |
| 543 | Ga0466958_0061728 | 3300045836 | Bacteria | 2283 |
| 544 | Ga0466958_0357637 | 3300045836 | Bacteria | 940 |
| 545 | Ga0466967_0002348 | 3300045976 | Bacteria | 11708 |
| 546 | Ga0466967_0008064 | 3300045976 | Bacteria | 7678 |
| 547 | Ga0466967_0027506 | 3300045976 | Bacteria | 4732 |
| 548 | Ga0466967_0039466 | 3300045976 | Bacteria | 4059 |
| 549 | Ga0466967_0074534 | 3300045976 | Bacteria | 3048 |
| 550 | Ga0466967_0087787 | 3300045976 | Bacteria | 2820 |
| 551 | Ga0466967_0091601 | 3300045976 | Bacteria | 2763 |
| 552 | Ga0466967_0104215 | 3300045976 | Bacteria | 2596 |
| 553 | Ga0466967_0135518 | 3300045976 | Bacteria | 2289 |
| 554 | Ga0466967_0197542 | 3300045976 | Bacteria | 1903 |
| 555 | Ga0466967_0225216 | 3300045976 | Bacteria | 1783 |
| 556 | Ga0466967_0286864 | 3300045976 | Bacteria | 1580 |
| 557 | Ga0466967_0309574 | 3300045976 | Bacteria | 1521 |
| 558 | Ga0466967_0310629 | 3300045976 | Bacteria | 1518 |
| 559 | Ga0466967_0340817 | 3300045976 | Bacteria | 1449 |
| 560 | Ga0466967_0376555 | 3300045976 | Bacteria | 1378 |
| 561 | Ga0466967_0407941 | 3300045976 | Bacteria | 1323 |
| 562 | Ga0466967_0466275 | 3300045976 | Bacteria | 1236 |
| 563 | Ga0466967_0498769 | 3300045976 | Bacteria | 1194 |
| 564 | Ga0466967_1007435 | 3300045976 | Bacteria | 829 |
| 565 | Ga0466967_1022476 | 3300045976 | Bacteria | 823 |
| 566 | Ga0466967_1284834 | 3300045976 | Unclassified | 729 |
| 567 | Ga0495592_0000082 | 3300046454 | Bacteria | 83312 |
| 568 | Ga0495592_0005470 | 3300046454 | Bacteria | 9382 |
| 569 | Ga0495592_0078369 | 3300046454 | Bacteria | 2393 |
| 570 | Ga0495592_0110113 | 3300046454 | Bacteria | 1950 |
| 571 | Ga0495592_0169612 | 3300046454 | Bacteria | 1495 |
| 572 | Ga0495603_0026915 | 3300046455 | Bacteria | 3473 |
| 573 | Ga0495603_0054621 | 3300046455 | Bacteria | 2367 |
| 574 | Ga0495603_0209415 | 3300046455 | Bacteria | 1126 |
| 575 | Ga0495603_0267484 | 3300046455 | Bacteria | 984 |
| 576 | Ga0495590_0375566 | 3300046457 | Bacteria | 543 |
| 577 | Ga0495629_0057569 | 3300046459 | Bacteria | 2717 |
| 578 | Ga0495629_0254100 | 3300046459 | Bacteria | 1209 |
| 579 | Ga0495629_0438158 | 3300046459 | Bacteria | 886 |
| 580 | Ga0495629_0484862 | 3300046459 | Bacteria | 835 |
| 581 | Ga0495641_0021128 | 3300046461 | Bacteria | 3282 |
| 582 | Ga0495641_0026211 | 3300046461 | Bacteria | 2847 |
| 583 | Ga0495641_0033988 | 3300046461 | Bacteria | 2414 |
| 584 | Ga0495641_0114119 | 3300046461 | Bacteria | 1205 |
| 585 | Ga0495641_0140930 | 3300046461 | Bacteria | 1077 |
| 586 | Ga0495641_0143146 | 3300046461 | Bacteria | 1068 |
| 587 | Ga0495641_0174278 | 3300046461 | Bacteria | 962 |
| 588 | Ga0495651_0000254 | 3300046462 | Bacteria | 41379 |
| 589 | Ga0495651_0147265 | 3300046462 | Bacteria | 1701 |
| 590 | Ga0495651_0233596 | 3300046462 | Bacteria | 1265 |
| 591 | Ga0495651_0859931 | 3300046462 | Bacteria | 557 |
| 592 | Ga0495653_0008090 | 3300046463 | Bacteria | 8614 |
| 593 | Ga0495653_0019537 | 3300046463 | Bacteria | 5493 |
| 594 | Ga0495653_0036185 | 3300046463 | Bacteria | 3890 |
| 595 | Ga0495653_0049166 | 3300046463 | Bacteria | 3251 |
| 596 | Ga0495653_0052428 | 3300046463 | Bacteria | 3126 |
| 597 | Ga0495653_0171551 | 3300046463 | Bacteria | 1497 |
| 598 | Ga0495653_0619901 | 3300046463 | Bacteria | 663 |
| 599 | Ga0495653_0886785 | 3300046463 | Bacteria | 532 |
| 600 | Ga0495580_0027920 | 3300046472 | Bacteria | 4105 |
| 601 | Ga0495580_0384454 | 3300046472 | Bacteria | 948 |
| 602 | Ga0495582_0021125 | 3300046473 | Bacteria | 3565 |
| 603 | Ga0495582_0166217 | 3300046473 | Bacteria | 1255 |
| 604 | Ga0495582_0247464 | 3300046473 | Bacteria | 1022 |
| 605 | Ga0495639_0021259 | 3300046475 | Bacteria | 2839 |
| 606 | Ga0495639_0114549 | 3300046475 | Bacteria | 1282 |
| 607 | Ga0495662_0002737 | 3300046476 | Bacteria | 8908 |
| 608 | Ga0495664_0023352 | 3300046477 | Bacteria | 3590 |
| 609 | Ga0495664_0048325 | 3300046477 | Bacteria | 2525 |
| 610 | Ga0495664_0281496 | 3300046477 | Bacteria | 1005 |
| 611 | Ga0495664_0340710 | 3300046477 | Bacteria | 903 |
| 612 | Ga0495664_0366013 | 3300046477 | Bacteria | 867 |
| 613 | Ga0495664_0454089 | 3300046477 | Bacteria | 767 |
| 614 | Ga0495664_0905223 | 3300046477 | Bacteria | 516 |
| 615 | Ga0495584_0029054 | 3300046491 | Bacteria | 2802 |
| 616 | Ga0495585_0225901 | 3300046492 | Bacteria | 943 |
| 617 | Ga0495596_0111430 | 3300046500 | Bacteria | 1062 |
| 618 | Ga0495596_0131101 | 3300046500 | Bacteria | 973 |
| 619 | Ga0495608_0003029 | 3300046511 | Bacteria | 11991 |
| 620 | Ga0495608_0024374 | 3300046511 | Bacteria | 4138 |
| 621 | Ga0495608_0105999 | 3300046511 | Bacteria | 1810 |
| 622 | Ga0495608_0728423 | 3300046511 | Bacteria | 589 |
| 623 | Ga0495608_0843316 | 3300046511 | Bacteria | 539 |
| 624 | Ga0495618_0025188 | 3300046514 | Bacteria | 3691 |
| 625 | Ga0495618_0045188 | 3300046514 | Bacteria | 2778 |
| 626 | Ga0495618_0065034 | 3300046514 | Bacteria | 2318 |
| 627 | Ga0495618_0154761 | 3300046514 | Bacteria | 1463 |
| 628 | Ga0495618_0173072 | 3300046514 | Bacteria | 1373 |
| 629 | Ga0495618_0255145 | 3300046514 | Bacteria | 1099 |
| 630 | Ga0495620_0186565 | 3300046515 | Bacteria | 801 |
| 631 | Ga0495628_0008466 | 3300046516 | Bacteria | 8819 |
| 632 | Ga0495628_0025414 | 3300046516 | Bacteria | 4837 |
| 633 | Ga0495628_0229084 | 3300046516 | Bacteria | 1393 |
| 634 | Ga0495630_0047973 | 3300046517 | Bacteria | 3195 |
| 635 | Ga0495630_0127048 | 3300046517 | Bacteria | 1935 |
| 636 | Ga0495630_0353097 | 3300046517 | Bacteria | 1125 |
| 637 | Ga0495630_0371840 | 3300046517 | Bacteria | 1095 |
| 638 | Ga0495630_1008805 | 3300046517 | Bacteria | 632 |
| 639 | Ga0495644_0059168 | 3300046523 | Bacteria | 1440 |
| 640 | Ga0495666_0000309 | 3300046526 | Bacteria | 21203 |
| 641 | Ga0495652_0000144 | 3300046529 | Bacteria | 80486 |
| 642 | Ga0495652_0098296 | 3300046529 | Bacteria | 2379 |
| 643 | Ga0495652_0101405 | 3300046529 | Bacteria | 2333 |
| 644 | Ga0495652_0202452 | 3300046529 | Bacteria | 1505 |
| 645 | Ga0495652_0310045 | 3300046529 | Bacteria | 1144 |
| 646 | Ga0495652_0526687 | 3300046529 | Bacteria | 816 |
| 647 | Ga0495652_0939203 | 3300046529 | Bacteria | 569 |
| 648 | Ga0495665_0046576 | 3300046531 | Bacteria | 2302 |
| 649 | Ga0495640_0068005 | 3300046533 | Bacteria | 2398 |
| 650 | Ga0495640_0153332 | 3300046533 | Bacteria | 1479 |
| 651 | Ga0495640_0430155 | 3300046533 | Bacteria | 808 |
| 652 | Ga0495640_0536709 | 3300046533 | Bacteria | 710 |
| 653 | Ga0495586_0052192 | 3300046535 | Bacteria | 2213 |
| 654 | Ga0495586_0087870 | 3300046535 | Bacteria | 1714 |
| 655 | Ga0495586_0099724 | 3300046535 | Bacteria | 1611 |
| 656 | Ga0495586_0168258 | 3300046535 | Bacteria | 1238 |
| 657 | Ga0495586_0231059 | 3300046535 | Bacteria | 1052 |
| 658 | Ga0495587_0000060 | 3300046536 | Bacteria | 93780 |
| 659 | Ga0495587_0054748 | 3300046536 | Bacteria | 2351 |
| 660 | Ga0495587_0130539 | 3300046536 | Bacteria | 1436 |
| 661 | Ga0495621_0186462 | 3300046539 | Bacteria | 830 |
| 662 | Ga0495645_0000038 | 3300046543 | Bacteria | 96124 |
