F486241
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 938 | 494 | 866 | 336 |
Family's Representative Sequence
| Representative Sequence | 3300005331|Ga0070670_100027932|Ga0070670_1000279324 |
| Length | 336 |
| Sequence | MLAKRVLLAVSIAFAVAFAGVASAQTATCYNCPPEWADFKTQLRVIKEQTGITVPPDNKNSGQTLAQLIAEKANPVADIGHFGVGFAIQAKDAGVVEAYKPAKYWDEIPADLKDPDGSWFTVYYGTLGLFVNVDALGGKPIPTSWKDLTDPKYKGMVGFLDPASSFVGVAAAVAINRALGGSLDDFTPAINWFKAMTKNEAIVPKQTSYARVVSGEIPILIDYDFNAYRAQYQDKVNARFVIPKEGTLIVPYVMSLVKGGPNAANGKKVLDFLLTDKGQAVFANAFVRPIRPSAASAEARSKFLPDAEYARASGIDFRKVAQVQDAFIKRYLAEGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 3 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 4 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 5 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 6 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 7 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 8 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 9 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 10 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 11 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 12 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 13 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 14 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 15 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 16 | 2565956521 | Vibrio rhizosphaerae DSM 18581 | Isolate | Rhizosphere |
| 17 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 18 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 19 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 20 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 21 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 22 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 23 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 24 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 25 | 2791355199 | |||
| 26 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 27 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 28 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 29 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 30 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 31 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 32 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 33 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 34 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 35 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 36 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 37 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 38 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 39 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 40 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 41 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 42 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 43 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 44 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 45 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 46 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 47 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 48 | 2906610324 | |||
| 49 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 50 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 51 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 52 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 53 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 54 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 55 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 56 | 2922425934 | |||
| 57 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 58 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 59 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 60 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 61 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 62 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 63 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 64 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 65 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 66 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 67 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 68 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 70 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 71 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 72 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 73 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 74 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 75 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 76 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 77 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 79 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 81 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 86 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 106 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 107 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 108 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 112 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 113 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 116 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 118 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 119 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 120 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 121 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 122 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 123 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 124 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 125 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 126 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 127 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 128 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 129 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 130 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 131 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 132 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 134 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 135 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 136 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 137 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 138 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 139 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 140 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 141 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 142 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 144 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 145 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 146 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 147 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 148 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 150 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 151 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 152 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 166 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 179 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 182 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 184 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 185 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 186 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 197 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 199 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 257 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 264 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 265 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 266 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 267 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 268 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 269 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 270 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 271 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 272 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 273 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 274 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 275 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 276 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 277 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 278 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 279 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 280 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 281 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 282 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 283 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 284 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 285 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 286 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 287 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 288 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 289 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 290 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 291 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 292 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 293 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 294 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 295 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 296 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 297 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 298 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 299 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 300 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 301 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 302 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 303 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 304 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 305 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 306 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 307 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 308 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 309 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 310 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 311 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 312 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 313 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 314 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 315 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 316 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 317 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 318 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 319 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 320 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 321 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 379 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 380 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 381 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 382 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 383 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 384 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 385 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 387 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 388 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 389 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 390 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 391 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 392 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 393 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 394 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 395 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 396 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 397 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 398 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 399 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 400 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 401 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 402 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 403 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 428 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 429 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 430 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 431 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 432 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 433 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 434 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 439 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 440 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 445 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 446 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 447 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 448 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 449 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 450 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 451 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 452 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 453 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 454 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 455 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 456 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 457 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 458 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 459 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 460 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 461 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 462 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 463 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 464 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 465 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 466 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 467 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 468 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 469 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 470 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 471 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 472 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 473 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 474 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 475 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 476 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 477 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 478 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 479 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 480 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 481 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 482 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 483 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 485 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 486 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 487 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 488 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 489 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 490 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 491 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 492 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 493 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 494 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.62 |
| Metatranscriptomes | 0 |
| Isolates | 7.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.26 |
| Nodule | 3.41 |
| Rhizoplane | 6.18 |
| Rhizosphere | 70.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3697715 | 2162886007 | Bacteria | 2197 |
| 2 | SwRhRL2b_contig_421928 | 2162886007 | Bacteria | 1154 |
| 3 | JGI25162J39368_1000202 | 3300002737 | Bacteria | 62873 |
| 4 | JGI25162J39368_1000303 | 3300002737 | Bacteria | 45206 |
| 5 | JGI25163J39215_1000073 | 3300002771 | Bacteria | 44827 |
| 6 | JGI25164J39214_1000222 | 3300002772 | Bacteria | 45206 |
| 7 | JGI25165J46597_1000296 | 3300003214 | Bacteria | 62873 |
| 8 | JGI25165J46597_1000409 | 3300003214 | Bacteria | 45206 |
| 9 | JGI25404J52841_10002179 | 3300003659 | Bacteria | 3663 |
| 10 | Ga0055538_1000010 | 3300003751 | Bacteria | 376599 |
| 11 | Ga0055538_1000113 | 3300003751 | Bacteria | 62873 |
| 12 | Ga0055539_1000015 | 3300003752 | Bacteria | 376599 |
| 13 | Ga0055539_1000161 | 3300003752 | Bacteria | 62873 |
| 14 | Ga0055533_1000018 | 3300003756 | Bacteria | 376599 |
| 15 | Ga0055533_1000163 | 3300003756 | Bacteria | 62873 |
| 16 | Ga0055525_1000020 | 3300003759 | Bacteria | 376599 |
| 17 | Ga0055525_1000218 | 3300003759 | Bacteria | 62873 |
| 18 | Ga0055541_1000011 | 3300003841 | Bacteria | 376599 |
| 19 | Ga0055541_1000106 | 3300003841 | Bacteria | 62873 |
| 20 | Ga0065714_10002440 | 3300005288 | Bacteria | 26394 |
| 21 | Ga0065704_10070871 | 3300005289 | Bacteria | 15191 |
| 22 | Ga0065704_10071587 | 3300005289 | Bacteria | 10610 |
| 23 | Ga0065712_10149151 | 3300005290 | Bacteria | 1384 |
| 24 | Ga0070683_100258772 | 3300005329 | Bacteria | 1655 |
| 25 | Ga0070683_100480830 | 3300005329 | Bacteria | 1186 |
| 26 | Ga0070683_100514276 | 3300005329 | Bacteria | 1144 |
| 27 | Ga0070690_100010911 | 3300005330 | Bacteria | 5302 |
| 28 | Ga0070690_100100581 | 3300005330 | Bacteria | 1917 |
| 29 | Ga0070690_100127371 | 3300005330 | Bacteria | 1716 |
| 30 | Ga0070670_100027932 | 3300005331 | Bacteria | 4855 |
| 31 | Ga0070670_100137806 | 3300005331 | Bacteria | 2109 |
| 32 | Ga0070670_100425712 | 3300005331 | Bacteria | 1174 |
| 33 | Ga0068869_100118220 | 3300005334 | Bacteria | 2024 |
| 34 | Ga0068869_100165040 | 3300005334 | Bacteria | 1726 |
| 35 | Ga0070666_10101981 | 3300005335 | Bacteria | 1979 |
| 36 | Ga0070666_10261423 | 3300005335 | Bacteria | 1227 |
| 37 | Ga0070680_100091191 | 3300005336 | Bacteria | 2523 |
| 38 | Ga0070680_100138359 | 3300005336 | Bacteria | 2041 |
| 39 | Ga0070680_100144216 | 3300005336 | Bacteria | 1997 |
| 40 | Ga0070680_100271876 | 3300005336 | Bacteria | 1435 |
| 41 | Ga0070682_100013240 | 3300005337 | Bacteria | 4743 |
| 42 | Ga0070682_100073266 | 3300005337 | Bacteria | 2197 |
| 43 | Ga0070660_100007189 | 3300005339 | Bacteria | 7744 |
| 44 | Ga0070660_100166106 | 3300005339 | Bacteria | 1781 |
| 45 | Ga0070689_100200571 | 3300005340 | Bacteria | 1629 |
| 46 | Ga0070689_100264087 | 3300005340 | Bacteria | 1424 |
| 47 | Ga0070691_10019427 | 3300005341 | Bacteria | 3136 |
| 48 | Ga0070687_100110435 | 3300005343 | Bacteria | 1555 |
| 49 | Ga0070661_100256191 | 3300005344 | Bacteria | 1352 |
| 50 | Ga0070668_100107536 | 3300005347 | Bacteria | 2217 |
| 51 | Ga0070668_100329691 | 3300005347 | Bacteria | 1287 |
| 52 | Ga0070669_100048294 | 3300005353 | Bacteria | 3106 |
| 53 | Ga0070669_100072345 | 3300005353 | Bacteria | 2552 |
| 54 | Ga0070671_100052533 | 3300005355 | Bacteria | 3388 |
| 55 | Ga0070671_100099616 | 3300005355 | Bacteria | 2438 |
| 56 | Ga0070674_100027167 | 3300005356 | Bacteria | 3747 |
| 57 | Ga0070673_100127265 | 3300005364 | Bacteria | 2133 |
| 58 | Ga0070659_100104900 | 3300005366 | Bacteria | 2277 |
| 59 | Ga0070659_100147002 | 3300005366 | Bacteria | 1921 |
| 60 | Ga0070667_100206242 | 3300005367 | Bacteria | 1745 |
| 61 | Ga0070667_100406043 | 3300005367 | Bacteria | 1240 |
| 62 | Ga0070709_10002767 | 3300005434 | Bacteria | 9474 |
| 63 | Ga0070709_10008832 | 3300005434 | Bacteria | 5547 |
| 64 | Ga0070709_10011082 | 3300005434 | Bacteria | 5013 |
| 65 | Ga0070709_10013113 | 3300005434 | Bacteria | 4652 |
| 66 | Ga0070714_100063993 | 3300005435 | Bacteria | 3165 |
| 67 | Ga0070714_100131195 | 3300005435 | Bacteria | 2240 |
| 68 | Ga0070714_100149682 | 3300005435 | Bacteria | 2102 |
| 69 | Ga0070713_100000550 | 3300005436 | Bacteria | 23862 |
| 70 | Ga0070713_100006026 | 3300005436 | Bacteria | 8351 |
| 71 | Ga0070713_100029112 | 3300005436 | Bacteria | 4369 |
| 72 | Ga0070713_100031737 | 3300005436 | Bacteria | 4211 |
| 73 | Ga0070710_10008247 | 3300005437 | Bacteria | 5069 |
| 74 | Ga0070710_10018621 | 3300005437 | Bacteria | 3575 |
| 75 | Ga0070710_10018876 | 3300005437 | Bacteria | 3554 |
| 76 | Ga0070710_10040195 | 3300005437 | Bacteria | 2577 |
| 77 | Ga0070711_100009943 | 3300005439 | Bacteria | 5868 |
| 78 | Ga0070711_100014342 | 3300005439 | Bacteria | 4993 |
| 79 | Ga0070711_100021650 | 3300005439 | Bacteria | 4160 |
| 80 | Ga0070711_100025491 | 3300005439 | Bacteria | 3870 |
| 81 | Ga0070700_100178922 | 3300005441 | Bacteria | 1474 |
| 82 | Ga0070663_100000736 | 3300005455 | Bacteria | 17673 |
| 83 | Ga0070663_100131854 | 3300005455 | Bacteria | 1898 |
| 84 | Ga0070663_100156860 | 3300005455 | Bacteria | 1749 |
| 85 | Ga0070663_100163807 | 3300005455 | Bacteria | 1713 |
| 86 | Ga0070678_100001495 | 3300005456 | Bacteria | 12487 |
| 87 | Ga0070678_100027494 | 3300005456 | Bacteria | 3862 |
| 88 | Ga0070662_100118960 | 3300005457 | Bacteria | 2022 |
| 89 | Ga0070681_10025079 | 3300005458 | Bacteria | 6001 |
| 90 | Ga0070681_10048540 | 3300005458 | Bacteria | 4241 |
| 91 | Ga0068867_100020022 | 3300005459 | Bacteria | 4768 |
| 92 | Ga0068867_100176966 | 3300005459 | Bacteria | 1693 |
| 93 | Ga0070685_10111379 | 3300005466 | Bacteria | 1686 |
| 94 | Ga0070706_100133864 | 3300005467 | Bacteria | 2314 |
| 95 | Ga0070698_100209429 | 3300005471 | Bacteria | 1885 |
| 96 | Ga0070699_100035564 | 3300005518 | Bacteria | 4305 |
| 97 | Ga0070679_100014293 | 3300005530 | Bacteria | 7623 |
| 98 | Ga0070679_100043390 | 3300005530 | Bacteria | 4479 |
| 99 | Ga0070679_100043780 | 3300005530 | Bacteria | 4457 |
| 100 | Ga0070679_100047120 | 3300005530 | Bacteria | 4298 |
| 101 | Ga0070679_100268687 | 3300005530 | Bacteria | 1660 |
| 102 | Ga0070679_100287992 | 3300005530 | Bacteria | 1594 |
| 103 | Ga0070686_100010100 | 3300005544 | Bacteria | 5312 |
| 104 | Ga0070686_100067858 | 3300005544 | Bacteria | 2325 |
| 105 | Ga0070686_100257394 | 3300005544 | Bacteria | 1278 |
| 106 | Ga0070696_100000694 | 3300005546 | Bacteria | 21554 |
| 107 | Ga0070696_100118754 | 3300005546 | Bacteria | 1912 |
| 108 | Ga0070665_100020717 | 3300005548 | Bacteria | 6606 |
| 109 | Ga0070665_100069514 | 3300005548 | Bacteria | 3529 |
| 110 | Ga0070665_100076366 | 3300005548 | Bacteria | 3357 |
| 111 | Ga0070665_100108349 | 3300005548 | Bacteria | 2780 |
| 112 | Ga0068855_100000064 | 3300005563 | Bacteria | 130807 |
| 113 | Ga0068855_100037921 | 3300005563 | Bacteria | 5727 |
| 114 | Ga0068855_100053720 | 3300005563 | Bacteria | 4738 |
| 115 | Ga0068855_100095032 | 3300005563 | Bacteria | 3436 |
| 116 | Ga0068855_100106579 | 3300005563 | Bacteria | 3221 |
| 117 | Ga0070664_100009890 | 3300005564 | Bacteria | 7731 |
| 118 | Ga0070664_100239772 | 3300005564 | Bacteria | 1627 |
| 119 | Ga0068857_100055630 | 3300005577 | Bacteria | 3511 |
| 120 | Ga0068854_100018026 | 3300005578 | Bacteria | 4733 |
| 121 | Ga0068856_100044511 | 3300005614 | Bacteria | 4369 |
| 122 | Ga0068852_100010158 | 3300005616 | Bacteria | 7014 |
| 123 | Ga0068859_100005475 | 3300005617 | Bacteria | 12919 |
| 124 | Ga0068859_100107766 | 3300005617 | Bacteria | 2847 |
| 125 | Ga0068859_100140979 | 3300005617 | Bacteria | 2484 |
| 126 | Ga0068859_100142811 | 3300005617 | Bacteria | 2467 |
| 127 | Ga0068864_100401438 | 3300005618 | Bacteria | 1303 |
| 128 | Ga0068866_10008172 | 3300005718 | Bacteria | 4397 |
| 129 | Ga0068866_10042110 | 3300005718 | Bacteria | 2271 |
| 130 | Ga0068861_100047868 | 3300005719 | Bacteria | 3229 |
| 131 | Ga0068861_100230206 | 3300005719 | Bacteria | 1571 |
| 132 | Ga0068863_100063589 | 3300005841 | Bacteria | 3490 |
| 133 | Ga0068863_100115896 | 3300005841 | Bacteria | 2553 |
| 134 | Ga0068863_100154161 | 3300005841 | Bacteria | 2199 |
| 135 | Ga0068858_100020207 | 3300005842 | Bacteria | 6227 |
| 136 | Ga0068858_100112360 | 3300005842 | Bacteria | 2544 |
| 137 | Ga0068858_100177289 | 3300005842 | Bacteria | 2011 |
| 138 | Ga0068860_100012743 | 3300005843 | Bacteria | 8270 |
| 139 | Ga0068860_100037218 | 3300005843 | Bacteria | 4658 |
| 140 | Ga0068860_100487273 | 3300005843 | Bacteria | 1229 |
| 141 | Ga0068862_100025981 | 3300005844 | Bacteria | 4921 |
| 142 | Ga0068862_100163005 | 3300005844 | Bacteria | 1991 |
| 143 | Ga0081455_10001659 | 3300005937 | Bacteria | 26976 |
| 144 | Ga0081455_10006992 | 3300005937 | Bacteria | 11989 |
| 145 | Ga0081455_10012994 | 3300005937 | Bacteria | 8255 |
| 146 | Ga0081455_10017230 | 3300005937 | Bacteria | 6936 |
| 147 | Ga0081455_10131669 | 3300005937 | Bacteria | 1955 |
| 148 | Ga0081455_10167437 | 3300005937 | Bacteria | 1677 |
| 149 | Ga0081540_1000918 | 3300005983 | Bacteria | 26491 |
| 150 | Ga0081540_1001903 | 3300005983 | Bacteria | 17470 |
| 151 | Ga0081540_1008878 | 3300005983 | Bacteria | 6977 |
| 152 | Ga0081540_1011330 | 3300005983 | Bacteria | 5965 |
| 153 | Ga0081540_1029456 | 3300005983 | Bacteria | 3058 |
| 154 | Ga0081540_1030924 | 3300005983 | Bacteria | 2956 |
| 155 | Ga0081540_1034951 | 3300005983 | Bacteria | 2701 |
| 156 | Ga0081540_1085163 | 3300005983 | Bacteria | 1408 |
| 157 | Ga0081539_10013000 | 3300005985 | Bacteria | 6322 |
| 158 | Ga0081539_10040848 | 3300005985 | Bacteria | 2719 |
| 159 | Ga0070717_10093748 | 3300006028 | Bacteria | 2539 |
| 160 | Ga0075365_10143290 | 3300006038 | Bacteria | 1659 |
| 161 | Ga0075368_10042163 | 3300006042 | Bacteria | 1795 |
| 162 | Ga0075364_10029741 | 3300006051 | Bacteria | 3504 |
| 163 | Ga0075364_10102111 | 3300006051 | Bacteria | 1909 |
| 164 | Ga0070716_100019032 | 3300006173 | Bacteria | 3585 |
| 165 | Ga0070712_100033602 | 3300006175 | Bacteria | 3472 |
| 166 | Ga0070712_100051371 | 3300006175 | Bacteria | 2871 |
| 167 | Ga0070712_100287613 | 3300006175 | Bacteria | 1326 |
| 168 | Ga0075362_10005709 | 3300006177 | Bacteria | 4579 |
| 169 | Ga0075362_10130010 | 3300006177 | Bacteria | 1197 |
| 170 | Ga0075367_10036921 | 3300006178 | Bacteria | 2836 |
| 171 | Ga0075367_10054959 | 3300006178 | Bacteria | 2361 |
| 172 | Ga0075367_10130750 | 3300006178 | Bacteria | 1552 |
| 173 | Ga0075367_10283531 | 3300006178 | Bacteria | 1041 |
| 174 | Ga0075369_10054050 | 3300006186 | Bacteria | 1743 |
| 175 | Ga0075366_10068321 | 3300006195 | Bacteria | 2114 |
| 176 | Ga0097621_100106316 | 3300006237 | Bacteria | 2367 |
| 177 | Ga0097621_100120180 | 3300006237 | Bacteria | 2227 |
| 178 | Ga0097621_100149237 | 3300006237 | Bacteria | 2004 |
| 179 | Ga0097621_100157586 | 3300006237 | Bacteria | 1949 |
| 180 | Ga0097621_100167217 | 3300006237 | Bacteria | 1894 |
| 181 | Ga0097621_100256511 | 3300006237 | Bacteria | 1533 |
| 182 | Ga0097621_100333600 | 3300006237 | Bacteria | 1346 |
| 183 | Ga0068871_100086625 | 3300006358 | Bacteria | 2603 |
| 184 | Ga0075433_10077757 | 3300006852 | Bacteria | 2923 |
| 185 | Ga0075434_100096130 | 3300006871 | Bacteria | 2968 |
| 186 | Ga0075434_100372320 | 3300006871 | Bacteria | 1449 |
| 187 | Ga0068865_100024037 | 3300006881 | Bacteria | 3994 |
| 188 | Ga0068865_100101753 | 3300006881 | Bacteria | 2104 |
| 189 | Ga0075436_100056029 | 3300006914 | Bacteria | 2723 |
| 190 | Ga0075436_100056902 | 3300006914 | Bacteria | 2700 |
| 191 | Ga0097620_100005475 | 3300006931 | Bacteria | 12919 |
| 192 | Ga0097620_100080152 | 3300006931 | Bacteria | 3305 |
| 193 | Ga0097620_100107769 | 3300006931 | Bacteria | 2847 |
| 194 | Ga0097620_100140978 | 3300006931 | Bacteria | 2484 |
| 195 | Ga0097620_100142823 | 3300006931 | Bacteria | 2467 |
| 196 | Ga0079104_1005889 | 3300006946 | Bacteria | 4773 |
| 197 | Ga0099794_10006387 | 3300007265 | Bacteria | 4770 |
| 198 | Ga0099794_10017410 | 3300007265 | Bacteria | 3202 |
| 199 | Ga0099795_10009349 | 3300007788 | Bacteria | 2840 |
| 200 | Ga0105251_10017050 | 3300009011 | Bacteria | 3902 |
| 201 | Ga0105244_10057244 | 3300009036 | Bacteria | 1970 |
| 202 | Ga0105240_10015165 | 3300009093 | Bacteria | 10489 |
| 203 | Ga0105240_10021813 | 3300009093 | Bacteria | 8511 |
| 204 | Ga0105240_10073219 | 3300009093 | Bacteria | 4231 |
| 205 | Ga0105240_10085390 | 3300009093 | Bacteria | 3867 |
| 206 | Ga0105240_10115099 | 3300009093 | Bacteria | 3247 |
| 207 | Ga0105240_10143986 | 3300009093 | Bacteria | 2846 |
| 208 | Ga0111539_10015461 | 3300009094 | Bacteria | 9492 |
| 209 | Ga0105245_10002531 | 3300009098 | Bacteria | 16481 |
| 210 | Ga0105245_10658529 | 3300009098 | Bacteria | 1078 |
| 211 | Ga0114129_10030277 | 3300009147 | Bacteria | 7662 |
| 212 | Ga0105243_10079656 | 3300009148 | Bacteria | 2670 |
| 213 | Ga0105241_10007289 | 3300009174 | Bacteria | 8140 |
| 214 | Ga0105241_10134881 | 3300009174 | Bacteria | 2003 |
| 215 | Ga0105242_10075590 | 3300009176 | Bacteria | 2805 |
| 216 | Ga0105242_10400148 | 3300009176 | Bacteria | 1281 |
| 217 | Ga0105248_10022592 | 3300009177 | Bacteria | 6981 |
| 218 | Ga0105248_10075435 | 3300009177 | Bacteria | 3790 |
| 219 | Ga0105248_10110482 | 3300009177 | Bacteria | 3099 |
| 220 | Ga0105248_10182612 | 3300009177 | Bacteria | 2364 |
| 221 | Ga0105248_10550685 | 3300009177 | Bacteria | 1301 |
| 222 | Ga0105237_10001496 | 3300009545 | Bacteria | 30781 |
| 223 | Ga0105237_10129824 | 3300009545 | Bacteria | 2515 |
| 224 | Ga0105237_10159728 | 3300009545 | Bacteria | 2252 |
| 225 | Ga0105238_10000004 | 3300009551 | Bacteria | 390514 |
| 226 | Ga0105238_10018073 | 3300009551 | Bacteria | 7166 |
| 227 | Ga0105238_10040254 | 3300009551 | Bacteria | 4737 |
| 228 | Ga0105238_10043302 | 3300009551 | Bacteria | 4555 |
| 229 | Ga0105238_10048052 | 3300009551 | Bacteria | 4301 |
| 230 | Ga0105238_10196497 | 3300009551 | Bacteria | 1993 |
| 231 | Ga0105249_10130729 | 3300009553 | Bacteria | 2397 |
| 232 | Ga0099796_10000523 | 3300010159 | Bacteria | 6545 |
| 233 | Ga0105239_10001696 | 3300010375 | Bacteria | 29043 |
| 234 | Ga0105239_10016969 | 3300010375 | Bacteria | 8048 |
| 235 | Ga0105239_10050901 | 3300010375 | Bacteria | 4542 |
| 236 | Ga0105239_10067412 | 3300010375 | Bacteria | 3931 |
| 237 | Ga0105239_10154408 | 3300010375 | Bacteria | 2563 |
| 238 | Ga0105239_10302738 | 3300010375 | Bacteria | 1800 |
| 239 | Ga0105246_10010484 | 3300011119 | Bacteria | 5736 |
| 240 | Ga0105246_10199058 | 3300011119 | Bacteria | 1556 |
| 241 | Ga0157373_10004002 | 3300013100 | Bacteria | 11114 |
| 242 | Ga0157371_10013766 | 3300013102 | Bacteria | 6130 |
| 243 | Ga0157370_10003286 | 3300013104 | Bacteria | 19065 |
| 244 | Ga0157370_10026919 | 3300013104 | Bacteria | 5672 |
| 245 | Ga0157370_10040442 | 3300013104 | Bacteria | 4502 |
| 246 | Ga0157370_10071749 | 3300013104 | Bacteria | 3267 |
| 247 | Ga0157370_10077971 | 3300013104 | Bacteria | 3120 |
| 248 | Ga0157370_10095726 | 3300013104 | Bacteria | 2785 |
| 249 | Ga0157370_10103291 | 3300013104 | Bacteria | 2668 |
| 250 | Ga0157369_10005086 | 3300013105 | Bacteria | 15396 |
| 251 | Ga0157369_10011901 | 3300013105 | Bacteria | 9882 |
| 252 | Ga0157369_10038842 | 3300013105 | Bacteria | 5204 |
| 253 | Ga0157369_10069540 | 3300013105 | Bacteria | 3782 |
| 254 | Ga0157374_10005291 | 3300013296 | Bacteria | 10834 |
| 255 | Ga0157374_10135525 | 3300013296 | Bacteria | 2387 |
| 256 | Ga0157374_10240722 | 3300013296 | Bacteria | 1779 |
| 257 | Ga0157378_10011318 | 3300013297 | Bacteria | 7807 |
| 258 | Ga0157378_10238743 | 3300013297 | Bacteria | 1735 |
| 259 | Ga0163162_10014205 | 3300013306 | Bacteria | 7780 |
| 260 | Ga0163162_10195876 | 3300013306 | Bacteria | 2149 |
| 261 | Ga0163162_10205560 | 3300013306 | Bacteria | 2098 |
| 262 | Ga0163162_10242545 | 3300013306 | Bacteria | 1933 |
| 263 | Ga0157372_10010113 | 3300013307 | Bacteria | 10021 |
| 264 | Ga0157372_10020473 | 3300013307 | Bacteria | 7138 |
| 265 | Ga0157372_10070760 | 3300013307 | Bacteria | 3926 |
| 266 | Ga0157372_10076305 | 3300013307 | Bacteria | 3784 |
| 267 | Ga0157372_10084797 | 3300013307 | Bacteria | 3592 |
| 268 | Ga0157372_10152536 | 3300013307 | Bacteria | 2667 |
| 269 | Ga0157372_10285537 | 3300013307 | Bacteria | 1919 |
| 270 | Ga0157372_10396830 | 3300013307 | Bacteria | 1608 |
| 271 | Ga0157375_10013496 | 3300013308 | Bacteria | 7275 |
| 272 | Ga0157375_10014079 | 3300013308 | Bacteria | 7131 |
| 273 | Ga0157375_10016136 | 3300013308 | Bacteria | 6700 |
| 274 | Ga0163163_10003162 | 3300014325 | Bacteria | 13951 |
| 275 | Ga0163163_10095390 | 3300014325 | Bacteria | 2994 |
| 276 | Ga0163163_10136234 | 3300014325 | Bacteria | 2496 |
| 277 | Ga0182008_10005975 | 3300014497 | Bacteria | 6859 |
| 278 | Ga0157379_10139777 | 3300014968 | Bacteria | 2183 |
| 279 | Ga0157376_10027977 | 3300014969 | Bacteria | 4476 |
| 280 | Ga0157376_10121790 | 3300014969 | Bacteria | 2313 |
| 281 | Ga0157376_10303274 | 3300014969 | Bacteria | 1513 |
| 282 | Ga0182006_1009528 | 3300015261 | Bacteria | 4349 |
| 283 | Ga0163161_10071302 | 3300017792 | Bacteria | 2542 |
| 284 | Ga0163161_10089968 | 3300017792 | Bacteria | 2271 |
| 285 | Ga0213872_10000803 | 3300021361 | Bacteria | 22846 |
| 286 | Ga0213872_10098001 | 3300021361 | Bacteria | 1308 |
| 287 | Ga0213874_10007376 | 3300021377 | Bacteria | 2637 |
| 288 | Ga0213871_10004773 | 3300021441 | Bacteria | 2742 |
| 289 | Ga0209760_100142 | 3300025207 | Bacteria | 45212 |
| 290 | Ga0209784_100020 | 3300025224 | Bacteria | 412353 |
| 291 | Ga0209784_100025 | 3300025224 | Bacteria | 376681 |
| 292 | Ga0209566_100020 | 3300025225 | Bacteria | 412353 |
| 293 | Ga0209566_100025 | 3300025225 | Bacteria | 376681 |
| 294 | Ga0209674_100035 | 3300025226 | Bacteria | 412353 |
| 295 | Ga0209674_100042 | 3300025226 | Bacteria | 376681 |
| 296 | Ga0209563_100038 | 3300025230 | Bacteria | 412353 |
| 297 | Ga0209563_100046 | 3300025230 | Bacteria | 376681 |
| 298 | Ga0207427_100004 | 3300025231 | Bacteria | 939600 |
| 299 | Ga0207427_100357 | 3300025231 | Bacteria | 28694 |
| 300 | Ga0209437_100025 | 3300025233 | Bacteria | 561333 |
| 301 | Ga0209437_100274 | 3300025233 | Bacteria | 76581 |
| 302 | Ga0209677_100027 | 3300025253 | Bacteria | 376681 |
| 303 | Ga0209677_100117 | 3300025253 | Bacteria | 82118 |
| 304 | Ga0209677_100937 | 3300025253 | Bacteria | 14279 |
| 305 | Ga0209233_1000060 | 3300025261 | Bacteria | 412379 |
| 306 | Ga0209233_1000145 | 3300025261 | Bacteria | 188955 |
| 307 | Ga0209233_1001494 | 3300025261 | Bacteria | 9194 |
| 308 | Ga0209455_1000462 | 3300025272 | Bacteria | 30709 |
| 309 | Ga0209455_1006887 | 3300025272 | Bacteria | 3297 |
| 310 | Ga0209675_1000445 | 3300025291 | Bacteria | 32155 |
| 311 | Ga0209025_1000019 | 3300025294 | Bacteria | 631548 |
| 312 | Ga0209564_1001354 | 3300025295 | Bacteria | 25872 |
| 313 | Ga0209758_1004698 | 3300025297 | Bacteria | 11156 |
| 314 | Ga0209758_1009495 | 3300025297 | Bacteria | 6031 |
| 315 | Ga0209758_1043917 | 3300025297 | Bacteria | 1640 |
| 316 | Ga0207696_1040247 | 3300025711 | Bacteria | 1370 |
| 317 | Ga0207653_10045925 | 3300025885 | Bacteria | 1443 |
| 318 | Ga0207692_10013372 | 3300025898 | Bacteria | 3559 |
| 319 | Ga0207692_10026865 | 3300025898 | Bacteria | 2705 |
| 320 | Ga0207642_10022024 | 3300025899 | Bacteria | 2520 |
| 321 | Ga0207680_10033248 | 3300025903 | Bacteria | 2940 |
| 322 | Ga0207680_10208858 | 3300025903 | Bacteria | 1334 |
| 323 | Ga0207685_10020107 | 3300025905 | Bacteria | 2213 |
| 324 | Ga0207699_10006470 | 3300025906 | Bacteria | 5675 |
| 325 | Ga0207699_10006652 | 3300025906 | Bacteria | 5608 |
| 326 | Ga0207699_10081648 | 3300025906 | Bacteria | 2006 |
| 327 | Ga0207645_10045098 | 3300025907 | Bacteria | 2818 |
| 328 | Ga0207645_10177100 | 3300025907 | Bacteria | 1399 |
| 329 | Ga0207705_10017874 | 3300025909 | Bacteria | 5072 |
| 330 | Ga0207705_10078242 | 3300025909 | Bacteria | 2407 |
| 331 | Ga0207705_10189346 | 3300025909 | Bacteria | 1555 |
| 332 | Ga0207684_10197368 | 3300025910 | Bacteria | 1736 |
| 333 | Ga0207654_10048715 | 3300025911 | Bacteria | 2426 |
| 334 | Ga0207707_10006804 | 3300025912 | Bacteria | 9975 |
| 335 | Ga0207707_10019522 | 3300025912 | Bacteria | 5917 |
| 336 | Ga0207707_10037004 | 3300025912 | Bacteria | 4264 |
| 337 | Ga0207707_10123088 | 3300025912 | Bacteria | 2268 |
| 338 | Ga0207695_10008300 | 3300025913 | Bacteria | 13014 |
| 339 | Ga0207695_10107402 | 3300025913 | Bacteria | 2776 |
| 340 | Ga0207695_10506335 | 3300025913 | Bacteria | 1089 |
| 341 | Ga0207671_10033572 | 3300025914 | Bacteria | 3816 |
| 342 | Ga0207671_10125560 | 3300025914 | Bacteria | 1965 |
| 343 | Ga0207671_10169230 | 3300025914 | Bacteria | 1696 |
| 344 | Ga0207671_10176353 | 3300025914 | Bacteria | 1661 |
| 345 | Ga0207693_10001763 | 3300025915 | Bacteria | 18986 |
| 346 | Ga0207693_10003380 | 3300025915 | Bacteria | 13629 |
| 347 | Ga0207693_10011875 | 3300025915 | Bacteria | 7041 |
| 348 | Ga0207693_10045197 | 3300025915 | Bacteria | 3461 |
| 349 | Ga0207693_10080594 | 3300025915 | Bacteria | 2548 |
| 350 | Ga0207693_10127089 | 3300025915 | Bacteria | 2004 |
| 351 | Ga0207663_10012696 | 3300025916 | Bacteria | 4561 |
| 352 | Ga0207663_10054175 | 3300025916 | Bacteria | 2510 |
| 353 | Ga0207663_10065085 | 3300025916 | Bacteria | 2329 |
| 354 | Ga0207663_10298074 | 3300025916 | Bacteria | 1203 |
| 355 | Ga0207660_10063010 | 3300025917 | Bacteria | 2672 |
| 356 | Ga0207660_10089625 | 3300025917 | Bacteria | 2277 |
| 357 | Ga0207660_10138257 | 3300025917 | Bacteria | 1860 |
| 358 | Ga0207662_10088843 | 3300025918 | Bacteria | 1898 |
| 359 | Ga0207662_10194990 | 3300025918 | Bacteria | 1308 |
| 360 | Ga0207657_10018284 | 3300025919 | Bacteria | 6701 |
| 361 | Ga0207657_10028761 | 3300025919 | Bacteria | 5065 |
| 362 | Ga0207657_10055214 | 3300025919 | Bacteria | 3432 |
| 363 | Ga0207657_10059358 | 3300025919 | Bacteria | 3287 |
| 364 | Ga0207649_10092019 | 3300025920 | Bacteria | 1987 |
| 365 | Ga0207652_10047048 | 3300025921 | Bacteria | 3684 |
| 366 | Ga0207652_10092056 | 3300025921 | Bacteria | 2667 |
| 367 | Ga0207652_10095660 | 3300025921 | Bacteria | 2616 |
| 368 | Ga0207652_10100679 | 3300025921 | Bacteria | 2551 |
| 369 | Ga0207652_10147395 | 3300025921 | Bacteria | 2107 |
| 370 | Ga0207652_10149939 | 3300025921 | Bacteria | 2088 |
| 371 | Ga0207652_10230812 | 3300025921 | Bacteria | 1668 |
| 372 | Ga0207694_10000021 | 3300025924 | Bacteria | 300246 |
| 373 | Ga0207694_10014493 | 3300025924 | Bacteria | 5943 |
| 374 | Ga0207694_10032380 | 3300025924 | Bacteria | 4001 |
| 375 | Ga0207694_10128607 | 3300025924 | Bacteria | 2029 |
| 376 | Ga0207694_10164092 | 3300025924 | Bacteria | 1796 |
| 377 | Ga0207694_10190355 | 3300025924 | Bacteria | 1666 |
| 378 | Ga0207650_10249867 | 3300025925 | Bacteria | 1435 |
| 379 | Ga0207687_10023754 | 3300025927 | Bacteria | 4089 |
| 380 | Ga0207687_10092182 | 3300025927 | Bacteria | 2212 |
| 381 | Ga0207700_10002100 | 3300025928 | Bacteria | 11375 |
| 382 | Ga0207700_10020769 | 3300025928 | Bacteria | 4469 |
| 383 | Ga0207700_10109006 | 3300025928 | Bacteria | 2224 |
| 384 | Ga0207664_10045808 | 3300025929 | Bacteria | 3431 |
| 385 | Ga0207664_10088331 | 3300025929 | Bacteria | 2536 |
| 386 | Ga0207644_10162561 | 3300025931 | Bacteria | 1736 |
| 387 | Ga0207690_10085645 | 3300025932 | Bacteria | 2213 |
| 388 | Ga0207706_10042434 | 3300025933 | Bacteria | 4032 |
| 389 | Ga0207706_10160692 | 3300025933 | Bacteria | 1975 |
| 390 | Ga0207686_10006690 | 3300025934 | Bacteria | 6213 |
| 391 | Ga0207686_10066018 | 3300025934 | Bacteria | 2309 |
| 392 | Ga0207670_10055542 | 3300025936 | Bacteria | 2677 |
| 393 | Ga0207670_10157481 | 3300025936 | Bacteria | 1692 |
| 394 | Ga0207669_10026914 | 3300025937 | Bacteria | 3137 |
| 395 | Ga0207669_10049350 | 3300025937 | Bacteria | 2508 |
| 396 | Ga0207704_10074988 | 3300025938 | Bacteria | 2161 |
| 397 | Ga0207665_10004373 | 3300025939 | Bacteria | 9383 |
| 398 | Ga0207665_10046616 | 3300025939 | Bacteria | 2904 |
| 399 | Ga0207691_10056876 | 3300025940 | Bacteria | 3562 |
| 400 | Ga0207711_10052845 | 3300025941 | Bacteria | 3483 |
| 401 | Ga0207711_10064437 | 3300025941 | Bacteria | 3165 |
| 402 | Ga0207711_10085575 | 3300025941 | Bacteria | 2762 |
| 403 | Ga0207711_10238315 | 3300025941 | Bacteria | 1668 |
| 404 | Ga0207689_10080792 | 3300025942 | Bacteria | 2672 |
| 405 | Ga0207689_10175812 | 3300025942 | Bacteria | 1765 |
| 406 | Ga0207661_10010608 | 3300025944 | Bacteria | 6638 |
| 407 | Ga0207679_10055726 | 3300025945 | Bacteria | 2915 |
| 408 | Ga0207667_10000019 | 3300025949 | Bacteria | 386233 |
| 409 | Ga0207667_10032188 | 3300025949 | Bacteria | 5654 |
| 410 | Ga0207667_10066976 | 3300025949 | Bacteria | 3741 |
| 411 | Ga0207667_10098018 | 3300025949 | Bacteria | 3025 |
| 412 | Ga0207667_10112866 | 3300025949 | Bacteria | 2802 |
| 413 | Ga0207667_10290962 | 3300025949 | Bacteria | 1669 |
| 414 | Ga0207651_10021775 | 3300025960 | Bacteria | 3904 |
| 415 | Ga0207651_10306283 | 3300025960 | Bacteria | 1323 |
| 416 | Ga0207712_10335191 | 3300025961 | Bacteria | 1253 |
| 417 | Ga0207712_10375655 | 3300025961 | Bacteria | 1188 |
| 418 | Ga0207668_10078489 | 3300025972 | Bacteria | 2384 |
| 419 | Ga0207668_10121912 | 3300025972 | Bacteria | 1975 |
| 420 | Ga0207668_10122768 | 3300025972 | Bacteria | 1969 |
| 421 | Ga0207640_10088917 | 3300025981 | Bacteria | 2134 |
| 422 | Ga0207640_10168625 | 3300025981 | Bacteria | 1629 |
| 423 | Ga0207677_10078568 | 3300026023 | Bacteria | 2357 |
| 424 | Ga0207703_10037438 | 3300026035 | Bacteria | 3864 |
| 425 | Ga0207703_10111792 | 3300026035 | Bacteria | 2333 |
| 426 | Ga0207639_10066141 | 3300026041 | Bacteria | 2808 |
| 427 | Ga0207639_10254755 | 3300026041 | Bacteria | 1532 |
| 428 | Ga0207678_10024312 | 3300026067 | Bacteria | 5291 |
| 429 | Ga0207678_10061718 | 3300026067 | Bacteria | 3224 |
| 430 | Ga0207678_10073139 | 3300026067 | Bacteria | 2938 |
| 431 | Ga0207678_10182169 | 3300026067 | Bacteria | 1794 |
| 432 | Ga0207708_10062247 | 3300026075 | Bacteria | 2850 |
| 433 | Ga0207708_10074055 | 3300026075 | Bacteria | 2610 |
| 434 | Ga0207702_10035585 | 3300026078 | Bacteria | 4164 |
| 435 | Ga0207702_10336994 | 3300026078 | Bacteria | 1440 |
| 436 | Ga0207641_10149459 | 3300026088 | Bacteria | 2115 |
| 437 | Ga0207648_10031432 | 3300026089 | Bacteria | 4695 |
| 438 | Ga0207648_10116198 | 3300026089 | Bacteria | 2351 |
| 439 | Ga0207648_10287232 | 3300026089 | Bacteria | 1472 |
| 440 | Ga0207676_10072689 | 3300026095 | Bacteria | 2765 |
| 441 | Ga0207676_10213237 | 3300026095 | Bacteria | 1714 |
| 442 | Ga0207674_10138731 | 3300026116 | Bacteria | 2392 |
| 443 | Ga0207674_10186388 | 3300026116 | Bacteria | 2025 |
| 444 | Ga0207674_10283413 | 3300026116 | Bacteria | 1605 |
| 445 | Ga0207674_10295157 | 3300026116 | Bacteria | 1570 |
| 446 | Ga0207675_100053059 | 3300026118 | Bacteria | 3784 |
| 447 | Ga0207675_100306520 | 3300026118 | Bacteria | 1548 |
| 448 | Ga0207675_100549707 | 3300026118 | Bacteria | 1154 |
| 449 | Ga0207675_100586454 | 3300026118 | Bacteria | 1117 |
| 450 | Ga0207683_10013945 | 3300026121 | Bacteria | 6853 |
| 451 | Ga0207683_10014942 | 3300026121 | Bacteria | 6609 |
| 452 | Ga0207683_10064283 | 3300026121 | Bacteria | 3233 |
| 453 | Ga0207683_10434419 | 3300026121 | Bacteria | 1210 |
| 454 | Ga0209281_1016135 | 3300027111 | Bacteria | 1540 |
| 455 | Ga0209179_1023956 | 3300027512 | Bacteria | 1208 |
| 456 | Ga0209588_1009342 | 3300027671 | Bacteria | 2930 |
| 457 | Ga0209813_10039646 | 3300027866 | Bacteria | 1428 |
| 458 | Ga0268266_10009413 | 3300028379 | Bacteria | 8605 |
| 459 | Ga0268266_10032359 | 3300028379 | Bacteria | 4444 |
| 460 | Ga0268266_10036611 | 3300028379 | Bacteria | 4178 |
| 461 | Ga0268266_10053239 | 3300028379 | Bacteria | 3476 |
| 462 | Ga0268266_10081416 | 3300028379 | Bacteria | 2823 |
| 463 | Ga0268266_10380684 | 3300028379 | Bacteria | 1331 |
| 464 | Ga0268265_10014881 | 3300028380 | Bacteria | 5310 |
| 465 | Ga0268265_10124226 | 3300028380 | Bacteria | 2132 |
| 466 | Ga0268265_10257104 | 3300028380 | Bacteria | 1550 |
| 467 | Ga0268264_10023027 | 3300028381 | Bacteria | 5083 |
| 468 | Ga0268264_10063077 | 3300028381 | Bacteria | 3114 |
| 469 | Ga0265326_10002066 | 3300028558 | Bacteria | 6837 |
| 470 | Ga0265319_1001508 | 3300028563 | Bacteria | 13832 |
| 471 | Ga0265334_10000614 | 3300028573 | Bacteria | 17940 |
| 472 | Ga0265318_10002674 | 3300028577 | Bacteria | 9373 |
| 473 | Ga0265323_10003948 | 3300028653 | Bacteria | 6445 |
| 474 | Ga0265336_10000259 | 3300028666 | Bacteria | 37606 |
| 475 | Ga0265338_10000013 | 3300028800 | Bacteria | 379065 |
| 476 | Ga0265324_10000235 | 3300029957 | Bacteria | 41792 |
| 477 | Ga0265330_10010495 | 3300031235 | Bacteria | 4363 |
| 478 | Ga0265330_10083704 | 3300031235 | Bacteria | 1373 |
| 479 | Ga0265328_10067757 | 3300031239 | Bacteria | 1311 |
| 480 | Ga0265325_10012884 | 3300031241 | Bacteria | 4770 |
| 481 | Ga0265340_10015613 | 3300031247 | Bacteria | 3944 |
| 482 | Ga0265339_10022247 | 3300031249 | Bacteria | 3676 |
| 483 | Ga0265339_10040494 | 3300031249 | Bacteria | 2589 |
| 484 | Ga0265331_10037267 | 3300031250 | Bacteria | 2382 |
| 485 | Ga0265316_10239343 | 3300031344 | Bacteria | 1335 |
| 486 | Ga0307408_100070810 | 3300031548 | Bacteria | 2576 |
| 487 | Ga0307508_10000058 | 3300031616 | Bacteria | 125293 |
| 488 | Ga0307508_10006654 | 3300031616 | Bacteria | 10852 |
| 489 | Ga0265342_10075616 | 3300031712 | Bacteria | 1953 |
| 490 | Ga0307516_10038712 | 3300031730 | Bacteria | 4756 |
| 491 | Ga0307405_10147464 | 3300031731 | Bacteria | 1650 |
| 492 | Ga0307406_10165628 | 3300031901 | Bacteria | 1594 |
| 493 | Ga0307416_100163465 | 3300032002 | Bacteria | 2061 |
| 494 | Ga0307411_10090159 | 3300032005 | Bacteria | 2138 |
| 495 | Ga0307415_100024425 | 3300032126 | Bacteria | 3773 |
| 496 | Ga0307415_100083825 | 3300032126 | Bacteria | 2285 |
| 497 | Ga0307507_10103121 | 3300033179 | Bacteria | 2376 |
| 498 | Ga0307510_10010251 | 3300033180 | Bacteria | 11142 |
| 499 | Ga0315911_1000014 | 3300033442 | Bacteria | 207605 |
| 500 | Ga0373938_0010138 | 3300034957 | Bacteria | 1724 |
| 501 | Ga0373928_0008035 | 3300035084 | Bacteria | 2043 |
| 502 | Ga0373934_0051067 | 3300035086 | Bacteria | 1639 |
| 503 | Ga0373951_0019493 | 3300035091 | Bacteria | 1547 |
| 504 | Ga0373923_0009270 | 3300035111 | Bacteria | 3547 |
| 505 | Ga0373923_0118195 | 3300035111 | Bacteria | 1182 |
| 506 | Ga0373943_0007309 | 3300035170 | Bacteria | 4958 |
| 507 | Ga0373943_0018390 | 3300035170 | Bacteria | 3210 |
| 508 | Ga0373946_0021866 | 3300035171 | Bacteria | 2484 |
| 509 | Ga0373946_0088103 | 3300035171 | Bacteria | 1371 |
| 510 | Ga0373955_0164291 | 3300035172 | Bacteria | 1312 |
| 511 | Ga0373962_0017066 | 3300035242 | Bacteria | 1879 |
| 512 | Ga0373924_0006573 | 3300035410 | Bacteria | 4168 |
| 513 | Ga0373931_0012384 | 3300035691 | Bacteria | 4132 |
| 514 | Ga0373931_0032579 | 3300035691 | Bacteria | 2697 |
| 515 | Ga0373931_0053757 | 3300035691 | Bacteria | 2150 |
| 516 | Ga0373935_0018884 | 3300035692 | Bacteria | 4202 |
| 517 | Ga0373927_0016422 | 3300035695 | Bacteria | 4882 |
| 518 | Ga0373927_0072473 | 3300035695 | Bacteria | 2229 |
| 519 | Ga0373927_0094837 | 3300035695 | Bacteria | 1939 |
| 520 | Ga0373927_0098182 | 3300035695 | Bacteria | 1904 |
| 521 | Ga0373927_0136103 | 3300035695 | Bacteria | 1605 |
| 522 | Ga0373933_0000052 | 3300035724 | Bacteria | 70592 |
| 523 | Ga0373933_0003499 | 3300035724 | Bacteria | 8744 |
| 524 | Ga0373933_0011933 | 3300035724 | Bacteria | 4796 |
| 525 | Ga0373933_0139370 | 3300035724 | Bacteria | 1530 |
| 526 | Ga0373947_0011386 | 3300035725 | Bacteria | 5106 |
| 527 | Ga0373947_0014214 | 3300035725 | Bacteria | 4565 |
| 528 | Ga0373947_0026317 | 3300035725 | Bacteria | 3399 |
| 529 | Ga0373937_0060000 | 3300036401 | Bacteria | 3495 |
| 530 | Ga0373937_0215787 | 3300036401 | Bacteria | 1806 |
| 531 | Ga0373925_0105607 | 3300037068 | Bacteria | 2170 |
| 532 | Ga0395899_0097674 | 3300037312 | Bacteria | 2123 |
| 533 | Ga0395900_0019659 | 3300037418 | Bacteria | 6886 |
| 534 | Ga0395900_0060117 | 3300037418 | Bacteria | 3911 |
| 535 | Ga0395900_0080473 | 3300037418 | Bacteria | 3348 |
| 536 | Ga0395898_0067674 | 3300037466 | Bacteria | 3457 |
| 537 | Ga0395898_0085136 | 3300037466 | Bacteria | 3047 |
| 538 | Ga0436364_0391517 | 3300037853 | Bacteria | 4832 |
| 539 | Ga0436364_1366209 | 3300037853 | Bacteria | 29318 |
| 540 | Ga0436364_1560306 | 3300037853 | Bacteria | 8813 |
| 541 | Ga0395901_0052080 | 3300038443 | Bacteria | 4255 |
| 542 | Ga0395901_0090577 | 3300038443 | Bacteria | 3201 |
| 543 | Ga0400483_159836 | 3300039062 | Bacteria | 2290 |
| 544 | Ga0436365_0721818 | 3300039437 | Bacteria | 1569 |
| 545 | Ga0436365_1694702 | 3300039437 | Bacteria | 1416 |
| 546 | Ga0436360_0119626 | 3300039438 | Bacteria | 5778 |
| 547 | Ga0436360_0545356 | 3300039438 | Bacteria | 2934 |
| 548 | Ga0436360_0570461 | 3300039438 | Bacteria | 5753 |
| 549 | Ga0436361_0132102 | 3300039447 | Bacteria | 51578 |
| 550 | Ga0436361_0168473 | 3300039447 | Bacteria | 40970 |
| 551 | Ga0436361_1195803 | 3300039447 | Bacteria | 5068 |
| 552 | Ga0436363_0003719 | 3300039450 | Bacteria | 3726 |
| 553 | Ga0436363_0027754 | 3300039450 | Bacteria | 2575 |
| 554 | Ga0436362_1299921 | 3300039453 | Bacteria | 4665 |
| 555 | Ga0466963_0105236 | 3300044694 | Bacteria | 1934 |
| 556 | Ga0466959_0128269 | 3300045049 | Bacteria | 1799 |
| 557 | Ga0466967_0260289 | 3300045976 | Bacteria | 1660 |
| 558 | Ga0495603_0000237 | 3300046455 | Bacteria | 28782 |
| 559 | Ga0495603_0005734 | 3300046455 | Bacteria | 7428 |
| 560 | Ga0495603_0036352 | 3300046455 | Bacteria | 2957 |
| 561 | Ga0495629_0001744 | 3300046459 | Bacteria | 17057 |
| 562 | Ga0495629_0004238 | 3300046459 | Bacteria | 10750 |
| 563 | Ga0495629_0049669 | 3300046459 | Bacteria | 2940 |
| 564 | Ga0495638_0030599 | 3300046460 | Bacteria | 3463 |
| 565 | Ga0495638_0201842 | 3300046460 | Bacteria | 1122 |
| 566 | Ga0495651_0000510 | 3300046462 | Bacteria | 30170 |
| 567 | Ga0495651_0064316 | 3300046462 | Bacteria | 2803 |
| 568 | Ga0495580_0007153 | 3300046472 | Bacteria | 8987 |
| 569 | Ga0495580_0182096 | 3300046472 | Bacteria | 1451 |
| 570 | Ga0495582_0000209 | 3300046473 | Bacteria | 32511 |
| 571 | Ga0495582_0052845 | 3300046473 | Bacteria | 2240 |
| 572 | Ga0495582_0057414 | 3300046473 | Bacteria | 2146 |
| 573 | Ga0495605_0056844 | 3300046474 | Bacteria | 1886 |
| 574 | Ga0495639_0084040 | 3300046475 | Bacteria | 1486 |
| 575 | Ga0495662_0105833 | 3300046476 | Bacteria | 1377 |
| 576 | Ga0495664_0096796 | 3300046477 | Bacteria | 1776 |
| 577 | Ga0495584_0047072 | 3300046491 | Bacteria | 2175 |
| 578 | Ga0495584_0137465 | 3300046491 | Bacteria | 1240 |
| 579 | Ga0495594_0007323 | 3300046499 | Bacteria | 5676 |
| 580 | Ga0495607_0044616 | 3300046501 | Bacteria | 2613 |
| 581 | Ga0495606_0024955 | 3300046507 | Bacteria | 4293 |
| 582 | Ga0495608_0011463 | 3300046511 | Bacteria | 6170 |
| 583 | Ga0495608_0057655 | 3300046511 | Bacteria | 2562 |
| 584 | Ga0495618_0097181 | 3300046514 | Bacteria | 1884 |
| 585 | Ga0495618_0102098 | 3300046514 | Bacteria | 1836 |
| 586 | Ga0495620_0071585 | 3300046515 | Bacteria | 1417 |
| 587 | Ga0495628_0000255 | 3300046516 | Bacteria | 47175 |
| 588 | Ga0495628_0007950 | 3300046516 | Bacteria | 9136 |
| 589 | Ga0495628_0086388 | 3300046516 | Bacteria | 2432 |
| 590 | Ga0495630_0052798 | 3300046517 | Bacteria | 3043 |
| 591 | Ga0495648_0008054 | 3300046524 | Bacteria | 8338 |
| 592 | Ga0495642_0060991 | 3300046528 | Bacteria | 1565 |
| 593 | Ga0495652_0005967 | 3300046529 | Bacteria | 11391 |
| 594 | Ga0495652_0033776 | 3300046529 | Bacteria | 4462 |
| 595 | Ga0495652_0046208 | 3300046529 | Bacteria | 3740 |
| 596 | Ga0495652_0123910 | 3300046529 | Bacteria | 2056 |
| 597 | Ga0495652_0186410 | 3300046529 | Bacteria | 1587 |
| 598 | Ga0495665_0020920 | 3300046531 | Bacteria | 3515 |
| 599 | Ga0495640_0081469 | 3300046533 | Bacteria | 2151 |
| 600 | Ga0495598_0033410 | 3300046537 | Bacteria | 1460 |
| 601 | Ga0495645_0039978 | 3300046543 | Bacteria | 3421 |
| 602 | Ga0495645_0137663 | 3300046543 | Bacteria | 1706 |
| 603 | Ga0495622_0054346 | 3300046557 | Bacteria | 1858 |
| 604 | Ga0495622_0065566 | 3300046557 | Bacteria | 1679 |
| 605 | Ga0495667_0019470 | 3300046559 | Bacteria | 4579 |
| 606 | Ga0495656_0146496 | 3300046615 | Bacteria | 1137 |
| 607 | Ga0495634_0024924 | 3300046642 | Bacteria | 4192 |
| 608 | Ga0495634_0048802 | 3300046642 | Bacteria | 2848 |
| 609 | Ga0495625_0112099 | 3300046660 | Bacteria | 1863 |
| 610 | Ga0495635_0020554 | 3300046663 | Bacteria | 4599 |
| 611 | Ga0495635_0061279 | 3300046663 | Bacteria | 2584 |
| 612 | Ga0495661_0004458 | 3300046665 | Bacteria | 10101 |
| 613 | Ga0495588_0017035 | 3300046674 | Bacteria | 3521 |
| 614 | Ga0495599_0001959 | 3300046678 | Bacteria | 11923 |
| 615 | Ga0495599_0114372 | 3300046678 | Bacteria | 1679 |
| 616 | Ga0495623_0005774 | 3300046679 | Bacteria | 8075 |
| 617 | Ga0495623_0035769 | 3300046679 | Bacteria | 3183 |
| 618 | Ga0495623_0039704 | 3300046679 | Bacteria | 3006 |
| 619 | Ga0495646_0000288 | 3300046680 | Bacteria | 25753 |
| 620 | Ga0495646_0011017 | 3300046680 | Bacteria | 5744 |
| 621 | Ga0495646_0029092 | 3300046680 | Bacteria | 3455 |
| 622 | Ga0495646_0059835 | 3300046680 | Bacteria | 2274 |
| 623 | Ga0495646_0133199 | 3300046680 | Bacteria | 1397 |
| 624 | Ga0495647_0004901 | 3300046681 | Bacteria | 4378 |
| 625 | Ga0495647_0008249 | 3300046681 | Bacteria | 3500 |
| 626 | Ga0495658_0002765 | 3300046683 | Bacteria | 8814 |
| 627 | Ga0495658_0129133 | 3300046683 | Bacteria | 1536 |
| 628 | Ga0495613_0006926 | 3300046689 | Bacteria | 8455 |
| 629 | Ga0495613_0015743 | 3300046689 | Bacteria | 5629 |
| 630 | Ga0495624_0119753 | 3300046690 | Bacteria | 1617 |
| 631 | Ga0495670_0022766 | 3300046691 | Bacteria | 3094 |
| 632 | Ga0495670_0079816 | 3300046691 | Bacteria | 1666 |
| 633 | Ga0495671_0107774 | 3300046692 | Bacteria | 1360 |
| 634 | Ga0495600_0001174 | 3300046809 | Bacteria | 14297 |
| 635 | Ga0495600_0111444 | 3300046809 | Bacteria | 1782 |
| 636 | Ga0495581_0146038 | 3300047315 | Bacteria | 1380 |
| 637 | Ga0495604_0022940 | 3300047317 | Bacteria | 4980 |
| 638 | Ga0495604_0034583 | 3300047317 | Bacteria | 3997 |
| 639 | Ga0495674_0020318 | 3300047319 | Bacteria | 6151 |
| 640 | Ga0495674_0233961 | 3300047319 | Bacteria | 1516 |
| 641 | Ga0495672_0022077 | 3300047320 | Bacteria | 4143 |
| 642 | Ga0495672_0068207 | 3300047320 | Bacteria | 2022 |
| 643 | Ga0495680_0017053 | 3300047322 | Bacteria | 6215 |
| 644 | Ga0495680_0116518 | 3300047322 | Bacteria | 1975 |
| 645 | Ga0495677_0066157 | 3300047445 | Bacteria | 1344 |
| 646 | Ga0495677_0069260 | 3300047445 | Bacteria | 1314 |
| 647 | Ga0495673_0026512 | 3300047469 | Bacteria | 2770 |
| 648 | Ga0495673_0067899 | 3300047469 | Bacteria | 1508 |
| 649 | Ga0495684_0071851 | 3300047471 | Bacteria | 2629 |
| 650 | Ga0495686_0063377 | 3300047472 | Bacteria | 2291 |
| 651 | Ga0495593_0026578 | 3300047673 | Bacteria | 3194 |
| 652 | Ga0495602_0099099 | 3300048088 | Bacteria | 2396 |
| 653 | Ga0495615_0027781 | 3300048090 | Bacteria | 1331 |
| 654 | Ga0496100_0069422 | 3300048903 | Bacteria | 2346 |
| 655 | Ga0496100_0214223 | 3300048903 | Bacteria | 1410 |
| 656 | Ga0496101_0003983 | 3300048904 | Bacteria | 9239 |
| 657 | Ga0496101_0004598 | 3300048904 | Bacteria | 8715 |
| 658 | Ga0496101_0170441 | 3300048904 | Bacteria | 1673 |
| 659 | Ga0496102_0036873 | 3300048905 | Bacteria | 4407 |
| 660 | Ga0496102_0047035 | 3300048905 | Bacteria | 3919 |
| 661 | Ga0496102_0106646 | 3300048905 | Bacteria | 2608 |
| 662 | Ga0496102_0148461 | 3300048905 | Bacteria | 2201 |
| 663 | Ga0496102_0244749 | 3300048905 | Bacteria | 1691 |
| 664 | Ga0496103_0027984 | 3300048906 | Bacteria | 3420 |
| 665 | Ga0496104_0201452 | 3300048907 | Bacteria | 1902 |
| 666 | Ga0496104_0320263 | 3300048907 | Bacteria | 1463 |
| 667 | Ga0496105_0019393 | 3300048908 | Bacteria | 5486 |
| 668 | Ga0496105_0083448 | 3300048908 | Bacteria | 2639 |
| 669 | Ga0496105_0245282 | 3300048908 | Bacteria | 1452 |
| 670 | Ga0496106_0015623 | 3300048909 | Bacteria | 5615 |
| 671 | Ga0496106_0064606 | 3300048909 | Bacteria | 2784 |
| 672 | Ga0496106_0092555 | 3300048909 | Bacteria | 2335 |
| 673 | Ga0496106_0210800 | 3300048909 | Bacteria | 1548 |
| 674 | Ga0496107_0010397 | 3300048910 | Bacteria | 6464 |
| 675 | Ga0496107_0043807 | 3300048910 | Bacteria | 3216 |
| 676 | Ga0496108_0013147 | 3300048911 | Bacteria | 6747 |
| 677 | Ga0496108_0076929 | 3300048911 | Bacteria | 2821 |
| 678 | Ga0496108_0084762 | 3300048911 | Bacteria | 2689 |
| 679 | Ga0496108_0098795 | 3300048911 | Bacteria | 2487 |
| 680 | Ga0496108_0126122 | 3300048911 | Bacteria | 2198 |
| 681 | Ga0496108_0198153 | 3300048911 | Bacteria | 1742 |
| 682 | Ga0496109_0003060 | 3300048912 | Bacteria | 13938 |
| 683 | Ga0496109_0009741 | 3300048912 | Bacteria | 8201 |
| 684 | Ga0496109_0022826 | 3300048912 | Bacteria | 5545 |
| 685 | Ga0496109_0025677 | 3300048912 | Bacteria | 5251 |
| 686 | Ga0496109_0072594 | 3300048912 | Bacteria | 3162 |
| 687 | Ga0496109_0126181 | 3300048912 | Bacteria | 2386 |
| 688 | Ga0496109_0190268 | 3300048912 | Bacteria | 1928 |
| 689 | Ga0496110_0000835 | 3300048913 | Bacteria | 21651 |
| 690 | Ga0496110_0036867 | 3300048913 | Bacteria | 4248 |
| 691 | Ga0496110_0102583 | 3300048913 | Bacteria | 2565 |
| 692 | Ga0496111_0015624 | 3300048914 | Bacteria | 5216 |
| 693 | Ga0496111_0021680 | 3300048914 | Bacteria | 4489 |
| 694 | Ga0496111_0026839 | 3300048914 | Bacteria | 4069 |
| 695 | Ga0496111_0088213 | 3300048914 | Bacteria | 2271 |
| 696 | Ga0496112_0063726 | 3300048915 | Bacteria | 3636 |
| 697 | Ga0496112_0069352 | 3300048915 | Bacteria | 3482 |
| 698 | Ga0496112_0177658 | 3300048915 | Bacteria | 2093 |
| 699 | Ga0496112_0279380 | 3300048915 | Bacteria | 1617 |
| 700 | Ga0496113_0026582 | 3300048916 | Bacteria | 4139 |
| 701 | Ga0496113_0030668 | 3300048916 | Bacteria | 3894 |
| 702 | Ga0496113_0045484 | 3300048916 | Bacteria | 3256 |
| 703 | Ga0496113_0323992 | 3300048916 | Bacteria | 1235 |
| 704 | Ga0496114_0003347 | 3300048917 | Bacteria | 12322 |
| 705 | Ga0496114_0008640 | 3300048917 | Bacteria | 8073 |
| 706 | Ga0496114_0050543 | 3300048917 | Bacteria | 3460 |
| 707 | Ga0496115_0003657 | 3300048918 | Bacteria | 11062 |
| 708 | Ga0496115_0036962 | 3300048918 | Bacteria | 3868 |
| 709 | Ga0496115_0091940 | 3300048918 | Bacteria | 2480 |
| 710 | Ga0496116_0001928 | 3300048919 | Bacteria | 22348 |
| 711 | Ga0496117_0027483 | 3300048920 | Bacteria | 4433 |
| 712 | Ga0496118_0167943 | 3300048921 | Bacteria | 1345 |
| 713 | Ga0496118_0192205 | 3300048921 | Bacteria | 1219 |
| 714 | Ga0496119_0078905 | 3300048922 | Bacteria | 1903 |
| 715 | Ga0496121_0007527 | 3300048924 | Bacteria | 13133 |
| 716 | Ga0496121_0019033 | 3300048924 | Bacteria | 6888 |
| 717 | Ga0496121_0023274 | 3300048924 | Bacteria | 5972 |
| 718 | Ga0496121_0047981 | 3300048924 | Bacteria | 3638 |
| 719 | Ga0496121_0057573 | 3300048924 | Bacteria | 3220 |
| 720 | Ga0496121_0063518 | 3300048924 | Bacteria | 3016 |
| 721 | Ga0496121_0088385 | 3300048924 | Bacteria | 2429 |
| 722 | Ga0496122_0006874 | 3300048925 | Bacteria | 12878 |
| 723 | Ga0496122_0022165 | 3300048925 | Bacteria | 5656 |
| 724 | Ga0496123_0011180 | 3300048926 | Bacteria | 7813 |
| 725 | Ga0496123_0022126 | 3300048926 | Bacteria | 4911 |
| 726 | Ga0496124_0000047 | 3300048927 | Bacteria | 285554 |
| 727 | Ga0496124_0047724 | 3300048927 | Bacteria | 3662 |
| 728 | Ga0496124_0164777 | 3300048927 | Bacteria | 1724 |
| 729 | Ga0496124_0186356 | 3300048927 | Bacteria | 1592 |
| 730 | Ga0496125_0005281 | 3300048928 | Bacteria | 14459 |
| 731 | Ga0496125_0008194 | 3300048928 | Bacteria | 10996 |
| 732 | Ga0496125_0017373 | 3300048928 | Bacteria | 6862 |
| 733 | Ga0496125_0051331 | 3300048928 | Bacteria | 3402 |
| 734 | Ga0496126_0003871 | 3300048929 | Bacteria | 18451 |
| 735 | Ga0496126_0018816 | 3300048929 | Bacteria | 6828 |
| 736 | Ga0496126_0025649 | 3300048929 | Bacteria | 5666 |
| 737 | Ga0496126_0026313 | 3300048929 | Bacteria | 5580 |
| 738 | Ga0496126_0040240 | 3300048929 | Bacteria | 4334 |
| 739 | Ga0496126_0090975 | 3300048929 | Bacteria | 2684 |
| 740 | Ga0501032_0080115 | 3300049569 | Bacteria | 2173 |
| 741 | Ga0501034_0001506 | 3300049571 | Bacteria | 30582 |
| 742 | Ga0501034_0035126 | 3300049571 | Bacteria | 5083 |
| 743 | Ga0501036_0002386 | 3300049572 | Bacteria | 14684 |
| 744 | Ga0501036_0024528 | 3300049572 | Bacteria | 5085 |
| 745 | Ga0501036_0097751 | 3300049572 | Bacteria | 2481 |
| 746 | Ga0501037_0003431 | 3300049573 | Bacteria | 11519 |
| 747 | Ga0501037_0017074 | 3300049573 | Bacteria | 5340 |
| 748 | Ga0501037_0061534 | 3300049573 | Bacteria | 2737 |
| 749 | Ga0501038_0077920 | 3300049574 | Bacteria | 2797 |
| 750 | Ga0501039_0047615 | 3300049575 | Bacteria | 3314 |
| 751 | Ga0501042_0083502 | 3300049578 | Bacteria | 2290 |
| 752 | Ga0501043_0030025 | 3300049579 | Bacteria | 4270 |
| 753 | Ga0501046_0024446 | 3300049580 | Bacteria | 4956 |
| 754 | Ga0501047_0000204 | 3300049581 | Bacteria | 71976 |
| 755 | Ga0501047_0003418 | 3300049581 | Bacteria | 15023 |
| 756 | Ga0501047_0007027 | 3300049581 | Bacteria | 10567 |
| 757 | Ga0501047_0156631 | 3300049581 | Bacteria | 2151 |
| 758 | Ga0501048_0000065 | 3300049582 | Bacteria | 53623 |
| 759 | Ga0501068_0185696 | 3300049584 | Bacteria | 1315 |
| 760 | Ga0501069_0011153 | 3300049585 | Bacteria | 4768 |
| 761 | Ga0501069_0027383 | 3300049585 | Bacteria | 3123 |
| 762 | Ga0501070_0011021 | 3300049586 | Bacteria | 7631 |
| 763 | Ga0501070_0034125 | 3300049586 | Bacteria | 4256 |
| 764 | Ga0501070_0076206 | 3300049586 | Bacteria | 2776 |
| 765 | Ga0501071_0072631 | 3300049587 | Bacteria | 2509 |
| 766 | Ga0501073_0006383 | 3300049589 | Bacteria | 8775 |
| 767 | Ga0501073_0043056 | 3300049589 | Bacteria | 3184 |
| 768 | Ga0501073_0074685 | 3300049589 | Bacteria | 2360 |
| 769 | Ga0501074_0000614 | 3300049590 | Bacteria | 22196 |
| 770 | Ga0501074_0029234 | 3300049590 | Bacteria | 3992 |
| 771 | Ga0501074_0139771 | 3300049590 | Bacteria | 1732 |
| 772 | Ga0501076_0156934 | 3300049592 | Bacteria | 1853 |
| 773 | Ga0501079_0034266 | 3300049741 | Bacteria | 3906 |
| 774 | Ga0501080_0000669 | 3300049742 | Bacteria | 27250 |
| 775 | Ga0501080_0000815 | 3300049742 | Bacteria | 25419 |
| 776 | Ga0501080_0070551 | 3300049742 | Bacteria | 3249 |
| 777 | Ga0501080_0096238 | 3300049742 | Bacteria | 2748 |
| 778 | Ga0501081_0105004 | 3300049743 | Bacteria | 2001 |
| 779 | Ga0501083_0003287 | 3300049744 | Bacteria | 11290 |
| 780 | Ga0501083_0018537 | 3300049744 | Bacteria | 4850 |
| 781 | Ga0501035_0003474 | 3300049822 | Bacteria | 15082 |
| 782 | Ga0501035_0031930 | 3300049822 | Bacteria | 4795 |
| 783 | Ga0501035_0034707 | 3300049822 | Bacteria | 4581 |
| 784 | Ga0501035_0151631 | 3300049822 | Bacteria | 2011 |
| 785 | Ga0501044_0008478 | 3300049823 | Bacteria | 11266 |
| 786 | Ga0501044_0050736 | 3300049823 | Bacteria | 4279 |
| 787 | Ga0501044_0089803 | 3300049823 | Bacteria | 3100 |
| 788 | Ga0501044_0168284 | 3300049823 | Bacteria | 2164 |
| 789 | Ga0501044_0178797 | 3300049823 | Bacteria | 2089 |
| 790 | nmdc:mga03683_5526_c1 | 3300050489 | Bacteria | 4273 |
| 791 | nmdc:mga03n38_58193_c1 | 3300050490 | Bacteria | 1750 |
| 792 | nmdc:mga03n38_73049_c1 | 3300050490 | Bacteria | 1592 |
| 793 | nmdc:mga00v17_3981_c1 | 3300050491 | Bacteria | 7624 |
| 794 | nmdc:mga0yw44_35851_c1 | 3300050492 | Bacteria | 2919 |
| 795 | nmdc:mga0k408_63593_c1 | 3300050493 | Bacteria | 2147 |
| 796 | nmdc:mga06z11_25615_c1 | 3300050494 | Bacteria | 2798 |
| 797 | nmdc:mga04h51_62798_c1 | 3300050495 | Bacteria | 1277 |
| 798 | nmdc:mga05p37_155674_c1 | 3300050507 | Bacteria | 2793 |
| 799 | nmdc:mga05p37_571424_c1 | 3300050507 | Bacteria | 1282 |
| 800 | nmdc:mga08y16_9239_c1 | 3300050511 | Bacteria | 10344 |
| 801 | nmdc:mga0n895_309611_c1 | 3300050512 | Bacteria | 1601 |
| 802 | nmdc:mga0rr50_54899_c1 | 3300050513 | Bacteria | 2970 |
| 803 | nmdc:mga08x19_46628_c1 | 3300050514 | Bacteria | 2772 |
| 804 | nmdc:mga0a205_48370_c1 | 3300050515 | Bacteria | 4104 |
| 805 | Ga0495601_0006786 | 3300053077 | Bacteria | 6705 |
| 806 | Ga0495601_0010642 | 3300053077 | Bacteria | 5483 |
| 807 | Ga0495612_0011588 | 3300053078 | Bacteria | 3552 |
| 808 | Ga0495595_0062494 | 3300053084 | Bacteria | 1746 |
| 809 | Ga0495595_0089254 | 3300053084 | Bacteria | 1477 |
| 810 | Ga0495619_0000439 | 3300053085 | Bacteria | 28081 |
| 811 | Ga0495619_0020595 | 3300053085 | Bacteria | 4203 |
| 812 | Ga0495619_0028612 | 3300053085 | Bacteria | 3596 |
| 813 | Ga0495619_0093575 | 3300053085 | Bacteria | 2037 |
| 814 | Ga0500578_0026796 | 3300053086 | Bacteria | 3697 |
| 815 | Ga0500578_0074268 | 3300053086 | Bacteria | 2166 |
| 816 | Ga0500643_012599 | 3300053087 | Bacteria | 3024 |
| 817 | Ga0500581_041070 | 3300053089 | Bacteria | 2369 |
| 818 | Ga0500651_0004771 | 3300053093 | Bacteria | 7645 |
| 819 | Ga0500566_0057279 | 3300053094 | Bacteria | 2213 |
| 820 | Ga0500640_001878 | 3300053095 | Bacteria | 6673 |
| 821 | Ga0500654_097566 | 3300053099 | Bacteria | 1272 |
| 822 | Ga0500554_001603 | 3300053102 | Bacteria | 4358 |
| 823 | Ga0500556_0000066 | 3300053104 | Bacteria | 105850 |
| 824 | Ga0500562_011695 | 3300053108 | Bacteria | 2228 |
| 825 | Ga0500572_000121 | 3300053111 | Bacteria | 26132 |
| 826 | Ga0500572_000212 | 3300053111 | Bacteria | 20613 |
| 827 | Ga0500592_000667 | 3300053116 | Bacteria | 5652 |
| 828 | Ga0500594_0008535 | 3300053118 | Bacteria | 2338 |
| 829 | Ga0500595_000736 | 3300053119 | Bacteria | 19450 |
| 830 | Ga0500595_001441 | 3300053119 | Bacteria | 12702 |
| 831 | Ga0500595_002340 | 3300053119 | Bacteria | 9474 |
| 832 | Ga0500595_002486 | 3300053119 | Bacteria | 9120 |
| 833 | Ga0500595_032971 | 3300053119 | Bacteria | 1723 |
| 834 | Ga0500614_001327 | 3300053123 | Bacteria | 5951 |
| 835 | Ga0500618_000767 | 3300053125 | Bacteria | 18143 |
| 836 | Ga0500642_0000072 | 3300053130 | Bacteria | 55645 |
| 837 | Ga0500652_000991 | 3300053131 | Bacteria | 9298 |
| 838 | Ga0500655_029869 | 3300053133 | Bacteria | 1047 |
| 839 | Ga0500658_0005728 | 3300053134 | Bacteria | 4626 |
| 840 | Ga0500658_0130220 | 3300053134 | Bacteria | 1121 |
| 841 | Ga0500559_0000246 | 3300053136 | Bacteria | 42730 |
| 842 | Ga0500559_0003571 | 3300053136 | Bacteria | 7603 |
| 843 | Ga0500559_0004708 | 3300053136 | Bacteria | 6422 |
| 844 | Ga0500568_0001230 | 3300053139 | Bacteria | 17069 |
| 845 | Ga0500574_000408 | 3300053141 | Bacteria | 5405 |
| 846 | Ga0500577_0000029 | 3300053142 | Bacteria | 34339 |
| 847 | Ga0500586_003380 | 3300053145 | Bacteria | 3765 |
| 848 | Ga0500603_004567 | 3300053150 | Bacteria | 2963 |
| 849 | Ga0500604_0002609 | 3300053151 | Bacteria | 4913 |
| 850 | Ga0500616_0000177 | 3300053153 | Bacteria | 106498 |
| 851 | Ga0500622_0002476 | 3300053156 | Bacteria | 13301 |
| 852 | Ga0500630_013764 | 3300053159 | Bacteria | 3984 |
| 853 | Ga0500633_0014547 | 3300053160 | Bacteria | 2236 |
| 854 | Ga0500638_033498 | 3300053162 | Bacteria | 2484 |
| 855 | Ga0500638_044831 | 3300053162 | Bacteria | 2146 |
| 856 | Ga0500639_000219 | 3300053163 | Bacteria | 28391 |
| 857 | Ga0500636_0002987 | 3300053177 | Bacteria | 9465 |
| 858 | Ga0500637_0000129 | 3300053178 | Bacteria | 27540 |
| 859 | Ga0500637_0007009 | 3300053178 | Bacteria | 5605 |
| 860 | Ga0500576_061313 | 3300053725 | Bacteria | 1644 |
| 861 | Ga0500596_000276 | 3300053735 | Bacteria | 9129 |
| 862 | Ga0500596_007362 | 3300053735 | Bacteria | 1807 |
| 863 | Ga0500601_002192 | 3300053737 | Bacteria | 2099 |
| 864 | Ga0500661_000658 | 3300055283 | Bacteria | 6461 |
| 865 | Ga0501082_0041781 | 3300060353 | Bacteria | 3953 |
| 866 | Ga0466962_0033405 | 3300061719 | Bacteria | 2461 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009093 | Ga0105240_10115099 | Ga0105240_101150994 | 318 |
| 2 | 3300025912 | Ga0207707_10037004 | Ga0207707_100370044 | 318 |
| 3 | 3300035695 | Ga0373927_0098182 | Ga0373927_0098182_911_1891 | 320 |
| 4 | 3300039438 | Ga0436360_0570461 | Ga0436360_0570461_23_1015 | 320 |
| 5 | 3300046460 | Ga0495638_0201842 | Ga0495638_0201842_13_993 | 320 |
| 6 | 3300053102 | Ga0500554_001603 | Ga0500554_001603_3223_4230 | 321 |
| 7 | 3300053150 | Ga0500603_004567 | Ga0500603_004567_870_1877 | 321 |
| 8 | 3300053178 | Ga0500637_0000129 | Ga0500637_0000129_4870_5877 | 321 |
| 9 | 3300053078 | Ga0495612_0011588 | Ga0495612_0011588_800_1804 | 322 |
| 10 | 3300053085 | Ga0495619_0028612 | Ga0495619_0028612_981_1985 | 322 |
| 11 | 3300025925 | Ga0207650_10249867 | Ga0207650_102498671 | 323 |
| 12 | 3300046462 | Ga0495651_0064316 | Ga0495651_0064316_638_1618 | 324 |
| 13 | 3300046511 | Ga0495608_0011463 | Ga0495608_0011463_1483_2463 | 324 |
| 14 | 3300046516 | Ga0495628_0007950 | Ga0495628_0007950_5316_6296 | 324 |
| 15 | 3300046516 | Ga0495628_0086388 | Ga0495628_0086388_382_1371 | 324 |
| 16 | 3300046529 | Ga0495652_0033776 | Ga0495652_0033776_2453_3442 | 324 |
| 17 | 3300046543 | Ga0495645_0137663 | Ga0495645_0137663_494_1483 | 324 |
| 18 | 3300046678 | Ga0495599_0001959 | Ga0495599_0001959_8103_9083 | 324 |
| 19 | 3300046679 | Ga0495623_0035769 | Ga0495623_0035769_136_1116 | 324 |
| 20 | 3300046680 | Ga0495646_0000288 | Ga0495646_0000288_2869_3858 | 324 |
| 21 | 3300046680 | Ga0495646_0011017 | Ga0495646_0011017_414_1394 | 324 |
| 22 | 3300046690 | Ga0495624_0119753 | Ga0495624_0119753_373_1362 | 324 |
| 23 | 3300046809 | Ga0495600_0001174 | Ga0495600_0001174_2841_3821 | 324 |
| 24 | 3300053077 | Ga0495601_0006786 | Ga0495601_0006786_2876_3856 | 324 |
| 25 | 3300053119 | Ga0500595_002340 | Ga0500595_002340_5375_6355 | 324 |
| 26 | 3300053141 | Ga0500574_000408 | Ga0500574_000408_1932_2912 | 324 |
| 27 | iso_pu_bacteria | 2513237087 | 2513592150 | 324 |
| 28 | iso_pu_bacteria | 2565956521 | 2566036709 | 324 |
| 29 | iso_pu_bacteria | 2508501128 | 2509148588 | 325 |
| 30 | iso_pu_bacteria | 2511231156 | 2511824901 | 325 |
| 31 | iso_pu_bacteria | 2513237096 | 2513660154 | 325 |
| 32 | iso_pu_bacteria | 2513237101 | 2513693620 | 325 |
| 33 | iso_pu_bacteria | 2513237137 | 2513862385 | 325 |
| 34 | iso_pu_bacteria | 2513237145 | 2513919398 | 325 |
| 35 | iso_pu_bacteria | 2517572143 | 2517894381 | 325 |
| 36 | iso_pu_bacteria | 2522572158 | 2523106800 | 325 |
| 37 | iso_pu_bacteria | 2524023228 | 2524535715 | 325 |
| 38 | iso_pu_bacteria | 2602042107 | 2603856957 | 325 |
| 39 | iso_pu_bacteria | 2667528175 | 2671123986 | 325 |
| 40 | iso_pu_bacteria | 2721755755 | 2723847520 | 325 |
| 41 | iso_pu_bacteria | 2728368998 | 2728753612 | 325 |
| 42 | iso_pu_bacteria | 2738541271 | 2738687743 | 325 |
| 43 | iso_pu_bacteria | 2738543016 | 2739263822 | 325 |
| 44 | iso_pu_bacteria | 2791355197 | 2793071371 | 325 |
| 45 | iso_pu_bacteria | 2791355199 | 2793081316 | 325 |
| 46 | iso_pu_bacteria | 2825651385 | 2825651765 | 325 |
| 47 | iso_pu_bacteria | 2857524615 | 2857528634 | 325 |
| 48 | iso_pu_bacteria | 2874604998 | 2874611483 | 325 |
| 49 | iso_pu_bacteria | 2876808645 | 2876817051 | 325 |
| 50 | iso_pu_bacteria | 2879110137 | 2879117564 | 325 |
| 51 | iso_pu_bacteria | 2885374607 | 2885376759 | 325 |
| 52 | iso_pu_bacteria | 2889033259 | 2889042282 | 325 |
| 53 | iso_pu_bacteria | 2893066018 | 2893066207 | 325 |
| 54 | iso_pu_bacteria | 2903748898 | 2903754452 | 325 |
| 55 | iso_pu_bacteria | 2906610324 | 2906611111 | 325 |
| 56 | iso_pu_bacteria | 2906635258 | 2906636562 | 325 |
| 57 | iso_pu_bacteria | 2906660503 | 2906667642 | 325 |
| 58 | iso_pu_bacteria | 2908739725 | 2908744635 | 325 |
| 59 | iso_pu_bacteria | 2919073203 | 2919076054 | 325 |
| 60 | iso_pu_bacteria | 2922425934 | 2922428197 | 325 |
| 61 | iso_pu_bacteria | 2935630451 | 2935631906 | 325 |
| 62 | iso_pu_bacteria | 2941507105 | 2941507854 | 325 |
| 63 | iso_pu_bacteria | 2941515067 | 2941515641 | 325 |
| 64 | iso_pu_bacteria | 2941523033 | 2941523784 | 325 |
| 65 | iso_pu_bacteria | 3005474847 | 3005478181 | 325 |
| 66 | iso_pu_bacteria | 8002745576 | 8002746786 | 325 |
| 67 | iso_pu_bacteria | 8006933436 | 8006943033 | 325 |
| 68 | iso_pu_bacteria | 8006964411 | 8006970157 | 325 |
| 69 | iso_pu_bacteria | 8006973647 | 8006982827 | 325 |
| 70 | iso_pu_bacteria | 8006984368 | 8006985440 | 325 |
| 71 | iso_pu_bacteria | 8006994254 | 8006994506 | 325 |
| 72 | iso_pu_bacteria | 8019555841 | 8019558877 | 325 |
| 73 | iso_pu_bacteria | 8019565922 | 8019566433 | 325 |
| 74 | iso_pu_bacteria | 8056673599 | 8056681241 | 325 |
| 75 | iso_pu_bacteria | 8056689827 | 8056694436 | 325 |
| 76 | 3300010375 | Ga0105239_10302738 | Ga0105239_103027382 | 326 |
| 77 | 3300013100 | Ga0157373_10004002 | Ga0157373_100040028 | 326 |
| 78 | 3300013104 | Ga0157370_10026919 | Ga0157370_100269193 | 326 |
| 79 | 3300013307 | Ga0157372_10010113 | Ga0157372_100101139 | 326 |
| 80 | 3300039062 | Ga0400483_159836 | Ga0400483_159836_937_1932 | 326 |
| 81 | 3300039453 | Ga0436362_1299921 | Ga0436362_1299921_1657_2673 | 326 |
| 82 | 3300049569 | Ga0501032_0080115 | Ga0501032_0080115_924_1925 | 326 |
| 83 | 3300049571 | Ga0501034_0001506 | Ga0501034_0001506_23594_24595 | 326 |
| 84 | 3300049571 | Ga0501034_0035126 | Ga0501034_0035126_1255_2256 | 326 |
| 85 | 3300049572 | Ga0501036_0002386 | Ga0501036_0002386_4850_5851 | 326 |
| 86 | 3300049572 | Ga0501036_0024528 | Ga0501036_0024528_3398_4399 | 326 |
| 87 | 3300049572 | Ga0501036_0097751 | Ga0501036_0097751_686_1687 | 326 |
| 88 | 3300049573 | Ga0501037_0003431 | Ga0501037_0003431_4454_5455 | 326 |
| 89 | 3300049573 | Ga0501037_0017074 | Ga0501037_0017074_437_1438 | 326 |
| 90 | 3300049573 | Ga0501037_0061534 | Ga0501037_0061534_972_1973 | 326 |
| 91 | 3300049574 | Ga0501038_0077920 | Ga0501038_0077920_675_1676 | 326 |
| 92 | 3300049575 | Ga0501039_0047615 | Ga0501039_0047615_425_1426 | 326 |
| 93 | 3300049579 | Ga0501043_0030025 | Ga0501043_0030025_1555_2556 | 326 |
| 94 | 3300049580 | Ga0501046_0024446 | Ga0501046_0024446_2216_3217 | 326 |
| 95 | 3300049581 | Ga0501047_0000204 | Ga0501047_0000204_53502_54503 | 326 |
| 96 | 3300049581 | Ga0501047_0156631 | Ga0501047_0156631_245_1246 | 326 |
| 97 | 3300049582 | Ga0501048_0000065 | Ga0501048_0000065_19823_20824 | 326 |
| 98 | 3300049584 | Ga0501068_0185696 | Ga0501068_0185696_50_1051 | 326 |
| 99 | 3300049585 | Ga0501069_0027383 | Ga0501069_0027383_129_1130 | 326 |
| 100 | 3300049586 | Ga0501070_0011021 | Ga0501070_0011021_1876_2877 | 326 |
| 101 | 3300049586 | Ga0501070_0076206 | Ga0501070_0076206_764_1765 | 326 |
| 102 | 3300049587 | Ga0501071_0072631 | Ga0501071_0072631_794_1795 | 326 |
| 103 | 3300049589 | Ga0501073_0074685 | Ga0501073_0074685_954_1955 | 326 |
| 104 | 3300049590 | Ga0501074_0139771 | Ga0501074_0139771_397_1398 | 326 |
| 105 | 3300049742 | Ga0501080_0000815 | Ga0501080_0000815_8103_9104 | 326 |
| 106 | 3300049742 | Ga0501080_0096238 | Ga0501080_0096238_984_1985 | 326 |
| 107 | 3300049743 | Ga0501081_0105004 | Ga0501081_0105004_467_1468 | 326 |
| 108 | 3300049822 | Ga0501035_0031930 | Ga0501035_0031930_113_1114 | 326 |
| 109 | 3300049822 | Ga0501035_0034707 | Ga0501035_0034707_2334_3335 | 326 |
| 110 | 3300049823 | Ga0501044_0008478 | Ga0501044_0008478_4915_5916 | 326 |
| 111 | 3300049823 | Ga0501044_0050736 | Ga0501044_0050736_890_1891 | 326 |
| 112 | 3300049823 | Ga0501044_0089803 | Ga0501044_0089803_1881_2882 | 326 |
| 113 | 3300049823 | Ga0501044_0168284 | Ga0501044_0168284_1147_2148 | 326 |
| 114 | 3300060353 | Ga0501082_0041781 | Ga0501082_0041781_2641_3642 | 326 |
| 115 | 3300005329 | Ga0070683_100258772 | Ga0070683_1002587722 | 327 |
| 116 | 3300005330 | Ga0070690_100010911 | Ga0070690_1000109116 | 327 |
| 117 | 3300005331 | Ga0070670_100137806 | Ga0070670_1001378062 | 327 |
| 118 | 3300005335 | Ga0070666_10101981 | Ga0070666_101019812 | 327 |
| 119 | 3300005337 | Ga0070682_100073266 | Ga0070682_1000732663 | 327 |
| 120 | 3300005339 | Ga0070660_100166106 | Ga0070660_1001661062 | 327 |
| 121 | 3300005343 | Ga0070687_100110435 | Ga0070687_1001104352 | 327 |
| 122 | 3300005364 | Ga0070673_100127265 | Ga0070673_1001272652 | 327 |
| 123 | 3300005366 | Ga0070659_100147002 | Ga0070659_1001470022 | 327 |
| 124 | 3300005367 | Ga0070667_100406043 | Ga0070667_1004060432 | 327 |
| 125 | 3300005434 | Ga0070709_10011082 | Ga0070709_100110825 | 327 |
| 126 | 3300005435 | Ga0070714_100063993 | Ga0070714_1000639931 | 327 |
| 127 | 3300005436 | Ga0070713_100000550 | Ga0070713_10000055014 | 327 |
| 128 | 3300005437 | Ga0070710_10018876 | Ga0070710_100188763 | 327 |
| 129 | 3300005466 | Ga0070685_10111379 | Ga0070685_101113792 | 327 |
| 130 | 3300005544 | Ga0070686_100010100 | Ga0070686_1000101006 | 327 |
| 131 | 3300009011 | Ga0105251_10017050 | Ga0105251_100170502 | 327 |
| 132 | 3300009174 | Ga0105241_10007289 | Ga0105241_100072893 | 327 |
| 133 | 3300009551 | Ga0105238_10196497 | Ga0105238_101964972 | 327 |
| 134 | 3300010375 | Ga0105239_10067412 | Ga0105239_100674122 | 327 |
| 135 | 3300013296 | Ga0157374_10240722 | Ga0157374_102407221 | 327 |
| 136 | 3300013306 | Ga0163162_10195876 | Ga0163162_101958762 | 327 |
| 137 | 3300014969 | Ga0157376_10303274 | Ga0157376_103032741 | 327 |
| 138 | 3300025905 | Ga0207685_10020107 | Ga0207685_100201073 | 327 |
| 139 | 3300025911 | Ga0207654_10048715 | Ga0207654_100487153 | 327 |
| 140 | 3300025915 | Ga0207693_10001763 | Ga0207693_1000176310 | 327 |
| 141 | 3300034957 | Ga0373938_0010138 | Ga0373938_0010138_586_1590 | 327 |
| 142 | 3300035084 | Ga0373928_0008035 | Ga0373928_0008035_1019_2023 | 327 |
| 143 | 3300035091 | Ga0373951_0019493 | Ga0373951_0019493_217_1221 | 327 |
| 144 | 3300035170 | Ga0373943_0018390 | Ga0373943_0018390_568_1572 | 327 |
| 145 | 3300035242 | Ga0373962_0017066 | Ga0373962_0017066_767_1771 | 327 |
| 146 | 3300035691 | Ga0373931_0032579 | Ga0373931_0032579_1310_2314 | 327 |
| 147 | 3300035695 | Ga0373927_0072473 | Ga0373927_0072473_1066_2070 | 327 |
| 148 | 3300035725 | Ga0373947_0014214 | Ga0373947_0014214_3506_4510 | 327 |
| 149 | 3300046459 | Ga0495629_0001744 | Ga0495629_0001744_4697_5701 | 327 |
| 150 | 3300046475 | Ga0495639_0084040 | Ga0495639_0084040_398_1402 | 327 |
| 151 | 3300046499 | Ga0495594_0007323 | Ga0495594_0007323_471_1475 | 327 |
| 152 | 3300046524 | Ga0495648_0008054 | Ga0495648_0008054_68_1069 | 327 |
| 153 | 3300046681 | Ga0495647_0008249 | Ga0495647_0008249_1351_2355 | 327 |
| 154 | 3300046683 | Ga0495658_0002765 | Ga0495658_0002765_2492_3496 | 327 |
| 155 | 3300046689 | Ga0495613_0006926 | Ga0495613_0006926_1910_2914 | 327 |
| 156 | 3300047315 | Ga0495581_0146038 | Ga0495581_0146038_137_1141 | 327 |
| 157 | 3300047322 | Ga0495680_0017053 | Ga0495680_0017053_4726_5730 | 327 |
| 158 | 3300048903 | Ga0496100_0069422 | Ga0496100_0069422_1318_2322 | 327 |
| 159 | 3300048904 | Ga0496101_0003983 | Ga0496101_0003983_3467_4471 | 327 |
| 160 | 3300048905 | Ga0496102_0148461 | Ga0496102_0148461_635_1639 | 327 |
| 161 | 3300048908 | Ga0496105_0245282 | Ga0496105_0245282_356_1360 | 327 |
| 162 | 3300048911 | Ga0496108_0013147 | Ga0496108_0013147_3000_4004 | 327 |
| 163 | 3300048911 | Ga0496108_0098795 | Ga0496108_0098795_95_1099 | 327 |
| 164 | 3300048913 | Ga0496110_0036867 | Ga0496110_0036867_104_1108 | 327 |
| 165 | 3300048913 | Ga0496110_0102583 | Ga0496110_0102583_1334_2338 | 327 |
| 166 | 3300048914 | Ga0496111_0015624 | Ga0496111_0015624_3578_4582 | 327 |
| 167 | 3300048914 | Ga0496111_0021680 | Ga0496111_0021680_3380_4384 | 327 |
| 168 | 3300048915 | Ga0496112_0063726 | Ga0496112_0063726_2171_3175 | 327 |
| 169 | 3300048915 | Ga0496112_0069352 | Ga0496112_0069352_2009_3013 | 327 |
| 170 | 3300048916 | Ga0496113_0026582 | Ga0496113_0026582_3000_4004 | 327 |
| 171 | 3300048917 | Ga0496114_0050543 | Ga0496114_0050543_1049_2053 | 327 |
| 172 | 3300048918 | Ga0496115_0091940 | Ga0496115_0091940_1118_2125 | 327 |
| 173 | 3300053085 | Ga0495619_0000439 | Ga0495619_0000439_22353_23357 | 327 |
| 174 | iso_pu_bacteria | 2891633521 | 2891636037 | 327 |
| 175 | 3300005441 | Ga0070700_100178922 | Ga0070700_1001789221 | 328 |
| 176 | 3300005937 | Ga0081455_10001659 | Ga0081455_1000165924 | 328 |
| 177 | 3300006177 | Ga0075362_10005709 | Ga0075362_100057093 | 328 |
| 178 | 3300006871 | Ga0075434_100372320 | Ga0075434_1003723202 | 328 |
| 179 | 3300009094 | Ga0111539_10015461 | Ga0111539_100154612 | 328 |
| 180 | 3300009147 | Ga0114129_10030277 | Ga0114129_100302776 | 328 |
| 181 | 3300025291 | Ga0209675_1000445 | Ga0209675_10004459 | 328 |
| 182 | 3300031249 | Ga0265339_10040494 | Ga0265339_100404943 | 328 |
| 183 | 3300036401 | Ga0373937_0215787 | Ga0373937_0215787_667_1674 | 328 |
| 184 | 3300037853 | Ga0436364_1366209 | Ga0436364_1366209_20245_21261 | 328 |
| 185 | 3300049823 | Ga0501044_0178797 | Ga0501044_0178797_942_1952 | 328 |
| 186 | 3300050489 | nmdc:mga03683_5526_c1 | nmdc:mga03683_5526_c1_1904_2914 | 328 |
| 187 | 3300050507 | nmdc:mga05p37_155674_c1 | nmdc:mga05p37_155674_c1_967_1977 | 328 |
| 188 | 3300050511 | nmdc:mga08y16_9239_c1 | nmdc:mga08y16_9239_c1_3735_4745 | 328 |
| 189 | iso_pu_bacteria | 2917699015 | 2917703495 | 328 |
| 190 | 2162886007 | SwRhRL2b_contig_421928 | SwRhRL2b_0309.00003010 | 329 |
| 191 | 3300002737 | JGI25162J39368_1000303 | JGI25162J39368_10003039 | 329 |
| 192 | 3300002771 | JGI25163J39215_1000073 | JGI25163J39215_10000739 | 329 |
| 193 | 3300002772 | JGI25164J39214_1000222 | JGI25164J39214_100022235 | 329 |
| 194 | 3300003214 | JGI25165J46597_1000409 | JGI25165J46597_10004099 | 329 |
| 195 | 3300003659 | JGI25404J52841_10002179 | JGI25404J52841_100021791 | 329 |
| 196 | 3300005288 | Ga0065714_10002440 | Ga0065714_1000244025 | 329 |
| 197 | 3300005289 | Ga0065704_10070871 | Ga0065704_1007087111 | 329 |
| 198 | 3300005290 | Ga0065712_10149151 | Ga0065712_101491512 | 329 |
| 199 | 3300005329 | Ga0070683_100480830 | Ga0070683_1004808301 | 329 |
| 200 | 3300005330 | Ga0070690_100100581 | Ga0070690_1001005812 | 329 |
| 201 | 3300005330 | Ga0070690_100127371 | Ga0070690_1001273712 | 329 |
| 202 | 3300005331 | Ga0070670_100425712 | Ga0070670_1004257121 | 329 |
| 203 | 3300005334 | Ga0068869_100118220 | Ga0068869_1001182201 | 329 |
| 204 | 3300005334 | Ga0068869_100165040 | Ga0068869_1001650402 | 329 |
| 205 | 3300005336 | Ga0070680_100091191 | Ga0070680_1000911912 | 329 |
| 206 | 3300005336 | Ga0070680_100138359 | Ga0070680_1001383592 | 329 |
| 207 | 3300005336 | Ga0070680_100144216 | Ga0070680_1001442162 | 329 |
| 208 | 3300005337 | Ga0070682_100013240 | Ga0070682_1000132403 | 329 |
| 209 | 3300005340 | Ga0070689_100200571 | Ga0070689_1002005712 | 329 |
| 210 | 3300005340 | Ga0070689_100264087 | Ga0070689_1002640872 | 329 |
| 211 | 3300005341 | Ga0070691_10019427 | Ga0070691_100194273 | 329 |
| 212 | 3300005344 | Ga0070661_100256191 | Ga0070661_1002561912 | 329 |
| 213 | 3300005347 | Ga0070668_100107536 | Ga0070668_1001075362 | 329 |
| 214 | 3300005353 | Ga0070669_100048294 | Ga0070669_1000482942 | 329 |
| 215 | 3300005353 | Ga0070669_100072345 | Ga0070669_1000723452 | 329 |
| 216 | 3300005355 | Ga0070671_100052533 | Ga0070671_1000525333 | 329 |
| 217 | 3300005355 | Ga0070671_100099616 | Ga0070671_1000996162 | 329 |
| 218 | 3300005356 | Ga0070674_100027167 | Ga0070674_1000271672 | 329 |
| 219 | 3300005366 | Ga0070659_100104900 | Ga0070659_1001049002 | 329 |
| 220 | 3300005367 | Ga0070667_100206242 | Ga0070667_1002062422 | 329 |
| 221 | 3300005434 | Ga0070709_10002767 | Ga0070709_1000276710 | 329 |
| 222 | 3300005434 | Ga0070709_10013113 | Ga0070709_100131134 | 329 |
| 223 | 3300005435 | Ga0070714_100131195 | Ga0070714_1001311951 | 329 |
| 224 | 3300005435 | Ga0070714_100149682 | Ga0070714_1001496822 | 329 |
| 225 | 3300005436 | Ga0070713_100029112 | Ga0070713_1000291122 | 329 |
| 226 | 3300005436 | Ga0070713_100031737 | Ga0070713_1000317374 | 329 |
| 227 | 3300005437 | Ga0070710_10018621 | Ga0070710_100186214 | 329 |
| 228 | 3300005437 | Ga0070710_10040195 | Ga0070710_100401952 | 329 |
| 229 | 3300005439 | Ga0070711_100009943 | Ga0070711_1000099434 | 329 |
| 230 | 3300005439 | Ga0070711_100014342 | Ga0070711_1000143423 | 329 |
| 231 | 3300005439 | Ga0070711_100021650 | Ga0070711_1000216502 | 329 |
| 232 | 3300005455 | Ga0070663_100000736 | Ga0070663_10000073610 | 329 |
| 233 | 3300005455 | Ga0070663_100131854 | Ga0070663_1001318542 | 329 |
| 234 | 3300005455 | Ga0070663_100156860 | Ga0070663_1001568602 | 329 |
| 235 | 3300005455 | Ga0070663_100163807 | Ga0070663_1001638072 | 329 |
| 236 | 3300005456 | Ga0070678_100001495 | Ga0070678_1000014955 | 329 |
| 237 | 3300005456 | Ga0070678_100027494 | Ga0070678_1000274942 | 329 |
| 238 | 3300005457 | Ga0070662_100118960 | Ga0070662_1001189601 | 329 |
| 239 | 3300005458 | Ga0070681_10025079 | Ga0070681_100250795 | 329 |
| 240 | 3300005458 | Ga0070681_10048540 | Ga0070681_100485404 | 329 |
| 241 | 3300005459 | Ga0068867_100020022 | Ga0068867_1000200221 | 329 |
| 242 | 3300005459 | Ga0068867_100176966 | Ga0068867_1001769661 | 329 |
| 243 | 3300005467 | Ga0070706_100133864 | Ga0070706_1001338642 | 329 |
| 244 | 3300005471 | Ga0070698_100209429 | Ga0070698_1002094292 | 329 |
| 245 | 3300005530 | Ga0070679_100014293 | Ga0070679_1000142937 | 329 |
| 246 | 3300005530 | Ga0070679_100047120 | Ga0070679_1000471204 | 329 |
| 247 | 3300005530 | Ga0070679_100268687 | Ga0070679_1002686872 | 329 |
| 248 | 3300005530 | Ga0070679_100287992 | Ga0070679_1002879921 | 329 |
| 249 | 3300005544 | Ga0070686_100067858 | Ga0070686_1000678583 | 329 |
| 250 | 3300005544 | Ga0070686_100257394 | Ga0070686_1002573941 | 329 |
| 251 | 3300005546 | Ga0070696_100118754 | Ga0070696_1001187541 | 329 |
| 252 | 3300005548 | Ga0070665_100020717 | Ga0070665_1000207172 | 329 |
| 253 | 3300005548 | Ga0070665_100069514 | Ga0070665_1000695143 | 329 |
| 254 | 3300005548 | Ga0070665_100076366 | Ga0070665_1000763663 | 329 |
| 255 | 3300005548 | Ga0070665_100108349 | Ga0070665_1001083492 | 329 |
| 256 | 3300005563 | Ga0068855_100053720 | Ga0068855_1000537203 | 329 |
| 257 | 3300005563 | Ga0068855_100095032 | Ga0068855_1000950323 | 329 |
| 258 | 3300005563 | Ga0068855_100106579 | Ga0068855_1001065793 | 329 |
| 259 | 3300005564 | Ga0070664_100009890 | Ga0070664_1000098901 | 329 |
| 260 | 3300005564 | Ga0070664_100239772 | Ga0070664_1002397722 | 329 |
| 261 | 3300005577 | Ga0068857_100055630 | Ga0068857_1000556302 | 329 |
| 262 | 3300005614 | Ga0068856_100044511 | Ga0068856_1000445112 | 329 |
| 263 | 3300005616 | Ga0068852_100010158 | Ga0068852_1000101582 | 329 |
| 264 | 3300005617 | Ga0068859_100005475 | Ga0068859_1000054752 | 329 |
| 265 | 3300005617 | Ga0068859_100107766 | Ga0068859_1001077662 | 329 |
| 266 | 3300005617 | Ga0068859_100142811 | Ga0068859_1001428112 | 329 |
| 267 | 3300005618 | Ga0068864_100401438 | Ga0068864_1004014381 | 329 |
| 268 | 3300005718 | Ga0068866_10008172 | Ga0068866_100081722 | 329 |
| 269 | 3300005719 | Ga0068861_100047868 | Ga0068861_1000478683 | 329 |
| 270 | 3300005841 | Ga0068863_100154161 | Ga0068863_1001541612 | 329 |
| 271 | 3300005842 | Ga0068858_100020207 | Ga0068858_1000202074 | 329 |
| 272 | 3300005842 | Ga0068858_100112360 | Ga0068858_1001123601 | 329 |
| 273 | 3300005843 | Ga0068860_100037218 | Ga0068860_1000372183 | 329 |
| 274 | 3300005844 | Ga0068862_100163005 | Ga0068862_1001630051 | 329 |
| 275 | 3300005937 | Ga0081455_10006992 | Ga0081455_100069929 | 329 |
| 276 | 3300005937 | Ga0081455_10012994 | Ga0081455_100129941 | 329 |
| 277 | 3300005937 | Ga0081455_10017230 | Ga0081455_100172302 | 329 |
| 278 | 3300005937 | Ga0081455_10131669 | Ga0081455_101316692 | 329 |
| 279 | 3300005937 | Ga0081455_10167437 | Ga0081455_101674371 | 329 |
| 280 | 3300005983 | Ga0081540_1000918 | Ga0081540_100091821 | 329 |
| 281 | 3300005983 | Ga0081540_1001903 | Ga0081540_100190311 | 329 |
| 282 | 3300005983 | Ga0081540_1008878 | Ga0081540_10088784 | 329 |
| 283 | 3300005983 | Ga0081540_1011330 | Ga0081540_10113302 | 329 |
| 284 | 3300005983 | Ga0081540_1029456 | Ga0081540_10294563 | 329 |
| 285 | 3300005983 | Ga0081540_1030924 | Ga0081540_10309242 | 329 |
| 286 | 3300005983 | Ga0081540_1034951 | Ga0081540_10349512 | 329 |
| 287 | 3300005983 | Ga0081540_1085163 | Ga0081540_10851631 | 329 |
| 288 | 3300005985 | Ga0081539_10013000 | Ga0081539_100130002 | 329 |
| 289 | 3300005985 | Ga0081539_10040848 | Ga0081539_100408481 | 329 |
| 290 | 3300006038 | Ga0075365_10143290 | Ga0075365_101432902 | 329 |
| 291 | 3300006042 | Ga0075368_10042163 | Ga0075368_100421632 | 329 |
| 292 | 3300006051 | Ga0075364_10029741 | Ga0075364_100297412 | 329 |
| 293 | 3300006051 | Ga0075364_10102111 | Ga0075364_101021112 | 329 |
| 294 | 3300006175 | Ga0070712_100033602 | Ga0070712_1000336024 | 329 |
| 295 | 3300006175 | Ga0070712_100051371 | Ga0070712_1000513712 | 329 |
| 296 | 3300006177 | Ga0075362_10130010 | Ga0075362_101300102 | 329 |
| 297 | 3300006178 | Ga0075367_10036921 | Ga0075367_100369212 | 329 |
| 298 | 3300006178 | Ga0075367_10054959 | Ga0075367_100549592 | 329 |
| 299 | 3300006178 | Ga0075367_10130750 | Ga0075367_101307502 | 329 |
| 300 | 3300006178 | Ga0075367_10283531 | Ga0075367_102835311 | 329 |
| 301 | 3300006186 | Ga0075369_10054050 | Ga0075369_100540502 | 329 |
| 302 | 3300006195 | Ga0075366_10068321 | Ga0075366_100683212 | 329 |
| 303 | 3300006237 | Ga0097621_100120180 | Ga0097621_1001201801 | 329 |
| 304 | 3300006237 | Ga0097621_100149237 | Ga0097621_1001492371 | 329 |
| 305 | 3300006237 | Ga0097621_100157586 | Ga0097621_1001575861 | 329 |
| 306 | 3300006237 | Ga0097621_100167217 | Ga0097621_1001672172 | 329 |
| 307 | 3300006237 | Ga0097621_100256511 | Ga0097621_1002565112 | 329 |
| 308 | 3300006871 | Ga0075434_100096130 | Ga0075434_1000961303 | 329 |
| 309 | 3300006881 | Ga0068865_100024037 | Ga0068865_1000240373 | 329 |
| 310 | 3300006931 | Ga0097620_100005475 | Ga0097620_1000054752 | 329 |
| 311 | 3300006931 | Ga0097620_100107769 | Ga0097620_1001077692 | 329 |
| 312 | 3300006931 | Ga0097620_100142823 | Ga0097620_1001428232 | 329 |
| 313 | 3300007265 | Ga0099794_10006387 | Ga0099794_100063872 | 329 |
| 314 | 3300007265 | Ga0099794_10017410 | Ga0099794_100174103 | 329 |
| 315 | 3300007788 | Ga0099795_10009349 | Ga0099795_100093491 | 329 |
| 316 | 3300009093 | Ga0105240_10015165 | Ga0105240_100151654 | 329 |
| 317 | 3300009093 | Ga0105240_10021813 | Ga0105240_100218133 | 329 |
| 318 | 3300009098 | Ga0105245_10002531 | Ga0105245_100025315 | 329 |
| 319 | 3300009098 | Ga0105245_10658529 | Ga0105245_106585291 | 329 |
| 320 | 3300009148 | Ga0105243_10079656 | Ga0105243_100796562 | 329 |
| 321 | 3300009174 | Ga0105241_10134881 | Ga0105241_101348811 | 329 |
| 322 | 3300009176 | Ga0105242_10075590 | Ga0105242_100755902 | 329 |
| 323 | 3300009177 | Ga0105248_10022592 | Ga0105248_100225924 | 329 |
| 324 | 3300009177 | Ga0105248_10075435 | Ga0105248_100754354 | 329 |
| 325 | 3300009177 | Ga0105248_10110482 | Ga0105248_101104823 | 329 |
| 326 | 3300009177 | Ga0105248_10550685 | Ga0105248_105506851 | 329 |
| 327 | 3300009545 | Ga0105237_10129824 | Ga0105237_101298243 | 329 |
| 328 | 3300009545 | Ga0105237_10159728 | Ga0105237_101597282 | 329 |
| 329 | 3300009551 | Ga0105238_10018073 | Ga0105238_100180736 | 329 |
| 330 | 3300009551 | Ga0105238_10040254 | Ga0105238_100402543 | 329 |
| 331 | 3300009551 | Ga0105238_10043302 | Ga0105238_100433025 | 329 |
| 332 | 3300009551 | Ga0105238_10048052 | Ga0105238_100480522 | 329 |
| 333 | 3300009553 | Ga0105249_10130729 | Ga0105249_101307293 | 329 |
| 334 | 3300010159 | Ga0099796_10000523 | Ga0099796_100005235 | 329 |
| 335 | 3300010375 | Ga0105239_10016969 | Ga0105239_100169696 | 329 |
| 336 | 3300010375 | Ga0105239_10050901 | Ga0105239_100509014 | 329 |
| 337 | 3300010375 | Ga0105239_10154408 | Ga0105239_101544082 | 329 |
| 338 | 3300011119 | Ga0105246_10010484 | Ga0105246_100104842 | 329 |
| 339 | 3300011119 | Ga0105246_10199058 | Ga0105246_101990582 | 329 |
| 340 | 3300013104 | Ga0157370_10040442 | Ga0157370_100404421 | 329 |
| 341 | 3300013104 | Ga0157370_10077971 | Ga0157370_100779711 | 329 |
| 342 | 3300013104 | Ga0157370_10103291 | Ga0157370_101032912 | 329 |
| 343 | 3300013105 | Ga0157369_10005086 | Ga0157369_100050868 | 329 |
| 344 | 3300013105 | Ga0157369_10011901 | Ga0157369_100119015 | 329 |
| 345 | 3300013105 | Ga0157369_10038842 | Ga0157369_100388424 | 329 |
| 346 | 3300013296 | Ga0157374_10005291 | Ga0157374_100052913 | 329 |
| 347 | 3300013296 | Ga0157374_10135525 | Ga0157374_101355252 | 329 |
| 348 | 3300013297 | Ga0157378_10011318 | Ga0157378_100113188 | 329 |
| 349 | 3300013306 | Ga0163162_10014205 | Ga0163162_100142055 | 329 |
| 350 | 3300013306 | Ga0163162_10205560 | Ga0163162_102055602 | 329 |
| 351 | 3300013307 | Ga0157372_10084797 | Ga0157372_100847973 | 329 |
| 352 | 3300013307 | Ga0157372_10285537 | Ga0157372_102855373 | 329 |
| 353 | 3300013307 | Ga0157372_10396830 | Ga0157372_103968302 | 329 |
| 354 | 3300013308 | Ga0157375_10013496 | Ga0157375_100134962 | 329 |
| 355 | 3300013308 | Ga0157375_10014079 | Ga0157375_100140792 | 329 |
| 356 | 3300013308 | Ga0157375_10016136 | Ga0157375_100161362 | 329 |
| 357 | 3300014325 | Ga0163163_10003162 | Ga0163163_1000316210 | 329 |
| 358 | 3300014325 | Ga0163163_10095390 | Ga0163163_100953903 | 329 |
| 359 | 3300014325 | Ga0163163_10136234 | Ga0163163_101362343 | 329 |
| 360 | 3300014497 | Ga0182008_10005975 | Ga0182008_100059758 | 329 |
| 361 | 3300014969 | Ga0157376_10027977 | Ga0157376_100279774 | 329 |
| 362 | 3300014969 | Ga0157376_10121790 | Ga0157376_101217902 | 329 |
| 363 | 3300017792 | Ga0163161_10071302 | Ga0163161_100713022 | 329 |
| 364 | 3300017792 | Ga0163161_10089968 | Ga0163161_100899682 | 329 |
| 365 | 3300021377 | Ga0213874_10007376 | Ga0213874_100073763 | 329 |
| 366 | 3300025207 | Ga0209760_100142 | Ga0209760_10014233 | 329 |
| 367 | 3300025231 | Ga0207427_100004 | Ga0207427_10000433 | 329 |
| 368 | 3300025233 | Ga0209437_100025 | Ga0209437_100025450 | 329 |
| 369 | 3300025253 | Ga0209677_100937 | Ga0209677_10093711 | 329 |
| 370 | 3300025261 | Ga0209233_1000145 | Ga0209233_100014533 | 329 |
| 371 | 3300025261 | Ga0209233_1001494 | Ga0209233_10014942 | 329 |
| 372 | 3300025272 | Ga0209455_1006887 | Ga0209455_10068872 | 329 |
| 373 | 3300025295 | Ga0209564_1001354 | Ga0209564_100135426 | 329 |
| 374 | 3300025297 | Ga0209758_1004698 | Ga0209758_10046987 | 329 |
| 375 | 3300025297 | Ga0209758_1009495 | Ga0209758_10094951 | 329 |
| 376 | 3300025297 | Ga0209758_1043917 | Ga0209758_10439172 | 329 |
| 377 | 3300025711 | Ga0207696_1040247 | Ga0207696_10402472 | 329 |
| 378 | 3300025885 | Ga0207653_10045925 | Ga0207653_100459252 | 329 |
| 379 | 3300025898 | Ga0207692_10013372 | Ga0207692_100133721 | 329 |
| 380 | 3300025899 | Ga0207642_10022024 | Ga0207642_100220242 | 329 |
| 381 | 3300025903 | Ga0207680_10208858 | Ga0207680_102088581 | 329 |
| 382 | 3300025906 | Ga0207699_10006652 | Ga0207699_100066526 | 329 |
| 383 | 3300025907 | Ga0207645_10177100 | Ga0207645_101771001 | 329 |
| 384 | 3300025909 | Ga0207705_10017874 | Ga0207705_100178742 | 329 |
| 385 | 3300025909 | Ga0207705_10078242 | Ga0207705_100782422 | 329 |
| 386 | 3300025909 | Ga0207705_10189346 | Ga0207705_101893462 | 329 |
| 387 | 3300025910 | Ga0207684_10197368 | Ga0207684_101973682 | 329 |
| 388 | 3300025912 | Ga0207707_10006804 | Ga0207707_100068047 | 329 |
| 389 | 3300025912 | Ga0207707_10019522 | Ga0207707_100195222 | 329 |
| 390 | 3300025913 | Ga0207695_10506335 | Ga0207695_105063351 | 329 |
| 391 | 3300025914 | Ga0207671_10033572 | Ga0207671_100335723 | 329 |
| 392 | 3300025914 | Ga0207671_10125560 | Ga0207671_101255602 | 329 |
| 393 | 3300025914 | Ga0207671_10169230 | Ga0207671_101692302 | 329 |
| 394 | 3300025914 | Ga0207671_10176353 | Ga0207671_101763532 | 329 |
| 395 | 3300025915 | Ga0207693_10003380 | Ga0207693_1000338012 | 329 |
| 396 | 3300025915 | Ga0207693_10011875 | Ga0207693_100118756 | 329 |
| 397 | 3300025915 | Ga0207693_10045197 | Ga0207693_100451972 | 329 |
| 398 | 3300025915 | Ga0207693_10080594 | Ga0207693_100805942 | 329 |
| 399 | 3300025915 | Ga0207693_10127089 | Ga0207693_101270891 | 329 |
| 400 | 3300025916 | Ga0207663_10012696 | Ga0207663_100126964 | 329 |
| 401 | 3300025916 | Ga0207663_10065085 | Ga0207663_100650852 | 329 |
| 402 | 3300025916 | Ga0207663_10298074 | Ga0207663_102980741 | 329 |
| 403 | 3300025917 | Ga0207660_10063010 | Ga0207660_100630103 | 329 |
| 404 | 3300025917 | Ga0207660_10089625 | Ga0207660_100896252 | 329 |
| 405 | 3300025917 | Ga0207660_10138257 | Ga0207660_101382571 | 329 |
| 406 | 3300025918 | Ga0207662_10088843 | Ga0207662_100888431 | 329 |
| 407 | 3300025918 | Ga0207662_10194990 | Ga0207662_101949902 | 329 |
| 408 | 3300025919 | Ga0207657_10028761 | Ga0207657_100287615 | 329 |
| 409 | 3300025919 | Ga0207657_10059358 | Ga0207657_100593583 | 329 |
| 410 | 3300025920 | Ga0207649_10092019 | Ga0207649_100920192 | 329 |
| 411 | 3300025921 | Ga0207652_10047048 | Ga0207652_100470483 | 329 |
| 412 | 3300025921 | Ga0207652_10095660 | Ga0207652_100956601 | 329 |
| 413 | 3300025921 | Ga0207652_10100679 | Ga0207652_101006791 | 329 |
| 414 | 3300025921 | Ga0207652_10149939 | Ga0207652_101499392 | 329 |
| 415 | 3300025921 | Ga0207652_10230812 | Ga0207652_102308122 | 329 |
| 416 | 3300025924 | Ga0207694_10014493 | Ga0207694_100144935 | 329 |
| 417 | 3300025924 | Ga0207694_10032380 | Ga0207694_100323804 | 329 |
| 418 | 3300025924 | Ga0207694_10128607 | Ga0207694_101286071 | 329 |
| 419 | 3300025924 | Ga0207694_10164092 | Ga0207694_101640922 | 329 |
| 420 | 3300025924 | Ga0207694_10190355 | Ga0207694_101903552 | 329 |
| 421 | 3300025927 | Ga0207687_10092182 | Ga0207687_100921822 | 329 |
| 422 | 3300025928 | Ga0207700_10020769 | Ga0207700_100207694 | 329 |
| 423 | 3300025933 | Ga0207706_10160692 | Ga0207706_101606922 | 329 |
| 424 | 3300025934 | Ga0207686_10066018 | Ga0207686_100660181 | 329 |
| 425 | 3300025936 | Ga0207670_10157481 | Ga0207670_101574812 | 329 |
| 426 | 3300025937 | Ga0207669_10026914 | Ga0207669_100269141 | 329 |
| 427 | 3300025937 | Ga0207669_10049350 | Ga0207669_100493502 | 329 |
| 428 | 3300025938 | Ga0207704_10074988 | Ga0207704_100749882 | 329 |
| 429 | 3300025939 | Ga0207665_10046616 | Ga0207665_100466163 | 329 |
| 430 | 3300025940 | Ga0207691_10056876 | Ga0207691_100568764 | 329 |
| 431 | 3300025941 | Ga0207711_10052845 | Ga0207711_100528453 | 329 |
| 432 | 3300025941 | Ga0207711_10064437 | Ga0207711_100644371 | 329 |
| 433 | 3300025942 | Ga0207689_10175812 | Ga0207689_101758122 | 329 |
| 434 | 3300025944 | Ga0207661_10010608 | Ga0207661_100106087 | 329 |
| 435 | 3300025945 | Ga0207679_10055726 | Ga0207679_100557263 | 329 |
| 436 | 3300025949 | Ga0207667_10066976 | Ga0207667_100669764 | 329 |
| 437 | 3300025949 | Ga0207667_10112866 | Ga0207667_101128662 | 329 |
| 438 | 3300025960 | Ga0207651_10306283 | Ga0207651_103062831 | 329 |
| 439 | 3300025961 | Ga0207712_10335191 | Ga0207712_103351911 | 329 |
| 440 | 3300025972 | Ga0207668_10078489 | Ga0207668_100784892 | 329 |
| 441 | 3300025972 | Ga0207668_10121912 | Ga0207668_101219121 | 329 |
| 442 | 3300025972 | Ga0207668_10122768 | Ga0207668_101227682 | 329 |
| 443 | 3300025981 | Ga0207640_10088917 | Ga0207640_100889172 | 329 |
| 444 | 3300026023 | Ga0207677_10078568 | Ga0207677_100785682 | 329 |
| 445 | 3300026035 | Ga0207703_10037438 | Ga0207703_100374383 | 329 |
| 446 | 3300026041 | Ga0207639_10254755 | Ga0207639_102547551 | 329 |
| 447 | 3300026067 | Ga0207678_10061718 | Ga0207678_100617182 | 329 |
| 448 | 3300026067 | Ga0207678_10073139 | Ga0207678_100731392 | 329 |
| 449 | 3300026067 | Ga0207678_10182169 | Ga0207678_101821692 | 329 |
| 450 | 3300026075 | Ga0207708_10062247 | Ga0207708_100622473 | 329 |
| 451 | 3300026075 | Ga0207708_10074055 | Ga0207708_100740552 | 329 |
| 452 | 3300026078 | Ga0207702_10035585 | Ga0207702_100355851 | 329 |
| 453 | 3300026078 | Ga0207702_10336994 | Ga0207702_103369942 | 329 |
| 454 | 3300026089 | Ga0207648_10031432 | Ga0207648_100314322 | 329 |
| 455 | 3300026089 | Ga0207648_10116198 | Ga0207648_101161981 | 329 |
| 456 | 3300026089 | Ga0207648_10287232 | Ga0207648_102872321 | 329 |
| 457 | 3300026095 | Ga0207676_10072689 | Ga0207676_100726891 | 329 |
| 458 | 3300026116 | Ga0207674_10138731 | Ga0207674_101387312 | 329 |
| 459 | 3300026116 | Ga0207674_10283413 | Ga0207674_102834131 | 329 |
| 460 | 3300026118 | Ga0207675_100053059 | Ga0207675_1000530593 | 329 |
| 461 | 3300026118 | Ga0207675_100549707 | Ga0207675_1005497071 | 329 |
| 462 | 3300026118 | Ga0207675_100586454 | Ga0207675_1005864541 | 329 |
| 463 | 3300026121 | Ga0207683_10014942 | Ga0207683_100149423 | 329 |
| 464 | 3300026121 | Ga0207683_10064283 | Ga0207683_100642833 | 329 |
| 465 | 3300026121 | Ga0207683_10434419 | Ga0207683_104344191 | 329 |
| 466 | 3300027512 | Ga0209179_1023956 | Ga0209179_10239561 | 329 |
| 467 | 3300027671 | Ga0209588_1009342 | Ga0209588_10093423 | 329 |
| 468 | 3300027866 | Ga0209813_10039646 | Ga0209813_100396462 | 329 |
| 469 | 3300028379 | Ga0268266_10009413 | Ga0268266_100094135 | 329 |
| 470 | 3300028379 | Ga0268266_10032359 | Ga0268266_100323594 | 329 |
| 471 | 3300028379 | Ga0268266_10036611 | Ga0268266_100366114 | 329 |
| 472 | 3300028379 | Ga0268266_10081416 | Ga0268266_100814162 | 329 |
| 473 | 3300028379 | Ga0268266_10380684 | Ga0268266_103806841 | 329 |
| 474 | 3300028380 | Ga0268265_10124226 | Ga0268265_101242261 | 329 |
| 475 | 3300028380 | Ga0268265_10257104 | Ga0268265_102571042 | 329 |
| 476 | 3300028558 | Ga0265326_10002066 | Ga0265326_100020662 | 329 |
| 477 | 3300028563 | Ga0265319_1001508 | Ga0265319_10015086 | 329 |
| 478 | 3300028573 | Ga0265334_10000614 | Ga0265334_1000061421 | 329 |
| 479 | 3300028577 | Ga0265318_10002674 | Ga0265318_100026746 | 329 |
| 480 | 3300028653 | Ga0265323_10003948 | Ga0265323_100039487 | 329 |
| 481 | 3300028666 | Ga0265336_10000259 | Ga0265336_1000025927 | 329 |
| 482 | 3300028800 | Ga0265338_10000013 | Ga0265338_10000013123 | 329 |
| 483 | 3300029957 | Ga0265324_10000235 | Ga0265324_1000023556 | 329 |
| 484 | 3300031235 | Ga0265330_10010495 | Ga0265330_100104953 | 329 |
| 485 | 3300031235 | Ga0265330_10083704 | Ga0265330_100837042 | 329 |
| 486 | 3300031239 | Ga0265328_10067757 | Ga0265328_100677571 | 329 |
| 487 | 3300031247 | Ga0265340_10015613 | Ga0265340_100156134 | 329 |
| 488 | 3300031249 | Ga0265339_10022247 | Ga0265339_100222472 | 329 |
| 489 | 3300031250 | Ga0265331_10037267 | Ga0265331_100372672 | 329 |
| 490 | 3300031344 | Ga0265316_10239343 | Ga0265316_102393432 | 329 |
| 491 | 3300031548 | Ga0307408_100070810 | Ga0307408_1000708102 | 329 |
| 492 | 3300031616 | Ga0307508_10000058 | Ga0307508_100000583 | 329 |
| 493 | 3300031616 | Ga0307508_10006654 | Ga0307508_100066547 | 329 |
| 494 | 3300031712 | Ga0265342_10075616 | Ga0265342_100756161 | 329 |
| 495 | 3300031730 | Ga0307516_10038712 | Ga0307516_100387124 | 329 |
| 496 | 3300031731 | Ga0307405_10147464 | Ga0307405_101474642 | 329 |
| 497 | 3300031901 | Ga0307406_10165628 | Ga0307406_101656281 | 329 |
| 498 | 3300032002 | Ga0307416_100163465 | Ga0307416_1001634652 | 329 |
| 499 | 3300032005 | Ga0307411_10090159 | Ga0307411_100901592 | 329 |
| 500 | 3300032126 | Ga0307415_100024425 | Ga0307415_1000244252 | 329 |
| 501 | 3300032126 | Ga0307415_100083825 | Ga0307415_1000838252 | 329 |
| 502 | 3300033179 | Ga0307507_10103121 | Ga0307507_101031213 | 329 |
| 503 | 3300033180 | Ga0307510_10010251 | Ga0307510_100102516 | 329 |
| 504 | 3300033442 | Ga0315911_1000014 | Ga0315911_1000014136 | 329 |
| 505 | 3300035086 | Ga0373934_0051067 | Ga0373934_0051067_585_1592 | 329 |
| 506 | 3300035111 | Ga0373923_0009270 | Ga0373923_0009270_1047_2054 | 329 |
| 507 | 3300035111 | Ga0373923_0118195 | Ga0373923_0118195_59_1066 | 329 |
| 508 | 3300035170 | Ga0373943_0007309 | Ga0373943_0007309_3051_4058 | 329 |
| 509 | 3300035171 | Ga0373946_0021866 | Ga0373946_0021866_1302_2309 | 329 |
| 510 | 3300035171 | Ga0373946_0088103 | Ga0373946_0088103_66_1073 | 329 |
| 511 | 3300035172 | Ga0373955_0164291 | Ga0373955_0164291_243_1250 | 329 |
| 512 | 3300035410 | Ga0373924_0006573 | Ga0373924_0006573_317_1324 | 329 |
| 513 | 3300035691 | Ga0373931_0012384 | Ga0373931_0012384_2616_3623 | 329 |
| 514 | 3300035691 | Ga0373931_0053757 | Ga0373931_0053757_432_1439 | 329 |
| 515 | 3300035692 | Ga0373935_0018884 | Ga0373935_0018884_163_1170 | 329 |
| 516 | 3300035695 | Ga0373927_0016422 | Ga0373927_0016422_894_1901 | 329 |
| 517 | 3300035695 | Ga0373927_0094837 | Ga0373927_0094837_306_1313 | 329 |
| 518 | 3300035695 | Ga0373927_0136103 | Ga0373927_0136103_157_1164 | 329 |
| 519 | 3300035724 | Ga0373933_0000052 | Ga0373933_0000052_25818_26825 | 329 |
| 520 | 3300035724 | Ga0373933_0003499 | Ga0373933_0003499_521_1528 | 329 |
| 521 | 3300035724 | Ga0373933_0011933 | Ga0373933_0011933_1259_2266 | 329 |
| 522 | 3300035724 | Ga0373933_0139370 | Ga0373933_0139370_232_1239 | 329 |
| 523 | 3300035725 | Ga0373947_0011386 | Ga0373947_0011386_382_1389 | 329 |
| 524 | 3300035725 | Ga0373947_0026317 | Ga0373947_0026317_454_1461 | 329 |
| 525 | 3300036401 | Ga0373937_0060000 | Ga0373937_0060000_438_1445 | 329 |
| 526 | 3300037068 | Ga0373925_0105607 | Ga0373925_0105607_157_1164 | 329 |
| 527 | 3300037418 | Ga0395900_0060117 | Ga0395900_0060117_461_1483 | 329 |
| 528 | 3300037466 | Ga0395898_0067674 | Ga0395898_0067674_1599_2621 | 329 |
| 529 | 3300037466 | Ga0395898_0085136 | Ga0395898_0085136_847_1854 | 329 |
| 530 | 3300037853 | Ga0436364_0391517 | Ga0436364_0391517_1475_2482 | 329 |
| 531 | 3300037853 | Ga0436364_1560306 | Ga0436364_1560306_1115_2122 | 329 |
| 532 | 3300038443 | Ga0395901_0052080 | Ga0395901_0052080_579_1586 | 329 |
| 533 | 3300039437 | Ga0436365_0721818 | Ga0436365_0721818_474_1481 | 329 |
| 534 | 3300039437 | Ga0436365_1694702 | Ga0436365_1694702_24_1031 | 329 |
| 535 | 3300039438 | Ga0436360_0545356 | Ga0436360_0545356_312_1319 | 329 |
| 536 | 3300039450 | Ga0436363_0003719 | Ga0436363_0003719_1688_2695 | 329 |
| 537 | 3300039450 | Ga0436363_0027754 | Ga0436363_0027754_456_1463 | 329 |
| 538 | 3300044694 | Ga0466963_0105236 | Ga0466963_0105236_893_1900 | 329 |
| 539 | 3300045049 | Ga0466959_0128269 | Ga0466959_0128269_443_1450 | 329 |
| 540 | 3300045976 | Ga0466967_0260289 | Ga0466967_0260289_348_1355 | 329 |
| 541 | 3300046455 | Ga0495603_0000237 | Ga0495603_0000237_3411_4418 | 329 |
| 542 | 3300046455 | Ga0495603_0005734 | Ga0495603_0005734_4128_5135 | 329 |
| 543 | 3300046455 | Ga0495603_0036352 | Ga0495603_0036352_1654_2661 | 329 |
| 544 | 3300046459 | Ga0495629_0004238 | Ga0495629_0004238_5695_6702 | 329 |
| 545 | 3300046459 | Ga0495629_0049669 | Ga0495629_0049669_913_1920 | 329 |
| 546 | 3300046460 | Ga0495638_0030599 | Ga0495638_0030599_2404_3411 | 329 |
| 547 | 3300046472 | Ga0495580_0007153 | Ga0495580_0007153_4848_5855 | 329 |
| 548 | 3300046472 | Ga0495580_0182096 | Ga0495580_0182096_431_1438 | 329 |
| 549 | 3300046473 | Ga0495582_0000209 | Ga0495582_0000209_17_1024 | 329 |
| 550 | 3300046473 | Ga0495582_0052845 | Ga0495582_0052845_881_1888 | 329 |
| 551 | 3300046473 | Ga0495582_0057414 | Ga0495582_0057414_916_1923 | 329 |
| 552 | 3300046474 | Ga0495605_0056844 | Ga0495605_0056844_336_1343 | 329 |
| 553 | 3300046476 | Ga0495662_0105833 | Ga0495662_0105833_289_1296 | 329 |
| 554 | 3300046477 | Ga0495664_0096796 | Ga0495664_0096796_277_1284 | 329 |
| 555 | 3300046491 | Ga0495584_0047072 | Ga0495584_0047072_753_1760 | 329 |
| 556 | 3300046491 | Ga0495584_0137465 | Ga0495584_0137465_130_1137 | 329 |
| 557 | 3300046511 | Ga0495608_0057655 | Ga0495608_0057655_1157_2164 | 329 |
| 558 | 3300046514 | Ga0495618_0102098 | Ga0495618_0102098_704_1711 | 329 |
| 559 | 3300046517 | Ga0495630_0052798 | Ga0495630_0052798_1137_2144 | 329 |
| 560 | 3300046528 | Ga0495642_0060991 | Ga0495642_0060991_128_1135 | 329 |
| 561 | 3300046529 | Ga0495652_0046208 | Ga0495652_0046208_779_1786 | 329 |
| 562 | 3300046529 | Ga0495652_0123910 | Ga0495652_0123910_533_1540 | 329 |
| 563 | 3300046529 | Ga0495652_0186410 | Ga0495652_0186410_139_1146 | 329 |
| 564 | 3300046531 | Ga0495665_0020920 | Ga0495665_0020920_1112_2119 | 329 |
| 565 | 3300046533 | Ga0495640_0081469 | Ga0495640_0081469_292_1299 | 329 |
| 566 | 3300046537 | Ga0495598_0033410 | Ga0495598_0033410_215_1222 | 329 |
| 567 | 3300046543 | Ga0495645_0039978 | Ga0495645_0039978_1795_2802 | 329 |
| 568 | 3300046557 | Ga0495622_0054346 | Ga0495622_0054346_549_1556 | 329 |
| 569 | 3300046559 | Ga0495667_0019470 | Ga0495667_0019470_3202_4209 | 329 |
| 570 | 3300046615 | Ga0495656_0146496 | Ga0495656_0146496_87_1094 | 329 |
| 571 | 3300046642 | Ga0495634_0024924 | Ga0495634_0024924_2780_3787 | 329 |
| 572 | 3300046642 | Ga0495634_0048802 | Ga0495634_0048802_761_1768 | 329 |
| 573 | 3300046660 | Ga0495625_0112099 | Ga0495625_0112099_45_1052 | 329 |
| 574 | 3300046663 | Ga0495635_0020554 | Ga0495635_0020554_3331_4338 | 329 |
| 575 | 3300046663 | Ga0495635_0061279 | Ga0495635_0061279_1294_2301 | 329 |
| 576 | 3300046674 | Ga0495588_0017035 | Ga0495588_0017035_512_1519 | 329 |
| 577 | 3300046678 | Ga0495599_0114372 | Ga0495599_0114372_504_1511 | 329 |
| 578 | 3300046679 | Ga0495623_0039704 | Ga0495623_0039704_396_1403 | 329 |
| 579 | 3300046680 | Ga0495646_0029092 | Ga0495646_0029092_697_1704 | 329 |
| 580 | 3300046680 | Ga0495646_0133199 | Ga0495646_0133199_356_1363 | 329 |
| 581 | 3300046681 | Ga0495647_0004901 | Ga0495647_0004901_391_1398 | 329 |
| 582 | 3300046683 | Ga0495658_0129133 | Ga0495658_0129133_193_1200 | 329 |
| 583 | 3300046689 | Ga0495613_0015743 | Ga0495613_0015743_1928_2935 | 329 |
| 584 | 3300046691 | Ga0495670_0079816 | Ga0495670_0079816_146_1153 | 329 |
| 585 | 3300046809 | Ga0495600_0111444 | Ga0495600_0111444_427_1434 | 329 |
| 586 | 3300047317 | Ga0495604_0022940 | Ga0495604_0022940_3412_4419 | 329 |
| 587 | 3300047317 | Ga0495604_0034583 | Ga0495604_0034583_2761_3768 | 329 |
| 588 | 3300047319 | Ga0495674_0020318 | Ga0495674_0020318_1016_2023 | 329 |
| 589 | 3300047319 | Ga0495674_0233961 | Ga0495674_0233961_178_1185 | 329 |
| 590 | 3300047320 | Ga0495672_0022077 | Ga0495672_0022077_1101_2108 | 329 |
| 591 | 3300047322 | Ga0495680_0116518 | Ga0495680_0116518_931_1938 | 329 |
| 592 | 3300047445 | Ga0495677_0066157 | Ga0495677_0066157_135_1142 | 329 |
| 593 | 3300047445 | Ga0495677_0069260 | Ga0495677_0069260_202_1209 | 329 |
| 594 | 3300047469 | Ga0495673_0026512 | Ga0495673_0026512_964_1971 | 329 |
| 595 | 3300047469 | Ga0495673_0067899 | Ga0495673_0067899_491_1498 | 329 |
| 596 | 3300047471 | Ga0495684_0071851 | Ga0495684_0071851_133_1140 | 329 |
| 597 | 3300047673 | Ga0495593_0026578 | Ga0495593_0026578_899_1906 | 329 |
| 598 | 3300048088 | Ga0495602_0099099 | Ga0495602_0099099_660_1667 | 329 |
| 599 | 3300048090 | Ga0495615_0027781 | Ga0495615_0027781_270_1277 | 329 |
| 600 | 3300048903 | Ga0496100_0214223 | Ga0496100_0214223_223_1230 | 329 |
| 601 | 3300048904 | Ga0496101_0004598 | Ga0496101_0004598_6424_7431 | 329 |
| 602 | 3300048904 | Ga0496101_0170441 | Ga0496101_0170441_154_1164 | 329 |
| 603 | 3300048905 | Ga0496102_0036873 | Ga0496102_0036873_115_1125 | 329 |
| 604 | 3300048905 | Ga0496102_0047035 | Ga0496102_0047035_1893_2900 | 329 |
| 605 | 3300048905 | Ga0496102_0106646 | Ga0496102_0106646_900_1907 | 329 |
| 606 | 3300048905 | Ga0496102_0244749 | Ga0496102_0244749_205_1212 | 329 |
| 607 | 3300048906 | Ga0496103_0027984 | Ga0496103_0027984_1362_2369 | 329 |
| 608 | 3300048907 | Ga0496104_0201452 | Ga0496104_0201452_852_1862 | 329 |
| 609 | 3300048907 | Ga0496104_0320263 | Ga0496104_0320263_324_1331 | 329 |
| 610 | 3300048908 | Ga0496105_0019393 | Ga0496105_0019393_2397_3404 | 329 |
| 611 | 3300048908 | Ga0496105_0083448 | Ga0496105_0083448_82_1089 | 329 |
| 612 | 3300048909 | Ga0496106_0015623 | Ga0496106_0015623_4578_5588 | 329 |
| 613 | 3300048909 | Ga0496106_0064606 | Ga0496106_0064606_553_1560 | 329 |
| 614 | 3300048909 | Ga0496106_0210800 | Ga0496106_0210800_149_1156 | 329 |
| 615 | 3300048910 | Ga0496107_0010397 | Ga0496107_0010397_388_1395 | 329 |
| 616 | 3300048910 | Ga0496107_0043807 | Ga0496107_0043807_1726_2733 | 329 |
| 617 | 3300048911 | Ga0496108_0076929 | Ga0496108_0076929_1681_2691 | 329 |
| 618 | 3300048911 | Ga0496108_0084762 | Ga0496108_0084762_1199_2206 | 329 |
| 619 | 3300048911 | Ga0496108_0126122 | Ga0496108_0126122_48_1055 | 329 |
| 620 | 3300048911 | Ga0496108_0198153 | Ga0496108_0198153_547_1554 | 329 |
| 621 | 3300048912 | Ga0496109_0003060 | Ga0496109_0003060_4678_5688 | 329 |
| 622 | 3300048912 | Ga0496109_0009741 | Ga0496109_0009741_1194_2201 | 329 |
| 623 | 3300048912 | Ga0496109_0022826 | Ga0496109_0022826_3415_4422 | 329 |
| 624 | 3300048912 | Ga0496109_0025677 | Ga0496109_0025677_3650_4657 | 329 |
| 625 | 3300048912 | Ga0496109_0072594 | Ga0496109_0072594_1332_2339 | 329 |
| 626 | 3300048912 | Ga0496109_0126181 | Ga0496109_0126181_118_1125 | 329 |
| 627 | 3300048912 | Ga0496109_0190268 | Ga0496109_0190268_109_1119 | 329 |
| 628 | 3300048913 | Ga0496110_0000835 | Ga0496110_0000835_16274_17284 | 329 |
| 629 | 3300048914 | Ga0496111_0026839 | Ga0496111_0026839_2956_3966 | 329 |
| 630 | 3300048914 | Ga0496111_0088213 | Ga0496111_0088213_1125_2132 | 329 |
| 631 | 3300048915 | Ga0496112_0177658 | Ga0496112_0177658_684_1691 | 329 |
| 632 | 3300048915 | Ga0496112_0279380 | Ga0496112_0279380_473_1480 | 329 |
| 633 | 3300048916 | Ga0496113_0030668 | Ga0496113_0030668_2731_3741 | 329 |
| 634 | 3300048916 | Ga0496113_0045484 | Ga0496113_0045484_1713_2720 | 329 |
| 635 | 3300048916 | Ga0496113_0323992 | Ga0496113_0323992_141_1148 | 329 |
| 636 | 3300048917 | Ga0496114_0003347 | Ga0496114_0003347_5805_6812 | 329 |
| 637 | 3300048917 | Ga0496114_0008640 | Ga0496114_0008640_3720_4727 | 329 |
| 638 | 3300048918 | Ga0496115_0003657 | Ga0496115_0003657_3256_4263 | 329 |
| 639 | 3300048918 | Ga0496115_0036962 | Ga0496115_0036962_1426_2448 | 329 |
| 640 | 3300048920 | Ga0496117_0027483 | Ga0496117_0027483_3066_4070 | 329 |
| 641 | 3300048921 | Ga0496118_0167943 | Ga0496118_0167943_294_1301 | 329 |
| 642 | 3300048922 | Ga0496119_0078905 | Ga0496119_0078905_309_1316 | 329 |
| 643 | 3300048924 | Ga0496121_0007527 | Ga0496121_0007527_1246_2253 | 329 |
| 644 | 3300048924 | Ga0496121_0047981 | Ga0496121_0047981_618_1625 | 329 |
| 645 | 3300048924 | Ga0496121_0057573 | Ga0496121_0057573_1064_2071 | 329 |
| 646 | 3300048924 | Ga0496121_0063518 | Ga0496121_0063518_1176_2183 | 329 |
| 647 | 3300048924 | Ga0496121_0088385 | Ga0496121_0088385_1135_2142 | 329 |
| 648 | 3300048927 | Ga0496124_0000047 | Ga0496124_0000047_192524_193528 | 329 |
| 649 | 3300048927 | Ga0496124_0186356 | Ga0496124_0186356_534_1541 | 329 |
| 650 | 3300048928 | Ga0496125_0008194 | Ga0496125_0008194_8574_9581 | 329 |
| 651 | 3300048928 | Ga0496125_0051331 | Ga0496125_0051331_1095_2102 | 329 |
| 652 | 3300048929 | Ga0496126_0003871 | Ga0496126_0003871_1974_2981 | 329 |
| 653 | 3300048929 | Ga0496126_0018816 | Ga0496126_0018816_2294_3301 | 329 |
| 654 | 3300048929 | Ga0496126_0090975 | Ga0496126_0090975_937_1944 | 329 |
| 655 | 3300049578 | Ga0501042_0083502 | Ga0501042_0083502_1244_2251 | 329 |
| 656 | 3300049592 | Ga0501076_0156934 | Ga0501076_0156934_715_1722 | 329 |
| 657 | 3300050490 | nmdc:mga03n38_58193_c1 | nmdc:mga03n38_58193_c1_14_1021 | 329 |
| 658 | 3300050490 | nmdc:mga03n38_73049_c1 | nmdc:mga03n38_73049_c1_564_1571 | 329 |
| 659 | 3300050493 | nmdc:mga0k408_63593_c1 | nmdc:mga0k408_63593_c1_632_1639 | 329 |
| 660 | 3300050494 | nmdc:mga06z11_25615_c1 | nmdc:mga06z11_25615_c1_499_1506 | 329 |
| 661 | 3300050507 | nmdc:mga05p37_571424_c1 | nmdc:mga05p37_571424_c1_27_1034 | 329 |
| 662 | 3300053077 | Ga0495601_0010642 | Ga0495601_0010642_2039_3046 | 329 |
| 663 | 3300053084 | Ga0495595_0062494 | Ga0495595_0062494_659_1666 | 329 |
| 664 | 3300053084 | Ga0495595_0089254 | Ga0495595_0089254_78_1085 | 329 |
| 665 | 3300053085 | Ga0495619_0020595 | Ga0495619_0020595_1916_2923 | 329 |
| 666 | 3300053085 | Ga0495619_0093575 | Ga0495619_0093575_718_1725 | 329 |
| 667 | 3300053087 | Ga0500643_012599 | Ga0500643_012599_206_1213 | 329 |
| 668 | 3300053095 | Ga0500640_001878 | Ga0500640_001878_4590_5609 | 329 |
| 669 | 3300053108 | Ga0500562_011695 | Ga0500562_011695_669_1676 | 329 |
| 670 | 3300053111 | Ga0500572_000121 | Ga0500572_000121_1107_2126 | 329 |
| 671 | 3300053111 | Ga0500572_000212 | Ga0500572_000212_5573_6580 | 329 |
| 672 | 3300053118 | Ga0500594_0008535 | Ga0500594_0008535_59_1066 | 329 |
| 673 | 3300053119 | Ga0500595_000736 | Ga0500595_000736_1008_2015 | 329 |
| 674 | 3300053119 | Ga0500595_001441 | Ga0500595_001441_4340_5347 | 329 |
| 675 | 3300053119 | Ga0500595_002486 | Ga0500595_002486_593_1600 | 329 |
| 676 | 3300053119 | Ga0500595_032971 | Ga0500595_032971_461_1468 | 329 |
| 677 | 3300053123 | Ga0500614_001327 | Ga0500614_001327_1081_2100 | 329 |
| 678 | 3300053133 | Ga0500655_029869 | Ga0500655_029869_10_1017 | 329 |
| 679 | 3300053134 | Ga0500658_0130220 | Ga0500658_0130220_96_1103 | 329 |
| 680 | 3300053136 | Ga0500559_0000246 | Ga0500559_0000246_35688_36695 | 329 |
| 681 | 3300053136 | Ga0500559_0003571 | Ga0500559_0003571_5520_6539 | 329 |
| 682 | 3300053142 | Ga0500577_0000029 | Ga0500577_0000029_30_1037 | 329 |
| 683 | 3300053159 | Ga0500630_013764 | Ga0500630_013764_1065_2084 | 329 |
| 684 | 3300053162 | Ga0500638_033498 | Ga0500638_033498_1263_2270 | 329 |
| 685 | 3300053162 | Ga0500638_044831 | Ga0500638_044831_312_1319 | 329 |
| 686 | 3300053163 | Ga0500639_000219 | Ga0500639_000219_26279_27298 | 329 |
| 687 | 3300053178 | Ga0500637_0007009 | Ga0500637_0007009_4027_5034 | 329 |
| 688 | 3300053725 | Ga0500576_061313 | Ga0500576_061313_128_1135 | 329 |
| 689 | 3300053735 | Ga0500596_000276 | Ga0500596_000276_3889_4896 | 329 |
| 690 | 3300053735 | Ga0500596_007362 | Ga0500596_007362_747_1766 | 329 |
| 691 | 3300053737 | Ga0500601_002192 | Ga0500601_002192_16_1035 | 329 |
| 692 | 3300055283 | Ga0500661_000658 | Ga0500661_000658_3941_4948 | 329 |
| 693 | 3300061719 | Ga0466962_0033405 | Ga0466962_0033405_194_1201 | 329 |
| 694 | iso_pu_bacteria | 2511231026 | 2511387102 | 329 |
| 695 | iso_pu_bacteria | 2521172590 | 2521556615 | 329 |
| 696 | iso_pu_bacteria | 2551306416 | 2553006789 | 329 |
| 697 | iso_pu_bacteria | 2765235838 | 2765567793 | 329 |
| 698 | iso_pu_bacteria | 2808606386 | 2808982826 | 329 |
| 699 | iso_pu_bacteria | 2808606415 | 2809130338 | 329 |
| 700 | iso_pu_bacteria | 2808606419 | 2809150185 | 329 |
| 701 | iso_pu_bacteria | 2818991436 | 2819545238 | 329 |
| 702 | iso_pu_bacteria | 2818991449 | 2819617982 | 329 |
| 703 | iso_pu_bacteria | 2839094727 | 2839097921 | 329 |
| 704 | iso_pu_bacteria | 2852618963 | 2852621594 | 329 |
| 705 | iso_pu_bacteria | 2904439833 | 2904442001 | 329 |
| 706 | iso_pu_bacteria | 2904530477 | 2904533298 | 329 |
| 707 | iso_pu_bacteria | 2904584206 | 2904586246 | 329 |
| 708 | iso_pu_bacteria | 2904589729 | 2904591941 | 329 |
| 709 | iso_pu_bacteria | 2904601388 | 2904601897 | 329 |
| 710 | iso_pu_bacteria | 2919046199 | 2919049388 | 329 |
| 711 | iso_pu_bacteria | 2919079590 | 2919083776 | 329 |
| 712 | iso_pu_bacteria | 2923510766 | 2923515211 | 329 |
| 713 | iso_pu_bacteria | 2928130867 | 2928132168 | 329 |
| 714 | 3300005331 | Ga0070670_100027932 | Ga0070670_1000279324 | 330 |
| 715 | 3300005335 | Ga0070666_10261423 | Ga0070666_102614231 | 330 |
| 716 | 3300005347 | Ga0070668_100329691 | Ga0070668_1003296912 | 330 |
| 717 | 3300005617 | Ga0068859_100140979 | Ga0068859_1001409793 | 330 |
| 718 | 3300005718 | Ga0068866_10042110 | Ga0068866_100421103 | 330 |
| 719 | 3300005719 | Ga0068861_100230206 | Ga0068861_1002302062 | 330 |
| 720 | 3300005841 | Ga0068863_100063589 | Ga0068863_1000635892 | 330 |
| 721 | 3300005841 | Ga0068863_100115896 | Ga0068863_1001158962 | 330 |
| 722 | 3300005842 | Ga0068858_100177289 | Ga0068858_1001772892 | 330 |
| 723 | 3300005843 | Ga0068860_100012743 | Ga0068860_1000127434 | 330 |
| 724 | 3300005843 | Ga0068860_100487273 | Ga0068860_1004872731 | 330 |
| 725 | 3300005844 | Ga0068862_100025981 | Ga0068862_1000259814 | 330 |
| 726 | 3300006028 | Ga0070717_10093748 | Ga0070717_100937482 | 330 |
| 727 | 3300006173 | Ga0070716_100019032 | Ga0070716_1000190323 | 330 |
| 728 | 3300006237 | Ga0097621_100106316 | Ga0097621_1001063162 | 330 |
| 729 | 3300006237 | Ga0097621_100333600 | Ga0097621_1003336002 | 330 |
| 730 | 3300006358 | Ga0068871_100086625 | Ga0068871_1000866253 | 330 |
| 731 | 3300006881 | Ga0068865_100101753 | Ga0068865_1001017533 | 330 |
| 732 | 3300006914 | Ga0075436_100056902 | Ga0075436_1000569023 | 330 |
| 733 | 3300006931 | Ga0097620_100080152 | Ga0097620_1000801523 | 330 |
| 734 | 3300006931 | Ga0097620_100140978 | Ga0097620_1001409782 | 330 |
| 735 | 3300009176 | Ga0105242_10400148 | Ga0105242_104001481 | 330 |
| 736 | 3300009177 | Ga0105248_10182612 | Ga0105248_101826122 | 330 |
| 737 | 3300013297 | Ga0157378_10238743 | Ga0157378_102387432 | 330 |
| 738 | 3300013306 | Ga0163162_10242545 | Ga0163162_102425452 | 330 |
| 739 | 3300014968 | Ga0157379_10139777 | Ga0157379_101397772 | 330 |
| 740 | 3300021441 | Ga0213871_10004773 | Ga0213871_100047733 | 330 |
| 741 | 3300025903 | Ga0207680_10033248 | Ga0207680_100332481 | 330 |
| 742 | 3300025906 | Ga0207699_10006470 | Ga0207699_100064703 | 330 |
| 743 | 3300025907 | Ga0207645_10045098 | Ga0207645_100450982 | 330 |
| 744 | 3300025919 | Ga0207657_10055214 | Ga0207657_100552142 | 330 |
| 745 | 3300025927 | Ga0207687_10023754 | Ga0207687_100237541 | 330 |
| 746 | 3300025928 | Ga0207700_10002100 | Ga0207700_100021007 | 330 |
| 747 | 3300025929 | Ga0207664_10045808 | Ga0207664_100458083 | 330 |
| 748 | 3300025931 | Ga0207644_10162561 | Ga0207644_101625611 | 330 |
| 749 | 3300025933 | Ga0207706_10042434 | Ga0207706_100424344 | 330 |
| 750 | 3300025934 | Ga0207686_10006690 | Ga0207686_100066905 | 330 |
| 751 | 3300025936 | Ga0207670_10055542 | Ga0207670_100555423 | 330 |
| 752 | 3300025939 | Ga0207665_10004373 | Ga0207665_100043735 | 330 |
| 753 | 3300025941 | Ga0207711_10085575 | Ga0207711_100855754 | 330 |
| 754 | 3300025941 | Ga0207711_10238315 | Ga0207711_102383151 | 330 |
| 755 | 3300025942 | Ga0207689_10080792 | Ga0207689_100807922 | 330 |
| 756 | 3300025960 | Ga0207651_10021775 | Ga0207651_100217753 | 330 |
| 757 | 3300025961 | Ga0207712_10375655 | Ga0207712_103756551 | 330 |
| 758 | 3300026035 | Ga0207703_10111792 | Ga0207703_101117922 | 330 |
| 759 | 3300026067 | Ga0207678_10024312 | Ga0207678_100243123 | 330 |
| 760 | 3300026088 | Ga0207641_10149459 | Ga0207641_101494592 | 330 |
| 761 | 3300026095 | Ga0207676_10213237 | Ga0207676_102132372 | 330 |
| 762 | 3300026118 | Ga0207675_100306520 | Ga0207675_1003065202 | 330 |
| 763 | 3300026121 | Ga0207683_10013945 | Ga0207683_100139452 | 330 |
| 764 | 3300028379 | Ga0268266_10053239 | Ga0268266_100532393 | 330 |
| 765 | 3300028380 | Ga0268265_10014881 | Ga0268265_100148815 | 330 |
| 766 | 3300028381 | Ga0268264_10023027 | Ga0268264_100230273 | 330 |
| 767 | 3300028381 | Ga0268264_10063077 | Ga0268264_100630774 | 330 |
| 768 | 3300037312 | Ga0395899_0097674 | Ga0395899_0097674_610_1623 | 330 |
| 769 | 3300037418 | Ga0395900_0080473 | Ga0395900_0080473_586_1599 | 330 |
| 770 | 3300038443 | Ga0395901_0090577 | Ga0395901_0090577_1737_2750 | 330 |
| 771 | 3300039438 | Ga0436360_0119626 | Ga0436360_0119626_2437_3447 | 330 |
| 772 | 3300049581 | Ga0501047_0007027 | Ga0501047_0007027_5294_6313 | 330 |
| 773 | 3300049586 | Ga0501070_0034125 | Ga0501070_0034125_2210_3229 | 330 |
| 774 | 3300049590 | Ga0501074_0029234 | Ga0501074_0029234_245_1264 | 330 |
| 775 | 3300049742 | Ga0501080_0000669 | Ga0501080_0000669_22479_23498 | 330 |
| 776 | 3300050491 | nmdc:mga00v17_3981_c1 | nmdc:mga00v17_3981_c1_2274_3284 | 330 |
| 777 | 3300005329 | Ga0070683_100514276 | Ga0070683_1005142761 | 331 |
| 778 | 3300005336 | Ga0070680_100271876 | Ga0070680_1002718761 | 331 |
| 779 | 3300005339 | Ga0070660_100007189 | Ga0070660_1000071897 | 331 |
| 780 | 3300005434 | Ga0070709_10008832 | Ga0070709_100088323 | 331 |
| 781 | 3300005436 | Ga0070713_100006026 | Ga0070713_1000060263 | 331 |
| 782 | 3300005437 | Ga0070710_10008247 | Ga0070710_100082473 | 331 |
| 783 | 3300005439 | Ga0070711_100025491 | Ga0070711_1000254912 | 331 |
| 784 | 3300005518 | Ga0070699_100035564 | Ga0070699_1000355641 | 331 |
| 785 | 3300005530 | Ga0070679_100043390 | Ga0070679_1000433902 | 331 |
| 786 | 3300005530 | Ga0070679_100043780 | Ga0070679_1000437804 | 331 |
| 787 | 3300005546 | Ga0070696_100000694 | Ga0070696_10000069412 | 331 |
| 788 | 3300006175 | Ga0070712_100287613 | Ga0070712_1002876132 | 331 |
| 789 | 3300006852 | Ga0075433_10077757 | Ga0075433_100777573 | 331 |
| 790 | 3300006914 | Ga0075436_100056029 | Ga0075436_1000560291 | 331 |
| 791 | 3300009093 | Ga0105240_10085390 | Ga0105240_100853902 | 331 |
| 792 | 3300009093 | Ga0105240_10143986 | Ga0105240_101439863 | 331 |
| 793 | 3300013104 | Ga0157370_10003286 | Ga0157370_1000328618 | 331 |
| 794 | 3300013104 | Ga0157370_10095726 | Ga0157370_100957263 | 331 |
| 795 | 3300013307 | Ga0157372_10020473 | Ga0157372_100204736 | 331 |
| 796 | 3300013307 | Ga0157372_10076305 | Ga0157372_100763052 | 331 |
| 797 | 3300025898 | Ga0207692_10026865 | Ga0207692_100268653 | 331 |
| 798 | 3300025906 | Ga0207699_10081648 | Ga0207699_100816482 | 331 |
| 799 | 3300025912 | Ga0207707_10123088 | Ga0207707_101230882 | 331 |
| 800 | 3300025913 | Ga0207695_10107402 | Ga0207695_101074023 | 331 |
| 801 | 3300025916 | Ga0207663_10054175 | Ga0207663_100541752 | 331 |
| 802 | 3300025919 | Ga0207657_10018284 | Ga0207657_100182844 | 331 |
| 803 | 3300025921 | Ga0207652_10092056 | Ga0207652_100920561 | 331 |
| 804 | 3300025921 | Ga0207652_10147395 | Ga0207652_101473952 | 331 |
| 805 | 3300025928 | Ga0207700_10109006 | Ga0207700_101090063 | 331 |
| 806 | 3300025929 | Ga0207664_10088331 | Ga0207664_100883312 | 331 |
| 807 | 3300025949 | Ga0207667_10290962 | Ga0207667_102909622 | 331 |
| 808 | 3300026116 | Ga0207674_10295157 | Ga0207674_102951572 | 331 |
| 809 | 3300037418 | Ga0395900_0019659 | Ga0395900_0019659_3004_4020 | 331 |
| 810 | 3300048909 | Ga0496106_0092555 | Ga0496106_0092555_379_1392 | 331 |
| 811 | 3300049589 | Ga0501073_0043056 | Ga0501073_0043056_249_1427 | 331 |
| 812 | 3300049744 | Ga0501083_0018537 | Ga0501083_0018537_1342_2346 | 331 |
| 813 | 3300050512 | nmdc:mga0n895_309611_c1 | nmdc:mga0n895_309611_c1_546_1556 | 331 |
| 814 | 3300050513 | nmdc:mga0rr50_54899_c1 | nmdc:mga0rr50_54899_c1_858_1868 | 331 |
| 815 | 3300050514 | nmdc:mga08x19_46628_c1 | nmdc:mga08x19_46628_c1_91_1101 | 331 |
| 816 | 3300050515 | nmdc:mga0a205_48370_c1 | nmdc:mga0a205_48370_c1_2105_3115 | 331 |
| 817 | 3300053086 | Ga0500578_0026796 | Ga0500578_0026796_2514_3527 | 331 |
| 818 | 3300013102 | Ga0157371_10013766 | Ga0157371_100137663 | 332 |
| 819 | 3300013104 | Ga0157370_10071749 | Ga0157370_100717492 | 332 |
| 820 | 3300013105 | Ga0157369_10069540 | Ga0157369_100695403 | 332 |
| 821 | 3300013307 | Ga0157372_10070760 | Ga0157372_100707603 | 332 |
| 822 | 3300013307 | Ga0157372_10152536 | Ga0157372_101525363 | 332 |
| 823 | 3300021361 | Ga0213872_10000803 | Ga0213872_1000080317 | 332 |
| 824 | 3300021361 | Ga0213872_10098001 | Ga0213872_100980012 | 332 |
| 825 | 3300025272 | Ga0209455_1000462 | Ga0209455_100046224 | 332 |
| 826 | 3300025294 | Ga0209025_1000019 | Ga0209025_100001962 | 332 |
| 827 | 3300025932 | Ga0207690_10085645 | Ga0207690_100856451 | 332 |
| 828 | 3300025949 | Ga0207667_10098018 | Ga0207667_100980183 | 332 |
| 829 | 3300026041 | Ga0207639_10066141 | Ga0207639_100661411 | 332 |
| 830 | 3300031241 | Ga0265325_10012884 | Ga0265325_100128842 | 332 |
| 831 | 3300039447 | Ga0436361_0132102 | Ga0436361_0132102_42909_43931 | 332 |
| 832 | 3300039447 | Ga0436361_1195803 | Ga0436361_1195803_1242_2264 | 332 |
| 833 | 3300046501 | Ga0495607_0044616 | Ga0495607_0044616_469_1491 | 332 |
| 834 | 3300046507 | Ga0495606_0024955 | Ga0495606_0024955_1391_2413 | 332 |
| 835 | 3300046515 | Ga0495620_0071585 | Ga0495620_0071585_42_1064 | 332 |
| 836 | 3300046557 | Ga0495622_0065566 | Ga0495622_0065566_10_1032 | 332 |
| 837 | 3300046665 | Ga0495661_0004458 | Ga0495661_0004458_888_1910 | 332 |
| 838 | 3300046691 | Ga0495670_0022766 | Ga0495670_0022766_131_1153 | 332 |
| 839 | 3300046692 | Ga0495671_0107774 | Ga0495671_0107774_314_1336 | 332 |
| 840 | 3300047320 | Ga0495672_0068207 | Ga0495672_0068207_475_1515 | 332 |
| 841 | 3300047472 | Ga0495686_0063377 | Ga0495686_0063377_683_1705 | 332 |
| 842 | 3300048919 | Ga0496116_0001928 | Ga0496116_0001928_10600_11622 | 332 |
| 843 | 3300048921 | Ga0496118_0192205 | Ga0496118_0192205_53_1075 | 332 |
| 844 | 3300048924 | Ga0496121_0019033 | Ga0496121_0019033_1981_3033 | 332 |
| 845 | 3300048924 | Ga0496121_0023274 | Ga0496121_0023274_297_1319 | 332 |
| 846 | 3300048925 | Ga0496122_0022165 | Ga0496122_0022165_2631_3653 | 332 |
| 847 | 3300048926 | Ga0496123_0011180 | Ga0496123_0011180_1899_2921 | 332 |
| 848 | 3300048927 | Ga0496124_0164777 | Ga0496124_0164777_226_1248 | 332 |
| 849 | 3300048928 | Ga0496125_0017373 | Ga0496125_0017373_4532_5554 | 332 |
| 850 | 3300048929 | Ga0496126_0025649 | Ga0496126_0025649_1330_2352 | 332 |
| 851 | 3300048929 | Ga0496126_0026313 | Ga0496126_0026313_640_1704 | 332 |
| 852 | 3300049822 | Ga0501035_0003474 | Ga0501035_0003474_7043_8056 | 332 |
| 853 | 3300050492 | nmdc:mga0yw44_35851_c1 | nmdc:mga0yw44_35851_c1_1814_2836 | 332 |
| 854 | 3300050495 | nmdc:mga04h51_62798_c1 | nmdc:mga04h51_62798_c1_47_1069 | 332 |
| 855 | 3300053086 | Ga0500578_0074268 | Ga0500578_0074268_1015_2037 | 332 |
| 856 | 3300053089 | Ga0500581_041070 | Ga0500581_041070_467_1489 | 332 |
| 857 | 3300053093 | Ga0500651_0004771 | Ga0500651_0004771_1784_2806 | 332 |
| 858 | 3300053094 | Ga0500566_0057279 | Ga0500566_0057279_42_1064 | 332 |
| 859 | 3300053099 | Ga0500654_097566 | Ga0500654_097566_68_1090 | 332 |
| 860 | 3300053104 | Ga0500556_0000066 | Ga0500556_0000066_37345_38367 | 332 |
| 861 | 3300053116 | Ga0500592_000667 | Ga0500592_000667_1838_2860 | 332 |
| 862 | 3300053130 | Ga0500642_0000072 | Ga0500642_0000072_14479_15501 | 332 |
| 863 | 3300053131 | Ga0500652_000991 | Ga0500652_000991_443_1465 | 332 |
| 864 | 3300053134 | Ga0500658_0005728 | Ga0500658_0005728_2648_3670 | 332 |
| 865 | 3300053136 | Ga0500559_0004708 | Ga0500559_0004708_3271_4290 | 332 |
| 866 | 3300053139 | Ga0500568_0001230 | Ga0500568_0001230_11428_12450 | 332 |
| 867 | 3300053145 | Ga0500586_003380 | Ga0500586_003380_2154_3176 | 332 |
| 868 | 3300053151 | Ga0500604_0002609 | Ga0500604_0002609_3013_4035 | 332 |
| 869 | 3300053153 | Ga0500616_0000177 | Ga0500616_0000177_39212_40234 | 332 |
| 870 | 3300053156 | Ga0500622_0002476 | Ga0500622_0002476_6385_7407 | 332 |
| 871 | 3300053160 | Ga0500633_0014547 | Ga0500633_0014547_1015_2037 | 332 |
| 872 | 3300053177 | Ga0500636_0002987 | Ga0500636_0002987_3678_4700 | 332 |
| 873 | iso_pu_bacteria | 2513237141 | 2513888405 | 332 |
| 874 | 3300002737 | JGI25162J39368_1000202 | JGI25162J39368_10002025 | 333 |
| 875 | 3300003214 | JGI25165J46597_1000296 | JGI25165J46597_10002965 | 333 |
| 876 | 3300003751 | Ga0055538_1000010 | Ga0055538_1000010314 | 333 |
| 877 | 3300003751 | Ga0055538_1000113 | Ga0055538_10001134 | 333 |
| 878 | 3300003752 | Ga0055539_1000015 | Ga0055539_1000015314 | 333 |
| 879 | 3300003752 | Ga0055539_1000161 | Ga0055539_100016148 | 333 |
| 880 | 3300003756 | Ga0055533_1000018 | Ga0055533_1000018314 | 333 |
| 881 | 3300003756 | Ga0055533_1000163 | Ga0055533_10001634 | 333 |
| 882 | 3300003759 | Ga0055525_1000020 | Ga0055525_1000020314 | 333 |
| 883 | 3300003759 | Ga0055525_1000218 | Ga0055525_10002184 | 333 |
| 884 | 3300003841 | Ga0055541_1000011 | Ga0055541_1000011314 | 333 |
| 885 | 3300003841 | Ga0055541_1000106 | Ga0055541_10001064 | 333 |
| 886 | 3300005563 | Ga0068855_100000064 | Ga0068855_10000006413 | 333 |
| 887 | 3300005563 | Ga0068855_100037921 | Ga0068855_1000379212 | 333 |
| 888 | 3300005578 | Ga0068854_100018026 | Ga0068854_1000180265 | 333 |
| 889 | 3300006946 | Ga0079104_1005889 | Ga0079104_10058894 | 333 |
| 890 | 3300009036 | Ga0105244_10057244 | Ga0105244_100572442 | 333 |
| 891 | 3300009093 | Ga0105240_10073219 | Ga0105240_100732192 | 333 |
| 892 | 3300009545 | Ga0105237_10001496 | Ga0105237_1000149616 | 333 |
| 893 | 3300009551 | Ga0105238_10000004 | Ga0105238_10000004346 | 333 |
| 894 | 3300010375 | Ga0105239_10001696 | Ga0105239_100016964 | 333 |
| 895 | 3300015261 | Ga0182006_1009528 | Ga0182006_10095283 | 333 |
| 896 | 3300025224 | Ga0209784_100020 | Ga0209784_1000205 | 333 |
| 897 | 3300025224 | Ga0209784_100025 | Ga0209784_100025311 | 333 |
| 898 | 3300025225 | Ga0209566_100020 | Ga0209566_1000205 | 333 |
| 899 | 3300025225 | Ga0209566_100025 | Ga0209566_100025311 | 333 |
| 900 | 3300025226 | Ga0209674_100035 | Ga0209674_1000355 | 333 |
| 901 | 3300025226 | Ga0209674_100042 | Ga0209674_100042311 | 333 |
| 902 | 3300025230 | Ga0209563_100038 | Ga0209563_1000385 | 333 |
| 903 | 3300025230 | Ga0209563_100046 | Ga0209563_100046311 | 333 |
| 904 | 3300025231 | Ga0207427_100357 | Ga0207427_10035721 | 333 |
| 905 | 3300025233 | Ga0209437_100274 | Ga0209437_10027452 | 333 |
| 906 | 3300025253 | Ga0209677_100027 | Ga0209677_100027311 | 333 |
| 907 | 3300025253 | Ga0209677_100117 | Ga0209677_1001176 | 333 |
| 908 | 3300025261 | Ga0209233_1000060 | Ga0209233_10000605 | 333 |
| 909 | 3300025913 | Ga0207695_10008300 | Ga0207695_100083004 | 333 |
| 910 | 3300025924 | Ga0207694_10000021 | Ga0207694_10000021263 | 333 |
| 911 | 3300025949 | Ga0207667_10000019 | Ga0207667_10000019266 | 333 |
| 912 | 3300025949 | Ga0207667_10032188 | Ga0207667_100321881 | 333 |
| 913 | 3300025981 | Ga0207640_10168625 | Ga0207640_101686252 | 333 |
| 914 | 3300026116 | Ga0207674_10186388 | Ga0207674_101863881 | 333 |
| 915 | 3300027111 | Ga0209281_1016135 | Ga0209281_10161352 | 333 |
| 916 | 3300039447 | Ga0436361_0168473 | Ga0436361_0168473_10071_11078 | 333 |
| 917 | 3300046462 | Ga0495651_0000510 | Ga0495651_0000510_2488_3495 | 333 |
| 918 | 3300046514 | Ga0495618_0097181 | Ga0495618_0097181_338_1345 | 333 |
| 919 | 3300046516 | Ga0495628_0000255 | Ga0495628_0000255_20785_21792 | 333 |
| 920 | 3300046529 | Ga0495652_0005967 | Ga0495652_0005967_3362_4369 | 333 |
| 921 | 3300046679 | Ga0495623_0005774 | Ga0495623_0005774_2954_3961 | 333 |
| 922 | 3300046680 | Ga0495646_0059835 | Ga0495646_0059835_287_1294 | 333 |
| 923 | 3300048927 | Ga0496124_0047724 | Ga0496124_0047724_147_1169 | 333 |
| 924 | 3300053125 | Ga0500618_000767 | Ga0500618_000767_2451_3458 | 333 |
| 925 | 3300049581 | Ga0501047_0003418 | Ga0501047_0003418_6077_7228 | 336 |
| 926 | 3300049585 | Ga0501069_0011153 | Ga0501069_0011153_2234_3385 | 336 |
| 927 | 3300049589 | Ga0501073_0006383 | Ga0501073_0006383_3651_4802 | 336 |
| 928 | 3300049590 | Ga0501074_0000614 | Ga0501074_0000614_14563_15714 | 336 |
| 929 | 3300049741 | Ga0501079_0034266 | Ga0501079_0034266_1574_2725 | 336 |
| 930 | 3300049742 | Ga0501080_0070551 | Ga0501080_0070551_1755_2906 | 336 |
| 931 | 3300049744 | Ga0501083_0003287 | Ga0501083_0003287_4602_5753 | 336 |
| 932 | 3300049822 | Ga0501035_0151631 | Ga0501035_0151631_491_1642 | 336 |
| 933 | 2162886007 | SwRhRL2b_contig_3697715 | SwRhRL2b_0838.00005370 | 337 |
| 934 | 3300005289 | Ga0065704_10071587 | Ga0065704_1007158711 | 337 |
| 935 | 3300048925 | Ga0496122_0006874 | Ga0496122_0006874_4254_5267 | 337 |
| 936 | 3300048926 | Ga0496123_0022126 | Ga0496123_0022126_2498_3511 | 337 |
| 937 | 3300048928 | Ga0496125_0005281 | Ga0496125_0005281_5887_6900 | 337 |
| 938 | 3300048929 | Ga0496126_0040240 | Ga0496126_0040240_833_1846 | 337 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5t1p-assembly5.cif.gz_E | crystal structure of the putative periplasmic solute-binding protein from campylobacter jejuni | 0.8829 | 23 | 336 |
| 5t1p-assembly8.cif.gz_H | crystal structure of the putative periplasmic solute-binding protein from campylobacter jejuni | 0.8814 | 25 | 336 |
| 4r6y-assembly1.cif.gz_A | crystal structure of solute-binding protein stm0429 from salmonella enterica subsp. enterica serovar typhimurium str. lt2, target efi-510776, a closed conformation, in complex with glycerol and acetate | 0.8592 | 26 | 336 |
| 5t1p-assembly5.cif.gz_E | crystal structure of the putative periplasmic solute-binding protein from campylobacter jejuni | 0.8476 | 23 | 336 |
| 4r6y-assembly1.cif.gz_A | crystal structure of solute-binding protein stm0429 from salmonella enterica subsp. enterica serovar typhimurium str. lt2, target efi-510776, a closed conformation, in complex with glycerol and acetate | 0.8415 | 26 | 336 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1y4tD01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8845 | 29 | 295 | 3.40.190.10 |
| 1xvyA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8758 | 29 | 122 | 3.40.190.10 |
| 1y4tD01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8675 | 29 | 295 | 3.40.190.10 |
| 4r6yA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8667 | 26 | 302 | 3.40.190.10 |
| 4elqB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8591 | 27 | 298 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0K2W9X9-F1-model_v4 | deleted | 0.9783 | 17 | 336 |
|
| AF-A0A2W4W886-F1-model_v4 | ABC transporter substrate-binding protein | 0.9747 | 22 | 336 |
GO:0015888
GO:0030288 GO:0030975 GO:0030976 |
| AF-A0A353M1K2-F1-model_v4 | ABC transporter substrate-binding protein | 0.9486 | 16 | 269 |
GO:0015888
GO:0030288 GO:0030975 GO:0030976 |
| AF-A0A7C6CIN4-F1-model_v4 | deleted | 0.947 | 17 | 335 |
|
| AF-A0A6P2XIH1-F1-model_v4 | ABC transporter, periplasmic substrate-binding protein | 0.9441 | 26 | 335 |
GO:0015888
GO:0030288 GO:0030975 GO:0030976 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar