F486241

General Info

Members Datasets Scaffolds Average Seq Length
938 494 866 336

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100027932|Ga0070670_1000279324
Length 336
Sequence MLAKRVLLAVSIAFAVAFAGVASAQTATCYNCPPEWADFKTQLRVIKEQTGITVPPDNKNSGQTLAQLIAEKANPVADIGHFGVGFAIQAKDAGVVEAYKPAKYWDEIPADLKDPDGSWFTVYYGTLGLFVNVDALGGKPIPTSWKDLTDPKYKGMVGFLDPASSFVGVAAAVAINRALGGSLDDFTPAINWFKAMTKNEAIVPKQTSYARVVSGEIPILIDYDFNAYRAQYQDKVNARFVIPKEGTLIVPYVMSLVKGGPNAANGKKVLDFLLTDKGQAVFANAFVRPIRPSAASAEARSKFLPDAEYARASGIDFRKVAQVQDAFIKRYLAEGR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
4 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
5 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
6 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
7 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
8 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
9 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
10 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
11 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
12 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
13 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
14 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
15 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
16 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
17 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
18 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
19 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
20 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
21 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
22 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
23 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
24 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
25 2791355199
26 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
27 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
28 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
29 2818991436 Collimonas arenae 515 Isolate Unclassified
30 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
31 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
32 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
33 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
34 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
35 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
36 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
37 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
38 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
39 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
40 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
41 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
42 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
43 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
44 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
45 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
46 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
47 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
48 2906610324
49 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
50 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
51 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
52 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
53 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
54 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
55 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
56 2922425934
57 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
58 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
59 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
60 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
61 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
62 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
63 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
64 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
65 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
66 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
67 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
68 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
70 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
71 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
72 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
73 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
74 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
75 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
76 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
77 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
78 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
79 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
80 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
81 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
82 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
83 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
84 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
85 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
86 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
87 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
88 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
89 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
90 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
91 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
92 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
93 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
94 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
95 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
96 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
97 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
98 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
99 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
100 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
101 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
102 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
103 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
104 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
105 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
106 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
107 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
108 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
109 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
110 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
111 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
112 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
113 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
114 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
115 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
116 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
117 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
118 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
119 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
120 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
121 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
122 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
123 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
124 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
125 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
126 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
127 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
128 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
129 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
130 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
131 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
132 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
133 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
134 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
135 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
136 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
137 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
138 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
139 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
140 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
141 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
142 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
143 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
144 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
145 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
146 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
147 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
148 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
149 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
150 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
151 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
152 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
153 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
154 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
155 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
156 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
157 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
158 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
159 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
160 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
161 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
162 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
163 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
164 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
165 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
166 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
167 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
168 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
169 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
170 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
171 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
172 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
173 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
174 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
175 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
176 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
177 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
178 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
179 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
180 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
181 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
182 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
183 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
184 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
185 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
186 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
187 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
192 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
193 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
195 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
198 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
199 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
200 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
257 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
260 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
264 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
265 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
266 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
267 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
268 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
269 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
270 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
271 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
272 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
273 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
274 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
275 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
276 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
277 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
278 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
279 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
280 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
281 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
282 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
283 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
284 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
285 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
286 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
287 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
288 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
289 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
290 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
291 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
292 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
293 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
294 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
295 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
296 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
297 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
298 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
299 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
300 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
301 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
302 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
303 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
304 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
305 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
306 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
307 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
308 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
309 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
310 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
311 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
312 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
313 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
314 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
315 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
316 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
317 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
318 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
319 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
320 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
321 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
322 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
323 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
324 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
325 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
326 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
327 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
328 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
329 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
330 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
331 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
332 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
333 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
334 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
335 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
336 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
337 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
338 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
339 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
340 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
341 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
342 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
343 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
344 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
345 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
346 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
347 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
348 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
349 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
350 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
351 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
352 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
353 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
354 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
355 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
356 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
357 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
358 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
359 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
360 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
361 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
362 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
363 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
364 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
365 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
366 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
367 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
368 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
369 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
370 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
371 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
372 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
373 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
374 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
375 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
376 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
377 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
378 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
379 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
380 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
381 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
382 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
383 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
384 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
385 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
386 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
387 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
388 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
389 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
390 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
391 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
392 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
393 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
394 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
395 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
396 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
397 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
398 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
399 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
400 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
401 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
402 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
403 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
409 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
415 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
416 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
417 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
418 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
419 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
420 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
421 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
422 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
423 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
424 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
425 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
427 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
428 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
429 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
430 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
431 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
432 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
433 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
434 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
435 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
436 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
437 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
438 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
439 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
440 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
441 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
442 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
443 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
444 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
445 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
446 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
447 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
448 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
449 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
450 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
451 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
452 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
453 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
454 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
455 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
456 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
457 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
458 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
459 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
460 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
461 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
462 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
463 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
464 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
465 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
466 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
467 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
468 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
469 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
470 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
471 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
472 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
473 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
474 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
475 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
476 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
477 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
478 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
479 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
480 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
481 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
482 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
483 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
484 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
485 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
486 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
487 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
488 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
489 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
490 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
491 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
492 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
493 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
494 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.62
Metatranscriptomes 0
Isolates 7.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.26
Nodule 3.41
Rhizoplane 6.18
Rhizosphere 70.68
Stem 0
Stem Tuber 0
Unclassified 7.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3697715 2162886007 Bacteria 2197
2 SwRhRL2b_contig_421928 2162886007 Bacteria 1154
3 JGI25162J39368_1000202 3300002737 Bacteria 62873
4 JGI25162J39368_1000303 3300002737 Bacteria 45206
5 JGI25163J39215_1000073 3300002771 Bacteria 44827
6 JGI25164J39214_1000222 3300002772 Bacteria 45206
7 JGI25165J46597_1000296 3300003214 Bacteria 62873
8 JGI25165J46597_1000409 3300003214 Bacteria 45206
9 JGI25404J52841_10002179 3300003659 Bacteria 3663
10 Ga0055538_1000010 3300003751 Bacteria 376599
11 Ga0055538_1000113 3300003751 Bacteria 62873
12 Ga0055539_1000015 3300003752 Bacteria 376599
13 Ga0055539_1000161 3300003752 Bacteria 62873
14 Ga0055533_1000018 3300003756 Bacteria 376599
15 Ga0055533_1000163 3300003756 Bacteria 62873
16 Ga0055525_1000020 3300003759 Bacteria 376599
17 Ga0055525_1000218 3300003759 Bacteria 62873
18 Ga0055541_1000011 3300003841 Bacteria 376599
19 Ga0055541_1000106 3300003841 Bacteria 62873
20 Ga0065714_10002440 3300005288 Bacteria 26394
21 Ga0065704_10070871 3300005289 Bacteria 15191
22 Ga0065704_10071587 3300005289 Bacteria 10610
23 Ga0065712_10149151 3300005290 Bacteria 1384
24 Ga0070683_100258772 3300005329 Bacteria 1655
25 Ga0070683_100480830 3300005329 Bacteria 1186
26 Ga0070683_100514276 3300005329 Bacteria 1144
27 Ga0070690_100010911 3300005330 Bacteria 5302
28 Ga0070690_100100581 3300005330 Bacteria 1917
29 Ga0070690_100127371 3300005330 Bacteria 1716
30 Ga0070670_100027932 3300005331 Bacteria 4855
31 Ga0070670_100137806 3300005331 Bacteria 2109
32 Ga0070670_100425712 3300005331 Bacteria 1174
33 Ga0068869_100118220 3300005334 Bacteria 2024
34 Ga0068869_100165040 3300005334 Bacteria 1726
35 Ga0070666_10101981 3300005335 Bacteria 1979
36 Ga0070666_10261423 3300005335 Bacteria 1227
37 Ga0070680_100091191 3300005336 Bacteria 2523
38 Ga0070680_100138359 3300005336 Bacteria 2041
39 Ga0070680_100144216 3300005336 Bacteria 1997
40 Ga0070680_100271876 3300005336 Bacteria 1435
41 Ga0070682_100013240 3300005337 Bacteria 4743
42 Ga0070682_100073266 3300005337 Bacteria 2197
43 Ga0070660_100007189 3300005339 Bacteria 7744
44 Ga0070660_100166106 3300005339 Bacteria 1781
45 Ga0070689_100200571 3300005340 Bacteria 1629
46 Ga0070689_100264087 3300005340 Bacteria 1424
47 Ga0070691_10019427 3300005341 Bacteria 3136
48 Ga0070687_100110435 3300005343 Bacteria 1555
49 Ga0070661_100256191 3300005344 Bacteria 1352
50 Ga0070668_100107536 3300005347 Bacteria 2217
51 Ga0070668_100329691 3300005347 Bacteria 1287
52 Ga0070669_100048294 3300005353 Bacteria 3106
53 Ga0070669_100072345 3300005353 Bacteria 2552
54 Ga0070671_100052533 3300005355 Bacteria 3388
55 Ga0070671_100099616 3300005355 Bacteria 2438
56 Ga0070674_100027167 3300005356 Bacteria 3747
57 Ga0070673_100127265 3300005364 Bacteria 2133
58 Ga0070659_100104900 3300005366 Bacteria 2277
59 Ga0070659_100147002 3300005366 Bacteria 1921
60 Ga0070667_100206242 3300005367 Bacteria 1745
61 Ga0070667_100406043 3300005367 Bacteria 1240
62 Ga0070709_10002767 3300005434 Bacteria 9474
63 Ga0070709_10008832 3300005434 Bacteria 5547
64 Ga0070709_10011082 3300005434 Bacteria 5013
65 Ga0070709_10013113 3300005434 Bacteria 4652
66 Ga0070714_100063993 3300005435 Bacteria 3165
67 Ga0070714_100131195 3300005435 Bacteria 2240
68 Ga0070714_100149682 3300005435 Bacteria 2102
69 Ga0070713_100000550 3300005436 Bacteria 23862
70 Ga0070713_100006026 3300005436 Bacteria 8351
71 Ga0070713_100029112 3300005436 Bacteria 4369
72 Ga0070713_100031737 3300005436 Bacteria 4211
73 Ga0070710_10008247 3300005437 Bacteria 5069
74 Ga0070710_10018621 3300005437 Bacteria 3575
75 Ga0070710_10018876 3300005437 Bacteria 3554
76 Ga0070710_10040195 3300005437 Bacteria 2577
77 Ga0070711_100009943 3300005439 Bacteria 5868
78 Ga0070711_100014342 3300005439 Bacteria 4993
79 Ga0070711_100021650 3300005439 Bacteria 4160
80 Ga0070711_100025491 3300005439 Bacteria 3870
81 Ga0070700_100178922 3300005441 Bacteria 1474
82 Ga0070663_100000736 3300005455 Bacteria 17673
83 Ga0070663_100131854 3300005455 Bacteria 1898
84 Ga0070663_100156860 3300005455 Bacteria 1749
85 Ga0070663_100163807 3300005455 Bacteria 1713
86 Ga0070678_100001495 3300005456 Bacteria 12487
87 Ga0070678_100027494 3300005456 Bacteria 3862
88 Ga0070662_100118960 3300005457 Bacteria 2022
89 Ga0070681_10025079 3300005458 Bacteria 6001
90 Ga0070681_10048540 3300005458 Bacteria 4241
91 Ga0068867_100020022 3300005459 Bacteria 4768
92 Ga0068867_100176966 3300005459 Bacteria 1693
93 Ga0070685_10111379 3300005466 Bacteria 1686
94 Ga0070706_100133864 3300005467 Bacteria 2314
95 Ga0070698_100209429 3300005471 Bacteria 1885
96 Ga0070699_100035564 3300005518 Bacteria 4305
97 Ga0070679_100014293 3300005530 Bacteria 7623
98 Ga0070679_100043390 3300005530 Bacteria 4479
99 Ga0070679_100043780 3300005530 Bacteria 4457
100 Ga0070679_100047120 3300005530 Bacteria 4298
101 Ga0070679_100268687 3300005530 Bacteria 1660
102 Ga0070679_100287992 3300005530 Bacteria 1594
103 Ga0070686_100010100 3300005544 Bacteria 5312
104 Ga0070686_100067858 3300005544 Bacteria 2325
105 Ga0070686_100257394 3300005544 Bacteria 1278
106 Ga0070696_100000694 3300005546 Bacteria 21554
107 Ga0070696_100118754 3300005546 Bacteria 1912
108 Ga0070665_100020717 3300005548 Bacteria 6606
109 Ga0070665_100069514 3300005548 Bacteria 3529
110 Ga0070665_100076366 3300005548 Bacteria 3357
111 Ga0070665_100108349 3300005548 Bacteria 2780
112 Ga0068855_100000064 3300005563 Bacteria 130807
113 Ga0068855_100037921 3300005563 Bacteria 5727
114 Ga0068855_100053720 3300005563 Bacteria 4738
115 Ga0068855_100095032 3300005563 Bacteria 3436
116 Ga0068855_100106579 3300005563 Bacteria 3221
117 Ga0070664_100009890 3300005564 Bacteria 7731
118 Ga0070664_100239772 3300005564 Bacteria 1627
119 Ga0068857_100055630 3300005577 Bacteria 3511
120 Ga0068854_100018026 3300005578 Bacteria 4733
121 Ga0068856_100044511 3300005614 Bacteria 4369
122 Ga0068852_100010158 3300005616 Bacteria 7014
123 Ga0068859_100005475 3300005617 Bacteria 12919
124 Ga0068859_100107766 3300005617 Bacteria 2847
125 Ga0068859_100140979 3300005617 Bacteria 2484
126 Ga0068859_100142811 3300005617 Bacteria 2467
127 Ga0068864_100401438 3300005618 Bacteria 1303
128 Ga0068866_10008172 3300005718 Bacteria 4397
129 Ga0068866_10042110 3300005718 Bacteria 2271
130 Ga0068861_100047868 3300005719 Bacteria 3229
131 Ga0068861_100230206 3300005719 Bacteria 1571
132 Ga0068863_100063589 3300005841 Bacteria 3490
133 Ga0068863_100115896 3300005841 Bacteria 2553
134 Ga0068863_100154161 3300005841 Bacteria 2199
135 Ga0068858_100020207 3300005842 Bacteria 6227
136 Ga0068858_100112360 3300005842 Bacteria 2544
137 Ga0068858_100177289 3300005842 Bacteria 2011
138 Ga0068860_100012743 3300005843 Bacteria 8270
139 Ga0068860_100037218 3300005843 Bacteria 4658
140 Ga0068860_100487273 3300005843 Bacteria 1229
141 Ga0068862_100025981 3300005844 Bacteria 4921
142 Ga0068862_100163005 3300005844 Bacteria 1991
143 Ga0081455_10001659 3300005937 Bacteria 26976
144 Ga0081455_10006992 3300005937 Bacteria 11989
145 Ga0081455_10012994 3300005937 Bacteria 8255
146 Ga0081455_10017230 3300005937 Bacteria 6936
147 Ga0081455_10131669 3300005937 Bacteria 1955
148 Ga0081455_10167437 3300005937 Bacteria 1677
149 Ga0081540_1000918 3300005983 Bacteria 26491
150 Ga0081540_1001903 3300005983 Bacteria 17470
151 Ga0081540_1008878 3300005983 Bacteria 6977
152 Ga0081540_1011330 3300005983 Bacteria 5965
153 Ga0081540_1029456 3300005983 Bacteria 3058
154 Ga0081540_1030924 3300005983 Bacteria 2956
155 Ga0081540_1034951 3300005983 Bacteria 2701
156 Ga0081540_1085163 3300005983 Bacteria 1408
157 Ga0081539_10013000 3300005985 Bacteria 6322
158 Ga0081539_10040848 3300005985 Bacteria 2719
159 Ga0070717_10093748 3300006028 Bacteria 2539
160 Ga0075365_10143290 3300006038 Bacteria 1659
161 Ga0075368_10042163 3300006042 Bacteria 1795
162 Ga0075364_10029741 3300006051 Bacteria 3504
163 Ga0075364_10102111 3300006051 Bacteria 1909
164 Ga0070716_100019032 3300006173 Bacteria 3585
165 Ga0070712_100033602 3300006175 Bacteria 3472
166 Ga0070712_100051371 3300006175 Bacteria 2871
167 Ga0070712_100287613 3300006175 Bacteria 1326
168 Ga0075362_10005709 3300006177 Bacteria 4579
169 Ga0075362_10130010 3300006177 Bacteria 1197
170 Ga0075367_10036921 3300006178 Bacteria 2836
171 Ga0075367_10054959 3300006178 Bacteria 2361
172 Ga0075367_10130750 3300006178 Bacteria 1552
173 Ga0075367_10283531 3300006178 Bacteria 1041
174 Ga0075369_10054050 3300006186 Bacteria 1743
175 Ga0075366_10068321 3300006195 Bacteria 2114
176 Ga0097621_100106316 3300006237 Bacteria 2367
177 Ga0097621_100120180 3300006237 Bacteria 2227
178 Ga0097621_100149237 3300006237 Bacteria 2004
179 Ga0097621_100157586 3300006237 Bacteria 1949
180 Ga0097621_100167217 3300006237 Bacteria 1894
181 Ga0097621_100256511 3300006237 Bacteria 1533
182 Ga0097621_100333600 3300006237 Bacteria 1346
183 Ga0068871_100086625 3300006358 Bacteria 2603
184 Ga0075433_10077757 3300006852 Bacteria 2923
185 Ga0075434_100096130 3300006871 Bacteria 2968
186 Ga0075434_100372320 3300006871 Bacteria 1449
187 Ga0068865_100024037 3300006881 Bacteria 3994
188 Ga0068865_100101753 3300006881 Bacteria 2104
189 Ga0075436_100056029 3300006914 Bacteria 2723
190 Ga0075436_100056902 3300006914 Bacteria 2700
191 Ga0097620_100005475 3300006931 Bacteria 12919
192 Ga0097620_100080152 3300006931 Bacteria 3305
193 Ga0097620_100107769 3300006931 Bacteria 2847
194 Ga0097620_100140978 3300006931 Bacteria 2484
195 Ga0097620_100142823 3300006931 Bacteria 2467
196 Ga0079104_1005889 3300006946 Bacteria 4773
197 Ga0099794_10006387 3300007265 Bacteria 4770
198 Ga0099794_10017410 3300007265 Bacteria 3202
199 Ga0099795_10009349 3300007788 Bacteria 2840
200 Ga0105251_10017050 3300009011 Bacteria 3902
201 Ga0105244_10057244 3300009036 Bacteria 1970
202 Ga0105240_10015165 3300009093 Bacteria 10489
203 Ga0105240_10021813 3300009093 Bacteria 8511
204 Ga0105240_10073219 3300009093 Bacteria 4231
205 Ga0105240_10085390 3300009093 Bacteria 3867
206 Ga0105240_10115099 3300009093 Bacteria 3247
207 Ga0105240_10143986 3300009093 Bacteria 2846
208 Ga0111539_10015461 3300009094 Bacteria 9492
209 Ga0105245_10002531 3300009098 Bacteria 16481
210 Ga0105245_10658529 3300009098 Bacteria 1078
211 Ga0114129_10030277 3300009147 Bacteria 7662
212 Ga0105243_10079656 3300009148 Bacteria 2670
213 Ga0105241_10007289 3300009174 Bacteria 8140
214 Ga0105241_10134881 3300009174 Bacteria 2003
215 Ga0105242_10075590 3300009176 Bacteria 2805
216 Ga0105242_10400148 3300009176 Bacteria 1281
217 Ga0105248_10022592 3300009177 Bacteria 6981
218 Ga0105248_10075435 3300009177 Bacteria 3790
219 Ga0105248_10110482 3300009177 Bacteria 3099
220 Ga0105248_10182612 3300009177 Bacteria 2364
221 Ga0105248_10550685 3300009177 Bacteria 1301
222 Ga0105237_10001496 3300009545 Bacteria 30781
223 Ga0105237_10129824 3300009545 Bacteria 2515
224 Ga0105237_10159728 3300009545 Bacteria 2252
225 Ga0105238_10000004 3300009551 Bacteria 390514
226 Ga0105238_10018073 3300009551 Bacteria 7166
227 Ga0105238_10040254 3300009551 Bacteria 4737
228 Ga0105238_10043302 3300009551 Bacteria 4555
229 Ga0105238_10048052 3300009551 Bacteria 4301
230 Ga0105238_10196497 3300009551 Bacteria 1993
231 Ga0105249_10130729 3300009553 Bacteria 2397
232 Ga0099796_10000523 3300010159 Bacteria 6545
233 Ga0105239_10001696 3300010375 Bacteria 29043
234 Ga0105239_10016969 3300010375 Bacteria 8048
235 Ga0105239_10050901 3300010375 Bacteria 4542
236 Ga0105239_10067412 3300010375 Bacteria 3931
237 Ga0105239_10154408 3300010375 Bacteria 2563
238 Ga0105239_10302738 3300010375 Bacteria 1800
239 Ga0105246_10010484 3300011119 Bacteria 5736
240 Ga0105246_10199058 3300011119 Bacteria 1556
241 Ga0157373_10004002 3300013100 Bacteria 11114
242 Ga0157371_10013766 3300013102 Bacteria 6130
243 Ga0157370_10003286 3300013104 Bacteria 19065
244 Ga0157370_10026919 3300013104 Bacteria 5672
245 Ga0157370_10040442 3300013104 Bacteria 4502
246 Ga0157370_10071749 3300013104 Bacteria 3267
247 Ga0157370_10077971 3300013104 Bacteria 3120
248 Ga0157370_10095726 3300013104 Bacteria 2785
249 Ga0157370_10103291 3300013104 Bacteria 2668
250 Ga0157369_10005086 3300013105 Bacteria 15396
251 Ga0157369_10011901 3300013105 Bacteria 9882
252 Ga0157369_10038842 3300013105 Bacteria 5204
253 Ga0157369_10069540 3300013105 Bacteria 3782
254 Ga0157374_10005291 3300013296 Bacteria 10834
255 Ga0157374_10135525 3300013296 Bacteria 2387
256 Ga0157374_10240722 3300013296 Bacteria 1779
257 Ga0157378_10011318 3300013297 Bacteria 7807
258 Ga0157378_10238743 3300013297 Bacteria 1735
259 Ga0163162_10014205 3300013306 Bacteria 7780
260 Ga0163162_10195876 3300013306 Bacteria 2149
261 Ga0163162_10205560 3300013306 Bacteria 2098
262 Ga0163162_10242545 3300013306 Bacteria 1933
263 Ga0157372_10010113 3300013307 Bacteria 10021
264 Ga0157372_10020473 3300013307 Bacteria 7138
265 Ga0157372_10070760 3300013307 Bacteria 3926
266 Ga0157372_10076305 3300013307 Bacteria 3784
267 Ga0157372_10084797 3300013307 Bacteria 3592
268 Ga0157372_10152536 3300013307 Bacteria 2667
269 Ga0157372_10285537 3300013307 Bacteria 1919
270 Ga0157372_10396830 3300013307 Bacteria 1608
271 Ga0157375_10013496 3300013308 Bacteria 7275
272 Ga0157375_10014079 3300013308 Bacteria 7131
273 Ga0157375_10016136 3300013308 Bacteria 6700
274 Ga0163163_10003162 3300014325 Bacteria 13951
275 Ga0163163_10095390 3300014325 Bacteria 2994
276 Ga0163163_10136234 3300014325 Bacteria 2496
277 Ga0182008_10005975 3300014497 Bacteria 6859
278 Ga0157379_10139777 3300014968 Bacteria 2183
279 Ga0157376_10027977 3300014969 Bacteria 4476
280 Ga0157376_10121790 3300014969 Bacteria 2313
281 Ga0157376_10303274 3300014969 Bacteria 1513
282 Ga0182006_1009528 3300015261 Bacteria 4349
283 Ga0163161_10071302 3300017792 Bacteria 2542
284 Ga0163161_10089968 3300017792 Bacteria 2271
285 Ga0213872_10000803 3300021361 Bacteria 22846
286 Ga0213872_10098001 3300021361 Bacteria 1308
287 Ga0213874_10007376 3300021377 Bacteria 2637
288 Ga0213871_10004773 3300021441 Bacteria 2742
289 Ga0209760_100142 3300025207 Bacteria 45212
290 Ga0209784_100020 3300025224 Bacteria 412353
291 Ga0209784_100025 3300025224 Bacteria 376681
292 Ga0209566_100020 3300025225 Bacteria 412353
293 Ga0209566_100025 3300025225 Bacteria 376681
294 Ga0209674_100035 3300025226 Bacteria 412353
295 Ga0209674_100042 3300025226 Bacteria 376681
296 Ga0209563_100038 3300025230 Bacteria 412353
297 Ga0209563_100046 3300025230 Bacteria 376681
298 Ga0207427_100004 3300025231 Bacteria 939600
299 Ga0207427_100357 3300025231 Bacteria 28694
300 Ga0209437_100025 3300025233 Bacteria 561333
301 Ga0209437_100274 3300025233 Bacteria 76581
302 Ga0209677_100027 3300025253 Bacteria 376681
303 Ga0209677_100117 3300025253 Bacteria 82118
304 Ga0209677_100937 3300025253 Bacteria 14279
305 Ga0209233_1000060 3300025261 Bacteria 412379
306 Ga0209233_1000145 3300025261 Bacteria 188955
307 Ga0209233_1001494 3300025261 Bacteria 9194
308 Ga0209455_1000462 3300025272 Bacteria 30709
309 Ga0209455_1006887 3300025272 Bacteria 3297
310 Ga0209675_1000445 3300025291 Bacteria 32155
311 Ga0209025_1000019 3300025294 Bacteria 631548
312 Ga0209564_1001354 3300025295 Bacteria 25872
313 Ga0209758_1004698 3300025297 Bacteria 11156
314 Ga0209758_1009495 3300025297 Bacteria 6031
315 Ga0209758_1043917 3300025297 Bacteria 1640
316 Ga0207696_1040247 3300025711 Bacteria 1370
317 Ga0207653_10045925 3300025885 Bacteria 1443
318 Ga0207692_10013372 3300025898 Bacteria 3559
319 Ga0207692_10026865 3300025898 Bacteria 2705
320 Ga0207642_10022024 3300025899 Bacteria 2520
321 Ga0207680_10033248 3300025903 Bacteria 2940
322 Ga0207680_10208858 3300025903 Bacteria 1334
323 Ga0207685_10020107 3300025905 Bacteria 2213
324 Ga0207699_10006470 3300025906 Bacteria 5675
325 Ga0207699_10006652 3300025906 Bacteria 5608
326 Ga0207699_10081648 3300025906 Bacteria 2006
327 Ga0207645_10045098 3300025907 Bacteria 2818
328 Ga0207645_10177100 3300025907 Bacteria 1399
329 Ga0207705_10017874 3300025909 Bacteria 5072
330 Ga0207705_10078242 3300025909 Bacteria 2407
331 Ga0207705_10189346 3300025909 Bacteria 1555
332 Ga0207684_10197368 3300025910 Bacteria 1736
333 Ga0207654_10048715 3300025911 Bacteria 2426
334 Ga0207707_10006804 3300025912 Bacteria 9975
335 Ga0207707_10019522 3300025912 Bacteria 5917
336 Ga0207707_10037004 3300025912 Bacteria 4264
337 Ga0207707_10123088 3300025912 Bacteria 2268
338 Ga0207695_10008300 3300025913 Bacteria 13014
339 Ga0207695_10107402 3300025913 Bacteria 2776
340 Ga0207695_10506335 3300025913 Bacteria 1089
341 Ga0207671_10033572 3300025914 Bacteria 3816
342 Ga0207671_10125560 3300025914 Bacteria 1965
343 Ga0207671_10169230 3300025914 Bacteria 1696
344 Ga0207671_10176353 3300025914 Bacteria 1661
345 Ga0207693_10001763 3300025915 Bacteria 18986
346 Ga0207693_10003380 3300025915 Bacteria 13629
347 Ga0207693_10011875 3300025915 Bacteria 7041
348 Ga0207693_10045197 3300025915 Bacteria 3461
349 Ga0207693_10080594 3300025915 Bacteria 2548
350 Ga0207693_10127089 3300025915 Bacteria 2004
351 Ga0207663_10012696 3300025916 Bacteria 4561
352 Ga0207663_10054175 3300025916 Bacteria 2510
353 Ga0207663_10065085 3300025916 Bacteria 2329
354 Ga0207663_10298074 3300025916 Bacteria 1203
355 Ga0207660_10063010 3300025917 Bacteria 2672
356 Ga0207660_10089625 3300025917 Bacteria 2277
357 Ga0207660_10138257 3300025917 Bacteria 1860
358 Ga0207662_10088843 3300025918 Bacteria 1898
359 Ga0207662_10194990 3300025918 Bacteria 1308
360 Ga0207657_10018284 3300025919 Bacteria 6701
361 Ga0207657_10028761 3300025919 Bacteria 5065
362 Ga0207657_10055214 3300025919 Bacteria 3432
363 Ga0207657_10059358 3300025919 Bacteria 3287
364 Ga0207649_10092019 3300025920 Bacteria 1987
365 Ga0207652_10047048 3300025921 Bacteria 3684
366 Ga0207652_10092056 3300025921 Bacteria 2667
367 Ga0207652_10095660 3300025921 Bacteria 2616
368 Ga0207652_10100679 3300025921 Bacteria 2551
369 Ga0207652_10147395 3300025921 Bacteria 2107
370 Ga0207652_10149939 3300025921 Bacteria 2088
371 Ga0207652_10230812 3300025921 Bacteria 1668
372 Ga0207694_10000021 3300025924 Bacteria 300246
373 Ga0207694_10014493 3300025924 Bacteria 5943
374 Ga0207694_10032380 3300025924 Bacteria 4001
375 Ga0207694_10128607 3300025924 Bacteria 2029
376 Ga0207694_10164092 3300025924 Bacteria 1796
377 Ga0207694_10190355 3300025924 Bacteria 1666
378 Ga0207650_10249867 3300025925 Bacteria 1435
379 Ga0207687_10023754 3300025927 Bacteria 4089
380 Ga0207687_10092182 3300025927 Bacteria 2212
381 Ga0207700_10002100 3300025928 Bacteria 11375
382 Ga0207700_10020769 3300025928 Bacteria 4469
383 Ga0207700_10109006 3300025928 Bacteria 2224
384 Ga0207664_10045808 3300025929 Bacteria 3431
385 Ga0207664_10088331 3300025929 Bacteria 2536
386 Ga0207644_10162561 3300025931 Bacteria 1736
387 Ga0207690_10085645 3300025932 Bacteria 2213
388 Ga0207706_10042434 3300025933 Bacteria 4032
389 Ga0207706_10160692 3300025933 Bacteria 1975
390 Ga0207686_10006690 3300025934 Bacteria 6213
391 Ga0207686_10066018 3300025934 Bacteria 2309
392 Ga0207670_10055542 3300025936 Bacteria 2677
393 Ga0207670_10157481 3300025936 Bacteria 1692
394 Ga0207669_10026914 3300025937 Bacteria 3137
395 Ga0207669_10049350 3300025937 Bacteria 2508
396 Ga0207704_10074988 3300025938 Bacteria 2161
397 Ga0207665_10004373 3300025939 Bacteria 9383
398 Ga0207665_10046616 3300025939 Bacteria 2904
399 Ga0207691_10056876 3300025940 Bacteria 3562
400 Ga0207711_10052845 3300025941 Bacteria 3483
401 Ga0207711_10064437 3300025941 Bacteria 3165
402 Ga0207711_10085575 3300025941 Bacteria 2762
403 Ga0207711_10238315 3300025941 Bacteria 1668
404 Ga0207689_10080792 3300025942 Bacteria 2672
405 Ga0207689_10175812 3300025942 Bacteria 1765
406 Ga0207661_10010608 3300025944 Bacteria 6638
407 Ga0207679_10055726 3300025945 Bacteria 2915
408 Ga0207667_10000019 3300025949 Bacteria 386233
409 Ga0207667_10032188 3300025949 Bacteria 5654
410 Ga0207667_10066976 3300025949 Bacteria 3741
411 Ga0207667_10098018 3300025949 Bacteria 3025
412 Ga0207667_10112866 3300025949 Bacteria 2802
413 Ga0207667_10290962 3300025949 Bacteria 1669
414 Ga0207651_10021775 3300025960 Bacteria 3904
415 Ga0207651_10306283 3300025960 Bacteria 1323
416 Ga0207712_10335191 3300025961 Bacteria 1253
417 Ga0207712_10375655 3300025961 Bacteria 1188
418 Ga0207668_10078489 3300025972 Bacteria 2384
419 Ga0207668_10121912 3300025972 Bacteria 1975
420 Ga0207668_10122768 3300025972 Bacteria 1969
421 Ga0207640_10088917 3300025981 Bacteria 2134
422 Ga0207640_10168625 3300025981 Bacteria 1629
423 Ga0207677_10078568 3300026023 Bacteria 2357
424 Ga0207703_10037438 3300026035 Bacteria 3864
425 Ga0207703_10111792 3300026035 Bacteria 2333
426 Ga0207639_10066141 3300026041 Bacteria 2808
427 Ga0207639_10254755 3300026041 Bacteria 1532
428 Ga0207678_10024312 3300026067 Bacteria 5291
429 Ga0207678_10061718 3300026067 Bacteria 3224
430 Ga0207678_10073139 3300026067 Bacteria 2938
431 Ga0207678_10182169 3300026067 Bacteria 1794
432 Ga0207708_10062247 3300026075 Bacteria 2850
433 Ga0207708_10074055 3300026075 Bacteria 2610
434 Ga0207702_10035585 3300026078 Bacteria 4164
435 Ga0207702_10336994 3300026078 Bacteria 1440
436 Ga0207641_10149459 3300026088 Bacteria 2115
437 Ga0207648_10031432 3300026089 Bacteria 4695
438 Ga0207648_10116198 3300026089 Bacteria 2351
439 Ga0207648_10287232 3300026089 Bacteria 1472
440 Ga0207676_10072689 3300026095 Bacteria 2765
441 Ga0207676_10213237 3300026095 Bacteria 1714
442 Ga0207674_10138731 3300026116 Bacteria 2392
443 Ga0207674_10186388 3300026116 Bacteria 2025
444 Ga0207674_10283413 3300026116 Bacteria 1605
445 Ga0207674_10295157 3300026116 Bacteria 1570
446 Ga0207675_100053059 3300026118 Bacteria 3784
447 Ga0207675_100306520 3300026118 Bacteria 1548
448 Ga0207675_100549707 3300026118 Bacteria 1154
449 Ga0207675_100586454 3300026118 Bacteria 1117
450 Ga0207683_10013945 3300026121 Bacteria 6853
451 Ga0207683_10014942 3300026121 Bacteria 6609
452 Ga0207683_10064283 3300026121 Bacteria 3233
453 Ga0207683_10434419 3300026121 Bacteria 1210
454 Ga0209281_1016135 3300027111 Bacteria 1540
455 Ga0209179_1023956 3300027512 Bacteria 1208
456 Ga0209588_1009342 3300027671 Bacteria 2930
457 Ga0209813_10039646 3300027866 Bacteria 1428
458 Ga0268266_10009413 3300028379 Bacteria 8605
459 Ga0268266_10032359 3300028379 Bacteria 4444
460 Ga0268266_10036611 3300028379 Bacteria 4178
461 Ga0268266_10053239 3300028379 Bacteria 3476
462 Ga0268266_10081416 3300028379 Bacteria 2823
463 Ga0268266_10380684 3300028379 Bacteria 1331
464 Ga0268265_10014881 3300028380 Bacteria 5310
465 Ga0268265_10124226 3300028380 Bacteria 2132
466 Ga0268265_10257104 3300028380 Bacteria 1550
467 Ga0268264_10023027 3300028381 Bacteria 5083
468 Ga0268264_10063077 3300028381 Bacteria 3114
469 Ga0265326_10002066 3300028558 Bacteria 6837
470 Ga0265319_1001508 3300028563 Bacteria 13832
471 Ga0265334_10000614 3300028573 Bacteria 17940
472 Ga0265318_10002674 3300028577 Bacteria 9373
473 Ga0265323_10003948 3300028653 Bacteria 6445
474 Ga0265336_10000259 3300028666 Bacteria 37606
475 Ga0265338_10000013 3300028800 Bacteria 379065
476 Ga0265324_10000235 3300029957 Bacteria 41792
477 Ga0265330_10010495 3300031235 Bacteria 4363
478 Ga0265330_10083704 3300031235 Bacteria 1373
479 Ga0265328_10067757 3300031239 Bacteria 1311
480 Ga0265325_10012884 3300031241 Bacteria 4770
481 Ga0265340_10015613 3300031247 Bacteria 3944
482 Ga0265339_10022247 3300031249 Bacteria 3676
483 Ga0265339_10040494 3300031249 Bacteria 2589
484 Ga0265331_10037267 3300031250 Bacteria 2382
485 Ga0265316_10239343 3300031344 Bacteria 1335
486 Ga0307408_100070810 3300031548 Bacteria 2576
487 Ga0307508_10000058 3300031616 Bacteria 125293
488 Ga0307508_10006654 3300031616 Bacteria 10852
489 Ga0265342_10075616 3300031712 Bacteria 1953
490 Ga0307516_10038712 3300031730 Bacteria 4756
491 Ga0307405_10147464 3300031731 Bacteria 1650
492 Ga0307406_10165628 3300031901 Bacteria 1594
493 Ga0307416_100163465 3300032002 Bacteria 2061
494 Ga0307411_10090159 3300032005 Bacteria 2138
495 Ga0307415_100024425 3300032126 Bacteria 3773
496 Ga0307415_100083825 3300032126 Bacteria 2285
497 Ga0307507_10103121 3300033179 Bacteria 2376
498 Ga0307510_10010251 3300033180 Bacteria 11142
499 Ga0315911_1000014 3300033442 Bacteria 207605
500 Ga0373938_0010138 3300034957 Bacteria 1724
501 Ga0373928_0008035 3300035084 Bacteria 2043
502 Ga0373934_0051067 3300035086 Bacteria 1639
503 Ga0373951_0019493 3300035091 Bacteria 1547
504 Ga0373923_0009270 3300035111 Bacteria 3547
505 Ga0373923_0118195 3300035111 Bacteria 1182
506 Ga0373943_0007309 3300035170 Bacteria 4958
507 Ga0373943_0018390 3300035170 Bacteria 3210
508 Ga0373946_0021866 3300035171 Bacteria 2484
509 Ga0373946_0088103 3300035171 Bacteria 1371
510 Ga0373955_0164291 3300035172 Bacteria 1312
511 Ga0373962_0017066 3300035242 Bacteria 1879
512 Ga0373924_0006573 3300035410 Bacteria 4168
513 Ga0373931_0012384 3300035691 Bacteria 4132
514 Ga0373931_0032579 3300035691 Bacteria 2697
515 Ga0373931_0053757 3300035691 Bacteria 2150
516 Ga0373935_0018884 3300035692 Bacteria 4202
517 Ga0373927_0016422 3300035695 Bacteria 4882
518 Ga0373927_0072473 3300035695 Bacteria 2229
519 Ga0373927_0094837 3300035695 Bacteria 1939
520 Ga0373927_0098182 3300035695 Bacteria 1904
521 Ga0373927_0136103 3300035695 Bacteria 1605
522 Ga0373933_0000052 3300035724 Bacteria 70592
523 Ga0373933_0003499 3300035724 Bacteria 8744
524 Ga0373933_0011933 3300035724 Bacteria 4796
525 Ga0373933_0139370 3300035724 Bacteria 1530
526 Ga0373947_0011386 3300035725 Bacteria 5106
527 Ga0373947_0014214 3300035725 Bacteria 4565
528 Ga0373947_0026317 3300035725 Bacteria 3399
529 Ga0373937_0060000 3300036401 Bacteria 3495
530 Ga0373937_0215787 3300036401 Bacteria 1806
531 Ga0373925_0105607 3300037068 Bacteria 2170
532 Ga0395899_0097674 3300037312 Bacteria 2123
533 Ga0395900_0019659 3300037418 Bacteria 6886
534 Ga0395900_0060117 3300037418 Bacteria 3911
535 Ga0395900_0080473 3300037418 Bacteria 3348
536 Ga0395898_0067674 3300037466 Bacteria 3457
537 Ga0395898_0085136 3300037466 Bacteria 3047
538 Ga0436364_0391517 3300037853 Bacteria 4832
539 Ga0436364_1366209 3300037853 Bacteria 29318
540 Ga0436364_1560306 3300037853 Bacteria 8813
541 Ga0395901_0052080 3300038443 Bacteria 4255
542 Ga0395901_0090577 3300038443 Bacteria 3201
543 Ga0400483_159836 3300039062 Bacteria 2290
544 Ga0436365_0721818 3300039437 Bacteria 1569
545 Ga0436365_1694702 3300039437 Bacteria 1416
546 Ga0436360_0119626 3300039438 Bacteria 5778
547 Ga0436360_0545356 3300039438 Bacteria 2934
548 Ga0436360_0570461 3300039438 Bacteria 5753
549 Ga0436361_0132102 3300039447 Bacteria 51578
550 Ga0436361_0168473 3300039447 Bacteria 40970
551 Ga0436361_1195803 3300039447 Bacteria 5068
552 Ga0436363_0003719 3300039450 Bacteria 3726
553 Ga0436363_0027754 3300039450 Bacteria 2575
554 Ga0436362_1299921 3300039453 Bacteria 4665
555 Ga0466963_0105236 3300044694 Bacteria 1934
556 Ga0466959_0128269 3300045049 Bacteria 1799
557 Ga0466967_0260289 3300045976 Bacteria 1660
558 Ga0495603_0000237 3300046455 Bacteria 28782
559 Ga0495603_0005734 3300046455 Bacteria 7428
560 Ga0495603_0036352 3300046455 Bacteria 2957
561 Ga0495629_0001744 3300046459 Bacteria 17057
562 Ga0495629_0004238 3300046459 Bacteria 10750
563 Ga0495629_0049669 3300046459 Bacteria 2940
564 Ga0495638_0030599 3300046460 Bacteria 3463
565 Ga0495638_0201842 3300046460 Bacteria 1122
566 Ga0495651_0000510 3300046462 Bacteria 30170
567 Ga0495651_0064316 3300046462 Bacteria 2803
568 Ga0495580_0007153 3300046472 Bacteria 8987
569 Ga0495580_0182096 3300046472 Bacteria 1451
570 Ga0495582_0000209 3300046473 Bacteria 32511
571 Ga0495582_0052845 3300046473 Bacteria 2240
572 Ga0495582_0057414 3300046473 Bacteria 2146
573 Ga0495605_0056844 3300046474 Bacteria 1886
574 Ga0495639_0084040 3300046475 Bacteria 1486
575 Ga0495662_0105833 3300046476 Bacteria 1377
576 Ga0495664_0096796 3300046477 Bacteria 1776
577 Ga0495584_0047072 3300046491 Bacteria 2175
578 Ga0495584_0137465 3300046491 Bacteria 1240
579 Ga0495594_0007323 3300046499 Bacteria 5676
580 Ga0495607_0044616 3300046501 Bacteria 2613
581 Ga0495606_0024955 3300046507 Bacteria 4293
582 Ga0495608_0011463 3300046511 Bacteria 6170
583 Ga0495608_0057655 3300046511 Bacteria 2562
584 Ga0495618_0097181 3300046514 Bacteria 1884
585 Ga0495618_0102098 3300046514 Bacteria 1836
586 Ga0495620_0071585 3300046515 Bacteria 1417
587 Ga0495628_0000255 3300046516 Bacteria 47175
588 Ga0495628_0007950 3300046516 Bacteria 9136
589 Ga0495628_0086388 3300046516 Bacteria 2432
590 Ga0495630_0052798 3300046517 Bacteria 3043
591 Ga0495648_0008054 3300046524 Bacteria 8338
592 Ga0495642_0060991 3300046528 Bacteria 1565
593 Ga0495652_0005967 3300046529 Bacteria 11391
594 Ga0495652_0033776 3300046529 Bacteria 4462
595 Ga0495652_0046208 3300046529 Bacteria 3740
596 Ga0495652_0123910 3300046529 Bacteria 2056
597 Ga0495652_0186410 3300046529 Bacteria 1587
598 Ga0495665_0020920 3300046531 Bacteria 3515
599 Ga0495640_0081469 3300046533 Bacteria 2151
600 Ga0495598_0033410 3300046537 Bacteria 1460
601 Ga0495645_0039978 3300046543 Bacteria 3421
602 Ga0495645_0137663 3300046543 Bacteria 1706
603 Ga0495622_0054346 3300046557 Bacteria 1858
604 Ga0495622_0065566 3300046557 Bacteria 1679
605 Ga0495667_0019470 3300046559 Bacteria 4579
606 Ga0495656_0146496 3300046615 Bacteria 1137
607 Ga0495634_0024924 3300046642 Bacteria 4192
608 Ga0495634_0048802 3300046642 Bacteria 2848
609 Ga0495625_0112099 3300046660 Bacteria 1863
610 Ga0495635_0020554 3300046663 Bacteria 4599
611 Ga0495635_0061279 3300046663 Bacteria 2584
612 Ga0495661_0004458 3300046665 Bacteria 10101
613 Ga0495588_0017035 3300046674 Bacteria 3521
614 Ga0495599_0001959 3300046678 Bacteria 11923
615 Ga0495599_0114372 3300046678 Bacteria 1679
616 Ga0495623_0005774 3300046679 Bacteria 8075
617 Ga0495623_0035769 3300046679 Bacteria 3183
618 Ga0495623_0039704 3300046679 Bacteria 3006
619 Ga0495646_0000288 3300046680 Bacteria 25753
620 Ga0495646_0011017 3300046680 Bacteria 5744
621 Ga0495646_0029092 3300046680 Bacteria 3455
622 Ga0495646_0059835 3300046680 Bacteria 2274
623 Ga0495646_0133199 3300046680 Bacteria 1397
624 Ga0495647_0004901 3300046681 Bacteria 4378
625 Ga0495647_0008249 3300046681 Bacteria 3500
626 Ga0495658_0002765 3300046683 Bacteria 8814
627 Ga0495658_0129133 3300046683 Bacteria 1536
628 Ga0495613_0006926 3300046689 Bacteria 8455
629 Ga0495613_0015743 3300046689 Bacteria 5629
630 Ga0495624_0119753 3300046690 Bacteria 1617
631 Ga0495670_0022766 3300046691 Bacteria 3094
632 Ga0495670_0079816 3300046691 Bacteria 1666
633 Ga0495671_0107774 3300046692 Bacteria 1360
634 Ga0495600_0001174 3300046809 Bacteria 14297
635 Ga0495600_0111444 3300046809 Bacteria 1782
636 Ga0495581_0146038 3300047315 Bacteria 1380
637 Ga0495604_0022940 3300047317 Bacteria 4980
638 Ga0495604_0034583 3300047317 Bacteria 3997
639 Ga0495674_0020318 3300047319 Bacteria 6151
640 Ga0495674_0233961 3300047319 Bacteria 1516
641 Ga0495672_0022077 3300047320 Bacteria 4143
642 Ga0495672_0068207 3300047320 Bacteria 2022
643 Ga0495680_0017053 3300047322 Bacteria 6215
644 Ga0495680_0116518 3300047322 Bacteria 1975
645 Ga0495677_0066157 3300047445 Bacteria 1344
646 Ga0495677_0069260 3300047445 Bacteria 1314
647 Ga0495673_0026512 3300047469 Bacteria 2770
648 Ga0495673_0067899 3300047469 Bacteria 1508
649 Ga0495684_0071851 3300047471 Bacteria 2629
650 Ga0495686_0063377 3300047472 Bacteria 2291
651 Ga0495593_0026578 3300047673 Bacteria 3194
652 Ga0495602_0099099 3300048088 Bacteria 2396
653 Ga0495615_0027781 3300048090 Bacteria 1331
654 Ga0496100_0069422 3300048903 Bacteria 2346
655 Ga0496100_0214223 3300048903 Bacteria 1410
656 Ga0496101_0003983 3300048904 Bacteria 9239
657 Ga0496101_0004598 3300048904 Bacteria 8715
658 Ga0496101_0170441 3300048904 Bacteria 1673
659 Ga0496102_0036873 3300048905 Bacteria 4407
660 Ga0496102_0047035 3300048905 Bacteria 3919
661 Ga0496102_0106646 3300048905 Bacteria 2608
662 Ga0496102_0148461 3300048905 Bacteria 2201
663 Ga0496102_0244749 3300048905 Bacteria 1691
664 Ga0496103_0027984 3300048906 Bacteria 3420
665 Ga0496104_0201452 3300048907 Bacteria 1902
666 Ga0496104_0320263 3300048907 Bacteria 1463
667 Ga0496105_0019393 3300048908 Bacteria 5486
668 Ga0496105_0083448 3300048908 Bacteria 2639
669 Ga0496105_0245282 3300048908 Bacteria 1452
670 Ga0496106_0015623 3300048909 Bacteria 5615
671 Ga0496106_0064606 3300048909 Bacteria 2784
672 Ga0496106_0092555 3300048909 Bacteria 2335
673 Ga0496106_0210800 3300048909 Bacteria 1548
674 Ga0496107_0010397 3300048910 Bacteria 6464
675 Ga0496107_0043807 3300048910 Bacteria 3216
676 Ga0496108_0013147 3300048911 Bacteria 6747
677 Ga0496108_0076929 3300048911 Bacteria 2821
678 Ga0496108_0084762 3300048911 Bacteria 2689
679 Ga0496108_0098795 3300048911 Bacteria 2487
680 Ga0496108_0126122 3300048911 Bacteria 2198
681 Ga0496108_0198153 3300048911 Bacteria 1742
682 Ga0496109_0003060 3300048912 Bacteria 13938
683 Ga0496109_0009741 3300048912 Bacteria 8201
684 Ga0496109_0022826 3300048912 Bacteria 5545
685 Ga0496109_0025677 3300048912 Bacteria 5251
686 Ga0496109_0072594 3300048912 Bacteria 3162
687 Ga0496109_0126181 3300048912 Bacteria 2386
688 Ga0496109_0190268 3300048912 Bacteria 1928
689 Ga0496110_0000835 3300048913 Bacteria 21651
690 Ga0496110_0036867 3300048913 Bacteria 4248
691 Ga0496110_0102583 3300048913 Bacteria 2565
692 Ga0496111_0015624 3300048914 Bacteria 5216
693 Ga0496111_0021680 3300048914 Bacteria 4489
694 Ga0496111_0026839 3300048914 Bacteria 4069
695 Ga0496111_0088213 3300048914 Bacteria 2271
696 Ga0496112_0063726 3300048915 Bacteria 3636
697 Ga0496112_0069352 3300048915 Bacteria 3482
698 Ga0496112_0177658 3300048915 Bacteria 2093
699 Ga0496112_0279380 3300048915 Bacteria 1617
700 Ga0496113_0026582 3300048916 Bacteria 4139
701 Ga0496113_0030668 3300048916 Bacteria 3894
702 Ga0496113_0045484 3300048916 Bacteria 3256
703 Ga0496113_0323992 3300048916 Bacteria 1235
704 Ga0496114_0003347 3300048917 Bacteria 12322
705 Ga0496114_0008640 3300048917 Bacteria 8073
706 Ga0496114_0050543 3300048917 Bacteria 3460
707 Ga0496115_0003657 3300048918 Bacteria 11062
708 Ga0496115_0036962 3300048918 Bacteria 3868
709 Ga0496115_0091940 3300048918 Bacteria 2480
710 Ga0496116_0001928 3300048919 Bacteria 22348
711 Ga0496117_0027483 3300048920 Bacteria 4433
712 Ga0496118_0167943 3300048921 Bacteria 1345
713 Ga0496118_0192205 3300048921 Bacteria 1219
714 Ga0496119_0078905 3300048922 Bacteria 1903
715 Ga0496121_0007527 3300048924 Bacteria 13133
716 Ga0496121_0019033 3300048924 Bacteria 6888
717 Ga0496121_0023274 3300048924 Bacteria 5972
718 Ga0496121_0047981 3300048924 Bacteria 3638
719 Ga0496121_0057573 3300048924 Bacteria 3220
720 Ga0496121_0063518 3300048924 Bacteria 3016
721 Ga0496121_0088385 3300048924 Bacteria 2429
722 Ga0496122_0006874 3300048925 Bacteria 12878
723 Ga0496122_0022165 3300048925 Bacteria 5656
724 Ga0496123_0011180 3300048926 Bacteria 7813
725 Ga0496123_0022126 3300048926 Bacteria 4911
726 Ga0496124_0000047 3300048927 Bacteria 285554
727 Ga0496124_0047724 3300048927 Bacteria 3662
728 Ga0496124_0164777 3300048927 Bacteria 1724
729 Ga0496124_0186356 3300048927 Bacteria 1592
730 Ga0496125_0005281 3300048928 Bacteria 14459
731 Ga0496125_0008194 3300048928 Bacteria 10996
732 Ga0496125_0017373 3300048928 Bacteria 6862
733 Ga0496125_0051331 3300048928 Bacteria 3402
734 Ga0496126_0003871 3300048929 Bacteria 18451
735 Ga0496126_0018816 3300048929 Bacteria 6828
736 Ga0496126_0025649 3300048929 Bacteria 5666
737 Ga0496126_0026313 3300048929 Bacteria 5580
738 Ga0496126_0040240 3300048929 Bacteria 4334
739 Ga0496126_0090975 3300048929 Bacteria 2684
740 Ga0501032_0080115 3300049569 Bacteria 2173
741 Ga0501034_0001506 3300049571 Bacteria 30582
742 Ga0501034_0035126 3300049571 Bacteria 5083
743 Ga0501036_0002386 3300049572 Bacteria 14684
744 Ga0501036_0024528 3300049572 Bacteria 5085
745 Ga0501036_0097751 3300049572 Bacteria 2481
746 Ga0501037_0003431 3300049573 Bacteria 11519
747 Ga0501037_0017074 3300049573 Bacteria 5340
748 Ga0501037_0061534 3300049573 Bacteria 2737
749 Ga0501038_0077920 3300049574 Bacteria 2797
750 Ga0501039_0047615 3300049575 Bacteria 3314
751 Ga0501042_0083502 3300049578 Bacteria 2290
752 Ga0501043_0030025 3300049579 Bacteria 4270
753 Ga0501046_0024446 3300049580 Bacteria 4956
754 Ga0501047_0000204 3300049581 Bacteria 71976
755 Ga0501047_0003418 3300049581 Bacteria 15023
756 Ga0501047_0007027 3300049581 Bacteria 10567
757 Ga0501047_0156631 3300049581 Bacteria 2151
758 Ga0501048_0000065 3300049582 Bacteria 53623
759 Ga0501068_0185696 3300049584 Bacteria 1315
760 Ga0501069_0011153 3300049585 Bacteria 4768
761 Ga0501069_0027383 3300049585 Bacteria 3123
762 Ga0501070_0011021 3300049586 Bacteria 7631
763 Ga0501070_0034125 3300049586 Bacteria 4256
764 Ga0501070_0076206 3300049586 Bacteria 2776
765 Ga0501071_0072631 3300049587 Bacteria 2509
766 Ga0501073_0006383 3300049589 Bacteria 8775
767 Ga0501073_0043056 3300049589 Bacteria 3184
768 Ga0501073_0074685 3300049589 Bacteria 2360
769 Ga0501074_0000614 3300049590 Bacteria 22196
770 Ga0501074_0029234 3300049590 Bacteria 3992
771 Ga0501074_0139771 3300049590 Bacteria 1732
772 Ga0501076_0156934 3300049592 Bacteria 1853
773 Ga0501079_0034266 3300049741 Bacteria 3906
774 Ga0501080_0000669 3300049742 Bacteria 27250
775 Ga0501080_0000815 3300049742 Bacteria 25419
776 Ga0501080_0070551 3300049742 Bacteria 3249
777 Ga0501080_0096238 3300049742 Bacteria 2748
778 Ga0501081_0105004 3300049743 Bacteria 2001
779 Ga0501083_0003287 3300049744 Bacteria 11290
780 Ga0501083_0018537 3300049744 Bacteria 4850
781 Ga0501035_0003474 3300049822 Bacteria 15082
782 Ga0501035_0031930 3300049822 Bacteria 4795
783 Ga0501035_0034707 3300049822 Bacteria 4581
784 Ga0501035_0151631 3300049822 Bacteria 2011
785 Ga0501044_0008478 3300049823 Bacteria 11266
786 Ga0501044_0050736 3300049823 Bacteria 4279
787 Ga0501044_0089803 3300049823 Bacteria 3100
788 Ga0501044_0168284 3300049823 Bacteria 2164
789 Ga0501044_0178797 3300049823 Bacteria 2089
790 nmdc:mga03683_5526_c1 3300050489 Bacteria 4273
791 nmdc:mga03n38_58193_c1 3300050490 Bacteria 1750
792 nmdc:mga03n38_73049_c1 3300050490 Bacteria 1592
793 nmdc:mga00v17_3981_c1 3300050491 Bacteria 7624
794 nmdc:mga0yw44_35851_c1 3300050492 Bacteria 2919
795 nmdc:mga0k408_63593_c1 3300050493 Bacteria 2147
796 nmdc:mga06z11_25615_c1 3300050494 Bacteria 2798
797 nmdc:mga04h51_62798_c1 3300050495 Bacteria 1277
798 nmdc:mga05p37_155674_c1 3300050507 Bacteria 2793
799 nmdc:mga05p37_571424_c1 3300050507 Bacteria 1282
800 nmdc:mga08y16_9239_c1 3300050511 Bacteria 10344
801 nmdc:mga0n895_309611_c1 3300050512 Bacteria 1601
802 nmdc:mga0rr50_54899_c1 3300050513 Bacteria 2970
803 nmdc:mga08x19_46628_c1 3300050514 Bacteria 2772
804 nmdc:mga0a205_48370_c1 3300050515 Bacteria 4104
805 Ga0495601_0006786 3300053077 Bacteria 6705
806 Ga0495601_0010642 3300053077 Bacteria 5483
807 Ga0495612_0011588 3300053078 Bacteria 3552
808 Ga0495595_0062494 3300053084 Bacteria 1746
809 Ga0495595_0089254 3300053084 Bacteria 1477
810 Ga0495619_0000439 3300053085 Bacteria 28081
811 Ga0495619_0020595 3300053085 Bacteria 4203
812 Ga0495619_0028612 3300053085 Bacteria 3596
813 Ga0495619_0093575 3300053085 Bacteria 2037
814 Ga0500578_0026796 3300053086 Bacteria 3697
815 Ga0500578_0074268 3300053086 Bacteria 2166
816 Ga0500643_012599 3300053087 Bacteria 3024
817 Ga0500581_041070 3300053089 Bacteria 2369
818 Ga0500651_0004771 3300053093 Bacteria 7645
819 Ga0500566_0057279 3300053094 Bacteria 2213
820 Ga0500640_001878 3300053095 Bacteria 6673
821 Ga0500654_097566 3300053099 Bacteria 1272
822 Ga0500554_001603 3300053102 Bacteria 4358
823 Ga0500556_0000066 3300053104 Bacteria 105850
824 Ga0500562_011695 3300053108 Bacteria 2228
825 Ga0500572_000121 3300053111 Bacteria 26132
826 Ga0500572_000212 3300053111 Bacteria 20613
827 Ga0500592_000667 3300053116 Bacteria 5652
828 Ga0500594_0008535 3300053118 Bacteria 2338
829 Ga0500595_000736 3300053119 Bacteria 19450
830 Ga0500595_001441 3300053119 Bacteria 12702
831 Ga0500595_002340 3300053119 Bacteria 9474
832 Ga0500595_002486 3300053119 Bacteria 9120
833 Ga0500595_032971 3300053119 Bacteria 1723
834 Ga0500614_001327 3300053123 Bacteria 5951
835 Ga0500618_000767 3300053125 Bacteria 18143
836 Ga0500642_0000072 3300053130 Bacteria 55645
837 Ga0500652_000991 3300053131 Bacteria 9298
838 Ga0500655_029869 3300053133 Bacteria 1047
839 Ga0500658_0005728 3300053134 Bacteria 4626
840 Ga0500658_0130220 3300053134 Bacteria 1121
841 Ga0500559_0000246 3300053136 Bacteria 42730
842 Ga0500559_0003571 3300053136 Bacteria 7603
843 Ga0500559_0004708 3300053136 Bacteria 6422
844 Ga0500568_0001230 3300053139 Bacteria 17069
845 Ga0500574_000408 3300053141 Bacteria 5405
846 Ga0500577_0000029 3300053142 Bacteria 34339
847 Ga0500586_003380 3300053145 Bacteria 3765
848 Ga0500603_004567 3300053150 Bacteria 2963
849 Ga0500604_0002609 3300053151 Bacteria 4913
850 Ga0500616_0000177 3300053153 Bacteria 106498
851 Ga0500622_0002476 3300053156 Bacteria 13301
852 Ga0500630_013764 3300053159 Bacteria 3984
853 Ga0500633_0014547 3300053160 Bacteria 2236
854 Ga0500638_033498 3300053162 Bacteria 2484
855 Ga0500638_044831 3300053162 Bacteria 2146
856 Ga0500639_000219 3300053163 Bacteria 28391
857 Ga0500636_0002987 3300053177 Bacteria 9465
858 Ga0500637_0000129 3300053178 Bacteria 27540
859 Ga0500637_0007009 3300053178 Bacteria 5605
860 Ga0500576_061313 3300053725 Bacteria 1644
861 Ga0500596_000276 3300053735 Bacteria 9129
862 Ga0500596_007362 3300053735 Bacteria 1807
863 Ga0500601_002192 3300053737 Bacteria 2099
864 Ga0500661_000658 3300055283 Bacteria 6461
865 Ga0501082_0041781 3300060353 Bacteria 3953
866 Ga0466962_0033405 3300061719 Bacteria 2461

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10115099 Ga0105240_101150994 318
2 3300025912 Ga0207707_10037004 Ga0207707_100370044 318
3 3300035695 Ga0373927_0098182 Ga0373927_0098182_911_1891 320
4 3300039438 Ga0436360_0570461 Ga0436360_0570461_23_1015 320
5 3300046460 Ga0495638_0201842 Ga0495638_0201842_13_993 320
6 3300053102 Ga0500554_001603 Ga0500554_001603_3223_4230 321
7 3300053150 Ga0500603_004567 Ga0500603_004567_870_1877 321
8 3300053178 Ga0500637_0000129 Ga0500637_0000129_4870_5877 321
9 3300053078 Ga0495612_0011588 Ga0495612_0011588_800_1804 322
10 3300053085 Ga0495619_0028612 Ga0495619_0028612_981_1985 322
11 3300025925 Ga0207650_10249867 Ga0207650_102498671 323
12 3300046462 Ga0495651_0064316 Ga0495651_0064316_638_1618 324
13 3300046511 Ga0495608_0011463 Ga0495608_0011463_1483_2463 324
14 3300046516 Ga0495628_0007950 Ga0495628_0007950_5316_6296 324
15 3300046516 Ga0495628_0086388 Ga0495628_0086388_382_1371 324
16 3300046529 Ga0495652_0033776 Ga0495652_0033776_2453_3442 324
17 3300046543 Ga0495645_0137663 Ga0495645_0137663_494_1483 324
18 3300046678 Ga0495599_0001959 Ga0495599_0001959_8103_9083 324
19 3300046679 Ga0495623_0035769 Ga0495623_0035769_136_1116 324
20 3300046680 Ga0495646_0000288 Ga0495646_0000288_2869_3858 324
21 3300046680 Ga0495646_0011017 Ga0495646_0011017_414_1394 324
22 3300046690 Ga0495624_0119753 Ga0495624_0119753_373_1362 324
23 3300046809 Ga0495600_0001174 Ga0495600_0001174_2841_3821 324
24 3300053077 Ga0495601_0006786 Ga0495601_0006786_2876_3856 324
25 3300053119 Ga0500595_002340 Ga0500595_002340_5375_6355 324
26 3300053141 Ga0500574_000408 Ga0500574_000408_1932_2912 324
27 iso_pu_bacteria 2513237087 2513592150 324
28 iso_pu_bacteria 2565956521 2566036709 324
29 iso_pu_bacteria 2508501128 2509148588 325
30 iso_pu_bacteria 2511231156 2511824901 325
31 iso_pu_bacteria 2513237096 2513660154 325
32 iso_pu_bacteria 2513237101 2513693620 325
33 iso_pu_bacteria 2513237137 2513862385 325
34 iso_pu_bacteria 2513237145 2513919398 325
35 iso_pu_bacteria 2517572143 2517894381 325
36 iso_pu_bacteria 2522572158 2523106800 325
37 iso_pu_bacteria 2524023228 2524535715 325
38 iso_pu_bacteria 2602042107 2603856957 325
39 iso_pu_bacteria 2667528175 2671123986 325
40 iso_pu_bacteria 2721755755 2723847520 325
41 iso_pu_bacteria 2728368998 2728753612 325
42 iso_pu_bacteria 2738541271 2738687743 325
43 iso_pu_bacteria 2738543016 2739263822 325
44 iso_pu_bacteria 2791355197 2793071371 325
45 iso_pu_bacteria 2791355199 2793081316 325
46 iso_pu_bacteria 2825651385 2825651765 325
47 iso_pu_bacteria 2857524615 2857528634 325
48 iso_pu_bacteria 2874604998 2874611483 325
49 iso_pu_bacteria 2876808645 2876817051 325
50 iso_pu_bacteria 2879110137 2879117564 325
51 iso_pu_bacteria 2885374607 2885376759 325
52 iso_pu_bacteria 2889033259 2889042282 325
53 iso_pu_bacteria 2893066018 2893066207 325
54 iso_pu_bacteria 2903748898 2903754452 325
55 iso_pu_bacteria 2906610324 2906611111 325
56 iso_pu_bacteria 2906635258 2906636562 325
57 iso_pu_bacteria 2906660503 2906667642 325
58 iso_pu_bacteria 2908739725 2908744635 325
59 iso_pu_bacteria 2919073203 2919076054 325
60 iso_pu_bacteria 2922425934 2922428197 325
61 iso_pu_bacteria 2935630451 2935631906 325
62 iso_pu_bacteria 2941507105 2941507854 325
63 iso_pu_bacteria 2941515067 2941515641 325
64 iso_pu_bacteria 2941523033 2941523784 325
65 iso_pu_bacteria 3005474847 3005478181 325
66 iso_pu_bacteria 8002745576 8002746786 325
67 iso_pu_bacteria 8006933436 8006943033 325
68 iso_pu_bacteria 8006964411 8006970157 325
69 iso_pu_bacteria 8006973647 8006982827 325
70 iso_pu_bacteria 8006984368 8006985440 325
71 iso_pu_bacteria 8006994254 8006994506 325
72 iso_pu_bacteria 8019555841 8019558877 325
73 iso_pu_bacteria 8019565922 8019566433 325
74 iso_pu_bacteria 8056673599 8056681241 325
75 iso_pu_bacteria 8056689827 8056694436 325
76 3300010375 Ga0105239_10302738 Ga0105239_103027382 326
77 3300013100 Ga0157373_10004002 Ga0157373_100040028 326
78 3300013104 Ga0157370_10026919 Ga0157370_100269193 326
79 3300013307 Ga0157372_10010113 Ga0157372_100101139 326
80 3300039062 Ga0400483_159836 Ga0400483_159836_937_1932 326
81 3300039453 Ga0436362_1299921 Ga0436362_1299921_1657_2673 326
82 3300049569 Ga0501032_0080115 Ga0501032_0080115_924_1925 326
83 3300049571 Ga0501034_0001506 Ga0501034_0001506_23594_24595 326
84 3300049571 Ga0501034_0035126 Ga0501034_0035126_1255_2256 326
85 3300049572 Ga0501036_0002386 Ga0501036_0002386_4850_5851 326
86 3300049572 Ga0501036_0024528 Ga0501036_0024528_3398_4399 326
87 3300049572 Ga0501036_0097751 Ga0501036_0097751_686_1687 326
88 3300049573 Ga0501037_0003431 Ga0501037_0003431_4454_5455 326
89 3300049573 Ga0501037_0017074 Ga0501037_0017074_437_1438 326
90 3300049573 Ga0501037_0061534 Ga0501037_0061534_972_1973 326
91 3300049574 Ga0501038_0077920 Ga0501038_0077920_675_1676 326
92 3300049575 Ga0501039_0047615 Ga0501039_0047615_425_1426 326
93 3300049579 Ga0501043_0030025 Ga0501043_0030025_1555_2556 326
94 3300049580 Ga0501046_0024446 Ga0501046_0024446_2216_3217 326
95 3300049581 Ga0501047_0000204 Ga0501047_0000204_53502_54503 326
96 3300049581 Ga0501047_0156631 Ga0501047_0156631_245_1246 326
97 3300049582 Ga0501048_0000065 Ga0501048_0000065_19823_20824 326
98 3300049584 Ga0501068_0185696 Ga0501068_0185696_50_1051 326
99 3300049585 Ga0501069_0027383 Ga0501069_0027383_129_1130 326
100 3300049586 Ga0501070_0011021 Ga0501070_0011021_1876_2877 326
101 3300049586 Ga0501070_0076206 Ga0501070_0076206_764_1765 326
102 3300049587 Ga0501071_0072631 Ga0501071_0072631_794_1795 326
103 3300049589 Ga0501073_0074685 Ga0501073_0074685_954_1955 326
104 3300049590 Ga0501074_0139771 Ga0501074_0139771_397_1398 326
105 3300049742 Ga0501080_0000815 Ga0501080_0000815_8103_9104 326
106 3300049742 Ga0501080_0096238 Ga0501080_0096238_984_1985 326
107 3300049743 Ga0501081_0105004 Ga0501081_0105004_467_1468 326
108 3300049822 Ga0501035_0031930 Ga0501035_0031930_113_1114 326
109 3300049822 Ga0501035_0034707 Ga0501035_0034707_2334_3335 326
110 3300049823 Ga0501044_0008478 Ga0501044_0008478_4915_5916 326
111 3300049823 Ga0501044_0050736 Ga0501044_0050736_890_1891 326
112 3300049823 Ga0501044_0089803 Ga0501044_0089803_1881_2882 326
113 3300049823 Ga0501044_0168284 Ga0501044_0168284_1147_2148 326
114 3300060353 Ga0501082_0041781 Ga0501082_0041781_2641_3642 326
115 3300005329 Ga0070683_100258772 Ga0070683_1002587722 327
116 3300005330 Ga0070690_100010911 Ga0070690_1000109116 327
117 3300005331 Ga0070670_100137806 Ga0070670_1001378062 327
118 3300005335 Ga0070666_10101981 Ga0070666_101019812 327
119 3300005337 Ga0070682_100073266 Ga0070682_1000732663 327
120 3300005339 Ga0070660_100166106 Ga0070660_1001661062 327
121 3300005343 Ga0070687_100110435 Ga0070687_1001104352 327
122 3300005364 Ga0070673_100127265 Ga0070673_1001272652 327
123 3300005366 Ga0070659_100147002 Ga0070659_1001470022 327
124 3300005367 Ga0070667_100406043 Ga0070667_1004060432 327
125 3300005434 Ga0070709_10011082 Ga0070709_100110825 327
126 3300005435 Ga0070714_100063993 Ga0070714_1000639931 327
127 3300005436 Ga0070713_100000550 Ga0070713_10000055014 327
128 3300005437 Ga0070710_10018876 Ga0070710_100188763 327
129 3300005466 Ga0070685_10111379 Ga0070685_101113792 327
130 3300005544 Ga0070686_100010100 Ga0070686_1000101006 327
131 3300009011 Ga0105251_10017050 Ga0105251_100170502 327
132 3300009174 Ga0105241_10007289 Ga0105241_100072893 327
133 3300009551 Ga0105238_10196497 Ga0105238_101964972 327
134 3300010375 Ga0105239_10067412 Ga0105239_100674122 327
135 3300013296 Ga0157374_10240722 Ga0157374_102407221 327
136 3300013306 Ga0163162_10195876 Ga0163162_101958762 327
137 3300014969 Ga0157376_10303274 Ga0157376_103032741 327
138 3300025905 Ga0207685_10020107 Ga0207685_100201073 327
139 3300025911 Ga0207654_10048715 Ga0207654_100487153 327
140 3300025915 Ga0207693_10001763 Ga0207693_1000176310 327
141 3300034957 Ga0373938_0010138 Ga0373938_0010138_586_1590 327
142 3300035084 Ga0373928_0008035 Ga0373928_0008035_1019_2023 327
143 3300035091 Ga0373951_0019493 Ga0373951_0019493_217_1221 327
144 3300035170 Ga0373943_0018390 Ga0373943_0018390_568_1572 327
145 3300035242 Ga0373962_0017066 Ga0373962_0017066_767_1771 327
146 3300035691 Ga0373931_0032579 Ga0373931_0032579_1310_2314 327
147 3300035695 Ga0373927_0072473 Ga0373927_0072473_1066_2070 327
148 3300035725 Ga0373947_0014214 Ga0373947_0014214_3506_4510 327
149 3300046459 Ga0495629_0001744 Ga0495629_0001744_4697_5701 327
150 3300046475 Ga0495639_0084040 Ga0495639_0084040_398_1402 327
151 3300046499 Ga0495594_0007323 Ga0495594_0007323_471_1475 327
152 3300046524 Ga0495648_0008054 Ga0495648_0008054_68_1069 327
153 3300046681 Ga0495647_0008249 Ga0495647_0008249_1351_2355 327
154 3300046683 Ga0495658_0002765 Ga0495658_0002765_2492_3496 327
155 3300046689 Ga0495613_0006926 Ga0495613_0006926_1910_2914 327
156 3300047315 Ga0495581_0146038 Ga0495581_0146038_137_1141 327
157 3300047322 Ga0495680_0017053 Ga0495680_0017053_4726_5730 327
158 3300048903 Ga0496100_0069422 Ga0496100_0069422_1318_2322 327
159 3300048904 Ga0496101_0003983 Ga0496101_0003983_3467_4471 327
160 3300048905 Ga0496102_0148461 Ga0496102_0148461_635_1639 327
161 3300048908 Ga0496105_0245282 Ga0496105_0245282_356_1360 327
162 3300048911 Ga0496108_0013147 Ga0496108_0013147_3000_4004 327
163 3300048911 Ga0496108_0098795 Ga0496108_0098795_95_1099 327
164 3300048913 Ga0496110_0036867 Ga0496110_0036867_104_1108 327
165 3300048913 Ga0496110_0102583 Ga0496110_0102583_1334_2338 327
166 3300048914 Ga0496111_0015624 Ga0496111_0015624_3578_4582 327
167 3300048914 Ga0496111_0021680 Ga0496111_0021680_3380_4384 327
168 3300048915 Ga0496112_0063726 Ga0496112_0063726_2171_3175 327
169 3300048915 Ga0496112_0069352 Ga0496112_0069352_2009_3013 327
170 3300048916 Ga0496113_0026582 Ga0496113_0026582_3000_4004 327
171 3300048917 Ga0496114_0050543 Ga0496114_0050543_1049_2053 327
172 3300048918 Ga0496115_0091940 Ga0496115_0091940_1118_2125 327
173 3300053085 Ga0495619_0000439 Ga0495619_0000439_22353_23357 327
174 iso_pu_bacteria 2891633521 2891636037 327
175 3300005441 Ga0070700_100178922 Ga0070700_1001789221 328
176 3300005937 Ga0081455_10001659 Ga0081455_1000165924 328
177 3300006177 Ga0075362_10005709 Ga0075362_100057093 328
178 3300006871 Ga0075434_100372320 Ga0075434_1003723202 328
179 3300009094 Ga0111539_10015461 Ga0111539_100154612 328
180 3300009147 Ga0114129_10030277 Ga0114129_100302776 328
181 3300025291 Ga0209675_1000445 Ga0209675_10004459 328
182 3300031249 Ga0265339_10040494 Ga0265339_100404943 328
183 3300036401 Ga0373937_0215787 Ga0373937_0215787_667_1674 328
184 3300037853 Ga0436364_1366209 Ga0436364_1366209_20245_21261 328
185 3300049823 Ga0501044_0178797 Ga0501044_0178797_942_1952 328
186 3300050489 nmdc:mga03683_5526_c1 nmdc:mga03683_5526_c1_1904_2914 328
187 3300050507 nmdc:mga05p37_155674_c1 nmdc:mga05p37_155674_c1_967_1977 328
188 3300050511 nmdc:mga08y16_9239_c1 nmdc:mga08y16_9239_c1_3735_4745 328
189 iso_pu_bacteria 2917699015 2917703495 328
190 2162886007 SwRhRL2b_contig_421928 SwRhRL2b_0309.00003010 329
191 3300002737 JGI25162J39368_1000303 JGI25162J39368_10003039 329
192 3300002771 JGI25163J39215_1000073 JGI25163J39215_10000739 329
193 3300002772 JGI25164J39214_1000222 JGI25164J39214_100022235 329
194 3300003214 JGI25165J46597_1000409 JGI25165J46597_10004099 329
195 3300003659 JGI25404J52841_10002179 JGI25404J52841_100021791 329
196 3300005288 Ga0065714_10002440 Ga0065714_1000244025 329
197 3300005289 Ga0065704_10070871 Ga0065704_1007087111 329
198 3300005290 Ga0065712_10149151 Ga0065712_101491512 329
199 3300005329 Ga0070683_100480830 Ga0070683_1004808301 329
200 3300005330 Ga0070690_100100581 Ga0070690_1001005812 329
201 3300005330 Ga0070690_100127371 Ga0070690_1001273712 329
202 3300005331 Ga0070670_100425712 Ga0070670_1004257121 329
203 3300005334 Ga0068869_100118220 Ga0068869_1001182201 329
204 3300005334 Ga0068869_100165040 Ga0068869_1001650402 329
205 3300005336 Ga0070680_100091191 Ga0070680_1000911912 329
206 3300005336 Ga0070680_100138359 Ga0070680_1001383592 329
207 3300005336 Ga0070680_100144216 Ga0070680_1001442162 329
208 3300005337 Ga0070682_100013240 Ga0070682_1000132403 329
209 3300005340 Ga0070689_100200571 Ga0070689_1002005712 329
210 3300005340 Ga0070689_100264087 Ga0070689_1002640872 329
211 3300005341 Ga0070691_10019427 Ga0070691_100194273 329
212 3300005344 Ga0070661_100256191 Ga0070661_1002561912 329
213 3300005347 Ga0070668_100107536 Ga0070668_1001075362 329
214 3300005353 Ga0070669_100048294 Ga0070669_1000482942 329
215 3300005353 Ga0070669_100072345 Ga0070669_1000723452 329
216 3300005355 Ga0070671_100052533 Ga0070671_1000525333 329
217 3300005355 Ga0070671_100099616 Ga0070671_1000996162 329
218 3300005356 Ga0070674_100027167 Ga0070674_1000271672 329
219 3300005366 Ga0070659_100104900 Ga0070659_1001049002 329
220 3300005367 Ga0070667_100206242 Ga0070667_1002062422 329
221 3300005434 Ga0070709_10002767 Ga0070709_1000276710 329
222 3300005434 Ga0070709_10013113 Ga0070709_100131134 329
223 3300005435 Ga0070714_100131195 Ga0070714_1001311951 329
224 3300005435 Ga0070714_100149682 Ga0070714_1001496822 329
225 3300005436 Ga0070713_100029112 Ga0070713_1000291122 329
226 3300005436 Ga0070713_100031737 Ga0070713_1000317374 329
227 3300005437 Ga0070710_10018621 Ga0070710_100186214 329
228 3300005437 Ga0070710_10040195 Ga0070710_100401952 329
229 3300005439 Ga0070711_100009943 Ga0070711_1000099434 329
230 3300005439 Ga0070711_100014342 Ga0070711_1000143423 329
231 3300005439 Ga0070711_100021650 Ga0070711_1000216502 329
232 3300005455 Ga0070663_100000736 Ga0070663_10000073610 329
233 3300005455 Ga0070663_100131854 Ga0070663_1001318542 329
234 3300005455 Ga0070663_100156860 Ga0070663_1001568602 329
235 3300005455 Ga0070663_100163807 Ga0070663_1001638072 329
236 3300005456 Ga0070678_100001495 Ga0070678_1000014955 329
237 3300005456 Ga0070678_100027494 Ga0070678_1000274942 329
238 3300005457 Ga0070662_100118960 Ga0070662_1001189601 329
239 3300005458 Ga0070681_10025079 Ga0070681_100250795 329
240 3300005458 Ga0070681_10048540 Ga0070681_100485404 329
241 3300005459 Ga0068867_100020022 Ga0068867_1000200221 329
242 3300005459 Ga0068867_100176966 Ga0068867_1001769661 329
243 3300005467 Ga0070706_100133864 Ga0070706_1001338642 329
244 3300005471 Ga0070698_100209429 Ga0070698_1002094292 329
245 3300005530 Ga0070679_100014293 Ga0070679_1000142937 329
246 3300005530 Ga0070679_100047120 Ga0070679_1000471204 329
247 3300005530 Ga0070679_100268687 Ga0070679_1002686872 329
248 3300005530 Ga0070679_100287992 Ga0070679_1002879921 329
249 3300005544 Ga0070686_100067858 Ga0070686_1000678583 329
250 3300005544 Ga0070686_100257394 Ga0070686_1002573941 329
251 3300005546 Ga0070696_100118754 Ga0070696_1001187541 329
252 3300005548 Ga0070665_100020717 Ga0070665_1000207172 329
253 3300005548 Ga0070665_100069514 Ga0070665_1000695143 329
254 3300005548 Ga0070665_100076366 Ga0070665_1000763663 329
255 3300005548 Ga0070665_100108349 Ga0070665_1001083492 329
256 3300005563 Ga0068855_100053720 Ga0068855_1000537203 329
257 3300005563 Ga0068855_100095032 Ga0068855_1000950323 329
258 3300005563 Ga0068855_100106579 Ga0068855_1001065793 329
259 3300005564 Ga0070664_100009890 Ga0070664_1000098901 329
260 3300005564 Ga0070664_100239772 Ga0070664_1002397722 329
261 3300005577 Ga0068857_100055630 Ga0068857_1000556302 329
262 3300005614 Ga0068856_100044511 Ga0068856_1000445112 329
263 3300005616 Ga0068852_100010158 Ga0068852_1000101582 329
264 3300005617 Ga0068859_100005475 Ga0068859_1000054752 329
265 3300005617 Ga0068859_100107766 Ga0068859_1001077662 329
266 3300005617 Ga0068859_100142811 Ga0068859_1001428112 329
267 3300005618 Ga0068864_100401438 Ga0068864_1004014381 329
268 3300005718 Ga0068866_10008172 Ga0068866_100081722 329
269 3300005719 Ga0068861_100047868 Ga0068861_1000478683 329
270 3300005841 Ga0068863_100154161 Ga0068863_1001541612 329
271 3300005842 Ga0068858_100020207 Ga0068858_1000202074 329
272 3300005842 Ga0068858_100112360 Ga0068858_1001123601 329
273 3300005843 Ga0068860_100037218 Ga0068860_1000372183 329
274 3300005844 Ga0068862_100163005 Ga0068862_1001630051 329
275 3300005937 Ga0081455_10006992 Ga0081455_100069929 329
276 3300005937 Ga0081455_10012994 Ga0081455_100129941 329
277 3300005937 Ga0081455_10017230 Ga0081455_100172302 329
278 3300005937 Ga0081455_10131669 Ga0081455_101316692 329
279 3300005937 Ga0081455_10167437 Ga0081455_101674371 329
280 3300005983 Ga0081540_1000918 Ga0081540_100091821 329
281 3300005983 Ga0081540_1001903 Ga0081540_100190311 329
282 3300005983 Ga0081540_1008878 Ga0081540_10088784 329
283 3300005983 Ga0081540_1011330 Ga0081540_10113302 329
284 3300005983 Ga0081540_1029456 Ga0081540_10294563 329
285 3300005983 Ga0081540_1030924 Ga0081540_10309242 329
286 3300005983 Ga0081540_1034951 Ga0081540_10349512 329
287 3300005983 Ga0081540_1085163 Ga0081540_10851631 329
288 3300005985 Ga0081539_10013000 Ga0081539_100130002 329
289 3300005985 Ga0081539_10040848 Ga0081539_100408481 329
290 3300006038 Ga0075365_10143290 Ga0075365_101432902 329
291 3300006042 Ga0075368_10042163 Ga0075368_100421632 329
292 3300006051 Ga0075364_10029741 Ga0075364_100297412 329
293 3300006051 Ga0075364_10102111 Ga0075364_101021112 329
294 3300006175 Ga0070712_100033602 Ga0070712_1000336024 329
295 3300006175 Ga0070712_100051371 Ga0070712_1000513712 329
296 3300006177 Ga0075362_10130010 Ga0075362_101300102 329
297 3300006178 Ga0075367_10036921 Ga0075367_100369212 329
298 3300006178 Ga0075367_10054959 Ga0075367_100549592 329
299 3300006178 Ga0075367_10130750 Ga0075367_101307502 329
300 3300006178 Ga0075367_10283531 Ga0075367_102835311 329
301 3300006186 Ga0075369_10054050 Ga0075369_100540502 329
302 3300006195 Ga0075366_10068321 Ga0075366_100683212 329
303 3300006237 Ga0097621_100120180 Ga0097621_1001201801 329
304 3300006237 Ga0097621_100149237 Ga0097621_1001492371 329
305 3300006237 Ga0097621_100157586 Ga0097621_1001575861 329
306 3300006237 Ga0097621_100167217 Ga0097621_1001672172 329
307 3300006237 Ga0097621_100256511 Ga0097621_1002565112 329
308 3300006871 Ga0075434_100096130 Ga0075434_1000961303 329
309 3300006881 Ga0068865_100024037 Ga0068865_1000240373 329
310 3300006931 Ga0097620_100005475 Ga0097620_1000054752 329
311 3300006931 Ga0097620_100107769 Ga0097620_1001077692 329
312 3300006931 Ga0097620_100142823 Ga0097620_1001428232 329
313 3300007265 Ga0099794_10006387 Ga0099794_100063872 329
314 3300007265 Ga0099794_10017410 Ga0099794_100174103 329
315 3300007788 Ga0099795_10009349 Ga0099795_100093491 329
316 3300009093 Ga0105240_10015165 Ga0105240_100151654 329
317 3300009093 Ga0105240_10021813 Ga0105240_100218133 329
318 3300009098 Ga0105245_10002531 Ga0105245_100025315 329
319 3300009098 Ga0105245_10658529 Ga0105245_106585291 329
320 3300009148 Ga0105243_10079656 Ga0105243_100796562 329
321 3300009174 Ga0105241_10134881 Ga0105241_101348811 329
322 3300009176 Ga0105242_10075590 Ga0105242_100755902 329
323 3300009177 Ga0105248_10022592 Ga0105248_100225924 329
324 3300009177 Ga0105248_10075435 Ga0105248_100754354 329
325 3300009177 Ga0105248_10110482 Ga0105248_101104823 329
326 3300009177 Ga0105248_10550685 Ga0105248_105506851 329
327 3300009545 Ga0105237_10129824 Ga0105237_101298243 329
328 3300009545 Ga0105237_10159728 Ga0105237_101597282 329
329 3300009551 Ga0105238_10018073 Ga0105238_100180736 329
330 3300009551 Ga0105238_10040254 Ga0105238_100402543 329
331 3300009551 Ga0105238_10043302 Ga0105238_100433025 329
332 3300009551 Ga0105238_10048052 Ga0105238_100480522 329
333 3300009553 Ga0105249_10130729 Ga0105249_101307293 329
334 3300010159 Ga0099796_10000523 Ga0099796_100005235 329
335 3300010375 Ga0105239_10016969 Ga0105239_100169696 329
336 3300010375 Ga0105239_10050901 Ga0105239_100509014 329
337 3300010375 Ga0105239_10154408 Ga0105239_101544082 329
338 3300011119 Ga0105246_10010484 Ga0105246_100104842 329
339 3300011119 Ga0105246_10199058 Ga0105246_101990582 329
340 3300013104 Ga0157370_10040442 Ga0157370_100404421 329
341 3300013104 Ga0157370_10077971 Ga0157370_100779711 329
342 3300013104 Ga0157370_10103291 Ga0157370_101032912 329
343 3300013105 Ga0157369_10005086 Ga0157369_100050868 329
344 3300013105 Ga0157369_10011901 Ga0157369_100119015 329
345 3300013105 Ga0157369_10038842 Ga0157369_100388424 329
346 3300013296 Ga0157374_10005291 Ga0157374_100052913 329
347 3300013296 Ga0157374_10135525 Ga0157374_101355252 329
348 3300013297 Ga0157378_10011318 Ga0157378_100113188 329
349 3300013306 Ga0163162_10014205 Ga0163162_100142055 329
350 3300013306 Ga0163162_10205560 Ga0163162_102055602 329
351 3300013307 Ga0157372_10084797 Ga0157372_100847973 329
352 3300013307 Ga0157372_10285537 Ga0157372_102855373 329
353 3300013307 Ga0157372_10396830 Ga0157372_103968302 329
354 3300013308 Ga0157375_10013496 Ga0157375_100134962 329
355 3300013308 Ga0157375_10014079 Ga0157375_100140792 329
356 3300013308 Ga0157375_10016136 Ga0157375_100161362 329
357 3300014325 Ga0163163_10003162 Ga0163163_1000316210 329
358 3300014325 Ga0163163_10095390 Ga0163163_100953903 329
359 3300014325 Ga0163163_10136234 Ga0163163_101362343 329
360 3300014497 Ga0182008_10005975 Ga0182008_100059758 329
361 3300014969 Ga0157376_10027977 Ga0157376_100279774 329
362 3300014969 Ga0157376_10121790 Ga0157376_101217902 329
363 3300017792 Ga0163161_10071302 Ga0163161_100713022 329
364 3300017792 Ga0163161_10089968 Ga0163161_100899682 329
365 3300021377 Ga0213874_10007376 Ga0213874_100073763 329
366 3300025207 Ga0209760_100142 Ga0209760_10014233 329
367 3300025231 Ga0207427_100004 Ga0207427_10000433 329
368 3300025233 Ga0209437_100025 Ga0209437_100025450 329
369 3300025253 Ga0209677_100937 Ga0209677_10093711 329
370 3300025261 Ga0209233_1000145 Ga0209233_100014533 329
371 3300025261 Ga0209233_1001494 Ga0209233_10014942 329
372 3300025272 Ga0209455_1006887 Ga0209455_10068872 329
373 3300025295 Ga0209564_1001354 Ga0209564_100135426 329
374 3300025297 Ga0209758_1004698 Ga0209758_10046987 329
375 3300025297 Ga0209758_1009495 Ga0209758_10094951 329
376 3300025297 Ga0209758_1043917 Ga0209758_10439172 329
377 3300025711 Ga0207696_1040247 Ga0207696_10402472 329
378 3300025885 Ga0207653_10045925 Ga0207653_100459252 329
379 3300025898 Ga0207692_10013372 Ga0207692_100133721 329
380 3300025899 Ga0207642_10022024 Ga0207642_100220242 329
381 3300025903 Ga0207680_10208858 Ga0207680_102088581 329
382 3300025906 Ga0207699_10006652 Ga0207699_100066526 329
383 3300025907 Ga0207645_10177100 Ga0207645_101771001 329
384 3300025909 Ga0207705_10017874 Ga0207705_100178742 329
385 3300025909 Ga0207705_10078242 Ga0207705_100782422 329
386 3300025909 Ga0207705_10189346 Ga0207705_101893462 329
387 3300025910 Ga0207684_10197368 Ga0207684_101973682 329
388 3300025912 Ga0207707_10006804 Ga0207707_100068047 329
389 3300025912 Ga0207707_10019522 Ga0207707_100195222 329
390 3300025913 Ga0207695_10506335 Ga0207695_105063351 329
391 3300025914 Ga0207671_10033572 Ga0207671_100335723 329
392 3300025914 Ga0207671_10125560 Ga0207671_101255602 329
393 3300025914 Ga0207671_10169230 Ga0207671_101692302 329
394 3300025914 Ga0207671_10176353 Ga0207671_101763532 329
395 3300025915 Ga0207693_10003380 Ga0207693_1000338012 329
396 3300025915 Ga0207693_10011875 Ga0207693_100118756 329
397 3300025915 Ga0207693_10045197 Ga0207693_100451972 329
398 3300025915 Ga0207693_10080594 Ga0207693_100805942 329
399 3300025915 Ga0207693_10127089 Ga0207693_101270891 329
400 3300025916 Ga0207663_10012696 Ga0207663_100126964 329
401 3300025916 Ga0207663_10065085 Ga0207663_100650852 329
402 3300025916 Ga0207663_10298074 Ga0207663_102980741 329
403 3300025917 Ga0207660_10063010 Ga0207660_100630103 329
404 3300025917 Ga0207660_10089625 Ga0207660_100896252 329
405 3300025917 Ga0207660_10138257 Ga0207660_101382571 329
406 3300025918 Ga0207662_10088843 Ga0207662_100888431 329
407 3300025918 Ga0207662_10194990 Ga0207662_101949902 329
408 3300025919 Ga0207657_10028761 Ga0207657_100287615 329
409 3300025919 Ga0207657_10059358 Ga0207657_100593583 329
410 3300025920 Ga0207649_10092019 Ga0207649_100920192 329
411 3300025921 Ga0207652_10047048 Ga0207652_100470483 329
412 3300025921 Ga0207652_10095660 Ga0207652_100956601 329
413 3300025921 Ga0207652_10100679 Ga0207652_101006791 329
414 3300025921 Ga0207652_10149939 Ga0207652_101499392 329
415 3300025921 Ga0207652_10230812 Ga0207652_102308122 329
416 3300025924 Ga0207694_10014493 Ga0207694_100144935 329
417 3300025924 Ga0207694_10032380 Ga0207694_100323804 329
418 3300025924 Ga0207694_10128607 Ga0207694_101286071 329
419 3300025924 Ga0207694_10164092 Ga0207694_101640922 329
420 3300025924 Ga0207694_10190355 Ga0207694_101903552 329
421 3300025927 Ga0207687_10092182 Ga0207687_100921822 329
422 3300025928 Ga0207700_10020769 Ga0207700_100207694 329
423 3300025933 Ga0207706_10160692 Ga0207706_101606922 329
424 3300025934 Ga0207686_10066018 Ga0207686_100660181 329
425 3300025936 Ga0207670_10157481 Ga0207670_101574812 329
426 3300025937 Ga0207669_10026914 Ga0207669_100269141 329
427 3300025937 Ga0207669_10049350 Ga0207669_100493502 329
428 3300025938 Ga0207704_10074988 Ga0207704_100749882 329
429 3300025939 Ga0207665_10046616 Ga0207665_100466163 329
430 3300025940 Ga0207691_10056876 Ga0207691_100568764 329
431 3300025941 Ga0207711_10052845 Ga0207711_100528453 329
432 3300025941 Ga0207711_10064437 Ga0207711_100644371 329
433 3300025942 Ga0207689_10175812 Ga0207689_101758122 329
434 3300025944 Ga0207661_10010608 Ga0207661_100106087 329
435 3300025945 Ga0207679_10055726 Ga0207679_100557263 329
436 3300025949 Ga0207667_10066976 Ga0207667_100669764 329
437 3300025949 Ga0207667_10112866 Ga0207667_101128662 329
438 3300025960 Ga0207651_10306283 Ga0207651_103062831 329
439 3300025961 Ga0207712_10335191 Ga0207712_103351911 329
440 3300025972 Ga0207668_10078489 Ga0207668_100784892 329
441 3300025972 Ga0207668_10121912 Ga0207668_101219121 329
442 3300025972 Ga0207668_10122768 Ga0207668_101227682 329
443 3300025981 Ga0207640_10088917 Ga0207640_100889172 329
444 3300026023 Ga0207677_10078568 Ga0207677_100785682 329
445 3300026035 Ga0207703_10037438 Ga0207703_100374383 329
446 3300026041 Ga0207639_10254755 Ga0207639_102547551 329
447 3300026067 Ga0207678_10061718 Ga0207678_100617182 329
448 3300026067 Ga0207678_10073139 Ga0207678_100731392 329
449 3300026067 Ga0207678_10182169 Ga0207678_101821692 329
450 3300026075 Ga0207708_10062247 Ga0207708_100622473 329
451 3300026075 Ga0207708_10074055 Ga0207708_100740552 329
452 3300026078 Ga0207702_10035585 Ga0207702_100355851 329
453 3300026078 Ga0207702_10336994 Ga0207702_103369942 329
454 3300026089 Ga0207648_10031432 Ga0207648_100314322 329
455 3300026089 Ga0207648_10116198 Ga0207648_101161981 329
456 3300026089 Ga0207648_10287232 Ga0207648_102872321 329
457 3300026095 Ga0207676_10072689 Ga0207676_100726891 329
458 3300026116 Ga0207674_10138731 Ga0207674_101387312 329
459 3300026116 Ga0207674_10283413 Ga0207674_102834131 329
460 3300026118 Ga0207675_100053059 Ga0207675_1000530593 329
461 3300026118 Ga0207675_100549707 Ga0207675_1005497071 329
462 3300026118 Ga0207675_100586454 Ga0207675_1005864541 329
463 3300026121 Ga0207683_10014942 Ga0207683_100149423 329
464 3300026121 Ga0207683_10064283 Ga0207683_100642833 329
465 3300026121 Ga0207683_10434419 Ga0207683_104344191 329
466 3300027512 Ga0209179_1023956 Ga0209179_10239561 329
467 3300027671 Ga0209588_1009342 Ga0209588_10093423 329
468 3300027866 Ga0209813_10039646 Ga0209813_100396462 329
469 3300028379 Ga0268266_10009413 Ga0268266_100094135 329
470 3300028379 Ga0268266_10032359 Ga0268266_100323594 329
471 3300028379 Ga0268266_10036611 Ga0268266_100366114 329
472 3300028379 Ga0268266_10081416 Ga0268266_100814162 329
473 3300028379 Ga0268266_10380684 Ga0268266_103806841 329
474 3300028380 Ga0268265_10124226 Ga0268265_101242261 329
475 3300028380 Ga0268265_10257104 Ga0268265_102571042 329
476 3300028558 Ga0265326_10002066 Ga0265326_100020662 329
477 3300028563 Ga0265319_1001508 Ga0265319_10015086 329
478 3300028573 Ga0265334_10000614 Ga0265334_1000061421 329
479 3300028577 Ga0265318_10002674 Ga0265318_100026746 329
480 3300028653 Ga0265323_10003948 Ga0265323_100039487 329
481 3300028666 Ga0265336_10000259 Ga0265336_1000025927 329
482 3300028800 Ga0265338_10000013 Ga0265338_10000013123 329
483 3300029957 Ga0265324_10000235 Ga0265324_1000023556 329
484 3300031235 Ga0265330_10010495 Ga0265330_100104953 329
485 3300031235 Ga0265330_10083704 Ga0265330_100837042 329
486 3300031239 Ga0265328_10067757 Ga0265328_100677571 329
487 3300031247 Ga0265340_10015613 Ga0265340_100156134 329
488 3300031249 Ga0265339_10022247 Ga0265339_100222472 329
489 3300031250 Ga0265331_10037267 Ga0265331_100372672 329
490 3300031344 Ga0265316_10239343 Ga0265316_102393432 329
491 3300031548 Ga0307408_100070810 Ga0307408_1000708102 329
492 3300031616 Ga0307508_10000058 Ga0307508_100000583 329
493 3300031616 Ga0307508_10006654 Ga0307508_100066547 329
494 3300031712 Ga0265342_10075616 Ga0265342_100756161 329
495 3300031730 Ga0307516_10038712 Ga0307516_100387124 329
496 3300031731 Ga0307405_10147464 Ga0307405_101474642 329
497 3300031901 Ga0307406_10165628 Ga0307406_101656281 329
498 3300032002 Ga0307416_100163465 Ga0307416_1001634652 329
499 3300032005 Ga0307411_10090159 Ga0307411_100901592 329
500 3300032126 Ga0307415_100024425 Ga0307415_1000244252 329
501 3300032126 Ga0307415_100083825 Ga0307415_1000838252 329
502 3300033179 Ga0307507_10103121 Ga0307507_101031213 329
503 3300033180 Ga0307510_10010251 Ga0307510_100102516 329
504 3300033442 Ga0315911_1000014 Ga0315911_1000014136 329
505 3300035086 Ga0373934_0051067 Ga0373934_0051067_585_1592 329
506 3300035111 Ga0373923_0009270 Ga0373923_0009270_1047_2054 329
507 3300035111 Ga0373923_0118195 Ga0373923_0118195_59_1066 329
508 3300035170 Ga0373943_0007309 Ga0373943_0007309_3051_4058 329
509 3300035171 Ga0373946_0021866 Ga0373946_0021866_1302_2309 329
510 3300035171 Ga0373946_0088103 Ga0373946_0088103_66_1073 329
511 3300035172 Ga0373955_0164291 Ga0373955_0164291_243_1250 329
512 3300035410 Ga0373924_0006573 Ga0373924_0006573_317_1324 329
513 3300035691 Ga0373931_0012384 Ga0373931_0012384_2616_3623 329
514 3300035691 Ga0373931_0053757 Ga0373931_0053757_432_1439 329
515 3300035692 Ga0373935_0018884 Ga0373935_0018884_163_1170 329
516 3300035695 Ga0373927_0016422 Ga0373927_0016422_894_1901 329
517 3300035695 Ga0373927_0094837 Ga0373927_0094837_306_1313 329
518 3300035695 Ga0373927_0136103 Ga0373927_0136103_157_1164 329
519 3300035724 Ga0373933_0000052 Ga0373933_0000052_25818_26825 329
520 3300035724 Ga0373933_0003499 Ga0373933_0003499_521_1528 329
521 3300035724 Ga0373933_0011933 Ga0373933_0011933_1259_2266 329
522 3300035724 Ga0373933_0139370 Ga0373933_0139370_232_1239 329
523 3300035725 Ga0373947_0011386 Ga0373947_0011386_382_1389 329
524 3300035725 Ga0373947_0026317 Ga0373947_0026317_454_1461 329
525 3300036401 Ga0373937_0060000 Ga0373937_0060000_438_1445 329
526 3300037068 Ga0373925_0105607 Ga0373925_0105607_157_1164 329
527 3300037418 Ga0395900_0060117 Ga0395900_0060117_461_1483 329
528 3300037466 Ga0395898_0067674 Ga0395898_0067674_1599_2621 329
529 3300037466 Ga0395898_0085136 Ga0395898_0085136_847_1854 329
530 3300037853 Ga0436364_0391517 Ga0436364_0391517_1475_2482 329
531 3300037853 Ga0436364_1560306 Ga0436364_1560306_1115_2122 329
532 3300038443 Ga0395901_0052080 Ga0395901_0052080_579_1586 329
533 3300039437 Ga0436365_0721818 Ga0436365_0721818_474_1481 329
534 3300039437 Ga0436365_1694702 Ga0436365_1694702_24_1031 329
535 3300039438 Ga0436360_0545356 Ga0436360_0545356_312_1319 329
536 3300039450 Ga0436363_0003719 Ga0436363_0003719_1688_2695 329
537 3300039450 Ga0436363_0027754 Ga0436363_0027754_456_1463 329
538 3300044694 Ga0466963_0105236 Ga0466963_0105236_893_1900 329
539 3300045049 Ga0466959_0128269 Ga0466959_0128269_443_1450 329
540 3300045976 Ga0466967_0260289 Ga0466967_0260289_348_1355 329
541 3300046455 Ga0495603_0000237 Ga0495603_0000237_3411_4418 329
542 3300046455 Ga0495603_0005734 Ga0495603_0005734_4128_5135 329
543 3300046455 Ga0495603_0036352 Ga0495603_0036352_1654_2661 329
544 3300046459 Ga0495629_0004238 Ga0495629_0004238_5695_6702 329
545 3300046459 Ga0495629_0049669 Ga0495629_0049669_913_1920 329
546 3300046460 Ga0495638_0030599 Ga0495638_0030599_2404_3411 329
547 3300046472 Ga0495580_0007153 Ga0495580_0007153_4848_5855 329
548 3300046472 Ga0495580_0182096 Ga0495580_0182096_431_1438 329
549 3300046473 Ga0495582_0000209 Ga0495582_0000209_17_1024 329
550 3300046473 Ga0495582_0052845 Ga0495582_0052845_881_1888 329
551 3300046473 Ga0495582_0057414 Ga0495582_0057414_916_1923 329
552 3300046474 Ga0495605_0056844 Ga0495605_0056844_336_1343 329
553 3300046476 Ga0495662_0105833 Ga0495662_0105833_289_1296 329
554 3300046477 Ga0495664_0096796 Ga0495664_0096796_277_1284 329
555 3300046491 Ga0495584_0047072 Ga0495584_0047072_753_1760 329
556 3300046491 Ga0495584_0137465 Ga0495584_0137465_130_1137 329
557 3300046511 Ga0495608_0057655 Ga0495608_0057655_1157_2164 329
558 3300046514 Ga0495618_0102098 Ga0495618_0102098_704_1711 329
559 3300046517 Ga0495630_0052798 Ga0495630_0052798_1137_2144 329
560 3300046528 Ga0495642_0060991 Ga0495642_0060991_128_1135 329
561 3300046529 Ga0495652_0046208 Ga0495652_0046208_779_1786 329
562 3300046529 Ga0495652_0123910 Ga0495652_0123910_533_1540 329
563 3300046529 Ga0495652_0186410 Ga0495652_0186410_139_1146 329
564 3300046531 Ga0495665_0020920 Ga0495665_0020920_1112_2119 329
565 3300046533 Ga0495640_0081469 Ga0495640_0081469_292_1299 329
566 3300046537 Ga0495598_0033410 Ga0495598_0033410_215_1222 329
567 3300046543 Ga0495645_0039978 Ga0495645_0039978_1795_2802 329
568 3300046557 Ga0495622_0054346 Ga0495622_0054346_549_1556 329
569 3300046559 Ga0495667_0019470 Ga0495667_0019470_3202_4209 329
570 3300046615 Ga0495656_0146496 Ga0495656_0146496_87_1094 329
571 3300046642 Ga0495634_0024924 Ga0495634_0024924_2780_3787 329
572 3300046642 Ga0495634_0048802 Ga0495634_0048802_761_1768 329
573 3300046660 Ga0495625_0112099 Ga0495625_0112099_45_1052 329
574 3300046663 Ga0495635_0020554 Ga0495635_0020554_3331_4338 329
575 3300046663 Ga0495635_0061279 Ga0495635_0061279_1294_2301 329
576 3300046674 Ga0495588_0017035 Ga0495588_0017035_512_1519 329
577 3300046678 Ga0495599_0114372 Ga0495599_0114372_504_1511 329
578 3300046679 Ga0495623_0039704 Ga0495623_0039704_396_1403 329
579 3300046680 Ga0495646_0029092 Ga0495646_0029092_697_1704 329
580 3300046680 Ga0495646_0133199 Ga0495646_0133199_356_1363 329
581 3300046681 Ga0495647_0004901 Ga0495647_0004901_391_1398 329
582 3300046683 Ga0495658_0129133 Ga0495658_0129133_193_1200 329
583 3300046689 Ga0495613_0015743 Ga0495613_0015743_1928_2935 329
584 3300046691 Ga0495670_0079816 Ga0495670_0079816_146_1153 329
585 3300046809 Ga0495600_0111444 Ga0495600_0111444_427_1434 329
586 3300047317 Ga0495604_0022940 Ga0495604_0022940_3412_4419 329
587 3300047317 Ga0495604_0034583 Ga0495604_0034583_2761_3768 329
588 3300047319 Ga0495674_0020318 Ga0495674_0020318_1016_2023 329
589 3300047319 Ga0495674_0233961 Ga0495674_0233961_178_1185 329
590 3300047320 Ga0495672_0022077 Ga0495672_0022077_1101_2108 329
591 3300047322 Ga0495680_0116518 Ga0495680_0116518_931_1938 329
592 3300047445 Ga0495677_0066157 Ga0495677_0066157_135_1142 329
593 3300047445 Ga0495677_0069260 Ga0495677_0069260_202_1209 329
594 3300047469 Ga0495673_0026512 Ga0495673_0026512_964_1971 329
595 3300047469 Ga0495673_0067899 Ga0495673_0067899_491_1498 329
596 3300047471 Ga0495684_0071851 Ga0495684_0071851_133_1140 329
597 3300047673 Ga0495593_0026578 Ga0495593_0026578_899_1906 329
598 3300048088 Ga0495602_0099099 Ga0495602_0099099_660_1667 329
599 3300048090 Ga0495615_0027781 Ga0495615_0027781_270_1277 329
600 3300048903 Ga0496100_0214223 Ga0496100_0214223_223_1230 329
601 3300048904 Ga0496101_0004598 Ga0496101_0004598_6424_7431 329
602 3300048904 Ga0496101_0170441 Ga0496101_0170441_154_1164 329
603 3300048905 Ga0496102_0036873 Ga0496102_0036873_115_1125 329
604 3300048905 Ga0496102_0047035 Ga0496102_0047035_1893_2900 329
605 3300048905 Ga0496102_0106646 Ga0496102_0106646_900_1907 329
606 3300048905 Ga0496102_0244749 Ga0496102_0244749_205_1212 329
607 3300048906 Ga0496103_0027984 Ga0496103_0027984_1362_2369 329
608 3300048907 Ga0496104_0201452 Ga0496104_0201452_852_1862 329
609 3300048907 Ga0496104_0320263 Ga0496104_0320263_324_1331 329
610 3300048908 Ga0496105_0019393 Ga0496105_0019393_2397_3404 329
611 3300048908 Ga0496105_0083448 Ga0496105_0083448_82_1089 329
612 3300048909 Ga0496106_0015623 Ga0496106_0015623_4578_5588 329
613 3300048909 Ga0496106_0064606 Ga0496106_0064606_553_1560 329
614 3300048909 Ga0496106_0210800 Ga0496106_0210800_149_1156 329
615 3300048910 Ga0496107_0010397 Ga0496107_0010397_388_1395 329
616 3300048910 Ga0496107_0043807 Ga0496107_0043807_1726_2733 329
617 3300048911 Ga0496108_0076929 Ga0496108_0076929_1681_2691 329
618 3300048911 Ga0496108_0084762 Ga0496108_0084762_1199_2206 329
619 3300048911 Ga0496108_0126122 Ga0496108_0126122_48_1055 329
620 3300048911 Ga0496108_0198153 Ga0496108_0198153_547_1554 329
621 3300048912 Ga0496109_0003060 Ga0496109_0003060_4678_5688 329
622 3300048912 Ga0496109_0009741 Ga0496109_0009741_1194_2201 329
623 3300048912 Ga0496109_0022826 Ga0496109_0022826_3415_4422 329
624 3300048912 Ga0496109_0025677 Ga0496109_0025677_3650_4657 329
625 3300048912 Ga0496109_0072594 Ga0496109_0072594_1332_2339 329
626 3300048912 Ga0496109_0126181 Ga0496109_0126181_118_1125 329
627 3300048912 Ga0496109_0190268 Ga0496109_0190268_109_1119 329
628 3300048913 Ga0496110_0000835 Ga0496110_0000835_16274_17284 329
629 3300048914 Ga0496111_0026839 Ga0496111_0026839_2956_3966 329
630 3300048914 Ga0496111_0088213 Ga0496111_0088213_1125_2132 329
631 3300048915 Ga0496112_0177658 Ga0496112_0177658_684_1691 329
632 3300048915 Ga0496112_0279380 Ga0496112_0279380_473_1480 329
633 3300048916 Ga0496113_0030668 Ga0496113_0030668_2731_3741 329
634 3300048916 Ga0496113_0045484 Ga0496113_0045484_1713_2720 329
635 3300048916 Ga0496113_0323992 Ga0496113_0323992_141_1148 329
636 3300048917 Ga0496114_0003347 Ga0496114_0003347_5805_6812 329
637 3300048917 Ga0496114_0008640 Ga0496114_0008640_3720_4727 329
638 3300048918 Ga0496115_0003657 Ga0496115_0003657_3256_4263 329
639 3300048918 Ga0496115_0036962 Ga0496115_0036962_1426_2448 329
640 3300048920 Ga0496117_0027483 Ga0496117_0027483_3066_4070 329
641 3300048921 Ga0496118_0167943 Ga0496118_0167943_294_1301 329
642 3300048922 Ga0496119_0078905 Ga0496119_0078905_309_1316 329
643 3300048924 Ga0496121_0007527 Ga0496121_0007527_1246_2253 329
644 3300048924 Ga0496121_0047981 Ga0496121_0047981_618_1625 329
645 3300048924 Ga0496121_0057573 Ga0496121_0057573_1064_2071 329
646 3300048924 Ga0496121_0063518 Ga0496121_0063518_1176_2183 329
647 3300048924 Ga0496121_0088385 Ga0496121_0088385_1135_2142 329
648 3300048927 Ga0496124_0000047 Ga0496124_0000047_192524_193528 329
649 3300048927 Ga0496124_0186356 Ga0496124_0186356_534_1541 329
650 3300048928 Ga0496125_0008194 Ga0496125_0008194_8574_9581 329
651 3300048928 Ga0496125_0051331 Ga0496125_0051331_1095_2102 329
652 3300048929 Ga0496126_0003871 Ga0496126_0003871_1974_2981 329
653 3300048929 Ga0496126_0018816 Ga0496126_0018816_2294_3301 329
654 3300048929 Ga0496126_0090975 Ga0496126_0090975_937_1944 329
655 3300049578 Ga0501042_0083502 Ga0501042_0083502_1244_2251 329
656 3300049592 Ga0501076_0156934 Ga0501076_0156934_715_1722 329
657 3300050490 nmdc:mga03n38_58193_c1 nmdc:mga03n38_58193_c1_14_1021 329
658 3300050490 nmdc:mga03n38_73049_c1 nmdc:mga03n38_73049_c1_564_1571 329
659 3300050493 nmdc:mga0k408_63593_c1 nmdc:mga0k408_63593_c1_632_1639 329
660 3300050494 nmdc:mga06z11_25615_c1 nmdc:mga06z11_25615_c1_499_1506 329
661 3300050507 nmdc:mga05p37_571424_c1 nmdc:mga05p37_571424_c1_27_1034 329
662 3300053077 Ga0495601_0010642 Ga0495601_0010642_2039_3046 329
663 3300053084 Ga0495595_0062494 Ga0495595_0062494_659_1666 329
664 3300053084 Ga0495595_0089254 Ga0495595_0089254_78_1085 329
665 3300053085 Ga0495619_0020595 Ga0495619_0020595_1916_2923 329
666 3300053085 Ga0495619_0093575 Ga0495619_0093575_718_1725 329
667 3300053087 Ga0500643_012599 Ga0500643_012599_206_1213 329
668 3300053095 Ga0500640_001878 Ga0500640_001878_4590_5609 329
669 3300053108 Ga0500562_011695 Ga0500562_011695_669_1676 329
670 3300053111 Ga0500572_000121 Ga0500572_000121_1107_2126 329
671 3300053111 Ga0500572_000212 Ga0500572_000212_5573_6580 329
672 3300053118 Ga0500594_0008535 Ga0500594_0008535_59_1066 329
673 3300053119 Ga0500595_000736 Ga0500595_000736_1008_2015 329
674 3300053119 Ga0500595_001441 Ga0500595_001441_4340_5347 329
675 3300053119 Ga0500595_002486 Ga0500595_002486_593_1600 329
676 3300053119 Ga0500595_032971 Ga0500595_032971_461_1468 329
677 3300053123 Ga0500614_001327 Ga0500614_001327_1081_2100 329
678 3300053133 Ga0500655_029869 Ga0500655_029869_10_1017 329
679 3300053134 Ga0500658_0130220 Ga0500658_0130220_96_1103 329
680 3300053136 Ga0500559_0000246 Ga0500559_0000246_35688_36695 329
681 3300053136 Ga0500559_0003571 Ga0500559_0003571_5520_6539 329
682 3300053142 Ga0500577_0000029 Ga0500577_0000029_30_1037 329
683 3300053159 Ga0500630_013764 Ga0500630_013764_1065_2084 329
684 3300053162 Ga0500638_033498 Ga0500638_033498_1263_2270 329
685 3300053162 Ga0500638_044831 Ga0500638_044831_312_1319 329
686 3300053163 Ga0500639_000219 Ga0500639_000219_26279_27298 329
687 3300053178 Ga0500637_0007009 Ga0500637_0007009_4027_5034 329
688 3300053725 Ga0500576_061313 Ga0500576_061313_128_1135 329
689 3300053735 Ga0500596_000276 Ga0500596_000276_3889_4896 329
690 3300053735 Ga0500596_007362 Ga0500596_007362_747_1766 329
691 3300053737 Ga0500601_002192 Ga0500601_002192_16_1035 329
692 3300055283 Ga0500661_000658 Ga0500661_000658_3941_4948 329
693 3300061719 Ga0466962_0033405 Ga0466962_0033405_194_1201 329
694 iso_pu_bacteria 2511231026 2511387102 329
695 iso_pu_bacteria 2521172590 2521556615 329
696 iso_pu_bacteria 2551306416 2553006789 329
697 iso_pu_bacteria 2765235838 2765567793 329
698 iso_pu_bacteria 2808606386 2808982826 329
699 iso_pu_bacteria 2808606415 2809130338 329
700 iso_pu_bacteria 2808606419 2809150185 329
701 iso_pu_bacteria 2818991436 2819545238 329
702 iso_pu_bacteria 2818991449 2819617982 329
703 iso_pu_bacteria 2839094727 2839097921 329
704 iso_pu_bacteria 2852618963 2852621594 329
705 iso_pu_bacteria 2904439833 2904442001 329
706 iso_pu_bacteria 2904530477 2904533298 329
707 iso_pu_bacteria 2904584206 2904586246 329
708 iso_pu_bacteria 2904589729 2904591941 329
709 iso_pu_bacteria 2904601388 2904601897 329
710 iso_pu_bacteria 2919046199 2919049388 329
711 iso_pu_bacteria 2919079590 2919083776 329
712 iso_pu_bacteria 2923510766 2923515211 329
713 iso_pu_bacteria 2928130867 2928132168 329
714 3300005331 Ga0070670_100027932 Ga0070670_1000279324 330
715 3300005335 Ga0070666_10261423 Ga0070666_102614231 330
716 3300005347 Ga0070668_100329691 Ga0070668_1003296912 330
717 3300005617 Ga0068859_100140979 Ga0068859_1001409793 330
718 3300005718 Ga0068866_10042110 Ga0068866_100421103 330
719 3300005719 Ga0068861_100230206 Ga0068861_1002302062 330
720 3300005841 Ga0068863_100063589 Ga0068863_1000635892 330
721 3300005841 Ga0068863_100115896 Ga0068863_1001158962 330
722 3300005842 Ga0068858_100177289 Ga0068858_1001772892 330
723 3300005843 Ga0068860_100012743 Ga0068860_1000127434 330
724 3300005843 Ga0068860_100487273 Ga0068860_1004872731 330
725 3300005844 Ga0068862_100025981 Ga0068862_1000259814 330
726 3300006028 Ga0070717_10093748 Ga0070717_100937482 330
727 3300006173 Ga0070716_100019032 Ga0070716_1000190323 330
728 3300006237 Ga0097621_100106316 Ga0097621_1001063162 330
729 3300006237 Ga0097621_100333600 Ga0097621_1003336002 330
730 3300006358 Ga0068871_100086625 Ga0068871_1000866253 330
731 3300006881 Ga0068865_100101753 Ga0068865_1001017533 330
732 3300006914 Ga0075436_100056902 Ga0075436_1000569023 330
733 3300006931 Ga0097620_100080152 Ga0097620_1000801523 330
734 3300006931 Ga0097620_100140978 Ga0097620_1001409782 330
735 3300009176 Ga0105242_10400148 Ga0105242_104001481 330
736 3300009177 Ga0105248_10182612 Ga0105248_101826122 330
737 3300013297 Ga0157378_10238743 Ga0157378_102387432 330
738 3300013306 Ga0163162_10242545 Ga0163162_102425452 330
739 3300014968 Ga0157379_10139777 Ga0157379_101397772 330
740 3300021441 Ga0213871_10004773 Ga0213871_100047733 330
741 3300025903 Ga0207680_10033248 Ga0207680_100332481 330
742 3300025906 Ga0207699_10006470 Ga0207699_100064703 330
743 3300025907 Ga0207645_10045098 Ga0207645_100450982 330
744 3300025919 Ga0207657_10055214 Ga0207657_100552142 330
745 3300025927 Ga0207687_10023754 Ga0207687_100237541 330
746 3300025928 Ga0207700_10002100 Ga0207700_100021007 330
747 3300025929 Ga0207664_10045808 Ga0207664_100458083 330
748 3300025931 Ga0207644_10162561 Ga0207644_101625611 330
749 3300025933 Ga0207706_10042434 Ga0207706_100424344 330
750 3300025934 Ga0207686_10006690 Ga0207686_100066905 330
751 3300025936 Ga0207670_10055542 Ga0207670_100555423 330
752 3300025939 Ga0207665_10004373 Ga0207665_100043735 330
753 3300025941 Ga0207711_10085575 Ga0207711_100855754 330
754 3300025941 Ga0207711_10238315 Ga0207711_102383151 330
755 3300025942 Ga0207689_10080792 Ga0207689_100807922 330
756 3300025960 Ga0207651_10021775 Ga0207651_100217753 330
757 3300025961 Ga0207712_10375655 Ga0207712_103756551 330
758 3300026035 Ga0207703_10111792 Ga0207703_101117922 330
759 3300026067 Ga0207678_10024312 Ga0207678_100243123 330
760 3300026088 Ga0207641_10149459 Ga0207641_101494592 330
761 3300026095 Ga0207676_10213237 Ga0207676_102132372 330
762 3300026118 Ga0207675_100306520 Ga0207675_1003065202 330
763 3300026121 Ga0207683_10013945 Ga0207683_100139452 330
764 3300028379 Ga0268266_10053239 Ga0268266_100532393 330
765 3300028380 Ga0268265_10014881 Ga0268265_100148815 330
766 3300028381 Ga0268264_10023027 Ga0268264_100230273 330
767 3300028381 Ga0268264_10063077 Ga0268264_100630774 330
768 3300037312 Ga0395899_0097674 Ga0395899_0097674_610_1623 330
769 3300037418 Ga0395900_0080473 Ga0395900_0080473_586_1599 330
770 3300038443 Ga0395901_0090577 Ga0395901_0090577_1737_2750 330
771 3300039438 Ga0436360_0119626 Ga0436360_0119626_2437_3447 330
772 3300049581 Ga0501047_0007027 Ga0501047_0007027_5294_6313 330
773 3300049586 Ga0501070_0034125 Ga0501070_0034125_2210_3229 330
774 3300049590 Ga0501074_0029234 Ga0501074_0029234_245_1264 330
775 3300049742 Ga0501080_0000669 Ga0501080_0000669_22479_23498 330
776 3300050491 nmdc:mga00v17_3981_c1 nmdc:mga00v17_3981_c1_2274_3284 330
777 3300005329 Ga0070683_100514276 Ga0070683_1005142761 331
778 3300005336 Ga0070680_100271876 Ga0070680_1002718761 331
779 3300005339 Ga0070660_100007189 Ga0070660_1000071897 331
780 3300005434 Ga0070709_10008832 Ga0070709_100088323 331
781 3300005436 Ga0070713_100006026 Ga0070713_1000060263 331
782 3300005437 Ga0070710_10008247 Ga0070710_100082473 331
783 3300005439 Ga0070711_100025491 Ga0070711_1000254912 331
784 3300005518 Ga0070699_100035564 Ga0070699_1000355641 331
785 3300005530 Ga0070679_100043390 Ga0070679_1000433902 331
786 3300005530 Ga0070679_100043780 Ga0070679_1000437804 331
787 3300005546 Ga0070696_100000694 Ga0070696_10000069412 331
788 3300006175 Ga0070712_100287613 Ga0070712_1002876132 331
789 3300006852 Ga0075433_10077757 Ga0075433_100777573 331
790 3300006914 Ga0075436_100056029 Ga0075436_1000560291 331
791 3300009093 Ga0105240_10085390 Ga0105240_100853902 331
792 3300009093 Ga0105240_10143986 Ga0105240_101439863 331
793 3300013104 Ga0157370_10003286 Ga0157370_1000328618 331
794 3300013104 Ga0157370_10095726 Ga0157370_100957263 331
795 3300013307 Ga0157372_10020473 Ga0157372_100204736 331
796 3300013307 Ga0157372_10076305 Ga0157372_100763052 331
797 3300025898 Ga0207692_10026865 Ga0207692_100268653 331
798 3300025906 Ga0207699_10081648 Ga0207699_100816482 331
799 3300025912 Ga0207707_10123088 Ga0207707_101230882 331
800 3300025913 Ga0207695_10107402 Ga0207695_101074023 331
801 3300025916 Ga0207663_10054175 Ga0207663_100541752 331
802 3300025919 Ga0207657_10018284 Ga0207657_100182844 331
803 3300025921 Ga0207652_10092056 Ga0207652_100920561 331
804 3300025921 Ga0207652_10147395 Ga0207652_101473952 331
805 3300025928 Ga0207700_10109006 Ga0207700_101090063 331
806 3300025929 Ga0207664_10088331 Ga0207664_100883312 331
807 3300025949 Ga0207667_10290962 Ga0207667_102909622 331
808 3300026116 Ga0207674_10295157 Ga0207674_102951572 331
809 3300037418 Ga0395900_0019659 Ga0395900_0019659_3004_4020 331
810 3300048909 Ga0496106_0092555 Ga0496106_0092555_379_1392 331
811 3300049589 Ga0501073_0043056 Ga0501073_0043056_249_1427 331
812 3300049744 Ga0501083_0018537 Ga0501083_0018537_1342_2346 331
813 3300050512 nmdc:mga0n895_309611_c1 nmdc:mga0n895_309611_c1_546_1556 331
814 3300050513 nmdc:mga0rr50_54899_c1 nmdc:mga0rr50_54899_c1_858_1868 331
815 3300050514 nmdc:mga08x19_46628_c1 nmdc:mga08x19_46628_c1_91_1101 331
816 3300050515 nmdc:mga0a205_48370_c1 nmdc:mga0a205_48370_c1_2105_3115 331
817 3300053086 Ga0500578_0026796 Ga0500578_0026796_2514_3527 331
818 3300013102 Ga0157371_10013766 Ga0157371_100137663 332
819 3300013104 Ga0157370_10071749 Ga0157370_100717492 332
820 3300013105 Ga0157369_10069540 Ga0157369_100695403 332
821 3300013307 Ga0157372_10070760 Ga0157372_100707603 332
822 3300013307 Ga0157372_10152536 Ga0157372_101525363 332
823 3300021361 Ga0213872_10000803 Ga0213872_1000080317 332
824 3300021361 Ga0213872_10098001 Ga0213872_100980012 332
825 3300025272 Ga0209455_1000462 Ga0209455_100046224 332
826 3300025294 Ga0209025_1000019 Ga0209025_100001962 332
827 3300025932 Ga0207690_10085645 Ga0207690_100856451 332
828 3300025949 Ga0207667_10098018 Ga0207667_100980183 332
829 3300026041 Ga0207639_10066141 Ga0207639_100661411 332
830 3300031241 Ga0265325_10012884 Ga0265325_100128842 332
831 3300039447 Ga0436361_0132102 Ga0436361_0132102_42909_43931 332
832 3300039447 Ga0436361_1195803 Ga0436361_1195803_1242_2264 332
833 3300046501 Ga0495607_0044616 Ga0495607_0044616_469_1491 332
834 3300046507 Ga0495606_0024955 Ga0495606_0024955_1391_2413 332
835 3300046515 Ga0495620_0071585 Ga0495620_0071585_42_1064 332
836 3300046557 Ga0495622_0065566 Ga0495622_0065566_10_1032 332
837 3300046665 Ga0495661_0004458 Ga0495661_0004458_888_1910 332
838 3300046691 Ga0495670_0022766 Ga0495670_0022766_131_1153 332
839 3300046692 Ga0495671_0107774 Ga0495671_0107774_314_1336 332
840 3300047320 Ga0495672_0068207 Ga0495672_0068207_475_1515 332
841 3300047472 Ga0495686_0063377 Ga0495686_0063377_683_1705 332
842 3300048919 Ga0496116_0001928 Ga0496116_0001928_10600_11622 332
843 3300048921 Ga0496118_0192205 Ga0496118_0192205_53_1075 332
844 3300048924 Ga0496121_0019033 Ga0496121_0019033_1981_3033 332
845 3300048924 Ga0496121_0023274 Ga0496121_0023274_297_1319 332
846 3300048925 Ga0496122_0022165 Ga0496122_0022165_2631_3653 332
847 3300048926 Ga0496123_0011180 Ga0496123_0011180_1899_2921 332
848 3300048927 Ga0496124_0164777 Ga0496124_0164777_226_1248 332
849 3300048928 Ga0496125_0017373 Ga0496125_0017373_4532_5554 332
850 3300048929 Ga0496126_0025649 Ga0496126_0025649_1330_2352 332
851 3300048929 Ga0496126_0026313 Ga0496126_0026313_640_1704 332
852 3300049822 Ga0501035_0003474 Ga0501035_0003474_7043_8056 332
853 3300050492 nmdc:mga0yw44_35851_c1 nmdc:mga0yw44_35851_c1_1814_2836 332
854 3300050495 nmdc:mga04h51_62798_c1 nmdc:mga04h51_62798_c1_47_1069 332
855 3300053086 Ga0500578_0074268 Ga0500578_0074268_1015_2037 332
856 3300053089 Ga0500581_041070 Ga0500581_041070_467_1489 332
857 3300053093 Ga0500651_0004771 Ga0500651_0004771_1784_2806 332
858 3300053094 Ga0500566_0057279 Ga0500566_0057279_42_1064 332
859 3300053099 Ga0500654_097566 Ga0500654_097566_68_1090 332
860 3300053104 Ga0500556_0000066 Ga0500556_0000066_37345_38367 332
861 3300053116 Ga0500592_000667 Ga0500592_000667_1838_2860 332
862 3300053130 Ga0500642_0000072 Ga0500642_0000072_14479_15501 332
863 3300053131 Ga0500652_000991 Ga0500652_000991_443_1465 332
864 3300053134 Ga0500658_0005728 Ga0500658_0005728_2648_3670 332
865 3300053136 Ga0500559_0004708 Ga0500559_0004708_3271_4290 332
866 3300053139 Ga0500568_0001230 Ga0500568_0001230_11428_12450 332
867 3300053145 Ga0500586_003380 Ga0500586_003380_2154_3176 332
868 3300053151 Ga0500604_0002609 Ga0500604_0002609_3013_4035 332
869 3300053153 Ga0500616_0000177 Ga0500616_0000177_39212_40234 332
870 3300053156 Ga0500622_0002476 Ga0500622_0002476_6385_7407 332
871 3300053160 Ga0500633_0014547 Ga0500633_0014547_1015_2037 332
872 3300053177 Ga0500636_0002987 Ga0500636_0002987_3678_4700 332
873 iso_pu_bacteria 2513237141 2513888405 332
874 3300002737 JGI25162J39368_1000202 JGI25162J39368_10002025 333
875 3300003214 JGI25165J46597_1000296 JGI25165J46597_10002965 333
876 3300003751 Ga0055538_1000010 Ga0055538_1000010314 333
877 3300003751 Ga0055538_1000113 Ga0055538_10001134 333
878 3300003752 Ga0055539_1000015 Ga0055539_1000015314 333
879 3300003752 Ga0055539_1000161 Ga0055539_100016148 333
880 3300003756 Ga0055533_1000018 Ga0055533_1000018314 333
881 3300003756 Ga0055533_1000163 Ga0055533_10001634 333
882 3300003759 Ga0055525_1000020 Ga0055525_1000020314 333
883 3300003759 Ga0055525_1000218 Ga0055525_10002184 333
884 3300003841 Ga0055541_1000011 Ga0055541_1000011314 333
885 3300003841 Ga0055541_1000106 Ga0055541_10001064 333
886 3300005563 Ga0068855_100000064 Ga0068855_10000006413 333
887 3300005563 Ga0068855_100037921 Ga0068855_1000379212 333
888 3300005578 Ga0068854_100018026 Ga0068854_1000180265 333
889 3300006946 Ga0079104_1005889 Ga0079104_10058894 333
890 3300009036 Ga0105244_10057244 Ga0105244_100572442 333
891 3300009093 Ga0105240_10073219 Ga0105240_100732192 333
892 3300009545 Ga0105237_10001496 Ga0105237_1000149616 333
893 3300009551 Ga0105238_10000004 Ga0105238_10000004346 333
894 3300010375 Ga0105239_10001696 Ga0105239_100016964 333
895 3300015261 Ga0182006_1009528 Ga0182006_10095283 333
896 3300025224 Ga0209784_100020 Ga0209784_1000205 333
897 3300025224 Ga0209784_100025 Ga0209784_100025311 333
898 3300025225 Ga0209566_100020 Ga0209566_1000205 333
899 3300025225 Ga0209566_100025 Ga0209566_100025311 333
900 3300025226 Ga0209674_100035 Ga0209674_1000355 333
901 3300025226 Ga0209674_100042 Ga0209674_100042311 333
902 3300025230 Ga0209563_100038 Ga0209563_1000385 333
903 3300025230 Ga0209563_100046 Ga0209563_100046311 333
904 3300025231 Ga0207427_100357 Ga0207427_10035721 333
905 3300025233 Ga0209437_100274 Ga0209437_10027452 333
906 3300025253 Ga0209677_100027 Ga0209677_100027311 333
907 3300025253 Ga0209677_100117 Ga0209677_1001176 333
908 3300025261 Ga0209233_1000060 Ga0209233_10000605 333
909 3300025913 Ga0207695_10008300 Ga0207695_100083004 333
910 3300025924 Ga0207694_10000021 Ga0207694_10000021263 333
911 3300025949 Ga0207667_10000019 Ga0207667_10000019266 333
912 3300025949 Ga0207667_10032188 Ga0207667_100321881 333
913 3300025981 Ga0207640_10168625 Ga0207640_101686252 333
914 3300026116 Ga0207674_10186388 Ga0207674_101863881 333
915 3300027111 Ga0209281_1016135 Ga0209281_10161352 333
916 3300039447 Ga0436361_0168473 Ga0436361_0168473_10071_11078 333
917 3300046462 Ga0495651_0000510 Ga0495651_0000510_2488_3495 333
918 3300046514 Ga0495618_0097181 Ga0495618_0097181_338_1345 333
919 3300046516 Ga0495628_0000255 Ga0495628_0000255_20785_21792 333
920 3300046529 Ga0495652_0005967 Ga0495652_0005967_3362_4369 333
921 3300046679 Ga0495623_0005774 Ga0495623_0005774_2954_3961 333
922 3300046680 Ga0495646_0059835 Ga0495646_0059835_287_1294 333
923 3300048927 Ga0496124_0047724 Ga0496124_0047724_147_1169 333
924 3300053125 Ga0500618_000767 Ga0500618_000767_2451_3458 333
925 3300049581 Ga0501047_0003418 Ga0501047_0003418_6077_7228 336
926 3300049585 Ga0501069_0011153 Ga0501069_0011153_2234_3385 336
927 3300049589 Ga0501073_0006383 Ga0501073_0006383_3651_4802 336
928 3300049590 Ga0501074_0000614 Ga0501074_0000614_14563_15714 336
929 3300049741 Ga0501079_0034266 Ga0501079_0034266_1574_2725 336
930 3300049742 Ga0501080_0070551 Ga0501080_0070551_1755_2906 336
931 3300049744 Ga0501083_0003287 Ga0501083_0003287_4602_5753 336
932 3300049822 Ga0501035_0151631 Ga0501035_0151631_491_1642 336
933 2162886007 SwRhRL2b_contig_3697715 SwRhRL2b_0838.00005370 337
934 3300005289 Ga0065704_10071587 Ga0065704_1007158711 337
935 3300048925 Ga0496122_0006874 Ga0496122_0006874_4254_5267 337
936 3300048926 Ga0496123_0022126 Ga0496123_0022126_2498_3511 337
937 3300048928 Ga0496125_0005281 Ga0496125_0005281_5887_6900 337
938 3300048929 Ga0496126_0040240 Ga0496126_0040240_833_1846 337

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

74

320

0.92

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

41

311

0.88

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

43

288

0.85

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

33

280

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
5t1p-assembly5.cif.gz_E crystal structure of the putative periplasmic solute-binding protein from campylobacter jejuni 0.8829 23 336
5t1p-assembly8.cif.gz_H crystal structure of the putative periplasmic solute-binding protein from campylobacter jejuni 0.8814 25 336
4r6y-assembly1.cif.gz_A crystal structure of solute-binding protein stm0429 from salmonella enterica subsp. enterica serovar typhimurium str. lt2, target efi-510776, a closed conformation, in complex with glycerol and acetate 0.8592 26 336
5t1p-assembly5.cif.gz_E crystal structure of the putative periplasmic solute-binding protein from campylobacter jejuni 0.8476 23 336
4r6y-assembly1.cif.gz_A crystal structure of solute-binding protein stm0429 from salmonella enterica subsp. enterica serovar typhimurium str. lt2, target efi-510776, a closed conformation, in complex with glycerol and acetate 0.8415 26 336
ID Description Score Start End Superfamily
1y4tD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8845 29 295 3.40.190.10
1xvyA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8758 29 122 3.40.190.10
1y4tD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8675 29 295 3.40.190.10
4r6yA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8667 26 302 3.40.190.10
4elqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8591 27 298 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A0K2W9X9-F1-model_v4 deleted 0.9783 17 336
AF-A0A2W4W886-F1-model_v4 ABC transporter substrate-binding protein 0.9747 22 336 GO:0015888
GO:0030288
GO:0030975
GO:0030976
AF-A0A353M1K2-F1-model_v4 ABC transporter substrate-binding protein 0.9486 16 269 GO:0015888
GO:0030288
GO:0030975
GO:0030976
AF-A0A7C6CIN4-F1-model_v4 deleted 0.947 17 335
AF-A0A6P2XIH1-F1-model_v4 ABC transporter, periplasmic substrate-binding protein 0.9441 26 335 GO:0015888
GO:0030288
GO:0030975
GO:0030976

Feature Viewer

pLDDT pTM Quality
92.78 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map