| 663 | Ga0495645_0026009 | 3300046543 | Bacteria | 4247 |
| 664 | Ga0495645_0065208 | 3300046543 | Bacteria | 2634 |
| 665 | Ga0495645_0108382 | 3300046543 | Bacteria | 1967 |
| 666 | Ga0495645_0425074 | 3300046543 | Bacteria | 842 |
| 667 | Ga0495667_0041480 | 3300046559 | Bacteria | 3052 |
| 668 | Ga0495667_0063361 | 3300046559 | Bacteria | 2420 |
| 669 | Ga0495667_0147787 | 3300046559 | Bacteria | 1513 |
| 670 | Ga0495667_0269832 | 3300046559 | Bacteria | 1081 |
| 671 | Ga0495667_0311179 | 3300046559 | Bacteria | 997 |
| 672 | Ga0495667_0327687 | 3300046559 | Bacteria | 969 |
| 673 | Ga0495667_0544390 | 3300046559 | Bacteria | 725 |
| 674 | Ga0495667_0670775 | 3300046559 | Bacteria | 643 |
| 675 | Ga0495667_0734070 | 3300046559 | Bacteria | 611 |
| 676 | Ga0495656_0004882 | 3300046615 | Bacteria | 4617 |
| 677 | Ga0495656_0414786 | 3300046615 | Bacteria | 706 |
| 678 | Ga0495668_0127931 | 3300046616 | Bacteria | 1391 |
| 679 | Ga0495634_0097102 | 3300046642 | Bacteria | 1908 |
| 680 | Ga0495634_0108667 | 3300046642 | Bacteria | 1785 |
| 681 | Ga0495634_0170122 | 3300046642 | Bacteria | 1369 |
| 682 | Ga0495634_0260784 | 3300046642 | Bacteria | 1057 |
| 683 | Ga0495634_0300388 | 3300046642 | Bacteria | 971 |
| 684 | Ga0495634_0705950 | 3300046642 | Bacteria | 580 |
| 685 | Ga0495635_0061455 | 3300046663 | Bacteria | 2580 |
| 686 | Ga0495635_0093282 | 3300046663 | Bacteria | 2058 |
| 687 | Ga0495635_0169001 | 3300046663 | Bacteria | 1487 |
| 688 | Ga0495635_0229115 | 3300046663 | Bacteria | 1255 |
| 689 | Ga0495659_0235092 | 3300046664 | Bacteria | 760 |
| 690 | Ga0495661_0216592 | 3300046665 | Bacteria | 994 |
| 691 | Ga0495588_0499315 | 3300046674 | Bacteria | 638 |
| 692 | Ga0495657_0017146 | 3300046675 | Bacteria | 5263 |
| 693 | Ga0495657_0074538 | 3300046675 | Bacteria | 2208 |
| 694 | Ga0495657_0130787 | 3300046675 | Bacteria | 1572 |
| 695 | Ga0495657_0409629 | 3300046675 | Bacteria | 797 |
| 696 | Ga0495657_0651169 | 3300046675 | Bacteria | 607 |
| 697 | Ga0495599_0007761 | 3300046678 | Bacteria | 6512 |
| 698 | Ga0495599_0022857 | 3300046678 | Bacteria | 3905 |
| 699 | Ga0495599_0148173 | 3300046678 | Bacteria | 1454 |
| 700 | Ga0495623_0001647 | 3300046679 | Bacteria | 15000 |
| 701 | Ga0495623_0462693 | 3300046679 | Bacteria | 674 |
| 702 | Ga0495646_0018814 | 3300046680 | Bacteria | 4374 |
| 703 | Ga0495646_0049372 | 3300046680 | Bacteria | 2554 |
| 704 | Ga0495646_0116807 | 3300046680 | Bacteria | 1513 |
| 705 | Ga0495647_0008741 | 3300046681 | Bacteria | 3410 |
| 706 | Ga0495647_0017159 | 3300046681 | Bacteria | 2558 |
| 707 | Ga0495647_0056840 | 3300046681 | Bacteria | 1535 |
| 708 | Ga0495647_0596353 | 3300046681 | Bacteria | 518 |
| 709 | Ga0495658_0027649 | 3300046683 | Bacteria | 3054 |
| 710 | Ga0495658_0244638 | 3300046683 | Bacteria | 1127 |
| 711 | Ga0495658_0653294 | 3300046683 | Bacteria | 674 |
| 712 | Ga0495658_0997222 | 3300046683 | Bacteria | 535 |
| 713 | Ga0495613_0015955 | 3300046689 | Bacteria | 5593 |
| 714 | Ga0495613_0260787 | 3300046689 | Bacteria | 1207 |
| 715 | Ga0495613_0353040 | 3300046689 | Bacteria | 1010 |
| 716 | Ga0495613_0385974 | 3300046689 | Bacteria | 957 |
| 717 | Ga0495624_0009825 | 3300046690 | Bacteria | 6618 |
| 718 | Ga0495624_0032420 | 3300046690 | Bacteria | 3388 |
| 719 | Ga0495624_0045373 | 3300046690 | Bacteria | 2798 |
| 720 | Ga0495624_0346354 | 3300046690 | Bacteria | 894 |
| 721 | Ga0495624_0399900 | 3300046690 | Bacteria | 825 |
| 722 | Ga0495600_0022116 | 3300046809 | Bacteria | 4081 |
| 723 | Ga0495600_0197659 | 3300046809 | Bacteria | 1292 |
| 724 | Ga0495600_0215664 | 3300046809 | Bacteria | 1229 |
| 725 | Ga0495660_0286114 | 3300046810 | Bacteria | 752 |
| 726 | Ga0495660_0507468 | 3300046810 | Bacteria | 515 |
| 727 | Ga0495581_0063679 | 3300047315 | Bacteria | 2130 |
| 728 | Ga0495581_0285930 | 3300047315 | Bacteria | 964 |
| 729 | Ga0495604_0000043 | 3300047317 | Bacteria | 116335 |
| 730 | Ga0495604_0148690 | 3300047317 | Bacteria | 1667 |
| 731 | Ga0495604_0284317 | 3300047317 | Bacteria | 1116 |
| 732 | Ga0495636_0112191 | 3300047318 | Bacteria | 1200 |
| 733 | Ga0495674_0039854 | 3300047319 | Bacteria | 4206 |
| 734 | Ga0495674_0133281 | 3300047319 | Bacteria | 2092 |
| 735 | Ga0495674_0165119 | 3300047319 | Bacteria | 1851 |
| 736 | Ga0495674_0187393 | 3300047319 | Bacteria | 1721 |
| 737 | Ga0495674_0275727 | 3300047319 | Bacteria | 1379 |
| 738 | Ga0495674_0328482 | 3300047319 | Bacteria | 1244 |
| 739 | Ga0495674_1035486 | 3300047319 | Unclassified | 627 |
| 740 | Ga0495676_0103965 | 3300047321 | Bacteria | 2096 |
| 741 | Ga0495676_0111905 | 3300047321 | Bacteria | 2002 |
| 742 | Ga0495676_0309857 | 3300047321 | Bacteria | 1062 |
| 743 | Ga0495680_0010993 | 3300047322 | Bacteria | 8042 |
| 744 | Ga0495680_0047309 | 3300047322 | Bacteria | 3384 |
| 745 | Ga0495680_0128449 | 3300047322 | Bacteria | 1864 |
| 746 | Ga0495680_0208519 | 3300047322 | Bacteria | 1399 |
| 747 | Ga0495680_0409729 | 3300047322 | Bacteria | 934 |
| 748 | Ga0495680_0487979 | 3300047322 | Bacteria | 838 |
| 749 | Ga0495680_0600625 | 3300047322 | Bacteria | 736 |
| 750 | Ga0495683_0164235 | 3300047323 | Bacteria | 1025 |
| 751 | Ga0495675_0000413 | 3300047444 | Bacteria | 29216 |
| 752 | Ga0495677_0215595 | 3300047445 | Bacteria | 747 |
| 753 | Ga0495679_057747 | 3300047446 | Bacteria | 1147 |
| 754 | Ga0495684_0001111 | 3300047471 | Bacteria | 21659 |
| 755 | Ga0495684_0006437 | 3300047471 | Bacteria | 9114 |
| 756 | Ga0495684_0193268 | 3300047471 | Bacteria | 1503 |
| 757 | Ga0495684_0249687 | 3300047471 | Bacteria | 1291 |
| 758 | Ga0495684_0540914 | 3300047471 | Bacteria | 795 |
| 759 | Ga0495684_0852706 | 3300047471 | Bacteria | 591 |
| 760 | Ga0495684_0881902 | 3300047471 | Bacteria | 578 |
| 761 | Ga0495593_0027939 | 3300047673 | Bacteria | 3101 |
| 762 | Ga0495593_0104572 | 3300047673 | Bacteria | 1450 |
| 763 | Ga0495602_0043043 | 3300048088 | Bacteria | 4109 |
| 764 | Ga0495602_0053415 | 3300048088 | Bacteria | 3578 |
| 765 | Ga0495602_0217072 | 3300048088 | Bacteria | 1446 |
| 766 | Ga0495602_0342351 | 3300048088 | Bacteria | 1081 |
| 767 | Ga0495614_0009758 | 3300048089 | Bacteria | 4242 |
| 768 | Ga0495614_0073037 | 3300048089 | Bacteria | 1481 |
| 769 | Ga0495615_0147763 | 3300048090 | Bacteria | 698 |
| 770 | Ga0496100_0028219 | 3300048903 | Bacteria | 3460 |
| 771 | Ga0496100_1434127 | 3300048903 | Bacteria | 545 |
| 772 | Ga0496101_0039194 | 3300048904 | Bacteria | 3368 |
| 773 | Ga0496101_0081933 | 3300048904 | Bacteria | 2387 |
| 774 | Ga0496101_0300984 | 3300048904 | Bacteria | 1256 |
| 775 | Ga0496101_1021589 | 3300048904 | Bacteria | 650 |
| 776 | Ga0496101_1061894 | 3300048904 | Bacteria | 636 |
| 777 | Ga0496101_1511711 | 3300048904 | Bacteria | 523 |
| 778 | Ga0496102_0003464 | 3300048905 | Bacteria | 13382 |
| 779 | Ga0496102_0008253 | 3300048905 | Bacteria | 8919 |
| 780 | Ga0496102_0143115 | 3300048905 | Bacteria | 2243 |
| 781 | Ga0496102_0189821 | 3300048905 | Bacteria | 1936 |
| 782 | Ga0496103_0005471 | 3300048906 | Bacteria | 7594 |
| 783 | Ga0496103_0023207 | 3300048906 | Bacteria | 3740 |
| 784 | Ga0496103_0358114 | 3300048906 | Bacteria | 938 |
| 785 | Ga0496104_0016980 | 3300048907 | Bacteria | 6621 |
| 786 | Ga0496104_0059067 | 3300048907 | Bacteria | 3630 |
| 787 | Ga0496104_0150580 | 3300048907 | Bacteria | 2233 |
| 788 | Ga0496104_0196248 | 3300048907 | Bacteria | 1930 |
| 789 | Ga0496104_0320571 | 3300048907 | Bacteria | 1463 |
| 790 | Ga0496104_1276829 | 3300048907 | Bacteria | 637 |
| 791 | Ga0496105_0015128 | 3300048908 | Bacteria | 6140 |
| 792 | Ga0496105_0065644 | 3300048908 | Bacteria | 2995 |
| 793 | Ga0496105_0161150 | 3300048908 | Bacteria | 1841 |
| 794 | Ga0496105_0440379 | 3300048908 | Bacteria | 1030 |
| 795 | Ga0496105_0629891 | 3300048908 | Bacteria | 829 |
| 796 | Ga0496106_0017267 | 3300048909 | Bacteria | 5340 |
| 797 | Ga0496106_0183614 | 3300048909 | Bacteria | 1661 |
| 798 | Ga0496106_0235757 | 3300048909 | Bacteria | 1462 |
| 799 | Ga0496106_0419118 | 3300048909 | Bacteria | 1076 |
| 800 | Ga0496107_0005952 | 3300048910 | Bacteria | 8355 |
| 801 | Ga0496107_0133461 | 3300048910 | Bacteria | 1834 |
| 802 | Ga0496107_0421448 | 3300048910 | Bacteria | 992 |
| 803 | Ga0496107_0579130 | 3300048910 | Bacteria | 830 |
| 804 | Ga0496107_1250802 | 3300048910 | Bacteria | 532 |
| 805 | Ga0496108_0037409 | 3300048911 | Bacteria | 4042 |
| 806 | Ga0496108_0110191 | 3300048911 | Bacteria | 2353 |
| 807 | Ga0496108_0221375 | 3300048911 | Bacteria | 1644 |
| 808 | Ga0496108_0240228 | 3300048911 | Bacteria | 1576 |
| 809 | Ga0496108_0302977 | 3300048911 | Bacteria | 1392 |
| 810 | Ga0496109_0053795 | 3300048912 | Bacteria | 3673 |
| 811 | Ga0496109_0102132 | 3300048912 | Bacteria | 2661 |
| 812 | Ga0496109_0119789 | 3300048912 | Bacteria | 2451 |
| 813 | Ga0496109_0129522 | 3300048912 | Bacteria | 2354 |
| 814 | Ga0496109_0289311 | 3300048912 | Bacteria | 1544 |
| 815 | Ga0496110_0169177 | 3300048913 | Bacteria | 1982 |
| 816 | Ga0496110_0628038 | 3300048913 | Bacteria | 973 |
| 817 | Ga0496110_1338264 | 3300048913 | Bacteria | 625 |
| 818 | Ga0496111_0117258 | 3300048914 | Bacteria | 1964 |
| 819 | Ga0496111_0120767 | 3300048914 | Bacteria | 1935 |
| 820 | Ga0496111_0161779 | 3300048914 | Bacteria | 1662 |
| 821 | Ga0496111_0221098 | 3300048914 | Bacteria | 1407 |
| 822 | Ga0496111_0758520 | 3300048914 | Bacteria | 704 |
| 823 | Ga0496112_0158987 | 3300048915 | Bacteria | 2226 |
| 824 | Ga0496112_0204957 | 3300048915 | Bacteria | 1930 |
| 825 | Ga0496112_1296300 | 3300048915 | Unclassified | 644 |
| 826 | Ga0496113_0071897 | 3300048916 | Bacteria | 2631 |
| 827 | Ga0496113_0113339 | 3300048916 | Bacteria | 2113 |
| 828 | Ga0496113_0246479 | 3300048916 | Bacteria | 1426 |
| 829 | Ga0496114_0004956 | 3300048917 | Bacteria | 10381 |
| 830 | Ga0496114_0006185 | 3300048917 | Bacteria | 9424 |
| 831 | Ga0496114_0033807 | 3300048917 | Bacteria | 4215 |
| 832 | Ga0496114_0164281 | 3300048917 | Bacteria | 1932 |
| 833 | Ga0496115_0009112 | 3300048918 | Bacteria | 7365 |
| 834 | Ga0496115_0033955 | 3300048918 | Bacteria | 4031 |
| 835 | Ga0496115_0194322 | 3300048918 | Bacteria | 1676 |
| 836 | Ga0496115_0329984 | 3300048918 | Bacteria | 1246 |
| 837 | Ga0496115_0382445 | 3300048918 | Bacteria | 1144 |
| 838 | Ga0501031_0003238 | 3300049568 | Bacteria | 10464 |
| 839 | Ga0501031_0755708 | 3300049568 | Unclassified | 624 |
| 840 | Ga0501032_0016731 | 3300049569 | Bacteria | 5152 |
| 841 | Ga0501033_0011156 | 3300049570 | Bacteria | 6883 |
| 842 | Ga0501036_0013212 | 3300049572 | Bacteria | 6856 |
| 843 | Ga0501036_1137596 | 3300049572 | Bacteria | 637 |
| 844 | Ga0501037_0001718 | 3300049573 | Bacteria | 15893 |
| 845 | Ga0501038_0071959 | 3300049574 | Bacteria | 2931 |
| 846 | Ga0501039_0033420 | 3300049575 | Bacteria | 3965 |
| 847 | Ga0501040_0177164 | 3300049576 | Bacteria | 1510 |
| 848 | Ga0501040_1096012 | 3300049576 | Bacteria | 578 |
| 849 | Ga0501041_0052787 | 3300049577 | Bacteria | 2478 |
| 850 | Ga0501042_0790184 | 3300049578 | Bacteria | 691 |
| 851 | Ga0501043_0005046 | 3300049579 | Bacteria | 10678 |
| 852 | Ga0501046_0226491 | 3300049580 | Bacteria | 1382 |
| 853 | Ga0501067_0070774 | 3300049583 | Bacteria | 1931 |
| 854 | Ga0501067_0260907 | 3300049583 | Bacteria | 964 |
| 855 | Ga0501069_0000281 | 3300049585 | Bacteria | 23211 |
| 856 | Ga0501069_0012970 | 3300049585 | Bacteria | 4439 |
| 857 | Ga0501069_0109884 | 3300049585 | Bacteria | 1569 |
| 858 | Ga0501070_0096580 | 3300049586 | Bacteria | 2444 |
| 859 | Ga0501070_0134827 | 3300049586 | Bacteria | 2039 |
| 860 | Ga0501071_0006860 | 3300049587 | Bacteria | 7420 |
| 861 | Ga0501071_0082451 | 3300049587 | Bacteria | 2355 |
| 862 | Ga0501071_0701119 | 3300049587 | Unclassified | 779 |
| 863 | Ga0501071_0744459 | 3300049587 | Bacteria | 755 |
| 864 | Ga0501072_0001268 | 3300049588 | Bacteria | 18858 |
| 865 | Ga0501072_1346898 | 3300049588 | Bacteria | 553 |
| 866 | Ga0501073_0004422 | 3300049589 | Bacteria | 10567 |
| 867 | Ga0501074_0060889 | 3300049590 | Bacteria | 2719 |
| 868 | Ga0501075_0026770 | 3300049591 | Bacteria | 4247 |
| 869 | Ga0501076_0221178 | 3300049592 | Bacteria | 1547 |
| 870 | Ga0501076_0255360 | 3300049592 | Bacteria | 1435 |
| 871 | Ga0501077_0006117 | 3300049593 | Bacteria | 7349 |
| 872 | Ga0501077_0197370 | 3300049593 | Unclassified | 1278 |
| 873 | Ga0501255_029548 | 3300049684 | Bacteria | 756 |
| 874 | Ga0501225_0356133 | 3300049705 | Bacteria | 507 |
| 875 | Ga0501079_0135066 | 3300049741 | Bacteria | 1920 |
| 876 | Ga0501079_0225222 | 3300049741 | Bacteria | 1465 |
| 877 | Ga0501081_0095144 | 3300049743 | Bacteria | 2099 |
| 878 | Ga0501083_0059072 | 3300049744 | Bacteria | 2565 |
| 879 | Ga0501268_076747 | 3300049765 | Bacteria | 684 |
| 880 | Ga0501035_0023192 | 3300049822 | Bacteria | 5692 |
| 881 | Ga0501044_0047525 | 3300049823 | Bacteria | 4438 |
| 882 | Ga0501045_0004644 | 3300049824 | Bacteria | 9481 |
| 883 | Ga0501045_0977297 | 3300049824 | Bacteria | 621 |
| 884 | nmdc:mga00v17_672439_c1 | 3300050491 | Bacteria | 665 |
| 885 | nmdc:mga06r32_1620144_c1 | 3300050510 | Bacteria | 585 |
| 886 | nmdc:mga08y16_1377811_c1 | 3300050511 | Bacteria | 669 |
| 887 | nmdc:mga08y16_201893_c1 | 3300050511 | Bacteria | 2060 |
| 888 | nmdc:mga08y16_503294_c1 | 3300050511 | Bacteria | 1230 |
| 889 | nmdc:mga08y16_529562_c1 | 3300050511 | Bacteria | 1194 |
| 890 | nmdc:mga0n895_104711_c1 | 3300050512 | Bacteria | 2842 |
| 891 | nmdc:mga08x19_498856_c1 | 3300050514 | Bacteria | 859 |
| 892 | nmdc:mga0a205_53821_c1 | 3300050515 | Bacteria | 3885 |
| 893 | Ga0495601_0016127 | 3300053077 | Bacteria | 4523 |
| 894 | Ga0495601_0106723 | 3300053077 | Bacteria | 1811 |
| 895 | Ga0495601_0121354 | 3300053077 | Bacteria | 1697 |
| 896 | Ga0495601_0132228 | 3300053077 | Bacteria | 1625 |
| 897 | Ga0495601_0219668 | 3300053077 | Bacteria | 1241 |
| 898 | Ga0495601_0298539 | 3300053077 | Bacteria | 1049 |
| 899 | Ga0495601_0383161 | 3300053077 | Bacteria | 912 |
| 900 | Ga0495612_0048056 | 3300053078 | Bacteria | 1749 |
| 901 | Ga0495612_0104624 | 3300053078 | Bacteria | 1207 |
| 902 | Ga0495595_0037657 | 3300053084 | Bacteria | 2200 |
| 903 | Ga0495595_0077821 | 3300053084 | Bacteria | 1576 |
| 904 | Ga0495595_0126829 | 3300053084 | Bacteria | 1245 |
| 905 | Ga0495619_0005446 | 3300053085 | Bacteria | 8067 |
| 906 | Ga0495619_0065883 | 3300053085 | Bacteria | 2417 |
| 907 | Ga0495619_0168655 | 3300053085 | Bacteria | 1513 |
| 908 | Ga0495619_0268750 | 3300053085 | Bacteria | 1182 |
| 909 | Ga0495619_0628109 | 3300053085 | Bacteria | 734 |
| 910 | Ga0500641_0121656 | 3300053096 | Bacteria | 1125 |
| 911 | Ga0500608_320245 | 3300053122 | Bacteria | 565 |
| 912 | Ga0501084_0076562 | 3300054114 | Bacteria | 2804 |
| 913 | Ga0501084_0128730 | 3300054114 | Bacteria | 2131 |
| 914 | Ga0587066_048692 | 3300059490 | Bacteria | 826 |
| 915 | Ga0587070_050497 | 3300059491 | Bacteria | 829 |
| 916 | Ga0587073_0179480 | 3300059492 | Bacteria | 620 |
| 917 | Ga0587073_0280482 | 3300059492 | Bacteria | 534 |
| 918 | Ga0587080_042143 | 3300059503 | Bacteria | 835 |
| 919 | Ga0587082_121217 | 3300059504 | Bacteria | 591 |
| 920 | Ga0587083_0111320 | 3300059505 | Bacteria | 696 |
| 921 | Ga0587085_085882 | 3300059506 | Bacteria | 642 |
| 922 | Ga0587088_151590 | 3300059508 | Bacteria | 561 |
| 923 | Ga0587113_026351 | 3300059625 | Bacteria | 640 |
| 924 | Ga0587122_061945 | 3300059628 | Bacteria | 504 |
| 925 | Ga0587067_200294 | 3300059640 | Bacteria | 530 |
| 926 | Ga0587069_101856 | 3300059642 | Bacteria | 588 |
| 927 | Ga0587069_113803 | 3300059642 | Bacteria | 566 |
| 928 | Ga0587075_142988 | 3300059644 | Bacteria | 512 |
| 929 | Ga0587079_189283 | 3300059647 | Bacteria | 555 |
| 930 | Ga0587114_079903 | 3300059655 | Bacteria | 607 |
| 931 | Ga0587119_041929 | 3300059658 | Bacteria | 659 |
| 932 | Ga0587071_072219 | 3300060344 | Bacteria | 754 |
| 933 | Ga0501082_0080589 | 3300060353 | Bacteria | 2809 |
| 934 | Ga0501082_0854572 | 3300060353 | Bacteria | 796 |
| 935 | Ga0466962_0032916 | 3300061719 | Bacteria | 2480 |
| 936 | Ga0466962_0193151 | 3300061719 | Bacteria | 993 |
| 937 | Ga0530510_0087455 | 3300061734 | Bacteria | 2270 |
| 938 | Ga0530510_0255315 | 3300061734 | Bacteria | 1307 |
| 939 | Ga0466964_0105434 | |||
| 940 | Ga0058862_12513208 | |||
| 941 | Ga0070658_10129125 | |||
| 942 | Ga0070683_100370415 | |||
| 943 | Ga0070683_100896320 | |||
| 944 | Ga0070666_10792227 | |||
| 945 | Ga0070680_100102008 | |||
| 946 | Ga0070680_100235830 | |||
| 947 | Ga0070682_100432012 | |||
| 948 | Ga0070682_100442268 | |||
| 949 | Ga0068868_100363719 | |||
| 950 | Ga0068868_100748772 | |||
| 951 | Ga0068868_100908393 | |||
| 952 | Ga0068868_101006419 | |||
| 953 | Ga0070660_100197424 | |||
| 954 | Ga0070691_10061930 | |||
| 955 | Ga0070691_10218997 | |||
| 956 | Ga0070691_10270110 | |||
| 957 | Ga0070687_100078432 | |||
| 958 | Ga0070687_100777720 | |||
| 959 | Ga0070661_100294553 | |||
| 960 | Ga0070661_100435253 | |||
| 961 | Ga0070661_101887956 | |||
| 962 | Ga0070669_101141892 | |||
| 963 | Ga0070669_101953349 | |||
| 964 | Ga0070671_101222235 | |||
| 965 | Ga0070674_101170412 | |||
| 966 | Ga0070688_100725808 | |||
| 967 | Ga0070659_100110245 | |||
| 968 | Ga0070659_100501127 | |||
| 969 | Ga0070667_101452144 | |||
| 970 | Ga0070709_10028862 | |||
| 971 | Ga0070709_10164035 | |||
| 972 | Ga0070709_10188355 | |||
| 973 | Ga0070714_100056543 | |||
| 974 | Ga0070714_100059769 | |||
| 975 | Ga0070714_100077238 | |||
| 976 | Ga0070714_100105023 | |||
| 977 | Ga0070714_100283994 | |||
| 978 | Ga0070714_100555310 | |||
| 979 | Ga0070714_100770655 | |||
| 980 | Ga0070714_100960920 | |||
| 981 | Ga0070713_100097613 | |||
| 982 | Ga0070713_100459845 | |||
| 983 | Ga0070710_10005822 | |||
| 984 | Ga0070710_10167643 | |||
| 985 | Ga0070701_11144916 | |||
| 986 | Ga0070711_100043043 | |||
| 987 | Ga0070711_100709271 | |||
| 988 | Ga0070711_101042357 | |||
| 989 | Ga0070711_101472117 | |||
| 990 | Ga0070705_100649209 | |||
| 991 | Ga0070700_100084563 | |||
| 992 | Ga0070708_101302718 | |||
| 993 | Ga0070663_100234715 | |||
| 994 | Ga0070663_100795047 | |||
| 995 | Ga0070678_100421481 | |||
| 996 | Ga0070678_100957821 | |||
| 997 | Ga0070662_101055438 | |||
| 998 | Ga0070662_101234788 | |||
| 999 | Ga0070681_10127620 | |||
| 1000 | Ga0070681_10168346 | |||
| 1001 | Ga0070681_10223330 | |||
| 1002 | Ga0070681_10223401 | |||
| 1003 | Ga0068867_100405633 | |||
| 1004 | Ga0070685_10637400 | |||
| 1005 | Ga0070685_10861543 | |||
| 1006 | Ga0070707_100001557 | |||
| 1007 | Ga0070707_100266830 | |||
| 1008 | Ga0070698_100849043 | |||
| 1009 | Ga0070679_100324484 | |||
| 1010 | Ga0070679_100392558 | |||
| 1011 | Ga0070684_100218577 | |||
| 1012 | Ga0070684_100352112 | |||
| 1013 | Ga0070684_100553428 | |||
| 1014 | Ga0070684_100864220 | |||
| 1015 | Ga0070684_101183869 | |||
| 1016 | Ga0070695_100001595 | |||
| 1017 | Ga0070665_100427482 | |||
| 1018 | Ga0068855_100177324 | |||
| 1019 | Ga0068855_100718550 | |||
| 1020 | Ga0068855_102429229 | |||
| 1021 | Ga0070664_100072110 | |||
| 1022 | Ga0070664_100810128 | |||
| 1023 | Ga0070664_101987995 | |||
| 1024 | Ga0068854_100330579 | |||
| 1025 | Ga0068856_100225532 | |||
| 1026 | Ga0068856_100267427 | |||
| 1027 | Ga0068856_100515783 | |||
| 1028 | Ga0070702_100005631 | |||
| 1029 | Ga0070702_100253720 | |||
| 1030 | Ga0070702_101450514 | |||
| 1031 | Ga0068852_100227666 | |||
| 1032 | Ga0068859_100119417 | |||
| 1033 | Ga0068864_100096261 | |||
| 1034 | Ga0068866_10057880 | |||
| 1035 | Ga0068861_101533561 | |||
| 1036 | Ga0068870_10062303 | |||
| 1037 | Ga0068863_100353207 | |||
| 1038 | Ga0068858_100115450 | |||
| 1039 | Ga0068858_100949432 | |||
| 1040 | Ga0068860_102073695 | |||
| 1041 | Ga0081455_10074026 | |||
| 1042 | Ga0081455_10096946 | |||
| 1043 | Ga0081455_10353406 | |||
| 1044 | Ga0081538_10030998 | |||
| 1045 | Ga0081538_10034025 | |||
| 1046 | Ga0081539_10161609 | |||
| 1047 | Ga0070717_10026635 | |||
| 1048 | Ga0070717_10096339 | |||
| 1049 | Ga0070717_10096495 | |||
| 1050 | Ga0070717_10442590 | |||
| 1051 | Ga0075365_10212128 | |||
| 1052 | Ga0075364_10511503 | |||
| 1053 | Ga0075432_10169267 | |||
| 1054 | Ga0070715_10005967 | |||
| 1055 | Ga0070715_10113250 | |||
| 1056 | Ga0070716_100070921 | |||
| 1057 | Ga0070716_100104618 | |||
| 1058 | Ga0070716_100682625 | |||
| 1059 | Ga0070716_101081207 | |||
| 1060 | Ga0070716_101257302 | |||
| 1061 | Ga0070712_100047985 | |||
| 1062 | Ga0070712_100063501 | |||
| 1063 | Ga0070712_100882128 | |||
| 1064 | Ga0070712_101187638 | |||
| 1065 | Ga0097621_100653875 | |||
| 1066 | Ga0097621_100763387 | |||
| 1067 | Ga0068871_100415161 | |||
| 1068 | Ga0068871_101478047 | |||
| 1069 | Ga0075428_101458411 | |||
| 1070 | Ga0075431_101685743 | |||
| 1071 | Ga0075433_10153434 | |||
| 1072 | Ga0075429_101874775 | |||
| 1073 | Ga0068865_100421386 | |||
| 1074 | Ga0097620_100119408 | |||
| 1075 | Ga0075435_101006573 | |||
| 1076 | Ga0105240_10128107 | |||
| 1077 | Ga0111539_10217483 | |||
| 1078 | Ga0111539_11694447 | |||
| 1079 | Ga0105245_10091016 | |||
| 1080 | Ga0105245_11052678 | |||
| 1081 | Ga0105245_12076983 | |||
| 1082 | Ga0105245_12327919 | |||
| 1083 | Ga0105245_12976242 | |||
| 1084 | Ga0105247_10230852 | |||
| 1085 | Ga0105247_11287676 | |||
| 1086 | Ga0114129_11008000 | |||
| 1087 | Ga0114129_11010623 | |||
| 1088 | Ga0105243_10085476 | |||
| 1089 | Ga0105243_10555802 | |||
| 1090 | Ga0105241_10772790 | |||
| 1091 | Ga0105241_11810639 | |||
| 1092 | Ga0105242_10689819 | |||
| 1093 | Ga0105242_10967178 | |||
| 1094 | Ga0105248_10181619 | |||
| 1095 | Ga0105248_11188175 | |||
| 1096 | Ga0105248_11533987 | |||
| 1097 | Ga0105237_10288496 | |||
| 1098 | Ga0105237_12161344 | |||
| 1099 | Ga0105237_12189820 | |||
| 1100 | Ga0105238_10078095 | |||
| 1101 | Ga0105238_10363513 | |||
| 1102 | Ga0105249_11103273 | |||
| 1103 | Ga0105249_12291076 | |||
| 1104 | Ga0105239_12001561 | |||
| 1105 | Ga0105239_12107478 | |||
| 1106 | Ga0105239_12689728 | |||
| 1107 | Ga0105239_13607146 | |||
| 1108 | Ga0105246_10050833 | |||
| 1109 | Ga0105246_11976188 | |||
| 1110 | Ga0157373_10489500 | |||
| 1111 | Ga0157371_10627397 | |||
| 1112 | Ga0157370_11176455 | |||
| 1113 | Ga0157369_10745475 | |||
| 1114 | Ga0157369_10893379 | |||
| 1115 | Ga0157374_10218951 | |||
| 1116 | Ga0157374_11330808 | |||
| 1117 | Ga0157374_12727037 | |||
| 1118 | Ga0163162_10235751 | |||
| 1119 | Ga0163162_10421942 | |||
| 1120 | Ga0157372_10092283 | |||
| 1121 | Ga0157372_10394922 | |||
| 1122 | Ga0157372_10579413 | |||
| 1123 | Ga0157372_10720578 | |||
| 1124 | Ga0157372_11284238 | |||
| 1125 | Ga0157375_12023917 | |||
| 1126 | Ga0157380_10513528 | |||
| 1127 | Ga0157380_10637294 | |||
| 1128 | Ga0157379_11136506 | |||
| 1129 | Ga0157379_12015990 | |||
| 1130 | Ga0157376_10217879 | |||
| 1131 | Ga0157376_11619526 | |||
| 1132 | Ga0182005_1051686 | |||
| 1133 | Ga0197907_10026626 | |||
| 1134 | Ga0197907_10678466 | |||
| 1135 | Ga0206356_10605300 | |||
| 1136 | Ga0206355_1424902 | |||
| 1137 | Ga0206355_1506274 | |||
| 1138 | Ga0206352_10068973 | |||
| 1139 | Ga0206350_11082515 | |||
| 1140 | Ga0206353_10705410 | |||
| 1141 | Ga0206353_10963865 | |||
| 1142 | Ga0224712_10017227 | |||
| 1143 | Ga0224712_10390005 | |||
| 1144 | Ga0207692_10004596 | |||
| 1145 | Ga0207692_10098877 | |||
| 1146 | Ga0207642_10225697 | |||
| 1147 | Ga0207688_10079443 | |||
| 1148 | Ga0207688_10820376 | |||
| 1149 | Ga0207647_10401665 | |||
| 1150 | Ga0207699_10002466 | |||
| 1151 | Ga0207699_10169674 | |||
| 1152 | Ga0207699_10420751 | |||
| 1153 | Ga0207699_10793224 | |||
| 1154 | Ga0207645_11147044 | |||
| 1155 | Ga0207643_10134240 | |||
| 1156 | Ga0207643_10913133 | |||
| 1157 | Ga0207705_10013304 | |||
| 1158 | Ga0207705_10106205 | |||
| 1159 | Ga0207705_10207196 | |||
| 1160 | Ga0207654_10584402 | |||
| 1161 | Ga0207707_10431618 | |||
| 1162 | Ga0207707_10597725 | |||
| 1163 | Ga0207707_11506543 | |||
| 1164 | Ga0207695_10019365 | |||
| 1165 | Ga0207695_10235810 | |||
| 1166 | Ga0207695_10372458 | |||
| 1167 | Ga0207671_10076739 | |||
| 1168 | Ga0207693_10010040 | |||
| 1169 | Ga0207693_10013941 | |||
| 1170 | Ga0207693_10487206 | |||
| 1171 | Ga0207693_10859425 | |||
| 1172 | Ga0207663_10001658 | |||
| 1173 | Ga0207663_10035718 | |||
| 1174 | Ga0207663_10405578 | |||
| 1175 | Ga0207663_11256590 | |||
| 1176 | Ga0207660_10084392 | |||
| 1177 | Ga0207660_10424304 | |||
| 1178 | Ga0207662_10155303 | |||
| 1179 | Ga0207657_10102802 | |||
| 1180 | Ga0207657_10255329 | |||
| 1181 | Ga0207657_10371965 | |||
| 1182 | Ga0207649_10142620 | |||
| 1183 | Ga0207652_10187288 | |||
| 1184 | Ga0207652_10436119 | |||
| 1185 | Ga0207652_10674724 | |||
| 1186 | Ga0207646_10000851 | |||
| 1187 | Ga0207646_10195739 | |||
| 1188 | Ga0207681_10306243 | |||
| 1189 | Ga0207681_10598453 | |||
| 1190 | Ga0207694_10781720 | |||
| 1191 | Ga0207650_11638263 | |||
| 1192 | Ga0207687_10030470 | |||
| 1193 | Ga0207687_10096683 | |||
| 1194 | Ga0207687_10666309 | |||
| 1195 | Ga0207700_10017072 | |||
| 1196 | Ga0207700_10399445 | |||
| 1197 | Ga0207700_10412395 | |||
| 1198 | Ga0207664_10007639 | |||
| 1199 | Ga0207664_10034818 | |||
| 1200 | Ga0207664_10115407 | |||
| 1201 | Ga0207664_10138735 | |||
| 1202 | Ga0207664_10164713 | |||
| 1203 | Ga0207664_10229497 | |||
| 1204 | Ga0207664_10328891 | |||
| 1205 | Ga0207664_10496599 | |||
| 1206 | Ga0207664_10561840 | |||
| 1207 | Ga0207664_11206491 | |||
| 1208 | Ga0207644_10072450 | |||
| 1209 | Ga0207644_10410772 | |||
| 1210 | Ga0207644_11411791 | |||
| 1211 | Ga0207690_10468740 | |||
| 1212 | Ga0207706_10482306 | |||
| 1213 | Ga0207706_10800498 | |||
| 1214 | Ga0207686_10401199 | |||
| 1215 | Ga0207686_10533676 | |||
| 1216 | Ga0207709_10082076 | |||
| 1217 | Ga0207709_11464786 | |||
| 1218 | Ga0207704_10051212 | |||
| 1219 | Ga0207665_10006320 | |||
| 1220 | Ga0207665_10473919 | |||
| 1221 | Ga0207665_10518986 | |||
| 1222 | Ga0207711_10169015 | |||
| 1223 | Ga0207711_10955081 | |||
| 1224 | Ga0207689_10091239 | |||
| 1225 | Ga0207689_11381585 | |||
| 1226 | Ga0207661_10276162 | |||
| 1227 | Ga0207661_10443483 | |||
| 1228 | Ga0207661_10591414 | |||
| 1229 | Ga0207661_11016368 | |||
| 1230 | Ga0207661_11046840 | |||
| 1231 | Ga0207667_10429595 | |||
| 1232 | Ga0207667_11422283 | |||
| 1233 | Ga0207712_10530389 | |||
| 1234 | Ga0207677_10344246 | |||
| 1235 | Ga0207677_10797360 | |||
| 1236 | Ga0207677_10960308 | |||
| 1237 | Ga0207703_10065761 | |||
| 1238 | Ga0207703_10837358 | |||
| 1239 | Ga0207703_10967563 | |||
| 1240 | Ga0207678_10100762 | |||
| 1241 | Ga0207678_10415995 | |||
| 1242 | Ga0207678_10766858 | |||
| 1243 | Ga0207678_10859714 | |||
| 1244 | Ga0207708_10087705 | |||
| 1245 | Ga0207708_10625417 | |||
| 1246 | Ga0207708_11781913 | |||
| 1247 | Ga0207702_10190079 | |||
| 1248 | Ga0207702_11213915 | |||
| 1249 | Ga0207641_10042697 | |||
| 1250 | Ga0207676_10054566 | |||
| 1251 | Ga0207676_10812390 | |||
| 1252 | Ga0207674_10435556 | |||
| 1253 | Ga0207674_11648572 | |||
| 1254 | Ga0207675_100246022 | |||
| 1255 | Ga0207675_101047703 | |||
| 1256 | Ga0207675_101057331 | |||
| 1257 | Ga0207675_101876437 | |||
| 1258 | Ga0207683_10117278 | |||
| 1259 | Ga0207683_10427006 | |||
| 1260 | Ga0207683_10588768 | |||
| 1261 | Ga0207683_10733875 | |||
| 1262 | Ga0209981_1020297 | |||
| 1263 | Ga0209974_10424135 | |||
| 1264 | Ga0207428_10228085 | |||
| 1265 | Ga0268266_10431066 | |||
| 1266 | Ga0268266_10701170 | |||
| 1267 | Ga0268265_11163717 | |||
| 1268 | Ga0268264_12539093 | |||
| 1269 | Ga0265337_1021431 | |||
| 1270 | Ga0265337_1084356 | |||
| 1271 | Ga0265326_10073608 | |||
| 1272 | Ga0265319_1001715 | |||
| 1273 | Ga0265334_10036178 | |||
| 1274 | Ga0265334_10147650 | |||
| 1275 | Ga0265318_10047830 | |||
| 1276 | Ga0265318_10255532 | |||
| 1277 | Ga0265322_10025674 | |||
| 1278 | Ga0265322_10182142 | |||
| 1279 | Ga0265336_10122894 | |||
| 1280 | Ga0265336_10147394 | |||
| 1281 | Ga0265338_10006529 | |||
| 1282 | Ga0265338_10045626 | |||
| 1283 | Ga0265338_10083592 | |||
| 1284 | Ga0265338_10099744 | |||
| 1285 | Ga0265330_10045559 | |||
| 1286 | Ga0265330_10098668 | |||
| 1287 | Ga0265328_10092750 | |||
| 1288 | Ga0265320_10017023 | |||
| 1289 | Ga0265325_10016452 | |||
| 1290 | Ga0265325_10085494 | |||
| 1291 | Ga0265325_10283961 | |||
| 1292 | Ga0265329_10138024 | |||
| 1293 | Ga0265329_10219597 | |||
| 1294 | Ga0265340_10038019 | |||
| 1295 | Ga0265339_10014606 | |||
| 1296 | Ga0265331_10367553 | |||
| 1297 | Ga0265327_10096947 | |||
| 1298 | Ga0265327_10123635 | |||
| 1299 | Ga0265316_10042776 | |||
| 1300 | Ga0265316_10092509 | |||
| 1301 | Ga0307408_100545538 | |||
| 1302 | Ga0265313_10006544 | |||
| 1303 | Ga0265313_10127195 | |||
| 1304 | Ga0265314_10006724 | |||
| 1305 | Ga0265314_10008726 | |||
| 1306 | Ga0265314_10422702 | |||
| 1307 | Ga0265314_10443618 | |||
| 1308 | Ga0265342_10025010 | |||
| 1309 | Ga0265342_10202846 | |||
| 1310 | Ga0307405_10074269 | |||
| 1311 | Ga0307405_10123693 | |||
| 1312 | Ga0307405_10204622 | |||
| 1313 | Ga0307413_10097915 | |||
| 1314 | Ga0307413_10188484 | |||
| 1315 | Ga0307413_10717449 | |||
| 1316 | Ga0307413_10839512 | |||
| 1317 | Ga0307410_10270296 | |||
| 1318 | Ga0307410_10311301 | |||
| 1319 | Ga0307410_10858627 | |||
| 1320 | Ga0326468_10109920 | |||
| 1321 | Ga0326468_10126297 | |||
| 1322 | Ga0307406_10407586 | |||
| 1323 | Ga0307406_10868431 | |||
| 1324 | Ga0307406_12096958 | |||
| 1325 | Ga0307407_10969741 | |||
| 1326 | Ga0307412_10343235 | |||
| 1327 | Ga0307409_100056567 | |||
| 1328 | Ga0307409_100096173 | |||
| 1329 | Ga0307409_100860291 | |||
| 1330 | Ga0307409_102072944 | |||
| 1331 | Ga0307409_102646222 | |||
| 1332 | Ga0307416_100089639 | |||
| 1333 | Ga0307416_100530152 | |||
| 1334 | Ga0307416_100888673 | |||
| 1335 | Ga0307416_101306845 | |||
| 1336 | Ga0307414_10073335 | |||
| 1337 | Ga0307411_10030391 | |||
| 1338 | Ga0307411_10262825 | |||
| 1339 | Ga0307411_10896739 | |||
| 1340 | Ga0307415_100127028 | |||
| 1341 | Ga0307415_100736408 | |||
| 1342 | Ga0373948_0139519 | |||
| 1343 | Ga0373926_0006000 | |||
| 1344 | Ga0373951_0142164 | |||
| 1345 | Ga0373952_0082783 | |||
| 1346 | Ga0373939_0168584 | |||
| 1347 | Ga0373941_0150692 | |||
| 1348 | Ga0373945_0023155 | |||
| 1349 | Ga0373956_0183074 | |||
| 1350 | Ga0373956_0513584 | |||
| 1351 | Ga0373943_0125938 | |||
| 1352 | Ga0373943_0151187 | |||
| 1353 | Ga0373946_0020441 | |||
| 1354 | Ga0373946_0236626 | |||
| 1355 | Ga0373946_0664180 | |||
| 1356 | Ga0373955_0377954 | |||
| 1357 | Ga0373942_0370355 | |||
| 1358 | Ga0373962_0117593 | |||
| 1359 | Ga0373931_0059336 | |||
| 1360 | Ga0373931_0259014 | |||
| 1361 | Ga0373931_0503773 | |||
| 1362 | Ga0373935_0090520 | |||
| 1363 | Ga0373935_0604723 | |||
| 1364 | Ga0373927_0546312 | |||
| 1365 | Ga0373927_0599879 | |||
| 1366 | Ga0373933_0089134 | |||
| 1367 | Ga0373933_0136788 | |||
| 1368 | Ga0373947_0005312 | |||
| 1369 | Ga0373937_0001944 | |||
| 1370 | Ga0373937_0073336 | |||
| 1371 | Ga0373937_0270361 | |||
| 1372 | Ga0373937_0548141 | |||
| 1373 | Ga0373937_1283235 | |||
| 1374 | Ga0373925_0052441 | |||
| 1375 | Ga0373925_0359065 | |||
| 1376 | Ga0373925_0979215 | |||
| 1377 | Ga0395899_0166213 | |||
| 1378 | Ga0395900_0011178 | |||
| 1379 | Ga0395900_0146861 | |||
| 1380 | Ga0395900_0676842 | |||
| 1381 | Ga0395898_0018787 | |||
| 1382 | Ga0395898_0265711 | |||
| 1383 | Ga0395898_0397597 | |||
| 1384 | Ga0395898_0531182 | |||
| 1385 | Ga0395905_0050090 | |||
| 1386 | Ga0395905_0369375 | |||
| 1387 | Ga0395905_0457870 | |||
| 1388 | Ga0395901_0010536 | |||
| 1389 | Ga0395901_0125050 | |||
| 1390 | Ga0395901_0481896 | |||
| 1391 | Ga0395901_0542906 | |||
| 1392 | Ga0436360_1056459 | |||
| 1393 | Ga0436360_1119388 | |||
| 1394 | Ga0436363_1310716 | |||
| 1395 | Ga0436362_0027807 | |||
| 1396 | Ga0439438_017736 | |||
| 1397 | Ga0439461_0016834 | |||
| 1398 | Ga0439466_0036002 | |||
| 1399 | Ga0451802_0689958 | |||
| 1400 | Ga0451853_3622250 | |||
| 1401 | Ga0439431_0101146 | |||
| 1402 | Ga0450915_008079 | |||
| 1403 | Ga0450920_041655 | |||
| 1404 | Ga0450896_061610 | |||
| 1405 | Ga0450898_116236 | |||
| 1406 | Ga0439446_0023933 | |||
| 1407 | Ga0439434_0121539 | |||
| 1408 | Ga0450916_033609 | |||
| 1409 | Ga0450918_004776 | |||
| 1410 | Ga0451577_1753020 | |||
| 1411 | Ga0466969_0006133 | |||
| 1412 | Ga0466969_0023380 | |||
| 1413 | Ga0466972_0034041 | |||
| 1414 | Ga0466965_0074448 | |||
| 1415 | Ga0466965_0252957 | |||
| 1416 | Ga0466965_0291117 | |||
| 1417 | Ga0466965_0388413 | |||
| 1418 | Ga0466966_0024593 | |||
| 1419 | Ga0466966_0052870 | |||
| 1420 | Ga0466961_0009749 | |||
| 1421 | Ga0466961_0011634 | |||
| 1422 | Ga0466961_0037779 | |||
| 1423 | Ga0466961_0130266 | |||
| 1424 | Ga0466961_0163835 | |||
| 1425 | Ga0466961_0177224 | |||
| 1426 | Ga0466963_0002044 | |||
| 1427 | Ga0466963_0003206 | |||
| 1428 | Ga0466963_0009978 | |||
| 1429 | Ga0466963_0012830 | |||
| 1430 | Ga0466963_0015028 | |||
| 1431 | Ga0466963_0021764 | |||
| 1432 | Ga0466963_0024321 | |||
| 1433 | Ga0466963_0043303 | |||
| 1434 | Ga0466963_0053690 | |||
| 1435 | Ga0466963_0059333 | |||
| 1436 | Ga0466963_0063099 | |||
| 1437 | Ga0466963_0134375 | |||
| 1438 | Ga0466963_0159747 | |||
| 1439 | Ga0466963_0202023 | |||
| 1440 | Ga0466963_0214431 | |||
| 1441 | Ga0466963_0513648 | |||
| 1442 | Ga0466963_1146383 | |||
| 1443 | Ga0466964_0002221 | |||
| 1444 | Ga0466964_0010956 | |||
| 1445 | Ga0466964_0038807 | |||
| 1446 | Ga0466964_0059035 | |||
| 1447 | Ga0466964_0110190 | |||
| 1448 | Ga0466964_0152954 | |||
| 1449 | Ga0453684_0774690 | |||
| 1450 | Ga0466971_0000811 | |||
| 1451 | Ga0466971_0034283 | |||
| 1452 | Ga0466971_0034812 | |||
| 1453 | Ga0466971_0095466 | |||
| 1454 | Ga0466968_0001383 | |||
| 1455 | Ga0466968_0009900 | |||
| 1456 | Ga0466968_0089730 | |||
| 1457 | Ga0466968_0126221 | |||
| 1458 | Ga0466970_0038989 | |||
| 1459 | Ga0466970_0555848 | |||
| 1460 | Ga0466957_0011431 | |||
| 1461 | Ga0466957_0014656 | |||
| 1462 | Ga0466957_0039094 | |||
| 1463 | Ga0466957_0043235 | |||
| 1464 | Ga0466957_0043431 | |||
| 1465 | Ga0466957_0050574 | |||
| 1466 | Ga0466957_0127925 | |||
| 1467 | Ga0466957_0141542 | |||
| 1468 | Ga0466957_0378501 | |||
| 1469 | Ga0466960_0019584 | |||
| 1470 | Ga0466960_0044711 | |||
| 1471 | Ga0466960_0280714 | |||
| 1472 | Ga0466959_0000761 | |||
| 1473 | Ga0466959_0005947 | |||
| 1474 | Ga0466959_0010572 | |||
| 1475 | Ga0466959_0040467 | |||
| 1476 | Ga0466958_0011877 | |||
| 1477 | Ga0466958_0019527 | |||
| 1478 | Ga0466958_0029055 | |||
| 1479 | Ga0466958_0037650 | |||
| 1480 | Ga0466958_0044163 | |||
| 1481 | Ga0466958_0061728 | |||
| 1482 | Ga0466958_0357637 | |||
| 1483 | Ga0466967_0002348 | |||
| 1484 | Ga0466967_0008064 | |||
| 1485 | Ga0466967_0027506 | |||
| 1486 | Ga0466967_0039466 | |||
| 1487 | Ga0466967_0074534 | |||
| 1488 | Ga0466967_0087787 | |||
| 1489 | Ga0466967_0091601 | |||
| 1490 | Ga0466967_0104215 | |||
| 1491 | Ga0466967_0135518 | |||
| 1492 | Ga0466967_0197542 | |||
| 1493 | Ga0466967_0225216 | |||
| 1494 | Ga0466967_0286864 | |||
| 1495 | Ga0466967_0309574 | |||
| 1496 | Ga0466967_0310629 | |||
| 1497 | Ga0466967_0340817 | |||
| 1498 | Ga0466967_0376555 | |||
| 1499 | Ga0466967_0407941 | |||
| 1500 | Ga0466967_0466275 | |||
| 1501 | Ga0466967_0498769 | |||
| 1502 | Ga0466967_1007435 | |||
| 1503 | Ga0466967_1022476 | |||
| 1504 | Ga0466967_1284834 | |||
| 1505 | Ga0495592_0000082 | |||
| 1506 | Ga0495592_0005470 | |||
| 1507 | Ga0495592_0078369 | |||
| 1508 | Ga0495592_0110113 | |||
| 1509 | Ga0495592_0169612 | |||
| 1510 | Ga0495603_0026915 | |||
| 1511 | Ga0495603_0054621 | |||
| 1512 | Ga0495603_0209415 | |||
| 1513 | Ga0495603_0267484 | |||
| 1514 | Ga0495590_0375566 | |||
| 1515 | Ga0495629_0057569 | |||
| 1516 | Ga0495629_0254100 | |||
| 1517 | Ga0495629_0438158 | |||
| 1518 | Ga0495629_0484862 | |||
| 1519 | Ga0495641_0021128 | |||
| 1520 | Ga0495641_0026211 | |||
| 1521 | Ga0495641_0033988 | |||
| 1522 | Ga0495641_0114119 | |||
| 1523 | Ga0495641_0140930 | |||
| 1524 | Ga0495641_0143146 | |||
| 1525 | Ga0495641_0174278 | |||
| 1526 | Ga0495651_0000254 | |||
| 1527 | Ga0495651_0147265 | |||
| 1528 | Ga0495651_0233596 | |||
| 1529 | Ga0495651_0859931 | |||
| 1530 | Ga0495653_0008090 | |||
| 1531 | Ga0495653_0019537 | |||
| 1532 | Ga0495653_0036185 | |||
| 1533 | Ga0495653_0049166 | |||
| 1534 | Ga0495653_0052428 | |||
| 1535 | Ga0495653_0171551 | |||
| 1536 | Ga0495653_0619901 | |||
| 1537 | Ga0495653_0886785 | |||
| 1538 | Ga0495580_0027920 | |||
| 1539 | Ga0495580_0384454 | |||
| 1540 | Ga0495582_0021125 | |||
| 1541 | Ga0495582_0166217 | |||
| 1542 | Ga0495582_0247464 | |||
| 1543 | Ga0495639_0021259 | |||
| 1544 | Ga0495639_0114549 | |||
| 1545 | Ga0495662_0002737 | |||
| 1546 | Ga0495664_0023352 | |||
| 1547 | Ga0495664_0048325 | |||
| 1548 | Ga0495664_0281496 | |||
| 1549 | Ga0495664_0340710 | |||
| 1550 | Ga0495664_0366013 | |||
| 1551 | Ga0495664_0454089 | |||
| 1552 | Ga0495664_0905223 | |||
| 1553 | Ga0495584_0029054 | |||
| 1554 | Ga0495585_0225901 | |||
| 1555 | Ga0495596_0111430 | |||
| 1556 | Ga0495596_0131101 | |||
| 1557 | Ga0495608_0003029 | |||
| 1558 | Ga0495608_0024374 | |||
| 1559 | Ga0495608_0105999 | |||
| 1560 | Ga0495608_0728423 | |||
| 1561 | Ga0495608_0843316 | |||
| 1562 | Ga0495618_0025188 | |||
| 1563 | Ga0495618_0045188 | |||
| 1564 | Ga0495618_0065034 | |||
| 1565 | Ga0495618_0154761 | |||
| 1566 | Ga0495618_0173072 | |||
| 1567 | Ga0495618_0255145 | |||
| 1568 | Ga0495620_0186565 | |||
| 1569 | Ga0495628_0008466 | |||
| 1570 | Ga0495628_0025414 | |||
| 1571 | Ga0495628_0229084 | |||
| 1572 | Ga0495630_0047973 | |||
| 1573 | Ga0495630_0127048 | |||
| 1574 | Ga0495630_0353097 | |||
| 1575 | Ga0495630_0371840 | |||
| 1576 | Ga0495630_1008805 | |||
| 1577 | Ga0495644_0059168 | |||
| 1578 | Ga0495666_0000309 | |||
| 1579 | Ga0495652_0000144 | |||
| 1580 | Ga0495652_0098296 | |||
| 1581 | Ga0495652_0101405 | |||
| 1582 | Ga0495652_0202452 | |||
| 1583 | Ga0495652_0310045 | |||
| 1584 | Ga0495652_0526687 | |||
| 1585 | Ga0495652_0939203 | |||
| 1586 | Ga0495665_0046576 | |||
| 1587 | Ga0495640_0068005 | |||
| 1588 | Ga0495640_0153332 | |||
| 1589 | Ga0495640_0430155 | |||
| 1590 | Ga0495640_0536709 | |||
| 1591 | Ga0495586_0052192 | |||
| 1592 | Ga0495586_0087870 | |||
| 1593 | Ga0495586_0099724 | |||
| 1594 | Ga0495586_0168258 | |||
| 1595 | Ga0495586_0231059 | |||
| 1596 | Ga0495587_0000060 | |||
| 1597 | Ga0495587_0054748 | |||
| 1598 | Ga0495587_0130539 | |||
| 1599 | Ga0495621_0186462 | |||
| 1600 | Ga0495645_0000038 | |||
| 1601 | Ga0495645_0026009 | |||
| 1602 | Ga0495645_0065208 | |||
| 1603 | Ga0495645_0108382 | |||
| 1604 | Ga0495645_0425074 | |||
| 1605 | Ga0495667_0041480 | |||
| 1606 | Ga0495667_0063361 | |||
| 1607 | Ga0495667_0147787 | |||
| 1608 | Ga0495667_0269832 | |||
| 1609 | Ga0495667_0311179 | |||
| 1610 | Ga0495667_0327687 | |||
| 1611 | Ga0495667_0544390 | |||
| 1612 | Ga0495667_0670775 | |||
| 1613 | Ga0495667_0734070 | |||
| 1614 | Ga0495656_0004882 | |||
| 1615 | Ga0495656_0414786 | |||
| 1616 | Ga0495668_0127931 | |||
| 1617 | Ga0495634_0097102 | |||
| 1618 | Ga0495634_0108667 | |||
| 1619 | Ga0495634_0170122 | |||
| 1620 | Ga0495634_0260784 | |||
| 1621 | Ga0495634_0300388 | |||
| 1622 | Ga0495634_0705950 | |||
| 1623 | Ga0495635_0061455 | |||
| 1624 | Ga0495635_0093282 | |||
| 1625 | Ga0495635_0169001 | |||
| 1626 | Ga0495635_0229115 | |||
| 1627 | Ga0495659_0235092 | |||
| 1628 | Ga0495661_0216592 | |||
| 1629 | Ga0495588_0499315 | |||
| 1630 | Ga0495657_0017146 | |||
| 1631 | Ga0495657_0074538 | |||
| 1632 | Ga0495657_0130787 | |||
| 1633 | Ga0495657_0409629 | |||
| 1634 | Ga0495657_0651169 | |||
| 1635 | Ga0495599_0007761 | |||
| 1636 | Ga0495599_0022857 | |||
| 1637 | Ga0495599_0148173 | |||
| 1638 | Ga0495623_0001647 | |||
| 1639 | Ga0495623_0462693 | |||
| 1640 | Ga0495646_0018814 | |||
| 1641 | Ga0495646_0049372 | |||
| 1642 | Ga0495646_0116807 | |||
| 1643 | Ga0495647_0008741 | |||
| 1644 | Ga0495647_0017159 | |||
| 1645 | Ga0495647_0056840 | |||
| 1646 | Ga0495647_0596353 | |||
| 1647 | Ga0495658_0027649 | |||
| 1648 | Ga0495658_0244638 | |||
| 1649 | Ga0495658_0653294 | |||
| 1650 | Ga0495658_0997222 | |||
| 1651 | Ga0495613_0015955 | |||
| 1652 | Ga0495613_0260787 | |||
| 1653 | Ga0495613_0353040 | |||
| 1654 | Ga0495613_0385974 | |||
| 1655 | Ga0495624_0009825 | |||
| 1656 | Ga0495624_0032420 | |||
| 1657 | Ga0495624_0045373 | |||
| 1658 | Ga0495624_0346354 | |||
| 1659 | Ga0495624_0399900 | |||
| 1660 | Ga0495600_0022116 | |||
| 1661 | Ga0495600_0197659 | |||
| 1662 | Ga0495600_0215664 | |||
| 1663 | Ga0495660_0286114 | |||
| 1664 | Ga0495660_0507468 | |||
| 1665 | Ga0495581_0063679 | |||
| 1666 | Ga0495581_0285930 | |||
| 1667 | Ga0495604_0000043 | |||
| 1668 | Ga0495604_0148690 | |||
| 1669 | Ga0495604_0284317 | |||
| 1670 | Ga0495636_0112191 | |||
| 1671 | Ga0495674_0039854 | |||
| 1672 | Ga0495674_0133281 | |||
| 1673 | Ga0495674_0165119 | |||
| 1674 | Ga0495674_0187393 | |||
| 1675 | Ga0495674_0275727 | |||
| 1676 | Ga0495674_0328482 | |||
| 1677 | Ga0495674_1035486 | |||
| 1678 | Ga0495676_0103965 | |||
| 1679 | Ga0495676_0111905 | |||
| 1680 | Ga0495676_0309857 | |||
| 1681 | Ga0495680_0010993 | |||
| 1682 | Ga0495680_0047309 | |||
| 1683 | Ga0495680_0128449 | |||
| 1684 | Ga0495680_0208519 | |||
| 1685 | Ga0495680_0409729 | |||
| 1686 | Ga0495680_0487979 | |||
| 1687 | Ga0495680_0600625 | |||
| 1688 | Ga0495683_0164235 | |||
| 1689 | Ga0495675_0000413 | |||
| 1690 | Ga0495677_0215595 | |||
| 1691 | Ga0495679_057747 | |||
| 1692 | Ga0495684_0001111 | |||
| 1693 | Ga0495684_0006437 | |||
| 1694 | Ga0495684_0193268 | |||
| 1695 | Ga0495684_0249687 | |||
| 1696 | Ga0495684_0540914 | |||
| 1697 | Ga0495684_0852706 | |||
| 1698 | Ga0495684_0881902 | |||
| 1699 | Ga0495593_0027939 | |||
| 1700 | Ga0495593_0104572 | |||
| 1701 | Ga0495602_0043043 | |||
| 1702 | Ga0495602_0053415 | |||
| 1703 | Ga0495602_0217072 | |||
| 1704 | Ga0495602_0342351 | |||
| 1705 | Ga0495614_0009758 | |||
| 1706 | Ga0495614_0073037 | |||
| 1707 | Ga0495615_0147763 | |||
| 1708 | Ga0496100_0028219 | |||
| 1709 | Ga0496100_1434127 | |||
| 1710 | Ga0496101_0039194 | |||
| 1711 | Ga0496101_0081933 | |||
| 1712 | Ga0496101_0300984 | |||
| 1713 | Ga0496101_1021589 | |||
| 1714 | Ga0496101_1061894 | |||
| 1715 | Ga0496101_1511711 | |||
| 1716 | Ga0496102_0003464 | |||
| 1717 | Ga0496102_0008253 | |||
| 1718 | Ga0496102_0143115 | |||
| 1719 | Ga0496102_0189821 | |||
| 1720 | Ga0496103_0005471 | |||
| 1721 | Ga0496103_0023207 | |||
| 1722 | Ga0496103_0358114 | |||
| 1723 | Ga0496104_0016980 | |||
| 1724 | Ga0496104_0059067 | |||
| 1725 | Ga0496104_0150580 | |||
| 1726 | Ga0496104_0196248 | |||
| 1727 | Ga0496104_0320571 | |||
| 1728 | Ga0496104_1276829 | |||
| 1729 | Ga0496105_0015128 | |||
| 1730 | Ga0496105_0065644 | |||
| 1731 | Ga0496105_0161150 | |||
| 1732 | Ga0496105_0440379 | |||
| 1733 | Ga0496105_0629891 | |||
| 1734 | Ga0496106_0017267 | |||
| 1735 | Ga0496106_0183614 | |||
| 1736 | Ga0496106_0235757 | |||
| 1737 | Ga0496106_0419118 | |||
| 1738 | Ga0496107_0005952 | |||
| 1739 | Ga0496107_0133461 | |||
| 1740 | Ga0496107_0421448 | |||
| 1741 | Ga0496107_0579130 | |||
| 1742 | Ga0496107_1250802 | |||
| 1743 | Ga0496108_0037409 | |||
| 1744 | Ga0496108_0110191 | |||
| 1745 | Ga0496108_0221375 | |||
| 1746 | Ga0496108_0240228 | |||
| 1747 | Ga0496108_0302977 | |||
| 1748 | Ga0496109_0053795 | |||
| 1749 | Ga0496109_0102132 | |||
| 1750 | Ga0496109_0119789 | |||
| 1751 | Ga0496109_0129522 | |||
| 1752 | Ga0496109_0289311 | |||
| 1753 | Ga0496110_0169177 | |||
| 1754 | Ga0496110_0628038 | |||
| 1755 | Ga0496110_1338264 | |||
| 1756 | Ga0496111_0117258 | |||
| 1757 | Ga0496111_0120767 | |||
| 1758 | Ga0496111_0161779 | |||
| 1759 | Ga0496111_0221098 | |||
| 1760 | Ga0496111_0758520 | |||
| 1761 | Ga0496112_0158987 | |||
| 1762 | Ga0496112_0204957 | |||
| 1763 | Ga0496112_1296300 | |||
| 1764 | Ga0496113_0071897 | |||
| 1765 | Ga0496113_0113339 | |||
| 1766 | Ga0496113_0246479 | |||
| 1767 | Ga0496114_0004956 | |||
| 1768 | Ga0496114_0006185 | |||
| 1769 | Ga0496114_0033807 | |||
| 1770 | Ga0496114_0164281 | |||
| 1771 | Ga0496115_0009112 | |||
| 1772 | Ga0496115_0033955 | |||
| 1773 | Ga0496115_0194322 | |||
| 1774 | Ga0496115_0329984 | |||
| 1775 | Ga0496115_0382445 | |||
| 1776 | Ga0501031_0003238 | |||
| 1777 | Ga0501031_0755708 | |||
| 1778 | Ga0501032_0016731 | |||
| 1779 | Ga0501033_0011156 | |||
| 1780 | Ga0501036_0013212 | |||
| 1781 | Ga0501036_1137596 | |||
| 1782 | Ga0501037_0001718 | |||
| 1783 | Ga0501038_0071959 | |||
| 1784 | Ga0501039_0033420 | |||
| 1785 | Ga0501040_0177164 | |||
| 1786 | Ga0501040_1096012 | |||
| 1787 | Ga0501041_0052787 | |||
| 1788 | Ga0501042_0790184 | |||
| 1789 | Ga0501043_0005046 | |||
| 1790 | Ga0501046_0226491 | |||
| 1791 | Ga0501067_0070774 | |||
| 1792 | Ga0501067_0260907 | |||
| 1793 | Ga0501069_0000281 | |||
| 1794 | Ga0501069_0012970 | |||
| 1795 | Ga0501069_0109884 | |||
| 1796 | Ga0501070_0096580 | |||
| 1797 | Ga0501070_0134827 | |||
| 1798 | Ga0501071_0006860 | |||
| 1799 | Ga0501071_0082451 | |||
| 1800 | Ga0501071_0701119 | |||
| 1801 | Ga0501071_0744459 | |||
| 1802 | Ga0501072_0001268 | |||
| 1803 | Ga0501072_1346898 | |||
| 1804 | Ga0501073_0004422 | |||
| 1805 | Ga0501074_0060889 | |||
| 1806 | Ga0501075_0026770 | |||
| 1807 | Ga0501076_0221178 | |||
| 1808 | Ga0501076_0255360 | |||
| 1809 | Ga0501077_0006117 | |||
| 1810 | Ga0501077_0197370 | |||
| 1811 | Ga0501255_029548 | |||
| 1812 | Ga0501225_0356133 | |||
| 1813 | Ga0501079_0135066 | |||
| 1814 | Ga0501079_0225222 | |||
| 1815 | Ga0501081_0095144 | |||
| 1816 | Ga0501083_0059072 | |||
| 1817 | Ga0501268_076747 | |||
| 1818 | Ga0501035_0023192 | |||
| 1819 | Ga0501044_0047525 | |||
| 1820 | Ga0501045_0004644 | |||
| 1821 | Ga0501045_0977297 | |||
| 1822 | nmdc:mga00v17_672439_c1 | |||
| 1823 | nmdc:mga06r32_1620144_c1 | |||
| 1824 | nmdc:mga08y16_1377811_c1 | |||
| 1825 | nmdc:mga08y16_201893_c1 | |||
| 1826 | nmdc:mga08y16_503294_c1 | |||
| 1827 | nmdc:mga08y16_529562_c1 | |||
| 1828 | nmdc:mga0n895_104711_c1 | |||
| 1829 | nmdc:mga08x19_498856_c1 | |||
| 1830 | nmdc:mga0a205_53821_c1 | |||
| 1831 | Ga0495601_0016127 | |||
| 1832 | Ga0495601_0106723 | |||
| 1833 | Ga0495601_0121354 | |||
| 1834 | Ga0495601_0132228 | |||
| 1835 | Ga0495601_0219668 | |||
| 1836 | Ga0495601_0298539 | |||
| 1837 | Ga0495601_0383161 | |||
| 1838 | Ga0495612_0048056 | |||
| 1839 | Ga0495612_0104624 | |||
| 1840 | Ga0495595_0037657 | |||
| 1841 | Ga0495595_0077821 | |||
| 1842 | Ga0495595_0126829 | |||
| 1843 | Ga0495619_0005446 | |||
| 1844 | Ga0495619_0065883 | |||
| 1845 | Ga0495619_0168655 | |||
| 1846 | Ga0495619_0268750 | |||
| 1847 | Ga0495619_0628109 | |||
| 1848 | Ga0500641_0121656 | |||
| 1849 | Ga0500608_320245 | |||
| 1850 | Ga0501084_0076562 | |||
| 1851 | Ga0501084_0128730 | |||
| 1852 | Ga0587066_048692 | |||
| 1853 | Ga0587070_050497 | |||
| 1854 | Ga0587073_0179480 | |||
| 1855 | Ga0587073_0280482 | |||
| 1856 | Ga0587080_042143 | |||
| 1857 | Ga0587082_121217 | |||
| 1858 | Ga0587083_0111320 | |||
| 1859 | Ga0587085_085882 | |||
| 1860 | Ga0587088_151590 | |||
| 1861 | Ga0587113_026351 | |||
| 1862 | Ga0587122_061945 | |||
| 1863 | Ga0587067_200294 | |||
| 1864 | Ga0587069_101856 | |||
| 1865 | Ga0587069_113803 | |||
| 1866 | Ga0587075_142988 | |||
| 1867 | Ga0587079_189283 | |||
| 1868 | Ga0587114_079903 | |||
| 1869 | Ga0587119_041929 | |||
| 1870 | Ga0587071_072219 | |||
| 1871 | Ga0501082_0080589 | |||
| 1872 | Ga0501082_0854572 | |||
| 1873 | Ga0466962_0032916 | |||
| 1874 | Ga0466962_0193151 | |||
| 1875 | Ga0530510_0087455 | |||
| 1876 | Ga0530510_0255315 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v5d-assembly1.cif.gz_BX | structure of the thermus thermophilus 70s ribosome in complex with mrna, paromomycin, acylated a- and p-site trnas, and e-site trna. | 0.9471 | 4 | 95 |
| 8cgd-assembly1.cif.gz_s | clindamycin bound to the 50s subunit | 0.9431 | 5 | 85 |
| 6ppf-assembly1.cif.gz_T | bacterial 45srbga ribosomal particle class b | 0.943 | 4 | 89 |
| 7nhn-assembly1.cif.gz_W | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9403 | 4 | 90 |
| 6enj-assembly1.cif.gz_T | polyproline-stalled ribosome in the presence of a+p site trna and elongation-factor p (ef-p) | 0.9381 | 5 | 90 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6hmaR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9377 | 4 | 89 | 3.30.70.330 |
| af_P61845_1_86_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9225 | 9 | 90 | 3.30.70.330 |
| 4ukhK00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9161 | 3 | 86 | 3.30.70.330 |
| 4qs3X00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9075 | 7 | 95 | 3.30.70.330 |
| 4garT00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9016 | 5 | 90 | 3.30.70.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9P4G8-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.973 | 1 | 98 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A348WVJ9-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9716 | 3 | 93 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A6B1CUX1-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9712 | 3 | 91 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A7G6E5U1-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9707 | 3 | 95 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1G2LQR1-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9706 | 7 | 91 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |