F486217

General Info

Members Datasets Scaffolds Average Seq Length
937 328 934 123

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100273229|Ga0070659_1002732293
Length 124
Sequence MSGPGPLMILVAGPYRSGTDGDPAMIKANVDAMTATALELHRRGHLPVMGEWFALPLIEVAEAAGDDPDEAYAAIFHPIAEQVLARCDACLRIGGPSEGADRMVATARRLGKTVFTSIAAVPAP

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
3 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
103 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
134 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
136 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
200 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
201 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
202 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
203 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
204 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
205 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
206 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
207 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
208 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
209 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
210 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
211 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
212 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
213 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
214 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
215 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
216 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
217 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
220 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
221 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
225 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
226 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
227 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
228 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
229 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
230 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
231 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
232 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
233 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
234 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
235 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
236 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
237 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
238 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
239 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
240 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
241 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
242 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
243 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
244 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
245 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
246 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
247 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
248 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
249 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
250 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
251 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
252 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
253 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
254 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
255 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
256 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
257 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
258 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
259 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
260 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
261 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
262 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
263 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
264 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
265 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
266 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
267 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
268 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
269 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
270 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
271 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
272 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
273 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
274 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
283 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
286 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
291 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
292 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
293 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
294 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
295 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
298 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
299 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
300 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
301 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
302 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
303 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
304 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
305 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
306 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
307 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
308 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
309 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
310 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
311 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
312 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
313 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
314 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
315 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
316 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
317 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
318 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
319 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
320 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
321 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
322 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
323 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
324 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
325 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
326 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
327 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
328 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.48
Nodule 0
Rhizoplane 5.34
Rhizosphere 85.59
Stem 0
Stem Tuber 0
Unclassified 4.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24749J21850_1007756 3300002076 Bacteria 1496
2 rootH1_10013630 3300003316 Bacteria 5119
3 rootL2_10012244 3300003322 Bacteria 2597
4 rootL2_10263668 3300003322 Bacteria 2565
5 rootH1_10048311 3300003323 Bacteria 2181
6 Ga0055540_1016407 3300003792 Unclassified 2109
7 Ga0055531_10003055 3300003794 Bacteria 10844
8 Ga0065712_10005764 3300005290 Bacteria 3381
9 Ga0065715_10273969 3300005293 Unclassified 1103
10 Ga0065707_10081818 3300005295 Bacteria 36625
11 Ga0065707_10267991 3300005295 Unclassified 1079
12 Ga0070676_10029108 3300005328 Unclassified 3140
13 Ga0070676_10717149 3300005328 Bacteria 731
14 Ga0070683_100509766 3300005329 Unclassified 1149
15 Ga0070690_100003391 3300005330 Bacteria 8706
16 Ga0070690_101543337 3300005330 Bacteria 537
17 Ga0070670_100014482 3300005331 Bacteria 6772
18 Ga0070670_100101660 3300005331 Unclassified 2475
19 Ga0070670_100701832 3300005331 Bacteria 910
20 Ga0070677_10022234 3300005333 Bacteria 2333
21 Ga0070677_10130591 3300005333 Bacteria 1146
22 Ga0070677_10261781 3300005333 Bacteria 863
23 Ga0070677_10846926 3300005333 Bacteria 525
24 Ga0068869_100000783 3300005334 Bacteria 18133
25 Ga0068869_100005806 3300005334 Bacteria 7789
26 Ga0068869_100046545 3300005334 Bacteria 3128
27 Ga0068869_100057682 3300005334 Bacteria 2836
28 Ga0068869_100097457 3300005334 Bacteria 2220
29 Ga0068869_100225440 3300005334 Unclassified 1487
30 Ga0068869_101018432 3300005334 Bacteria 722
31 Ga0070666_10013641 3300005335 Bacteria 5161
32 Ga0070666_10838080 3300005335 Unclassified 678
33 Ga0070680_100078898 3300005336 Bacteria 2713
34 Ga0070680_100088549 3300005336 Bacteria 2561
35 Ga0070682_100004134 3300005337 Bacteria 8051
36 Ga0070682_100034568 3300005337 Bacteria 3079
37 Ga0070682_100128736 3300005337 Bacteria 1710
38 Ga0068868_100038587 3300005338 Unclassified 3708
39 Ga0068868_100221156 3300005338 Bacteria 1585
40 Ga0068868_100392398 3300005338 Unclassified 1196
41 Ga0070660_101037396 3300005339 Unclassified 693
42 Ga0070660_101155796 3300005339 Bacteria 656
43 Ga0070689_100004010 3300005340 Bacteria 9898
44 Ga0070689_100004027 3300005340 Bacteria 9884
45 Ga0070689_100004215 3300005340 Bacteria 9698
46 Ga0070689_100729463 3300005340 Unclassified 867
47 Ga0070687_100028089 3300005343 Bacteria 2725
48 Ga0070661_100026560 3300005344 Bacteria 4164
49 Ga0070661_100087165 3300005344 Bacteria 2309
50 Ga0070661_100274125 3300005344 Unclassified 1307
51 Ga0070661_100894169 3300005344 Unclassified 733
52 Ga0070661_101129301 3300005344 Bacteria 654
53 Ga0070692_10052322 3300005345 Bacteria 2127
54 Ga0070692_10893209 3300005345 Bacteria 614
55 Ga0070692_11038990 3300005345 Bacteria 575
56 Ga0070668_100425520 3300005347 Bacteria 1137
57 Ga0070668_100740046 3300005347 Bacteria 870
58 Ga0070669_100252509 3300005353 Bacteria 1404
59 Ga0070669_100608776 3300005353 Bacteria 916
60 Ga0070669_100732150 3300005353 Unclassified 837
61 Ga0070675_100030122 3300005354 Bacteria 4379
62 Ga0070675_100065416 3300005354 Bacteria 3006
63 Ga0070675_100387504 3300005354 Bacteria 1245
64 Ga0070675_100819081 3300005354 Bacteria 851
65 Ga0070675_101277372 3300005354 Unclassified 676
66 Ga0070675_101726012 3300005354 Bacteria 578
67 Ga0070671_100224904 3300005355 Unclassified 1592
68 Ga0070671_100350404 3300005355 Unclassified 1260
69 Ga0070671_100436087 3300005355 Bacteria 1123
70 Ga0070671_100498001 3300005355 Unclassified 1048
71 Ga0070671_100992514 3300005355 Bacteria 735
72 Ga0070674_100017744 3300005356 Unclassified 4484
73 Ga0070674_100063485 3300005356 Bacteria 2585
74 Ga0070674_100346536 3300005356 Bacteria 1198
75 Ga0070674_100679970 3300005356 Bacteria 878
76 Ga0070673_100089944 3300005364 Unclassified 2507
77 Ga0070673_100151412 3300005364 Bacteria 1965
78 Ga0070673_100358104 3300005364 Bacteria 1296
79 Ga0070673_100496406 3300005364 Bacteria 1103
80 Ga0070688_100004559 3300005365 Bacteria 7225
81 Ga0070688_100113529 3300005365 Unclassified 1805
82 Ga0070688_100191552 3300005365 Bacteria 1425
83 Ga0070688_100670577 3300005365 Bacteria 800
84 Ga0070688_100938259 3300005365 Unclassified 684
85 Ga0070659_100093309 3300005366 Bacteria 2415
86 Ga0070659_100230223 3300005366 Bacteria 1531
87 Ga0070659_100273229 3300005366 Bacteria 1405
88 Ga0070659_101082012 3300005366 Bacteria 706
89 Ga0070667_100112120 3300005367 Bacteria 2366
90 Ga0070667_100217983 3300005367 Bacteria 1698
91 Ga0070667_100605824 3300005367 Bacteria 1009
92 Ga0070667_100785874 3300005367 Unclassified 883
93 Ga0070709_10169849 3300005434 Unclassified 1523
94 Ga0070714_100216012 3300005435 Bacteria 1760
95 Ga0070713_100304050 3300005436 Unclassified 1469
96 Ga0070701_10028952 3300005438 Bacteria 2726
97 Ga0070701_10615016 3300005438 Unclassified 721
98 Ga0070705_100019887 3300005440 Bacteria 3541
99 Ga0070705_100135379 3300005440 Bacteria 1613
100 Ga0070700_100001744 3300005441 Bacteria 10932
101 Ga0070700_100012034 3300005441 Bacteria 4809
102 Ga0070700_100432251 3300005441 Bacteria 997
103 Ga0070700_100970225 3300005441 Bacteria 697
104 Ga0070694_100003464 3300005444 Bacteria 9450
105 Ga0070694_100039481 3300005444 Bacteria 3142
106 Ga0070694_100214808 3300005444 Bacteria 1440
107 Ga0070694_101293086 3300005444 Bacteria 613
108 Ga0070708_100148228 3300005445 Bacteria 2181
109 Ga0070708_100449583 3300005445 Unclassified 1215
110 Ga0070663_100110139 3300005455 Bacteria 2068
111 Ga0070663_100636538 3300005455 Bacteria 901
112 Ga0070663_100915633 3300005455 Unclassified 758
113 Ga0070663_101034958 3300005455 Bacteria 715
114 Ga0070663_101616042 3300005455 Bacteria 578
115 Ga0070678_100002589 3300005456 Bacteria 9938
116 Ga0070678_100328002 3300005456 Unclassified 1309
117 Ga0070678_100712084 3300005456 Bacteria 905
118 Ga0070662_100016182 3300005457 Bacteria 5005
119 Ga0070662_100104949 3300005457 Bacteria 2145
120 Ga0070662_100172098 3300005457 Unclassified 1701
121 Ga0070681_10007435 3300005458 Bacteria 10706
122 Ga0070681_11488711 3300005458 Unclassified 601
123 Ga0068867_100000607 3300005459 Bacteria 23750
124 Ga0068867_100016935 3300005459 Bacteria 5179
125 Ga0068867_100052765 3300005459 Bacteria 3001
126 Ga0068867_100075645 3300005459 Unclassified 2526
127 Ga0068867_100105147 3300005459 Unclassified 2161
128 Ga0068867_100115762 3300005459 Unclassified 2065
129 Ga0068867_100270765 3300005459 Bacteria 1388
130 Ga0068867_100907994 3300005459 Bacteria 793
131 Ga0068867_101311495 3300005459 Bacteria 668
132 Ga0068867_102370856 3300005459 Unclassified 505
133 Ga0070685_10009078 3300005466 Bacteria 5131
134 Ga0070685_10022874 3300005466 Bacteria 3413
135 Ga0070685_10031471 3300005466 Bacteria 2965
136 Ga0070685_10174741 3300005466 Bacteria 1378
137 Ga0070685_10577612 3300005466 Bacteria 806
138 Ga0070706_100086631 3300005467 Bacteria 2902
139 Ga0070698_100055650 3300005471 Bacteria 4010
140 Ga0070698_101172933 3300005471 Unclassified 717
141 Ga0070699_100312743 3300005518 Bacteria 1410
142 Ga0070679_100169876 3300005530 Unclassified 2153
143 Ga0070679_101161245 3300005530 Unclassified 717
144 Ga0070679_101889668 3300005530 Bacteria 546
145 Ga0070684_100340586 3300005535 Bacteria 1379
146 Ga0068853_100006426 3300005539 Bacteria 9340
147 Ga0068853_100013959 3300005539 Bacteria 6570
148 Ga0068853_100104439 3300005539 Bacteria 2508
149 Ga0068853_100193406 3300005539 Bacteria 1849
150 Ga0068853_100279128 3300005539 Bacteria 1540
151 Ga0068853_100432240 3300005539 Bacteria 1236
152 Ga0068853_100804414 3300005539 Bacteria 900
153 Ga0070672_100237439 3300005543 Bacteria 1532
154 Ga0070672_101069505 3300005543 Bacteria 716
155 Ga0070686_100043769 3300005544 Bacteria 2810
156 Ga0070686_100248248 3300005544 Unclassified 1299
157 Ga0070686_100594612 3300005544 Bacteria 871
158 Ga0070695_100073268 3300005545 Bacteria 2247
159 Ga0070695_100107677 3300005545 Bacteria 1886
160 Ga0070696_100122071 3300005546 Bacteria 1887
161 Ga0070696_100192662 3300005546 Bacteria 1518
162 Ga0070696_100955833 3300005546 Bacteria 713
163 Ga0070693_100197008 3300005547 Bacteria 1306
164 Ga0070665_100067768 3300005548 Bacteria 3579
165 Ga0070665_100069338 3300005548 Bacteria 3534
166 Ga0070665_100075809 3300005548 Bacteria 3370
167 Ga0070665_100112180 3300005548 Bacteria 2729
168 Ga0070665_100466686 3300005548 Bacteria 1273
169 Ga0070704_100112443 3300005549 Unclassified 2075
170 Ga0068855_100026904 3300005563 Bacteria 6883
171 Ga0070664_100001011 3300005564 Bacteria 22087
172 Ga0070664_100007884 3300005564 Bacteria 8603
173 Ga0070664_100011932 3300005564 Bacteria 7054
174 Ga0070664_100039975 3300005564 Bacteria 3954
175 Ga0070664_100136405 3300005564 Unclassified 2158
176 Ga0070664_100139461 3300005564 Bacteria 2134
177 Ga0070664_100605156 3300005564 Unclassified 1017
178 Ga0070664_100944770 3300005564 Bacteria 809
179 Ga0070664_101770132 3300005564 Bacteria 586
180 Ga0068857_100038300 3300005577 Bacteria 4246
181 Ga0068857_100061555 3300005577 Bacteria 3335
182 Ga0068857_100215056 3300005577 Bacteria 1754
183 Ga0068857_100506414 3300005577 Bacteria 1133
184 Ga0068857_100859152 3300005577 Unclassified 869
185 Ga0068857_100991811 3300005577 Bacteria 808
186 Ga0068857_101199986 3300005577 Bacteria 735
187 Ga0068854_100013305 3300005578 Bacteria 5396
188 Ga0068854_100036744 3300005578 Unclassified 3436
189 Ga0068854_100049001 3300005578 Bacteria 3016
190 Ga0068854_100128176 3300005578 Bacteria 1935
191 Ga0068854_100454449 3300005578 Bacteria 1070
192 Ga0068856_100289249 3300005614 Bacteria 1656
193 Ga0068856_102216196 3300005614 Bacteria 558
194 Ga0070702_100001586 3300005615 Bacteria 9373
195 Ga0070702_100023630 3300005615 Bacteria 3270
196 Ga0068852_100002484 3300005616 Bacteria 12701
197 Ga0068852_100004129 3300005616 Bacteria 10225
198 Ga0068852_100030350 3300005616 Bacteria 4449
199 Ga0068852_100073262 3300005616 Bacteria 3012
200 Ga0068852_101976455 3300005616 Bacteria 605
201 Ga0068859_100002059 3300005617 Bacteria 20524
202 Ga0068859_100052584 3300005617 Bacteria 4095
203 Ga0068859_100150650 3300005617 Unclassified 2401
204 Ga0068859_100429086 3300005617 Unclassified 1418
205 Ga0068859_100492728 3300005617 Unclassified 1321
206 Ga0068859_101035796 3300005617 Bacteria 902
207 Ga0068859_101935221 3300005617 Unclassified 651
208 Ga0068859_102167318 3300005617 Unclassified 613
209 Ga0068859_102700753 3300005617 Bacteria 546
210 Ga0068864_100004086 3300005618 Bacteria 11984
211 Ga0068864_100083267 3300005618 Bacteria 2809
212 Ga0068864_100377884 3300005618 Unclassified 1342
213 Ga0068864_100718478 3300005618 Bacteria 977
214 Ga0068864_101194915 3300005618 Unclassified 759
215 Ga0068864_101675744 3300005618 Unclassified 640
216 Ga0068866_10004418 3300005718 Bacteria 5774
217 Ga0068866_10006093 3300005718 Bacteria 5017
218 Ga0068866_10012222 3300005718 Bacteria 3739
219 Ga0068866_10234648 3300005718 Bacteria 1114
220 Ga0068866_10617304 3300005718 Bacteria 734
221 Ga0068866_10629930 3300005718 Unclassified 728
222 Ga0068861_100028714 3300005719 Bacteria 4061
223 Ga0068861_100683121 3300005719 Unclassified 952
224 Ga0068861_100805078 3300005719 Unclassified 882
225 Ga0068861_101603467 3300005719 Bacteria 641
226 Ga0068851_10037646 3300005834 Bacteria 2425
227 Ga0068870_10002423 3300005840 Bacteria 7762
228 Ga0068870_10618556 3300005840 Bacteria 738
229 Ga0068863_100046831 3300005841 Unclassified 4104
230 Ga0068863_100321027 3300005841 Bacteria 1504
231 Ga0068863_101146198 3300005841 Bacteria 783
232 Ga0068863_101332415 3300005841 Bacteria 725
233 Ga0068863_102287269 3300005841 Unclassified 550
234 Ga0068863_102463819 3300005841 Unclassified 530
235 Ga0068858_100003646 3300005842 Bacteria 15233
236 Ga0068858_100128869 3300005842 Bacteria 2371
237 Ga0068858_100250366 3300005842 Bacteria 1683
238 Ga0068858_100293938 3300005842 Unclassified 1549
239 Ga0068858_100298131 3300005842 Bacteria 1537
240 Ga0068858_100633933 3300005842 Bacteria 1038
241 Ga0068858_100915076 3300005842 Bacteria 858
242 Ga0068858_101744089 3300005842 Unclassified 615
243 Ga0068860_100000807 3300005843 Bacteria 35154
244 Ga0068860_100047311 3300005843 Bacteria 4100
245 Ga0068860_100133240 3300005843 Bacteria 2386
246 Ga0068860_100379578 3300005843 Bacteria 1395
247 Ga0068862_100025990 3300005844 Bacteria 4919
248 Ga0068862_100048249 3300005844 Bacteria 3635
249 Ga0068862_100356788 3300005844 Bacteria 1358
250 Ga0068862_100375363 3300005844 Bacteria 1325
251 Ga0068862_100723219 3300005844 Unclassified 966
252 Ga0068862_100727145 3300005844 Bacteria 964
253 Ga0068862_100862411 3300005844 Unclassified 888
254 Ga0075365_10571464 3300006038 Bacteria 800
255 Ga0075368_10045248 3300006042 Bacteria 1738
256 Ga0075368_10154623 3300006042 Bacteria 959
257 Ga0075363_100023527 3300006048 Unclassified 3123
258 Ga0075432_10424739 3300006058 Bacteria 578
259 Ga0070716_100158647 3300006173 Unclassified 1463
260 Ga0075362_10001487 3300006177 Bacteria 7522
261 Ga0075367_10006063 3300006178 Bacteria 6074
262 Ga0075367_10016808 3300006178 Bacteria 4001
263 Ga0075367_10202043 3300006178 Bacteria 1242
264 Ga0075367_10343321 3300006178 Bacteria 942
265 Ga0075369_10066687 3300006186 Bacteria 1579
266 Ga0075369_10327161 3300006186 Unclassified 717
267 Ga0075366_10004910 3300006195 Bacteria 7215
268 Ga0075366_10020335 3300006195 Bacteria 3850
269 Ga0075366_10111803 3300006195 Bacteria 1643
270 Ga0075366_10453389 3300006195 Unclassified 791
271 Ga0075366_10794980 3300006195 Bacteria 588
272 Ga0097621_100039285 3300006237 Bacteria 3801
273 Ga0097621_100169616 3300006237 Bacteria 1880
274 Ga0097621_100175303 3300006237 Unclassified 1850
275 Ga0097621_100371119 3300006237 Bacteria 1276
276 Ga0097621_100545068 3300006237 Bacteria 1055
277 Ga0097621_101615824 3300006237 Bacteria 616
278 Ga0075370_10058732 3300006353 Unclassified 2188
279 Ga0075370_10068185 3300006353 Bacteria 2031
280 Ga0075370_10089065 3300006353 Bacteria 1779
281 Ga0075370_10189555 3300006353 Unclassified 1211
282 Ga0075370_10546436 3300006353 Bacteria 700
283 Ga0068871_100021156 3300006358 Bacteria 4994
284 Ga0068871_100368873 3300006358 Bacteria 1273
285 Ga0068871_100407729 3300006358 Bacteria 1211
286 Ga0068871_100845094 3300006358 Bacteria 846
287 Ga0075428_100301804 3300006844 Bacteria 1722
288 Ga0075430_100306148 3300006846 Unclassified 1314
289 Ga0075430_100739134 3300006846 Bacteria 811
290 Ga0075431_100676077 3300006847 Bacteria 1011
291 Ga0075431_100731311 3300006847 Bacteria 966
292 Ga0075431_100941114 3300006847 Unclassified 832
293 Ga0075433_11211947 3300006852 Unclassified 655
294 Ga0075434_100330807 3300006871 Bacteria 1544
295 Ga0075434_101923036 3300006871 Unclassified 597
296 Ga0075429_100476477 3300006880 Unclassified 1094
297 Ga0068865_100018344 3300006881 Bacteria 4513
298 Ga0068865_100132666 3300006881 Bacteria 1868
299 Ga0068865_100380475 3300006881 Bacteria 1151
300 Ga0068865_100405687 3300006881 Bacteria 1117
301 Ga0068865_100548854 3300006881 Unclassified 970
302 Ga0068865_100598196 3300006881 Bacteria 932
303 Ga0068865_100693696 3300006881 Bacteria 869
304 Ga0068865_101284340 3300006881 Bacteria 650
305 Ga0068865_102219962 3300006881 Unclassified 500
306 Ga0097620_100002059 3300006931 Bacteria 20524
307 Ga0097620_100052587 3300006931 Bacteria 4095
308 Ga0097620_100150662 3300006931 Unclassified 2401
309 Ga0097620_100429138 3300006931 Unclassified 1418
310 Ga0097620_100492742 3300006931 Unclassified 1321
311 Ga0097620_100667774 3300006931 Bacteria 1131
312 Ga0097620_100826692 3300006931 Bacteria 1013
313 Ga0097620_101035599 3300006931 Bacteria 902
314 Ga0097620_101934752 3300006931 Unclassified 651
315 Ga0097620_102167485 3300006931 Unclassified 613
316 Ga0097620_102700850 3300006931 Bacteria 546
317 Ga0075435_100957244 3300007076 Bacteria 747
318 Ga0099794_10001490 3300007265 Bacteria 8206
319 Ga0099795_10104898 3300007788 Unclassified 1113
320 Ga0105251_10456859 3300009011 Bacteria 593
321 Ga0105240_10007439 3300009093 Bacteria 15906
322 Ga0105240_10013447 3300009093 Bacteria 11239
323 Ga0105240_10016259 3300009093 Bacteria 10081
324 Ga0105240_10054468 3300009093 Bacteria 5013
325 Ga0111539_10007243 3300009094 Bacteria 14214
326 Ga0111539_10014384 3300009094 Bacteria 9875
327 Ga0111539_10059108 3300009094 Unclassified 4547
328 Ga0111539_10129876 3300009094 Bacteria 2951
329 Ga0111539_10245527 3300009094 Bacteria 2084
330 Ga0111539_10973116 3300009094 Unclassified 987
331 Ga0111539_11866932 3300009094 Unclassified 697
332 Ga0111539_12436754 3300009094 Unclassified 607
333 Ga0111539_12966915 3300009094 Bacteria 548
334 Ga0105245_10005108 3300009098 Bacteria 11535
335 Ga0105245_10048092 3300009098 Bacteria 3815
336 Ga0105245_10110128 3300009098 Bacteria 2560
337 Ga0105245_10297274 3300009098 Bacteria 1583
338 Ga0105245_11049290 3300009098 Bacteria 860
339 Ga0105245_11123365 3300009098 Bacteria 832
340 Ga0105247_10240647 3300009101 Bacteria 1233
341 Ga0105247_10288690 3300009101 Unclassified 1134
342 Ga0105247_10947429 3300009101 Bacteria 668
343 Ga0114129_10058324 3300009147 Bacteria 5400
344 Ga0114129_10103822 3300009147 Bacteria 3929
345 Ga0114129_10295150 3300009147 Bacteria 2162
346 Ga0114129_12008951 3300009147 Unclassified 699
347 Ga0105243_10007489 3300009148 Bacteria 8387
348 Ga0105243_10181574 3300009148 Bacteria 1830
349 Ga0105243_10570986 3300009148 Unclassified 1084
350 Ga0105243_10572261 3300009148 Bacteria 1083
351 Ga0105243_10801532 3300009148 Bacteria 928
352 Ga0105243_10845137 3300009148 Bacteria 906
353 Ga0105243_10979859 3300009148 Bacteria 847
354 Ga0105241_10211209 3300009174 Bacteria 1626
355 Ga0105241_10306870 3300009174 Bacteria 1364
356 Ga0105241_10795868 3300009174 Bacteria 871
357 Ga0105241_10821420 3300009174 Bacteria 858
358 Ga0105241_10879069 3300009174 Unclassified 831
359 Ga0105241_11036023 3300009174 Unclassified 769
360 Ga0105241_11747639 3300009174 Unclassified 606
361 Ga0105242_10001358 3300009176 Bacteria 19304
362 Ga0105242_10076211 3300009176 Bacteria 2795
363 Ga0105242_10233422 3300009176 Bacteria 1650
364 Ga0105242_10732124 3300009176 Unclassified 971
365 Ga0105242_10808984 3300009176 Bacteria 928
366 Ga0105242_12847157 3300009176 Unclassified 534
367 Ga0105248_10016657 3300009177 Bacteria 8091
368 Ga0105248_10023841 3300009177 Bacteria 6801
369 Ga0105248_10079252 3300009177 Bacteria 3691
370 Ga0105248_10270503 3300009177 Bacteria 1913
371 Ga0105248_10336945 3300009177 Bacteria 1698
372 Ga0105248_10486111 3300009177 Bacteria 1391
373 Ga0105248_11054431 3300009177 Bacteria 919
374 Ga0105248_11225207 3300009177 Bacteria 849
375 Ga0105248_12061247 3300009177 Bacteria 648
376 Ga0105237_10003127 3300009545 Bacteria 19921
377 Ga0105237_10007400 3300009545 Bacteria 12020
378 Ga0105237_10008504 3300009545 Bacteria 11102
379 Ga0105237_10062594 3300009545 Bacteria 3720
380 Ga0105237_10124293 3300009545 Bacteria 2575
381 Ga0105237_10710777 3300009545 Bacteria 1011
382 Ga0105237_11418004 3300009545 Bacteria 701
383 Ga0105238_10000630 3300009551 Bacteria 37045
384 Ga0105238_10002427 3300009551 Bacteria 18694
385 Ga0105238_10515568 3300009551 Bacteria 1198
386 Ga0105238_11012466 3300009551 Bacteria 852
387 Ga0105238_11178050 3300009551 Unclassified 790
388 Ga0105249_10001772 3300009553 Bacteria 18816
389 Ga0105249_10013377 3300009553 Bacteria 7247
390 Ga0105249_10206470 3300009553 Bacteria 1925
391 Ga0105249_10354426 3300009553 Bacteria 1487
392 Ga0105249_10872399 3300009553 Bacteria 966
393 Ga0105249_11045354 3300009553 Unclassified 886
394 Ga0105249_11316919 3300009553 Unclassified 794
395 Ga0105249_11367004 3300009553 Bacteria 780
396 Ga0105249_11639595 3300009553 Bacteria 716
397 Ga0105239_10021540 3300010375 Bacteria 7107
398 Ga0105239_10080659 3300010375 Bacteria 3580
399 Ga0105239_10176568 3300010375 Bacteria 2389
400 Ga0105239_10190382 3300010375 Bacteria 2296
401 Ga0105239_10550953 3300010375 Bacteria 1313
402 Ga0105239_10586538 3300010375 Unclassified 1271
403 Ga0105239_11164908 3300010375 Bacteria 888
404 Ga0105239_11224975 3300010375 Unclassified 865
405 Ga0105239_11384705 3300010375 Bacteria 812
406 Ga0105239_12112242 3300010375 Bacteria 654
407 Ga0105246_10066825 3300011119 Bacteria 2518
408 Ga0105246_10362226 3300011119 Unclassified 1192
409 Ga0157371_10350368 3300013102 Bacteria 1075
410 Ga0157371_10821186 3300013102 Bacteria 701
411 Ga0157370_10002445 3300013104 Bacteria 22405
412 Ga0157370_10717849 3300013104 Unclassified 912
413 Ga0157369_10010660 3300013105 Bacteria 10462
414 Ga0157369_10116821 3300013105 Bacteria 2832
415 Ga0157369_10893147 3300013105 Unclassified 911
416 Ga0157374_10003088 3300013296 Bacteria 13973
417 Ga0157374_10017683 3300013296 Bacteria 6282
418 Ga0157374_10026571 3300013296 Bacteria 5210
419 Ga0157378_10002215 3300013297 Bacteria 17236
420 Ga0157378_10057347 3300013297 Unclassified 3471
421 Ga0157378_10106460 3300013297 Bacteria 2565
422 Ga0157378_10129141 3300013297 Bacteria 2338
423 Ga0157378_10155466 3300013297 Unclassified 2134
424 Ga0157378_10235882 3300013297 Bacteria 1745
425 Ga0157378_10395512 3300013297 Bacteria 1360
426 Ga0157378_10710144 3300013297 Unclassified 1025
427 Ga0157378_11744504 3300013297 Bacteria 670
428 Ga0163162_10000003 3300013306 Bacteria 698280
429 Ga0163162_10003082 3300013306 Bacteria 15919
430 Ga0163162_10010455 3300013306 Bacteria 9021
431 Ga0163162_10041418 3300013306 Bacteria 4608
432 Ga0163162_10063827 3300013306 Bacteria 3727
433 Ga0163162_10228430 3300013306 Unclassified 1991
434 Ga0163162_10319374 3300013306 Unclassified 1686
435 Ga0163162_10670972 3300013306 Unclassified 1160
436 Ga0163162_10855809 3300013306 Bacteria 1024
437 Ga0163162_11248506 3300013306 Bacteria 844
438 Ga0163162_11264108 3300013306 Unclassified 838
439 Ga0163162_12535318 3300013306 Bacteria 590
440 Ga0157372_10000656 3300013307 Bacteria 37971
441 Ga0157372_10042624 3300013307 Bacteria 5021
442 Ga0157372_10147119 3300013307 Bacteria 2717
443 Ga0157372_10158348 3300013307 Unclassified 2616
444 Ga0157372_10235370 3300013307 Bacteria 2124
445 Ga0157372_10685374 3300013307 Unclassified 1193
446 Ga0157372_13442502 3300013307 Unclassified 503
447 Ga0157375_10066469 3300013308 Unclassified 3600
448 Ga0157375_10161094 3300013308 Bacteria 2385
449 Ga0157375_10210023 3300013308 Unclassified 2104
450 Ga0157375_10310387 3300013308 Bacteria 1741
451 Ga0157375_10371297 3300013308 Bacteria 1597
452 Ga0157375_10622839 3300013308 Bacteria 1237
453 Ga0157375_10851285 3300013308 Bacteria 1058
454 Ga0157375_11326942 3300013308 Unclassified 846
455 Ga0163163_10021449 3300014325 Bacteria 6097
456 Ga0163163_10024708 3300014325 Bacteria 5721
457 Ga0163163_10037055 3300014325 Bacteria 4742
458 Ga0163163_10037639 3300014325 Bacteria 4708
459 Ga0163163_10054161 3300014325 Bacteria 3962
460 Ga0163163_10124708 3300014325 Bacteria 2612
461 Ga0163163_10252688 3300014325 Bacteria 1813
462 Ga0163163_10387917 3300014325 Bacteria 1454
463 Ga0163163_11207725 3300014325 Bacteria 819
464 Ga0163163_11227568 3300014325 Bacteria 812
465 Ga0157380_10002108 3300014326 Bacteria 13337
466 Ga0157380_10002689 3300014326 Bacteria 12060
467 Ga0157380_10017561 3300014326 Bacteria 5295
468 Ga0157380_10032589 3300014326 Bacteria 4010
469 Ga0157380_10045490 3300014326 Bacteria 3444
470 Ga0157380_10239085 3300014326 Bacteria 1636
471 Ga0157380_10292688 3300014326 Unclassified 1496
472 Ga0157380_10467604 3300014326 Bacteria 1216
473 Ga0157380_10717490 3300014326 Bacteria 1007
474 Ga0157380_10754884 3300014326 Bacteria 985
475 Ga0157380_11610588 3300014326 Bacteria 705
476 Ga0157380_11669786 3300014326 Bacteria 694
477 Ga0157380_12116494 3300014326 Unclassified 626
478 Ga0157380_12748132 3300014326 Unclassified 559
479 Ga0157377_10444818 3300014745 Unclassified 893
480 Ga0157379_10012056 3300014968 Bacteria 7553
481 Ga0157379_10017429 3300014968 Bacteria 6324
482 Ga0157379_10020519 3300014968 Bacteria 5843
483 Ga0157379_10063543 3300014968 Bacteria 3300
484 Ga0157379_10314365 3300014968 Unclassified 1429
485 Ga0157379_10506164 3300014968 Bacteria 1120
486 Ga0157379_11005087 3300014968 Bacteria 795
487 Ga0157379_11100465 3300014968 Bacteria 761
488 Ga0157379_11803441 3300014968 Unclassified 601
489 Ga0157376_10020301 3300014969 Bacteria 5137
490 Ga0157376_10061796 3300014969 Bacteria 3150
491 Ga0157376_10147511 3300014969 Bacteria 2118
492 Ga0157376_10282658 3300014969 Bacteria 1563
493 Ga0157376_10435668 3300014969 Bacteria 1275
494 Ga0157376_10439104 3300014969 Unclassified 1270
495 Ga0157376_10895325 3300014969 Bacteria 905
496 Ga0157376_11073596 3300014969 Bacteria 830
497 Ga0157376_11675253 3300014969 Bacteria 671
498 Ga0157376_11698879 3300014969 Bacteria 666
499 Ga0157376_11734379 3300014969 Bacteria 660
500 Ga0157376_11735144 3300014969 Bacteria 660
501 Ga0157376_11794174 3300014969 Bacteria 650
502 Ga0157376_11922364 3300014969 Bacteria 629
503 Ga0163161_10159845 3300017792 Bacteria 1718
504 Ga0163161_10605122 3300017792 Bacteria 904
505 Ga0163161_10872943 3300017792 Bacteria 760
506 Ga0163161_12024222 3300017792 Bacteria 512
507 Ga0213876_10143140 3300021384 Bacteria 1271
508 Ga0209673_1012504 3300025273 Bacteria 3414
509 Ga0207673_1018235 3300025290 Bacteria 939
510 Ga0209051_1004592 3300025303 Bacteria 8425
511 Ga0209257_1000309 3300025304 Bacteria 104166
512 Ga0207697_10001907 3300025315 Bacteria 11108
513 Ga0207697_10146494 3300025315 Bacteria 1026
514 Ga0207656_10006854 3300025321 Bacteria 4124
515 Ga0207682_10000850 3300025893 Bacteria 14174
516 Ga0207642_10018161 3300025899 Bacteria 2693
517 Ga0207642_10046203 3300025899 Bacteria 1938
518 Ga0207642_10645851 3300025899 Bacteria 663
519 Ga0207688_10000680 3300025901 Bacteria 16796
520 Ga0207688_10930532 3300025901 Unclassified 550
521 Ga0207680_10043301 3300025903 Bacteria 2639
522 Ga0207680_10787634 3300025903 Bacteria 682
523 Ga0207647_10028610 3300025904 Bacteria 3617
524 Ga0207647_10076768 3300025904 Bacteria 2009
525 Ga0207645_10002221 3300025907 Bacteria 15483
526 Ga0207645_10046224 3300025907 Unclassified 2781
527 Ga0207645_10421765 3300025907 Unclassified 899
528 Ga0207645_10588287 3300025907 Bacteria 755
529 Ga0207645_10767041 3300025907 Bacteria 656
530 Ga0207643_10000188 3300025908 Bacteria 42556
531 Ga0207643_10003877 3300025908 Bacteria 8046
532 Ga0207643_10202540 3300025908 Unclassified 1209
533 Ga0207643_11022632 3300025908 Unclassified 534
534 Ga0207705_10427082 3300025909 Bacteria 1026
535 Ga0207654_11138634 3300025911 Unclassified 568
536 Ga0207707_11336623 3300025912 Unclassified 574
537 Ga0207695_10043435 3300025913 Bacteria 4790
538 Ga0207660_11209211 3300025917 Bacteria 615
539 Ga0207662_10149877 3300025918 Bacteria 1483
540 Ga0207662_10539827 3300025918 Bacteria 807
541 Ga0207662_10644454 3300025918 Bacteria 739
542 Ga0207649_10374097 3300025920 Bacteria 1060
543 Ga0207649_10774074 3300025920 Bacteria 748
544 Ga0207649_11194787 3300025920 Unclassified 601
545 Ga0207652_10041101 3300025921 Bacteria 3929
546 Ga0207652_10330171 3300025921 Unclassified 1377
547 Ga0207652_11820665 3300025921 Bacteria 514
548 Ga0207646_10790638 3300025922 Bacteria 845
549 Ga0207681_10098123 3300025923 Unclassified 2107
550 Ga0207681_10159293 3300025923 Bacteria 1699
551 Ga0207681_11834782 3300025923 Bacteria 506
552 Ga0207694_10039354 3300025924 Bacteria 3639
553 Ga0207650_10009664 3300025925 Bacteria 6593
554 Ga0207650_10041245 3300025925 Bacteria 3381
555 Ga0207650_10079123 3300025925 Unclassified 2489
556 Ga0207650_10830773 3300025925 Bacteria 783
557 Ga0207659_10035434 3300025926 Bacteria 3449
558 Ga0207659_10133498 3300025926 Unclassified 1919
559 Ga0207659_10248453 3300025926 Bacteria 1442
560 Ga0207659_10329937 3300025926 Bacteria 1261
561 Ga0207659_10996802 3300025926 Bacteria 721
562 Ga0207659_11187102 3300025926 Bacteria 656
563 Ga0207687_10013955 3300025927 Bacteria 5251
564 Ga0207687_10176843 3300025927 Bacteria 1650
565 Ga0207687_10363300 3300025927 Bacteria 1182
566 Ga0207687_10399224 3300025927 Bacteria 1130
567 Ga0207687_10789427 3300025927 Bacteria 809
568 Ga0207687_10970987 3300025927 Bacteria 728
569 Ga0207644_10279526 3300025931 Unclassified 1340
570 Ga0207644_10403473 3300025931 Unclassified 1118
571 Ga0207644_10444615 3300025931 Unclassified 1064
572 Ga0207644_10637294 3300025931 Bacteria 886
573 Ga0207644_10907408 3300025931 Bacteria 738
574 Ga0207690_10466400 3300025932 Bacteria 1017
575 Ga0207706_10023206 3300025933 Bacteria 5572
576 Ga0207706_10039291 3300025933 Bacteria 4194
577 Ga0207706_10064005 3300025933 Bacteria 3238
578 Ga0207706_10097186 3300025933 Bacteria 2590
579 Ga0207706_10154534 3300025933 Unclassified 2018
580 Ga0207686_10000532 3300025934 Bacteria 24670
581 Ga0207686_10099083 3300025934 Bacteria 1942
582 Ga0207686_10436684 3300025934 Bacteria 1004
583 Ga0207686_10819497 3300025934 Bacteria 747
584 Ga0207709_10008548 3300025935 Bacteria 5661
585 Ga0207709_10080536 3300025935 Bacteria 2097
586 Ga0207709_10486832 3300025935 Bacteria 960
587 Ga0207670_10052595 3300025936 Bacteria 2739
588 Ga0207670_10311355 3300025936 Bacteria 1236
589 Ga0207670_10489223 3300025936 Bacteria 997
590 Ga0207669_10030931 3300025937 Bacteria 2983
591 Ga0207669_10504958 3300025937 Bacteria 968
592 Ga0207704_10022957 3300025938 Bacteria 3354
593 Ga0207704_10025570 3300025938 Bacteria 3223
594 Ga0207704_10374697 3300025938 Bacteria 1115
595 Ga0207704_10631267 3300025938 Bacteria 880
596 Ga0207704_10693640 3300025938 Bacteria 842
597 Ga0207704_10803835 3300025938 Bacteria 785
598 Ga0207691_10059928 3300025940 Bacteria 3460
599 Ga0207691_10268705 3300025940 Bacteria 1469
600 Ga0207691_10886073 3300025940 Bacteria 747
601 Ga0207711_10014526 3300025941 Bacteria 6545
602 Ga0207711_10122894 3300025941 Bacteria 2319
603 Ga0207711_10387824 3300025941 Bacteria 1297
604 Ga0207711_10559649 3300025941 Unclassified 1067
605 Ga0207711_10608593 3300025941 Unclassified 1019
606 Ga0207689_10000262 3300025942 Bacteria 47258
607 Ga0207689_10001600 3300025942 Bacteria 21433
608 Ga0207689_10003034 3300025942 Bacteria 15480
609 Ga0207689_10034333 3300025942 Unclassified 4213
610 Ga0207689_10090212 3300025942 Unclassified 2518
611 Ga0207689_10142695 3300025942 Unclassified 1973
612 Ga0207689_10941790 3300025942 Bacteria 729
613 Ga0207661_10071203 3300025944 Bacteria 2841
614 Ga0207661_10158672 3300025944 Bacteria 1961
615 Ga0207661_10456935 3300025944 Bacteria 1164
616 Ga0207661_10711611 3300025944 Unclassified 924
617 Ga0207679_10258257 3300025945 Unclassified 1485
618 Ga0207679_10284192 3300025945 Bacteria 1420
619 Ga0207679_10350033 3300025945 Bacteria 1287
620 Ga0207679_11861771 3300025945 Bacteria 549
621 Ga0207667_10017959 3300025949 Bacteria 7950
622 Ga0207667_10463725 3300025949 Bacteria 1286
623 Ga0207651_10021076 3300025960 Bacteria 3951
624 Ga0207651_10186042 3300025960 Bacteria 1652
625 Ga0207651_10820029 3300025960 Bacteria 826
626 Ga0207651_10943385 3300025960 Bacteria 769
627 Ga0207712_10013240 3300025961 Bacteria 5286
628 Ga0207712_10091122 3300025961 Bacteria 2245
629 Ga0207712_10625193 3300025961 Bacteria 934
630 Ga0207712_10752027 3300025961 Unclassified 854
631 Ga0207668_10647254 3300025972 Bacteria 925
632 Ga0207668_11029828 3300025972 Bacteria 736
633 Ga0207668_11375652 3300025972 Bacteria 636
634 Ga0207640_10207980 3300025981 Bacteria 1488
635 Ga0207640_10345344 3300025981 Bacteria 1194
636 Ga0207640_10419216 3300025981 Bacteria 1095
637 Ga0207658_10042515 3300025986 Bacteria 3297
638 Ga0207658_10180401 3300025986 Bacteria 1747
639 Ga0207658_10194728 3300025986 Unclassified 1688
640 Ga0207658_10305766 3300025986 Bacteria 1371
641 Ga0207658_10346714 3300025986 Unclassified 1292
642 Ga0207677_10067833 3300026023 Bacteria 2500
643 Ga0207677_10411035 3300026023 Unclassified 1150
644 Ga0207677_10577116 3300026023 Bacteria 984
645 Ga0207703_10004514 3300026035 Bacteria 11423
646 Ga0207703_10169825 3300026035 Unclassified 1917
647 Ga0207703_10385636 3300026035 Bacteria 1297
648 Ga0207703_11106745 3300026035 Unclassified 761
649 Ga0207703_11119581 3300026035 Bacteria 756
650 Ga0207703_11236044 3300026035 Bacteria 718
651 Ga0207639_10075088 3300026041 Unclassified 2657
652 Ga0207639_10280903 3300026041 Bacteria 1464
653 Ga0207639_10286459 3300026041 Bacteria 1451
654 Ga0207639_10400305 3300026041 Bacteria 1237
655 Ga0207639_10431819 3300026041 Bacteria 1193
656 Ga0207639_10661793 3300026041 Unclassified 967
657 Ga0207639_11135618 3300026041 Bacteria 733
658 Ga0207678_10006127 3300026067 Bacteria 10696
659 Ga0207678_11049804 3300026067 Bacteria 721
660 Ga0207708_10003947 3300026075 Bacteria 10920
661 Ga0207708_10006587 3300026075 Bacteria 8597
662 Ga0207708_10020126 3300026075 Bacteria 5032
663 Ga0207708_10411284 3300026075 Bacteria 1120
664 Ga0207708_10425749 3300026075 Bacteria 1101
665 Ga0207702_10155402 3300026078 Unclassified 2085
666 Ga0207641_10142817 3300026088 Bacteria 2162
667 Ga0207641_10283932 3300026088 Bacteria 1558
668 Ga0207641_10516476 3300026088 Bacteria 1161
669 Ga0207641_10528138 3300026088 Bacteria 1148
670 Ga0207641_10547030 3300026088 Bacteria 1129
671 Ga0207648_10000491 3300026089 Bacteria 44111
672 Ga0207648_10029798 3300026089 Bacteria 4839
673 Ga0207648_10031490 3300026089 Unclassified 4690
674 Ga0207648_10047261 3300026089 Bacteria 3773
675 Ga0207648_10057742 3300026089 Bacteria 3386
676 Ga0207648_10087070 3300026089 Unclassified 2726
677 Ga0207648_10119486 3300026089 Bacteria 2317
678 Ga0207648_10211352 3300026089 Bacteria 1722
679 Ga0207648_10467606 3300026089 Bacteria 1150
680 Ga0207676_10001767 3300026095 Bacteria 15841
681 Ga0207676_10068447 3300026095 Bacteria 2840
682 Ga0207676_10180624 3300026095 Bacteria 1847
683 Ga0207676_10188273 3300026095 Unclassified 1814
684 Ga0207676_10301302 3300026095 Bacteria 1464
685 Ga0207676_10928094 3300026095 Bacteria 855
686 Ga0207674_10016255 3300026116 Bacteria 8151
687 Ga0207674_10074752 3300026116 Bacteria 3399
688 Ga0207674_10284184 3300026116 Bacteria 1603
689 Ga0207674_10368055 3300026116 Bacteria 1390
690 Ga0207674_11433263 3300026116 Bacteria 660
691 Ga0207674_11435934 3300026116 Bacteria 659
692 Ga0207675_100001238 3300026118 Bacteria 25498
693 Ga0207675_100004912 3300026118 Bacteria 12882
694 Ga0207675_100239679 3300026118 Bacteria 1752
695 Ga0207675_100250736 3300026118 Unclassified 1713
696 Ga0207675_100427987 3300026118 Bacteria 1308
697 Ga0207675_101938803 3300026118 Bacteria 607
698 Ga0207683_10007474 3300026121 Bacteria 9374
699 Ga0207683_10017447 3300026121 Bacteria 6118
700 Ga0207683_10469893 3300026121 Unclassified 1160
701 Ga0207683_11078736 3300026121 Bacteria 745
702 Ga0207698_10034858 3300026142 Bacteria 3675
703 Ga0207698_10353884 3300026142 Bacteria 1388
704 Ga0207698_10451312 3300026142 Bacteria 1241
705 Ga0207698_10838248 3300026142 Bacteria 924
706 Ga0209995_1033562 3300027471 Bacteria 862
707 Ga0209995_1096427 3300027471 Unclassified 509
708 Ga0209813_10261256 3300027866 Bacteria 661
709 Ga0207428_10394380 3300027907 Bacteria 1014
710 Ga0207428_10414733 3300027907 Bacteria 985
711 Ga0268266_10063426 3300028379 Bacteria 3189
712 Ga0268266_10387800 3300028379 Bacteria 1319
713 Ga0268266_10768376 3300028379 Unclassified 930
714 Ga0268265_10047352 3300028380 Unclassified 3221
715 Ga0268265_10127567 3300028380 Bacteria 2108
716 Ga0268265_10433938 3300028380 Bacteria 1223
717 Ga0268265_10917746 3300028380 Unclassified 861
718 Ga0268264_10005327 3300028381 Bacteria 10897
719 Ga0268264_10063467 3300028381 Bacteria 3105
720 Ga0268264_10342856 3300028381 Bacteria 1420
721 Ga0268264_10360143 3300028381 Bacteria 1387
722 Ga0268264_10552555 3300028381 Bacteria 1129
723 Ga0268264_10574161 3300028381 Bacteria 1109
724 Ga0307517_10608010 3300028786 Bacteria 537
725 Ga0307515_10000059 3300028794 Bacteria 257520
726 Ga0307515_10000265 3300028794 Bacteria 129554
727 Ga0307515_10000347 3300028794 Bacteria 114603
728 Ga0307515_10002435 3300028794 Bacteria 40544
729 Ga0307515_10003762 3300028794 Bacteria 31786
730 Ga0307515_10546302 3300028794 Bacteria 768
731 Ga0307512_10120497 3300030522 Bacteria 1688
732 Ga0307512_10194593 3300030522 Bacteria 1111
733 Ga0307513_10006201 3300031456 Bacteria 15675
734 Ga0307513_10024660 3300031456 Bacteria 6992
735 Ga0307513_10083106 3300031456 Bacteria 3294
736 Ga0307513_10133414 3300031456 Bacteria 2424
737 Ga0307513_10146015 3300031456 Bacteria 2283
738 Ga0307513_10351259 3300031456 Bacteria 1222
739 Ga0307513_10498207 3300031456 Bacteria 936
740 Ga0307513_10580467 3300031456 Bacteria 831
741 Ga0307513_10657106 3300031456 Bacteria 755
742 Ga0307509_10003931 3300031507 Bacteria 21948
743 Ga0307509_10021357 3300031507 Bacteria 7320
744 Ga0307408_100385531 3300031548 Bacteria 1199
745 Ga0307408_100958799 3300031548 Unclassified 786
746 Ga0307408_101066397 3300031548 Bacteria 748
747 Ga0307508_10001686 3300031616 Bacteria 24498
748 Ga0307508_10002419 3300031616 Bacteria 19681
749 Ga0307508_10401553 3300031616 Bacteria 962
750 Ga0307514_10241678 3300031649 Bacteria 1080
751 Ga0265314_10150042 3300031711 Bacteria 1431
752 Ga0307516_10001538 3300031730 Bacteria 31719
753 Ga0307516_10053528 3300031730 Bacteria 3946
754 Ga0307516_10362362 3300031730 Bacteria 1114
755 Ga0307410_10158797 3300031852 Bacteria 1692
756 Ga0307406_10361484 3300031901 Unclassified 1138
757 Ga0307412_11016713 3300031911 Bacteria 733
758 Ga0307415_100728098 3300032126 Bacteria 898
759 Ga0307415_100786915 3300032126 Bacteria 867
760 Ga0307507_10032282 3300033179 Bacteria 5470
761 Ga0307507_10169869 3300033179 Bacteria 1587
762 Ga0307510_10222308 3300033180 Bacteria 1398
763 Ga0307510_10269257 3300033180 Bacteria 1180
764 Ga0373929_0034657 3300035085 Bacteria 1096
765 Ga0373941_0041623 3300035115 Bacteria 1423
766 Ga0373962_0079264 3300035242 Bacteria 994
767 Ga0373962_0406256 3300035242 Unclassified 502
768 Ga0373927_0164380 3300035695 Bacteria 1454
769 Ga0373933_0626756 3300035724 Unclassified 707
770 Ga0373947_0100675 3300035725 Bacteria 1816
771 Ga0373925_0700550 3300037068 Bacteria 835
772 Ga0395900_1101200 3300037418 Unclassified 711
773 Ga0436365_0306342 3300039437 Bacteria 13671
774 Ga0436365_1894678 3300039437 Bacteria 43063
775 Ga0436361_0128791 3300039447 Bacteria 2143
776 Ga0439436_0001316 3300041404 Bacteria 7122
777 Ga0439438_028748 3300041405 Bacteria 1493
778 Ga0439439_0003403 3300041406 Bacteria 3509
779 Ga0439447_020516 3300041407 Bacteria 1752
780 Ga0439461_0031947 3300041410 Bacteria 1101
781 Ga0439461_0176768 3300041410 Bacteria 564
782 Ga0439466_0001978 3300041411 Bacteria 8035
783 Ga0439466_0056408 3300041411 Bacteria 1274
784 Ga0439465_0000192 3300041413 Bacteria 15978
785 Ga0439465_0002208 3300041413 Bacteria 6377
786 Ga0451791_1225265 3300041451 Bacteria 1068
787 Ga0451793_1678246 3300041452 Unclassified 639
788 Ga0451797_0863558 3300041453 Bacteria 617
789 Ga0451795_0384717 3300041456 Bacteria 850
790 Ga0451800_1433977 3300041459 Bacteria 996
791 Ga0451802_1010297 3300041460 Bacteria 1449
792 Ga0451851_1155442 3300041507 Bacteria 878
793 Ga0451853_0039075 3300041512 Bacteria 1449
794 Ga0451853_1468226 3300041512 Bacteria 1367
795 Ga0451853_2687333 3300041512 Bacteria 1095
796 Ga0439431_0001341 3300041997 Bacteria 5426
797 Ga0439433_0000590 3300041999 Bacteria 6900
798 Ga0439442_019855 3300042002 Bacteria 1392
799 Ga0439445_0000167 3300042004 Bacteria 11641
800 Ga0439432_016348 3300042006 Bacteria 2498
801 Ga0439432_211189 3300042006 Bacteria 561
802 Ga0439449_0039405 3300042007 Bacteria 1756
803 Ga0439449_0046631 3300042007 Bacteria 1605
804 Ga0439452_008633 3300042010 Bacteria 3052
805 Ga0450920_125695 3300042122 Bacteria 539
806 Ga0450897_032760 3300042128 Bacteria 593
807 Ga0450898_076471 3300042134 Bacteria 676
808 Ga0439446_0017468 3300042156 Bacteria 2005
809 Ga0450909_007456 3300042185 Bacteria 1584
810 Ga0439434_0000712 3300042435 Bacteria 9583
811 Ga0451577_0004145 3300042876 Bacteria 15530
812 Ga0466963_1146702 3300044694 Unclassified 546
813 Ga0453684_0000039 3300044712 Bacteria 697730
814 Ga0453684_0023646 3300044712 Bacteria 9031
815 Ga0453684_0198610 3300044712 Bacteria 2340
816 Ga0453684_0329636 3300044712 Unclassified 1726
817 Ga0451576_2461799 3300045051 Unclassified 532
818 Ga0495638_0330326 3300046460 Bacteria 812
819 Ga0495580_0159595 3300046472 Bacteria 1561
820 Ga0495582_0084811 3300046473 Bacteria 1761
821 Ga0495585_0342341 3300046492 Unclassified 728
822 Ga0495608_0432898 3300046511 Unclassified 802
823 Ga0495610_0069557 3300046512 Bacteria 1647
824 Ga0495618_0203502 3300046514 Bacteria 1253
825 Ga0495632_0012811 3300046519 Bacteria 4814
826 Ga0495632_0067042 3300046519 Bacteria 1731
827 Ga0495632_0247542 3300046519 Bacteria 800
828 Ga0495598_0267410 3300046537 Bacteria 638
829 Ga0495621_0365042 3300046539 Bacteria 608
830 Ga0495656_0115467 3300046615 Unclassified 1261
831 Ga0495668_0361514 3300046616 Unclassified 797
832 Ga0495668_0462831 3300046616 Unclassified 698
833 Ga0495625_0004683 3300046660 Bacteria 12847
834 Ga0495625_0016141 3300046660 Bacteria 5884
835 Ga0495625_0776219 3300046660 Bacteria 559
836 Ga0495647_0191009 3300046681 Bacteria 895
837 Ga0495658_0185882 3300046683 Bacteria 1290
838 Ga0495658_0213301 3300046683 Bacteria 1207
839 Ga0495679_116250 3300047446 Archaea 734
840 Ga0495673_0181730 3300047469 Bacteria 796
841 Ga0495686_0097614 3300047472 Bacteria 1776
842 Ga0496100_0251681 3300048903 Bacteria 1307
843 Ga0496100_0295744 3300048903 Bacteria 1211
844 Ga0496100_0712000 3300048903 Bacteria 784
845 Ga0496100_1439728 3300048903 Bacteria 544
846 Ga0496101_0034501 3300048904 Bacteria 3574
847 Ga0496101_0150565 3300048904 Bacteria 1780
848 Ga0496101_0784496 3300048904 Bacteria 751
849 Ga0496102_0323085 3300048905 Bacteria 1454
850 Ga0496103_0671372 3300048906 Bacteria 658
851 Ga0496104_0004292 3300048907 Bacteria 12392
852 Ga0496104_0057193 3300048907 Bacteria 3690
853 Ga0496104_0199685 3300048907 Bacteria 1912
854 Ga0496104_0489401 3300048907 Bacteria 1141
855 Ga0496104_0720424 3300048907 Bacteria 905
856 Ga0496105_0107660 3300048908 Bacteria 2301
857 Ga0496106_0219399 3300048909 Bacteria 1516
858 Ga0496106_0240449 3300048909 Bacteria 1447
859 Ga0496106_0428171 3300048909 Bacteria 1063
860 Ga0496107_0079878 3300048910 Bacteria 2385
861 Ga0496108_0005708 3300048911 Bacteria 10075
862 Ga0496108_0067785 3300048911 Bacteria 3010
863 Ga0496108_0256375 3300048911 Bacteria 1522
864 Ga0496108_0512151 3300048911 Bacteria 1048
865 Ga0496108_0831898 3300048911 Bacteria 795
866 Ga0496109_0008725 3300048912 Bacteria 8630
867 Ga0496109_0056385 3300048912 Bacteria 3586
868 Ga0496109_1069882 3300048912 Unclassified 744
869 Ga0496110_0353976 3300048913 Bacteria 1338
870 Ga0496110_0360864 3300048913 Bacteria 1324
871 Ga0496110_0936536 3300048913 Bacteria 773
872 Ga0496111_0114173 3300048914 Bacteria 1991
873 Ga0496111_0456751 3300048914 Bacteria 942
874 Ga0496111_0771821 3300048914 Bacteria 697
875 Ga0496112_0214172 3300048915 Bacteria 1883
876 Ga0496112_0259752 3300048915 Bacteria 1686
877 Ga0496112_0603738 3300048915 Bacteria 1029
878 Ga0496112_0698379 3300048915 Bacteria 942
879 Ga0496113_0151283 3300048916 Bacteria 1831
880 Ga0496113_0238281 3300048916 Bacteria 1451
881 Ga0496113_0240023 3300048916 Bacteria 1446
882 Ga0496114_0422860 3300048917 Bacteria 1180
883 Ga0496114_0714958 3300048917 Unclassified 878
884 Ga0496115_0243135 3300048918 Bacteria 1483
885 Ga0496115_0737112 3300048918 Bacteria 772
886 Ga0496119_0151588 3300048922 Bacteria 1242
887 Ga0501292_004192 3300049515 Bacteria 1960
888 Ga0501298_119148 3300049521 Bacteria 620
889 Ga0501303_006056 3300049526 Bacteria 1047
890 Ga0501034_0000487 3300049571 Bacteria 64548
891 Ga0501034_0008360 3300049571 Bacteria 10945
892 Ga0501048_0158019 3300049582 Unclassified 1604
893 Ga0501069_0016511 3300049585 Bacteria 3966
894 Ga0501072_0029917 3300049588 Bacteria 4255
895 Ga0501072_0417538 3300049588 Bacteria 1064
896 Ga0501073_0419239 3300049589 Bacteria 925
897 Ga0501074_0220870 3300049590 Bacteria 1349
898 Ga0501077_0549707 3300049593 Bacteria 741
899 Ga0501238_030630 3300049671 Bacteria 777
900 Ga0501252_064573 3300049682 Bacteria 579
901 Ga0501257_029363 3300049686 Bacteria 1321
902 Ga0501080_0370665 3300049742 Bacteria 1291
903 Ga0501083_0059628 3300049744 Bacteria 2552
904 Ga0501083_0417993 3300049744 Bacteria 872
905 Ga0501241_030233 3300049758 Unclassified 1022
906 Ga0501265_012248 3300049762 Bacteria 1066
907 nmdc:mga00v17_460736_c1 3300050491 Unclassified 825
908 nmdc:mga0k408_131819_c1 3300050493 Bacteria 1484
909 nmdc:mga0k408_29009_c1 3300050493 Bacteria 3148
910 nmdc:mga0k408_38329_c1 3300050493 Bacteria 2751
911 nmdc:mga0k408_83997_c1 3300050493 Bacteria 1545
912 nmdc:mga06z11_87728_c1 3300050494 Bacteria 1683
913 nmdc:mga07m45_196928_c1 3300050496 Bacteria 1172
914 nmdc:mga07m45_735693_c1 3300050496 Unclassified 567
915 nmdc:mga09592_1072740_c1 3300050508 Unclassified 670
916 nmdc:mga0qj67_276973_c1 3300050509 Unclassified 1360
917 nmdc:mga06r32_1554084_c1 3300050510 Bacteria 601
918 nmdc:mga06r32_245325_c1 3300050510 Bacteria 1778
919 nmdc:mga06r32_509301_c1 3300050510 Bacteria 1180
920 nmdc:mga08y16_125428_c1 3300050511 Bacteria 2671
921 nmdc:mga08y16_406415_c1 3300050511 Bacteria 1393
922 nmdc:mga0n895_687279_c1 3300050512 Bacteria 1020
923 nmdc:mga0rr50_671024_c1 3300050513 Bacteria 884
924 nmdc:mga0a205_158727_c1 3300050515 Bacteria 2159
925 nmdc:mga0a205_849353_c1 3300050515 Unclassified 760
926 nmdc:mga0sz30_245696_c1 3300050516 Unclassified 797
927 Ga0495601_0565859 3300053077 Unclassified 731
928 Ga0500644_0037342 3300053088 Bacteria 1587
929 Ga0500621_231062 3300053126 Bacteria 634
930 Ga0500658_0039635 3300053134 Bacteria 1884
931 Ga0500559_0075454 3300053136 Bacteria 1525
932 Ga0500568_0109976 3300053139 Bacteria 1030
933 Ga0500587_023225 3300053739 Bacteria 818
934 Ga0530510_0009843 3300061734 Bacteria 6708

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_2461799 Ga0451576_2461799_47_349 99
2 3300005549 Ga0070704_100112443 Ga0070704_1001124432 113
3 3300006880 Ga0075429_100476477 Ga0075429_1004764772 113
4 3300005331 Ga0070670_100701832 Ga0070670_1007018322 114
5 3300005344 Ga0070661_101129301 Ga0070661_1011293012 114
6 3300005345 Ga0070692_10893209 Ga0070692_108932092 114
7 3300005354 Ga0070675_101726012 Ga0070675_1017260121 114
8 3300005444 Ga0070694_101293086 Ga0070694_1012930862 114
9 3300005455 Ga0070663_101616042 Ga0070663_1016160421 114
10 3300005466 Ga0070685_10174741 Ga0070685_101747412 114
11 3300005466 Ga0070685_10577612 Ga0070685_105776121 114
12 3300005518 Ga0070699_100312743 Ga0070699_1003127431 114
13 3300005564 Ga0070664_100605156 Ga0070664_1006051562 114
14 3300005577 Ga0068857_100506414 Ga0068857_1005064142 114
15 3300005615 Ga0070702_100023630 Ga0070702_1000236303 114
16 3300005617 Ga0068859_102700753 Ga0068859_1027007531 114
17 3300005618 Ga0068864_100377884 Ga0068864_1003778843 114
18 3300005718 Ga0068866_10234648 Ga0068866_102346482 114
19 3300005841 Ga0068863_101332415 Ga0068863_1013324152 114
20 3300005842 Ga0068858_100633933 Ga0068858_1006339331 114
21 3300005844 Ga0068862_100375363 Ga0068862_1003753633 114
22 3300006358 Ga0068871_100845094 Ga0068871_1008450942 114
23 3300006871 Ga0075434_100330807 Ga0075434_1003308073 114
24 3300006881 Ga0068865_100380475 Ga0068865_1003804752 114
25 3300006931 Ga0097620_102700850 Ga0097620_1027008502 114
26 3300009011 Ga0105251_10456859 Ga0105251_104568592 114
27 3300009094 Ga0111539_10014384 Ga0111539_100143848 114
28 3300009098 Ga0105245_10048092 Ga0105245_100480924 114
29 3300009098 Ga0105245_11049290 Ga0105245_110492903 114
30 3300009101 Ga0105247_10240647 Ga0105247_102406472 114
31 3300009148 Ga0105243_10801532 Ga0105243_108015322 114
32 3300009148 Ga0105243_10845137 Ga0105243_108451372 114
33 3300009176 Ga0105242_10233422 Ga0105242_102334223 114
34 3300009177 Ga0105248_10270503 Ga0105248_102705033 114
35 3300009177 Ga0105248_11225207 Ga0105248_112252072 114
36 3300009553 Ga0105249_10872399 Ga0105249_108723992 114
37 3300009553 Ga0105249_11639595 Ga0105249_116395952 114
38 3300010375 Ga0105239_10586538 Ga0105239_105865382 114
39 3300010375 Ga0105239_11384705 Ga0105239_113847052 114
40 3300011119 Ga0105246_10362226 Ga0105246_103622262 114
41 3300013297 Ga0157378_10106460 Ga0157378_101064603 114
42 3300013306 Ga0163162_11248506 Ga0163162_112485062 114
43 3300013308 Ga0157375_10161094 Ga0157375_101610941 114
44 3300014325 Ga0163163_10021449 Ga0163163_100214496 114
45 3300014325 Ga0163163_10037639 Ga0163163_100376393 114
46 3300014325 Ga0163163_10124708 Ga0163163_101247082 114
47 3300014325 Ga0163163_10252688 Ga0163163_102526883 114
48 3300014325 Ga0163163_11207725 Ga0163163_112077251 114
49 3300014326 Ga0157380_10032589 Ga0157380_100325896 114
50 3300014326 Ga0157380_10467604 Ga0157380_104676042 114
51 3300014968 Ga0157379_10506164 Ga0157379_105061642 114
52 3300014969 Ga0157376_10895325 Ga0157376_108953252 114
53 3300014969 Ga0157376_11734379 Ga0157376_117343792 114
54 3300014969 Ga0157376_11922364 Ga0157376_119223642 114
55 3300017792 Ga0163161_12024222 Ga0163161_120242221 114
56 3300025926 Ga0207659_10996802 Ga0207659_109968021 114
57 3300025927 Ga0207687_10970987 Ga0207687_109709872 114
58 3300025934 Ga0207686_10099083 Ga0207686_100990832 114
59 3300025938 Ga0207704_10693640 Ga0207704_106936402 114
60 3300025944 Ga0207661_10456935 Ga0207661_104569352 114
61 3300025945 Ga0207679_11861771 Ga0207679_118617711 114
62 3300025972 Ga0207668_10647254 Ga0207668_106472542 114
63 3300025972 Ga0207668_11375652 Ga0207668_113756522 114
64 3300026023 Ga0207677_10411035 Ga0207677_104110352 114
65 3300026035 Ga0207703_11119581 Ga0207703_111195812 114
66 3300026095 Ga0207676_10068447 Ga0207676_100684473 114
67 3300026095 Ga0207676_10301302 Ga0207676_103013022 114
68 3300026116 Ga0207674_10368055 Ga0207674_103680552 114
69 3300026116 Ga0207674_11433263 Ga0207674_114332632 114
70 3300028380 Ga0268265_10433938 Ga0268265_104339382 114
71 3300032126 Ga0307415_100728098 Ga0307415_1007280982 114
72 3300035085 Ga0373929_0034657 Ga0373929_0034657_162_521 114
73 3300035242 Ga0373962_0079264 Ga0373962_0079264_73_432 114
74 3300041452 Ga0451793_1678246 Ga0451793_1678246_261_626 114
75 3300041512 Ga0451853_0039075 Ga0451853_0039075_98_442 114
76 3300041512 Ga0451853_1468226 Ga0451853_1468226_211_576 114
77 3300042122 Ga0450920_125695 Ga0450920_125695_145_510 114
78 3300044712 Ga0453684_0023646 Ga0453684_0023646_5300_5671 114
79 3300044712 Ga0453684_0329636 Ga0453684_0329636_1071_1442 114
80 3300048903 Ga0496100_0712000 Ga0496100_0712000_301_663 114
81 3300048904 Ga0496101_0150565 Ga0496101_0150565_1133_1492 114
82 3300048904 Ga0496101_0784496 Ga0496101_0784496_228_590 114
83 3300048907 Ga0496104_0057193 Ga0496104_0057193_96_458 114
84 3300048908 Ga0496105_0107660 Ga0496105_0107660_419_781 114
85 3300048909 Ga0496106_0240449 Ga0496106_0240449_842_1204 114
86 3300048909 Ga0496106_0428171 Ga0496106_0428171_194_553 114
87 3300048911 Ga0496108_0067785 Ga0496108_0067785_395_754 114
88 3300048911 Ga0496108_0256375 Ga0496108_0256375_690_1052 114
89 3300048911 Ga0496108_0512151 Ga0496108_0512151_530_898 114
90 3300048911 Ga0496108_0831898 Ga0496108_0831898_165_530 114
91 3300048912 Ga0496109_1069882 Ga0496109_1069882_354_713 114
92 3300048913 Ga0496110_0353976 Ga0496110_0353976_780_1142 114
93 3300048913 Ga0496110_0936536 Ga0496110_0936536_367_732 114
94 3300048914 Ga0496111_0114173 Ga0496111_0114173_1006_1368 114
95 3300048914 Ga0496111_0771821 Ga0496111_0771821_14_379 114
96 3300048915 Ga0496112_0214172 Ga0496112_0214172_199_564 114
97 3300048915 Ga0496112_0698379 Ga0496112_0698379_131_493 114
98 3300048916 Ga0496113_0151283 Ga0496113_0151283_199_558 114
99 3300048916 Ga0496113_0238281 Ga0496113_0238281_690_1052 114
100 3300048917 Ga0496114_0422860 Ga0496114_0422860_525_887 114
101 3300049588 Ga0501072_0417538 Ga0501072_0417538_391_750 114
102 3300049590 Ga0501074_0220870 Ga0501074_0220870_489_848 114
103 3300049593 Ga0501077_0549707 Ga0501077_0549707_38_397 114
104 3300050511 nmdc:mga08y16_406415_c1 nmdc:mga08y16_406415_c1_142_501 114
105 3300050512 nmdc:mga0n895_687279_c1 nmdc:mga0n895_687279_c1_227_586 114
106 3300050515 nmdc:mga0a205_158727_c1 nmdc:mga0a205_158727_c1_784_1143 114
107 3300005328 Ga0070676_10029108 Ga0070676_100291083 115
108 3300005330 Ga0070690_101543337 Ga0070690_1015433371 115
109 3300005334 Ga0068869_100005806 Ga0068869_1000058062 115
110 3300005338 Ga0068868_100038587 Ga0068868_1000385873 115
111 3300005340 Ga0070689_100729463 Ga0070689_1007294631 115
112 3300005344 Ga0070661_100274125 Ga0070661_1002741252 115
113 3300005355 Ga0070671_100350404 Ga0070671_1003504042 115
114 3300005364 Ga0070673_100089944 Ga0070673_1000899443 115
115 3300005441 Ga0070700_100970225 Ga0070700_1009702252 115
116 3300005455 Ga0070663_100636538 Ga0070663_1006365381 115
117 3300005457 Ga0070662_100172098 Ga0070662_1001720982 115
118 3300005459 Ga0068867_100115762 Ga0068867_1001157622 115
119 3300005539 Ga0068853_100432240 Ga0068853_1004322401 115
120 3300005564 Ga0070664_100136405 Ga0070664_1001364052 115
121 3300005577 Ga0068857_100859152 Ga0068857_1008591522 115
122 3300005578 Ga0068854_100036744 Ga0068854_1000367443 115
123 3300005617 Ga0068859_100150650 Ga0068859_1001506504 115
124 3300005718 Ga0068866_10617304 Ga0068866_106173041 115
125 3300005841 Ga0068863_100046831 Ga0068863_1000468312 115
126 3300005842 Ga0068858_101744089 Ga0068858_1017440892 115
127 3300005844 Ga0068862_100723219 Ga0068862_1007232192 115
128 3300006881 Ga0068865_100548854 Ga0068865_1005488542 115
129 3300006931 Ga0097620_100150662 Ga0097620_1001506624 115
130 3300009174 Ga0105241_11747639 Ga0105241_117476392 115
131 3300009176 Ga0105242_10732124 Ga0105242_107321241 115
132 3300010375 Ga0105239_12112242 Ga0105239_121122422 115
133 3300013102 Ga0157371_10821186 Ga0157371_108211862 115
134 3300013297 Ga0157378_10057347 Ga0157378_100573473 115
135 3300013297 Ga0157378_10129141 Ga0157378_101291413 115
136 3300013306 Ga0163162_10010455 Ga0163162_100104553 115
137 3300013306 Ga0163162_10228430 Ga0163162_102284304 115
138 3300013307 Ga0157372_10685374 Ga0157372_106853742 115
139 3300013308 Ga0157375_10066469 Ga0157375_100664693 115
140 3300014968 Ga0157379_10314365 Ga0157379_103143653 115
141 3300014968 Ga0157379_11100465 Ga0157379_111004652 115
142 3300014969 Ga0157376_11794174 Ga0157376_117941741 115
143 3300017792 Ga0163161_10605122 Ga0163161_106051222 115
144 3300025899 Ga0207642_10645851 Ga0207642_106458511 115
145 3300025901 Ga0207688_10930532 Ga0207688_109305322 115
146 3300025907 Ga0207645_10046224 Ga0207645_100462243 115
147 3300025920 Ga0207649_11194787 Ga0207649_111947872 115
148 3300025923 Ga0207681_10098123 Ga0207681_100981232 115
149 3300025931 Ga0207644_10444615 Ga0207644_104446151 115
150 3300025933 Ga0207706_10154534 Ga0207706_101545342 115
151 3300025942 Ga0207689_10001600 Ga0207689_100016006 115
152 3300025944 Ga0207661_10711611 Ga0207661_107116112 115
153 3300025945 Ga0207679_10258257 Ga0207679_102582573 115
154 3300025986 Ga0207658_10194728 Ga0207658_101947282 115
155 3300026041 Ga0207639_10286459 Ga0207639_102864594 115
156 3300026075 Ga0207708_10411284 Ga0207708_104112842 115
157 3300026089 Ga0207648_10031490 Ga0207648_100314902 115
158 3300005331 Ga0070670_100014482 Ga0070670_10001448211 116
159 3300005333 Ga0070677_10261781 Ga0070677_102617811 116
160 3300005334 Ga0068869_100225440 Ga0068869_1002254402 116
161 3300005334 Ga0068869_101018432 Ga0068869_1010184322 116
162 3300005337 Ga0070682_100034568 Ga0070682_1000345683 116
163 3300005353 Ga0070669_100608776 Ga0070669_1006087762 116
164 3300005355 Ga0070671_100224904 Ga0070671_1002249041 116
165 3300005366 Ga0070659_100273229 Ga0070659_1002732293 116
166 3300005367 Ga0070667_100605824 Ga0070667_1006058242 116
167 3300005367 Ga0070667_100785874 Ga0070667_1007858742 116
168 3300005441 Ga0070700_100012034 Ga0070700_1000120343 116
169 3300005444 Ga0070694_100003464 Ga0070694_1000034643 116
170 3300005459 Ga0068867_100000607 Ga0068867_10000060710 116
171 3300005539 Ga0068853_100804414 Ga0068853_1008044142 116
172 3300005578 Ga0068854_100128176 Ga0068854_1001281764 116
173 3300005617 Ga0068859_100429086 Ga0068859_1004290862 116
174 3300005718 Ga0068866_10004418 Ga0068866_1000441810 116
175 3300005719 Ga0068861_100028714 Ga0068861_1000287148 116
176 3300005841 Ga0068863_102287269 Ga0068863_1022872692 116
177 3300005842 Ga0068858_100293938 Ga0068858_1002939383 116
178 3300005843 Ga0068860_100000807 Ga0068860_10000080726 116
179 3300005844 Ga0068862_100025990 Ga0068862_1000259906 116
180 3300006237 Ga0097621_101615824 Ga0097621_1016158241 116
181 3300006852 Ga0075433_11211947 Ga0075433_112119471 116
182 3300006931 Ga0097620_100429138 Ga0097620_1004291382 116
183 3300009093 Ga0105240_10007439 Ga0105240_1000743914 116
184 3300009093 Ga0105240_10013447 Ga0105240_100134476 116
185 3300009148 Ga0105243_10570986 Ga0105243_105709861 116
186 3300009174 Ga0105241_10306870 Ga0105241_103068702 116
187 3300009545 Ga0105237_10003127 Ga0105237_100031278 116
188 3300009545 Ga0105237_10124293 Ga0105237_101242934 116
189 3300009551 Ga0105238_10002427 Ga0105238_1000242714 116
190 3300009553 Ga0105249_10001772 Ga0105249_1000177214 116
191 3300010375 Ga0105239_10021540 Ga0105239_100215408 116
192 3300010375 Ga0105239_10176568 Ga0105239_101765682 116
193 3300013104 Ga0157370_10002445 Ga0157370_1000244522 116
194 3300013105 Ga0157369_10010660 Ga0157369_100106602 116
195 3300013297 Ga0157378_10002215 Ga0157378_1000221525 116
196 3300013306 Ga0163162_10003082 Ga0163162_1000308215 116
197 3300013307 Ga0157372_10000656 Ga0157372_1000065616 116
198 3300013307 Ga0157372_10158348 Ga0157372_101583482 116
199 3300013308 Ga0157375_11326942 Ga0157375_113269422 116
200 3300014326 Ga0157380_10292688 Ga0157380_102926882 116
201 3300014326 Ga0157380_11669786 Ga0157380_116697862 116
202 3300014968 Ga0157379_10020519 Ga0157379_1002051911 116
203 3300014969 Ga0157376_10147511 Ga0157376_101475111 116
204 3300021384 Ga0213876_10143140 Ga0213876_101431402 116
205 3300025899 Ga0207642_10046203 Ga0207642_100462032 116
206 3300025907 Ga0207645_10421765 Ga0207645_104217652 116
207 3300025912 Ga0207707_11336623 Ga0207707_113366232 116
208 3300025918 Ga0207662_10539827 Ga0207662_105398272 116
209 3300025925 Ga0207650_10041245 Ga0207650_100412455 116
210 3300025933 Ga0207706_10097186 Ga0207706_100971864 116
211 3300025935 Ga0207709_10486832 Ga0207709_104868322 116
212 3300025938 Ga0207704_10025570 Ga0207704_100255706 116
213 3300025942 Ga0207689_10142695 Ga0207689_101426953 116
214 3300025942 Ga0207689_10941790 Ga0207689_109417902 116
215 3300025961 Ga0207712_10013240 Ga0207712_100132408 116
216 3300025986 Ga0207658_10042515 Ga0207658_100425156 116
217 3300025986 Ga0207658_10346714 Ga0207658_103467142 116
218 3300026023 Ga0207677_10577116 Ga0207677_105771161 116
219 3300026041 Ga0207639_10400305 Ga0207639_104003052 116
220 3300026075 Ga0207708_10020126 Ga0207708_100201264 116
221 3300026089 Ga0207648_10000491 Ga0207648_1000049146 116
222 3300026118 Ga0207675_100250736 Ga0207675_1002507363 116
223 3300028380 Ga0268265_10047352 Ga0268265_100473521 116
224 3300028381 Ga0268264_10005327 Ga0268264_100053278 116
225 3300028381 Ga0268264_10342856 Ga0268264_103428562 116
226 3300031852 Ga0307410_10158797 Ga0307410_101587972 116
227 3300039437 Ga0436365_1894678 Ga0436365_1894678_22223_22618 116
228 3300041459 Ga0451800_1433977 Ga0451800_1433977_241_603 116
229 3300042128 Ga0450897_032760 Ga0450897_032760_119_481 116
230 3300042134 Ga0450898_076471 Ga0450898_076471_193_555 116
231 3300046460 Ga0495638_0330326 Ga0495638_0330326_375_737 116
232 3300046519 Ga0495632_0067042 Ga0495632_0067042_141_503 116
233 3300046660 Ga0495625_0016141 Ga0495625_0016141_2807_3169 116
234 3300049758 Ga0501241_030233 Ga0501241_030233_95_457 116
235 3300003316 rootH1_10013630 rootH1_100136304 117
236 3300003322 rootL2_10012244 rootL2_100122442 117
237 3300003323 rootH1_10048311 rootH1_100483113 117
238 3300005295 Ga0065707_10267991 Ga0065707_102679912 117
239 3300005328 Ga0070676_10717149 Ga0070676_107171492 117
240 3300005330 Ga0070690_100003391 Ga0070690_1000033913 117
241 3300005334 Ga0068869_100000783 Ga0068869_10000078320 117
242 3300005334 Ga0068869_100046545 Ga0068869_1000465454 117
243 3300005334 Ga0068869_100057682 Ga0068869_1000576823 117
244 3300005335 Ga0070666_10013641 Ga0070666_100136414 117
245 3300005335 Ga0070666_10838080 Ga0070666_108380801 117
246 3300005336 Ga0070680_100078898 Ga0070680_1000788983 117
247 3300005337 Ga0070682_100128736 Ga0070682_1001287362 117
248 3300005338 Ga0068868_100392398 Ga0068868_1003923983 117
249 3300005339 Ga0070660_101037396 Ga0070660_1010373961 117
250 3300005340 Ga0070689_100004027 Ga0070689_1000040278 117
251 3300005340 Ga0070689_100004215 Ga0070689_1000042159 117
252 3300005343 Ga0070687_100028089 Ga0070687_1000280892 117
253 3300005345 Ga0070692_10052322 Ga0070692_100523223 117
254 3300005347 Ga0070668_100740046 Ga0070668_1007400461 117
255 3300005353 Ga0070669_100732150 Ga0070669_1007321502 117
256 3300005354 Ga0070675_100387504 Ga0070675_1003875042 117
257 3300005354 Ga0070675_100819081 Ga0070675_1008190811 117
258 3300005354 Ga0070675_101277372 Ga0070675_1012773721 117
259 3300005356 Ga0070674_100017744 Ga0070674_1000177442 117
260 3300005356 Ga0070674_100063485 Ga0070674_1000634852 117
261 3300005364 Ga0070673_100151412 Ga0070673_1001514122 117
262 3300005365 Ga0070688_100113529 Ga0070688_1001135292 117
263 3300005365 Ga0070688_100670577 Ga0070688_1006705771 117
264 3300005365 Ga0070688_100938259 Ga0070688_1009382591 117
265 3300005366 Ga0070659_100230223 Ga0070659_1002302232 117
266 3300005367 Ga0070667_100112120 Ga0070667_1001121202 117
267 3300005434 Ga0070709_10169849 Ga0070709_101698491 117
268 3300005436 Ga0070713_100304050 Ga0070713_1003040501 117
269 3300005438 Ga0070701_10028952 Ga0070701_100289523 117
270 3300005438 Ga0070701_10615016 Ga0070701_106150161 117
271 3300005440 Ga0070705_100019887 Ga0070705_1000198874 117
272 3300005440 Ga0070705_100135379 Ga0070705_1001353791 117
273 3300005441 Ga0070700_100001744 Ga0070700_10000174411 117
274 3300005444 Ga0070694_100039481 Ga0070694_1000394812 117
275 3300005444 Ga0070694_100214808 Ga0070694_1002148082 117
276 3300005445 Ga0070708_100148228 Ga0070708_1001482282 117
277 3300005445 Ga0070708_100449583 Ga0070708_1004495832 117
278 3300005455 Ga0070663_100110139 Ga0070663_1001101392 117
279 3300005455 Ga0070663_100915633 Ga0070663_1009156332 117
280 3300005455 Ga0070663_101034958 Ga0070663_1010349581 117
281 3300005456 Ga0070678_100002589 Ga0070678_1000025897 117
282 3300005456 Ga0070678_100328002 Ga0070678_1003280022 117
283 3300005456 Ga0070678_100712084 Ga0070678_1007120841 117
284 3300005457 Ga0070662_100016182 Ga0070662_1000161824 117
285 3300005457 Ga0070662_100104949 Ga0070662_1001049492 117
286 3300005458 Ga0070681_10007435 Ga0070681_100074355 117
287 3300005459 Ga0068867_100016935 Ga0068867_1000169354 117
288 3300005459 Ga0068867_100052765 Ga0068867_1000527653 117
289 3300005459 Ga0068867_100075645 Ga0068867_1000756454 117
290 3300005459 Ga0068867_100105147 Ga0068867_1001051472 117
291 3300005459 Ga0068867_100270765 Ga0068867_1002707652 117
292 3300005459 Ga0068867_100907994 Ga0068867_1009079942 117
293 3300005466 Ga0070685_10022874 Ga0070685_100228744 117
294 3300005466 Ga0070685_10031471 Ga0070685_100314712 117
295 3300005467 Ga0070706_100086631 Ga0070706_1000866313 117
296 3300005471 Ga0070698_100055650 Ga0070698_1000556504 117
297 3300005471 Ga0070698_101172933 Ga0070698_1011729332 117
298 3300005530 Ga0070679_101161245 Ga0070679_1011612451 117
299 3300005539 Ga0068853_100006426 Ga0068853_1000064265 117
300 3300005539 Ga0068853_100193406 Ga0068853_1001934063 117
301 3300005539 Ga0068853_100279128 Ga0068853_1002791282 117
302 3300005543 Ga0070672_101069505 Ga0070672_1010695052 117
303 3300005544 Ga0070686_100043769 Ga0070686_1000437693 117
304 3300005544 Ga0070686_100248248 Ga0070686_1002482482 117
305 3300005544 Ga0070686_100594612 Ga0070686_1005946122 117
306 3300005545 Ga0070695_100073268 Ga0070695_1000732682 117
307 3300005545 Ga0070695_100107677 Ga0070695_1001076772 117
308 3300005546 Ga0070696_100122071 Ga0070696_1001220711 117
309 3300005546 Ga0070696_100955833 Ga0070696_1009558332 117
310 3300005547 Ga0070693_100197008 Ga0070693_1001970082 117
311 3300005548 Ga0070665_100067768 Ga0070665_1000677687 117
312 3300005548 Ga0070665_100069338 Ga0070665_1000693381 117
313 3300005564 Ga0070664_100039975 Ga0070664_1000399753 117
314 3300005564 Ga0070664_100139461 Ga0070664_1001394612 117
315 3300005564 Ga0070664_100944770 Ga0070664_1009447702 117
316 3300005564 Ga0070664_101770132 Ga0070664_1017701321 117
317 3300005577 Ga0068857_100061555 Ga0068857_1000615554 117
318 3300005577 Ga0068857_100991811 Ga0068857_1009918111 117
319 3300005577 Ga0068857_101199986 Ga0068857_1011999862 117
320 3300005578 Ga0068854_100049001 Ga0068854_1000490013 117
321 3300005615 Ga0070702_100001586 Ga0070702_1000015863 117
322 3300005616 Ga0068852_100002484 Ga0068852_1000024848 117
323 3300005616 Ga0068852_100004129 Ga0068852_1000041298 117
324 3300005616 Ga0068852_100030350 Ga0068852_1000303507 117
325 3300005616 Ga0068852_101976455 Ga0068852_1019764551 117
326 3300005617 Ga0068859_100002059 Ga0068859_10000205911 117
327 3300005617 Ga0068859_100492728 Ga0068859_1004927282 117
328 3300005617 Ga0068859_102167318 Ga0068859_1021673182 117
329 3300005618 Ga0068864_100083267 Ga0068864_1000832674 117
330 3300005618 Ga0068864_100718478 Ga0068864_1007184781 117
331 3300005618 Ga0068864_101194915 Ga0068864_1011949151 117
332 3300005618 Ga0068864_101675744 Ga0068864_1016757441 117
333 3300005718 Ga0068866_10012222 Ga0068866_100122224 117
334 3300005718 Ga0068866_10629930 Ga0068866_106299301 117
335 3300005719 Ga0068861_100683121 Ga0068861_1006831213 117
336 3300005719 Ga0068861_100805078 Ga0068861_1008050782 117
337 3300005719 Ga0068861_101603467 Ga0068861_1016034672 117
338 3300005840 Ga0068870_10618556 Ga0068870_106185562 117
339 3300005841 Ga0068863_100321027 Ga0068863_1003210273 117
340 3300005841 Ga0068863_101146198 Ga0068863_1011461982 117
341 3300005841 Ga0068863_102463819 Ga0068863_1024638191 117
342 3300005842 Ga0068858_100003646 Ga0068858_10000364610 117
343 3300005842 Ga0068858_100128869 Ga0068858_1001288692 117
344 3300005842 Ga0068858_100250366 Ga0068858_1002503662 117
345 3300005842 Ga0068858_100915076 Ga0068858_1009150762 117
346 3300005843 Ga0068860_100133240 Ga0068860_1001332401 117
347 3300005843 Ga0068860_100379578 Ga0068860_1003795781 117
348 3300005844 Ga0068862_100048249 Ga0068862_1000482494 117
349 3300005844 Ga0068862_100727145 Ga0068862_1007271452 117
350 3300005844 Ga0068862_100862411 Ga0068862_1008624111 117
351 3300006038 Ga0075365_10571464 Ga0075365_105714642 117
352 3300006042 Ga0075368_10045248 Ga0075368_100452482 117
353 3300006048 Ga0075363_100023527 Ga0075363_1000235272 117
354 3300006173 Ga0070716_100158647 Ga0070716_1001586472 117
355 3300006177 Ga0075362_10001487 Ga0075362_100014878 117
356 3300006178 Ga0075367_10006063 Ga0075367_100060635 117
357 3300006178 Ga0075367_10016808 Ga0075367_100168085 117
358 3300006178 Ga0075367_10343321 Ga0075367_103433212 117
359 3300006186 Ga0075369_10066687 Ga0075369_100666872 117
360 3300006186 Ga0075369_10327161 Ga0075369_103271612 117
361 3300006195 Ga0075366_10004910 Ga0075366_100049104 117
362 3300006195 Ga0075366_10020335 Ga0075366_100203352 117
363 3300006195 Ga0075366_10453389 Ga0075366_104533892 117
364 3300006237 Ga0097621_100039285 Ga0097621_1000392856 117
365 3300006237 Ga0097621_100169616 Ga0097621_1001696163 117
366 3300006237 Ga0097621_100545068 Ga0097621_1005450682 117
367 3300006353 Ga0075370_10058732 Ga0075370_100587323 117
368 3300006353 Ga0075370_10068185 Ga0075370_100681854 117
369 3300006353 Ga0075370_10089065 Ga0075370_100890653 117
370 3300006353 Ga0075370_10189555 Ga0075370_101895552 117
371 3300006358 Ga0068871_100021156 Ga0068871_1000211565 117
372 3300006358 Ga0068871_100368873 Ga0068871_1003688732 117
373 3300006846 Ga0075430_100739134 Ga0075430_1007391342 117
374 3300006847 Ga0075431_100731311 Ga0075431_1007313112 117
375 3300006871 Ga0075434_101923036 Ga0075434_1019230362 117
376 3300006881 Ga0068865_100018344 Ga0068865_1000183444 117
377 3300006881 Ga0068865_100598196 Ga0068865_1005981962 117
378 3300006881 Ga0068865_100693696 Ga0068865_1006936962 117
379 3300006881 Ga0068865_101284340 Ga0068865_1012843402 117
380 3300006881 Ga0068865_102219962 Ga0068865_1022199621 117
381 3300006931 Ga0097620_100002059 Ga0097620_10000205911 117
382 3300006931 Ga0097620_100492742 Ga0097620_1004927422 117
383 3300006931 Ga0097620_100667774 Ga0097620_1006677743 117
384 3300006931 Ga0097620_100826692 Ga0097620_1008266922 117
385 3300006931 Ga0097620_102167485 Ga0097620_1021674852 117
386 3300007265 Ga0099794_10001490 Ga0099794_100014907 117
387 3300007788 Ga0099795_10104898 Ga0099795_101048982 117
388 3300009093 Ga0105240_10016259 Ga0105240_100162592 117
389 3300009093 Ga0105240_10054468 Ga0105240_100544685 117
390 3300009094 Ga0111539_10059108 Ga0111539_100591085 117
391 3300009094 Ga0111539_10973116 Ga0111539_109731161 117
392 3300009094 Ga0111539_11866932 Ga0111539_118669322 117
393 3300009094 Ga0111539_12966915 Ga0111539_129669151 117
394 3300009098 Ga0105245_10005108 Ga0105245_1000510812 117
395 3300009098 Ga0105245_10110128 Ga0105245_101101284 117
396 3300009098 Ga0105245_10297274 Ga0105245_102972743 117
397 3300009101 Ga0105247_10288690 Ga0105247_102886902 117
398 3300009147 Ga0114129_10103822 Ga0114129_101038222 117
399 3300009147 Ga0114129_10295150 Ga0114129_102951502 117
400 3300009148 Ga0105243_10007489 Ga0105243_100074895 117
401 3300009148 Ga0105243_10181574 Ga0105243_101815743 117
402 3300009148 Ga0105243_10572261 Ga0105243_105722611 117
403 3300009148 Ga0105243_10979859 Ga0105243_109798592 117
404 3300009174 Ga0105241_10211209 Ga0105241_102112092 117
405 3300009174 Ga0105241_10879069 Ga0105241_108790692 117
406 3300009176 Ga0105242_10001358 Ga0105242_1000135819 117
407 3300009176 Ga0105242_12847157 Ga0105242_128471571 117
408 3300009177 Ga0105248_10016657 Ga0105248_1001665711 117
409 3300009177 Ga0105248_10023841 Ga0105248_100238412 117
410 3300009177 Ga0105248_10079252 Ga0105248_100792524 117
411 3300009177 Ga0105248_10336945 Ga0105248_103369453 117
412 3300009177 Ga0105248_11054431 Ga0105248_110544312 117
413 3300009545 Ga0105237_10007400 Ga0105237_100074003 117
414 3300009545 Ga0105237_10008504 Ga0105237_100085049 117
415 3300009545 Ga0105237_10062594 Ga0105237_100625942 117
416 3300009545 Ga0105237_11418004 Ga0105237_114180041 117
417 3300009551 Ga0105238_10000630 Ga0105238_100006309 117
418 3300009551 Ga0105238_10515568 Ga0105238_105155682 117
419 3300009551 Ga0105238_11012466 Ga0105238_110124662 117
420 3300009551 Ga0105238_11178050 Ga0105238_111780502 117
421 3300009553 Ga0105249_10013377 Ga0105249_100133772 117
422 3300009553 Ga0105249_11316919 Ga0105249_113169191 117
423 3300009553 Ga0105249_11367004 Ga0105249_113670041 117
424 3300010375 Ga0105239_10080659 Ga0105239_100806592 117
425 3300010375 Ga0105239_10190382 Ga0105239_101903821 117
426 3300010375 Ga0105239_11224975 Ga0105239_112249752 117
427 3300013104 Ga0157370_10717849 Ga0157370_107178491 117
428 3300013105 Ga0157369_10893147 Ga0157369_108931472 117
429 3300013296 Ga0157374_10026571 Ga0157374_100265713 117
430 3300013297 Ga0157378_10155466 Ga0157378_101554664 117
431 3300013297 Ga0157378_10235882 Ga0157378_102358824 117
432 3300013297 Ga0157378_10395512 Ga0157378_103955122 117
433 3300013297 Ga0157378_10710144 Ga0157378_107101442 117
434 3300013306 Ga0163162_10041418 Ga0163162_100414182 117
435 3300013306 Ga0163162_10063827 Ga0163162_100638272 117
436 3300013306 Ga0163162_10319374 Ga0163162_103193742 117
437 3300013306 Ga0163162_10670972 Ga0163162_106709722 117
438 3300013306 Ga0163162_11264108 Ga0163162_112641082 117
439 3300013306 Ga0163162_12535318 Ga0163162_125353181 117
440 3300013307 Ga0157372_10147119 Ga0157372_101471191 117
441 3300013308 Ga0157375_10210023 Ga0157375_102100232 117
442 3300013308 Ga0157375_10371297 Ga0157375_103712972 117
443 3300013308 Ga0157375_10622839 Ga0157375_106228392 117
444 3300013308 Ga0157375_10851285 Ga0157375_108512851 117
445 3300014325 Ga0163163_10054161 Ga0163163_100541616 117
446 3300014325 Ga0163163_10387917 Ga0163163_103879172 117
447 3300014326 Ga0157380_10045490 Ga0157380_100454904 117
448 3300014326 Ga0157380_10239085 Ga0157380_102390852 117
449 3300014326 Ga0157380_10754884 Ga0157380_107548842 117
450 3300014326 Ga0157380_12748132 Ga0157380_127481321 117
451 3300014745 Ga0157377_10444818 Ga0157377_104448182 117
452 3300014968 Ga0157379_10012056 Ga0157379_100120568 117
453 3300014968 Ga0157379_10063543 Ga0157379_100635432 117
454 3300014968 Ga0157379_11005087 Ga0157379_110050872 117
455 3300014968 Ga0157379_11803441 Ga0157379_118034411 117
456 3300014969 Ga0157376_10020301 Ga0157376_100203012 117
457 3300014969 Ga0157376_10061796 Ga0157376_100617964 117
458 3300014969 Ga0157376_10435668 Ga0157376_104356682 117
459 3300014969 Ga0157376_11675253 Ga0157376_116752531 117
460 3300014969 Ga0157376_11698879 Ga0157376_116988792 117
461 3300017792 Ga0163161_10159845 Ga0163161_101598453 117
462 3300025899 Ga0207642_10018161 Ga0207642_100181615 117
463 3300025904 Ga0207647_10076768 Ga0207647_100767682 117
464 3300025907 Ga0207645_10588287 Ga0207645_105882872 117
465 3300025907 Ga0207645_10767041 Ga0207645_107670412 117
466 3300025908 Ga0207643_10003877 Ga0207643_100038778 117
467 3300025911 Ga0207654_11138634 Ga0207654_111386341 117
468 3300025913 Ga0207695_10043435 Ga0207695_100434355 117
469 3300025918 Ga0207662_10149877 Ga0207662_101498772 117
470 3300025922 Ga0207646_10790638 Ga0207646_107906381 117
471 3300025926 Ga0207659_10248453 Ga0207659_102484533 117
472 3300025926 Ga0207659_10329937 Ga0207659_103299372 117
473 3300025927 Ga0207687_10013955 Ga0207687_100139556 117
474 3300025927 Ga0207687_10363300 Ga0207687_103633002 117
475 3300025927 Ga0207687_10399224 Ga0207687_103992242 117
476 3300025931 Ga0207644_10403473 Ga0207644_104034732 117
477 3300025933 Ga0207706_10039291 Ga0207706_100392913 117
478 3300025933 Ga0207706_10064005 Ga0207706_100640052 117
479 3300025934 Ga0207686_10000532 Ga0207686_1000053218 117
480 3300025934 Ga0207686_10436684 Ga0207686_104366842 117
481 3300025934 Ga0207686_10819497 Ga0207686_108194972 117
482 3300025935 Ga0207709_10008548 Ga0207709_100085482 117
483 3300025935 Ga0207709_10080536 Ga0207709_100805361 117
484 3300025936 Ga0207670_10052595 Ga0207670_100525953 117
485 3300025936 Ga0207670_10489223 Ga0207670_104892231 117
486 3300025937 Ga0207669_10030931 Ga0207669_100309314 117
487 3300025938 Ga0207704_10022957 Ga0207704_100229574 117
488 3300025938 Ga0207704_10803835 Ga0207704_108038351 117
489 3300025940 Ga0207691_10886073 Ga0207691_108860732 117
490 3300025941 Ga0207711_10014526 Ga0207711_1001452610 117
491 3300025941 Ga0207711_10559649 Ga0207711_105596493 117
492 3300025941 Ga0207711_10608593 Ga0207711_106085932 117
493 3300025942 Ga0207689_10000262 Ga0207689_100002623 117
494 3300025942 Ga0207689_10034333 Ga0207689_100343335 117
495 3300025942 Ga0207689_10090212 Ga0207689_100902122 117
496 3300025944 Ga0207661_10071203 Ga0207661_100712034 117
497 3300025945 Ga0207679_10284192 Ga0207679_102841922 117
498 3300025960 Ga0207651_10820029 Ga0207651_108200291 117
499 3300025961 Ga0207712_10091122 Ga0207712_100911223 117
500 3300025981 Ga0207640_10207980 Ga0207640_102079803 117
501 3300025986 Ga0207658_10180401 Ga0207658_101804014 117
502 3300026035 Ga0207703_10004514 Ga0207703_1000451413 117
503 3300026035 Ga0207703_10169825 Ga0207703_101698252 117
504 3300026035 Ga0207703_11106745 Ga0207703_111067451 117
505 3300026035 Ga0207703_11236044 Ga0207703_112360441 117
506 3300026041 Ga0207639_10280903 Ga0207639_102809033 117
507 3300026041 Ga0207639_10431819 Ga0207639_104318193 117
508 3300026041 Ga0207639_10661793 Ga0207639_106617932 117
509 3300026067 Ga0207678_11049804 Ga0207678_110498041 117
510 3300026075 Ga0207708_10003947 Ga0207708_100039473 117
511 3300026088 Ga0207641_10142817 Ga0207641_101428172 117
512 3300026088 Ga0207641_10283932 Ga0207641_102839322 117
513 3300026088 Ga0207641_10547030 Ga0207641_105470302 117
514 3300026089 Ga0207648_10029798 Ga0207648_100297984 117
515 3300026089 Ga0207648_10047261 Ga0207648_100472614 117
516 3300026089 Ga0207648_10057742 Ga0207648_100577423 117
517 3300026089 Ga0207648_10087070 Ga0207648_100870702 117
518 3300026089 Ga0207648_10211352 Ga0207648_102113521 117
519 3300026095 Ga0207676_10180624 Ga0207676_101806242 117
520 3300026095 Ga0207676_10188273 Ga0207676_101882733 117
521 3300026095 Ga0207676_10928094 Ga0207676_109280942 117
522 3300026116 Ga0207674_10074752 Ga0207674_100747524 117
523 3300026116 Ga0207674_11435934 Ga0207674_114359342 117
524 3300026118 Ga0207675_100001238 Ga0207675_10000123826 117
525 3300026118 Ga0207675_100239679 Ga0207675_1002396792 117
526 3300026118 Ga0207675_100427987 Ga0207675_1004279873 117
527 3300026118 Ga0207675_101938803 Ga0207675_1019388031 117
528 3300026121 Ga0207683_10007474 Ga0207683_1000747410 117
529 3300026142 Ga0207698_10034858 Ga0207698_100348584 117
530 3300026142 Ga0207698_10353884 Ga0207698_103538842 117
531 3300026142 Ga0207698_10838248 Ga0207698_108382482 117
532 3300028379 Ga0268266_10768376 Ga0268266_107683762 117
533 3300028380 Ga0268265_10127567 Ga0268265_101275673 117
534 3300028380 Ga0268265_10917746 Ga0268265_109177462 117
535 3300028381 Ga0268264_10063467 Ga0268264_100634675 117
536 3300028381 Ga0268264_10574161 Ga0268264_105741611 117
537 3300028786 Ga0307517_10608010 Ga0307517_106080101 117
538 3300031456 Ga0307513_10006201 Ga0307513_100062018 117
539 3300031456 Ga0307513_10083106 Ga0307513_100831063 117
540 3300031456 Ga0307513_10657106 Ga0307513_106571061 117
541 3300031507 Ga0307509_10003931 Ga0307509_100039318 117
542 3300031616 Ga0307508_10002419 Ga0307508_100024198 117
543 3300031616 Ga0307508_10401553 Ga0307508_104015532 117
544 3300031730 Ga0307516_10053528 Ga0307516_100535284 117
545 3300031730 Ga0307516_10362362 Ga0307516_103623622 117
546 3300033179 Ga0307507_10169869 Ga0307507_101698694 117
547 3300033180 Ga0307510_10222308 Ga0307510_102223082 117
548 3300033180 Ga0307510_10269257 Ga0307510_102692573 117
549 3300035724 Ga0373933_0626756 Ga0373933_0626756_70_435 117
550 3300041411 Ga0439466_0056408 Ga0439466_0056408_754_1128 117
551 3300044712 Ga0453684_0198610 Ga0453684_0198610_26_391 117
552 3300046616 Ga0495668_0361514 Ga0495668_0361514_59_424 117
553 3300046616 Ga0495668_0462831 Ga0495668_0462831_72_458 117
554 3300047469 Ga0495673_0181730 Ga0495673_0181730_290_655 117
555 3300048903 Ga0496100_1439728 Ga0496100_1439728_64_438 117
556 3300048907 Ga0496104_0720424 Ga0496104_0720424_49_423 117
557 3300048917 Ga0496114_0714958 Ga0496114_0714958_410_796 117
558 3300049571 Ga0501034_0000487 Ga0501034_0000487_37895_38263 117
559 3300049571 Ga0501034_0008360 Ga0501034_0008360_2014_2382 117
560 3300049582 Ga0501048_0158019 Ga0501048_0158019_697_1077 117
561 3300049588 Ga0501072_0029917 Ga0501072_0029917_299_667 117
562 3300049589 Ga0501073_0419239 Ga0501073_0419239_424_798 117
563 3300049671 Ga0501238_030630 Ga0501238_030630_277_651 117
564 3300049682 Ga0501252_064573 Ga0501252_064573_148_522 117
565 3300049742 Ga0501080_0370665 Ga0501080_0370665_236_610 117
566 3300049744 Ga0501083_0417993 Ga0501083_0417993_424_792 117
567 3300050491 nmdc:mga00v17_460736_c1 nmdc:mga00v17_460736_c1_230_598 117
568 3300050493 nmdc:mga0k408_29009_c1 nmdc:mga0k408_29009_c1_1926_2291 117
569 3300050493 nmdc:mga0k408_38329_c1 nmdc:mga0k408_38329_c1_359_727 117
570 3300050494 nmdc:mga06z11_87728_c1 nmdc:mga06z11_87728_c1_557_925 117
571 3300050496 nmdc:mga07m45_735693_c1 nmdc:mga07m45_735693_c1_113_478 117
572 3300050510 nmdc:mga06r32_1554084_c1 nmdc:mga06r32_1554084_c1_51_437 117
573 3300050516 nmdc:mga0sz30_245696_c1 nmdc:mga0sz30_245696_c1_235_603 117
574 3300053126 Ga0500621_231062 Ga0500621_231062_152_517 117
575 iso_pu_bacteria 2904419702 2904424025 117
576 3300005355 Ga0070671_100498001 Ga0070671_1004980012 118
577 3300005459 Ga0068867_102370856 Ga0068867_1023708561 118
578 3300005617 Ga0068859_101035796 Ga0068859_1010357962 118
579 3300006844 Ga0075428_100301804 Ga0075428_1003018042 118
580 3300006846 Ga0075430_100306148 Ga0075430_1003061482 118
581 3300006847 Ga0075431_100941114 Ga0075431_1009411142 118
582 3300006931 Ga0097620_101035599 Ga0097620_1010355992 118
583 3300009094 Ga0111539_10245527 Ga0111539_102455271 118
584 3300009147 Ga0114129_10058324 Ga0114129_100583247 118
585 3300009147 Ga0114129_12008951 Ga0114129_120089512 118
586 3300014326 Ga0157380_11610588 Ga0157380_116105881 118
587 3300025923 Ga0207681_11834782 Ga0207681_118347821 118
588 3300025931 Ga0207644_10279526 Ga0207644_102795263 118
589 3300027471 Ga0209995_1033562 Ga0209995_10335622 118
590 3300027471 Ga0209995_1096427 Ga0209995_10964272 118
591 3300028381 Ga0268264_10360143 Ga0268264_103601432 118
592 3300028794 Ga0307515_10000059 Ga0307515_1000005974 118
593 3300031456 Ga0307513_10146015 Ga0307513_101460151 118
594 3300031456 Ga0307513_10498207 Ga0307513_104982073 118
595 3300031548 Ga0307408_101066397 Ga0307408_1010663971 118
596 3300031711 Ga0265314_10150042 Ga0265314_101500422 118
597 3300035695 Ga0373927_0164380 Ga0373927_0164380_418_774 118
598 3300041410 Ga0439461_0176768 Ga0439461_0176768_91_447 118
599 3300041413 Ga0439465_0000192 Ga0439465_0000192_9668_10024 118
600 3300041512 Ga0451853_2687333 Ga0451853_2687333_107_463 118
601 3300042007 Ga0439449_0046631 Ga0439449_0046631_516_884 118
602 3300042876 Ga0451577_0004145 Ga0451577_0004145_9736_10092 118
603 3300044712 Ga0453684_0000039 Ga0453684_0000039_555224_555580 118
604 3300046473 Ga0495582_0084811 Ga0495582_0084811_1395_1751 118
605 3300046511 Ga0495608_0432898 Ga0495608_0432898_59_415 118
606 3300046683 Ga0495658_0213301 Ga0495658_0213301_233_589 118
607 3300049585 Ga0501069_0016511 Ga0501069_0016511_2990_3370 118
608 3300050508 nmdc:mga09592_1072740_c1 nmdc:mga09592_1072740_c1_83_451 118
609 3300050509 nmdc:mga0qj67_276973_c1 nmdc:mga0qj67_276973_c1_742_1110 118
610 3300050510 nmdc:mga06r32_509301_c1 nmdc:mga06r32_509301_c1_505_873 118
611 3300053077 Ga0495601_0565859 Ga0495601_0565859_115_471 118
612 3300053134 Ga0500658_0039635 Ga0500658_0039635_667_1026 118
613 3300053136 Ga0500559_0075454 Ga0500559_0075454_615_1010 118
614 3300053139 Ga0500568_0109976 Ga0500568_0109976_515_874 118
615 3300061734 Ga0530510_0009843 Ga0530510_0009843_327_707 118
616 3300002076 JGI24749J21850_1007756 JGI24749J21850_10077563 119
617 3300003322 rootL2_10263668 rootL2_102636682 119
618 3300003792 Ga0055540_1016407 Ga0055540_10164072 119
619 3300003794 Ga0055531_10003055 Ga0055531_100030555 119
620 3300005290 Ga0065712_10005764 Ga0065712_100057641 119
621 3300005293 Ga0065715_10273969 Ga0065715_102739692 119
622 3300005295 Ga0065707_10081818 Ga0065707_1008181831 119
623 3300005329 Ga0070683_100509766 Ga0070683_1005097662 119
624 3300005331 Ga0070670_100101660 Ga0070670_1001016603 119
625 3300005333 Ga0070677_10022234 Ga0070677_100222342 119
626 3300005333 Ga0070677_10130591 Ga0070677_101305912 119
627 3300005333 Ga0070677_10846926 Ga0070677_108469261 119
628 3300005334 Ga0068869_100097457 Ga0068869_1000974571 119
629 3300005336 Ga0070680_100088549 Ga0070680_1000885493 119
630 3300005337 Ga0070682_100004134 Ga0070682_10000413411 119
631 3300005338 Ga0068868_100221156 Ga0068868_1002211562 119
632 3300005339 Ga0070660_101155796 Ga0070660_1011557961 119
633 3300005340 Ga0070689_100004010 Ga0070689_10000401013 119
634 3300005344 Ga0070661_100026560 Ga0070661_1000265609 119
635 3300005344 Ga0070661_100087165 Ga0070661_1000871654 119
636 3300005344 Ga0070661_100894169 Ga0070661_1008941691 119
637 3300005345 Ga0070692_11038990 Ga0070692_110389901 119
638 3300005347 Ga0070668_100425520 Ga0070668_1004255202 119
639 3300005353 Ga0070669_100252509 Ga0070669_1002525092 119
640 3300005354 Ga0070675_100030122 Ga0070675_1000301225 119
641 3300005354 Ga0070675_100065416 Ga0070675_1000654165 119
642 3300005355 Ga0070671_100436087 Ga0070671_1004360872 119
643 3300005355 Ga0070671_100992514 Ga0070671_1009925142 119
644 3300005356 Ga0070674_100346536 Ga0070674_1003465362 119
645 3300005356 Ga0070674_100679970 Ga0070674_1006799702 119
646 3300005364 Ga0070673_100358104 Ga0070673_1003581043 119
647 3300005364 Ga0070673_100496406 Ga0070673_1004964063 119
648 3300005365 Ga0070688_100004559 Ga0070688_1000045596 119
649 3300005365 Ga0070688_100191552 Ga0070688_1001915522 119
650 3300005366 Ga0070659_100093309 Ga0070659_1000933092 119
651 3300005366 Ga0070659_101082012 Ga0070659_1010820122 119
652 3300005367 Ga0070667_100217983 Ga0070667_1002179833 119
653 3300005435 Ga0070714_100216012 Ga0070714_1002160122 119
654 3300005441 Ga0070700_100432251 Ga0070700_1004322511 119
655 3300005458 Ga0070681_11488711 Ga0070681_114887111 119
656 3300005459 Ga0068867_101311495 Ga0068867_1013114951 119
657 3300005466 Ga0070685_10009078 Ga0070685_100090786 119
658 3300005530 Ga0070679_100169876 Ga0070679_1001698763 119
659 3300005530 Ga0070679_101889668 Ga0070679_1018896681 119
660 3300005535 Ga0070684_100340586 Ga0070684_1003405862 119
661 3300005539 Ga0068853_100013959 Ga0068853_1000139594 119
662 3300005539 Ga0068853_100104439 Ga0068853_1001044393 119
663 3300005543 Ga0070672_100237439 Ga0070672_1002374393 119
664 3300005546 Ga0070696_100192662 Ga0070696_1001926622 119
665 3300005548 Ga0070665_100075809 Ga0070665_1000758097 119
666 3300005548 Ga0070665_100112180 Ga0070665_1001121802 119
667 3300005548 Ga0070665_100466686 Ga0070665_1004666862 119
668 3300005563 Ga0068855_100026904 Ga0068855_1000269043 119
669 3300005564 Ga0070664_100001011 Ga0070664_1000010115 119
670 3300005564 Ga0070664_100007884 Ga0070664_1000078842 119
671 3300005564 Ga0070664_100011932 Ga0070664_10001193213 119
672 3300005577 Ga0068857_100038300 Ga0068857_1000383005 119
673 3300005577 Ga0068857_100215056 Ga0068857_1002150563 119
674 3300005578 Ga0068854_100013305 Ga0068854_1000133052 119
675 3300005578 Ga0068854_100454449 Ga0068854_1004544492 119
676 3300005614 Ga0068856_100289249 Ga0068856_1002892492 119
677 3300005614 Ga0068856_102216196 Ga0068856_1022161962 119
678 3300005616 Ga0068852_100073262 Ga0068852_1000732626 119
679 3300005617 Ga0068859_100052584 Ga0068859_1000525842 119
680 3300005617 Ga0068859_101935221 Ga0068859_1019352212 119
681 3300005618 Ga0068864_100004086 Ga0068864_10000408610 119
682 3300005718 Ga0068866_10006093 Ga0068866_1000609310 119
683 3300005834 Ga0068851_10037646 Ga0068851_100376463 119
684 3300005840 Ga0068870_10002423 Ga0068870_1000242310 119
685 3300005842 Ga0068858_100298131 Ga0068858_1002981312 119
686 3300005843 Ga0068860_100047311 Ga0068860_1000473115 119
687 3300005844 Ga0068862_100356788 Ga0068862_1003567883 119
688 3300006042 Ga0075368_10154623 Ga0075368_101546232 119
689 3300006058 Ga0075432_10424739 Ga0075432_104247391 119
690 3300006178 Ga0075367_10202043 Ga0075367_102020432 119
691 3300006195 Ga0075366_10111803 Ga0075366_101118032 119
692 3300006195 Ga0075366_10794980 Ga0075366_107949802 119
693 3300006237 Ga0097621_100175303 Ga0097621_1001753032 119
694 3300006237 Ga0097621_100371119 Ga0097621_1003711192 119
695 3300006353 Ga0075370_10546436 Ga0075370_105464362 119
696 3300006358 Ga0068871_100407729 Ga0068871_1004077292 119
697 3300006847 Ga0075431_100676077 Ga0075431_1006760773 119
698 3300006881 Ga0068865_100132666 Ga0068865_1001326662 119
699 3300006881 Ga0068865_100405687 Ga0068865_1004056872 119
700 3300006931 Ga0097620_100052587 Ga0097620_1000525872 119
701 3300006931 Ga0097620_101934752 Ga0097620_1019347522 119
702 3300007076 Ga0075435_100957244 Ga0075435_1009572442 119
703 3300009094 Ga0111539_10007243 Ga0111539_1000724313 119
704 3300009094 Ga0111539_10129876 Ga0111539_101298764 119
705 3300009094 Ga0111539_12436754 Ga0111539_124367541 119
706 3300009098 Ga0105245_11123365 Ga0105245_111233651 119
707 3300009101 Ga0105247_10947429 Ga0105247_109474291 119
708 3300009174 Ga0105241_10795868 Ga0105241_107958682 119
709 3300009174 Ga0105241_10821420 Ga0105241_108214202 119
710 3300009174 Ga0105241_11036023 Ga0105241_110360232 119
711 3300009176 Ga0105242_10076211 Ga0105242_100762112 119
712 3300009176 Ga0105242_10808984 Ga0105242_108089841 119
713 3300009177 Ga0105248_10486111 Ga0105248_104861112 119
714 3300009177 Ga0105248_12061247 Ga0105248_120612472 119
715 3300009545 Ga0105237_10710777 Ga0105237_107107772 119
716 3300009553 Ga0105249_10206470 Ga0105249_102064702 119
717 3300009553 Ga0105249_10354426 Ga0105249_103544262 119
718 3300009553 Ga0105249_11045354 Ga0105249_110453542 119
719 3300010375 Ga0105239_10550953 Ga0105239_105509533 119
720 3300010375 Ga0105239_11164908 Ga0105239_111649082 119
721 3300011119 Ga0105246_10066825 Ga0105246_100668254 119
722 3300013102 Ga0157371_10350368 Ga0157371_103503682 119
723 3300013105 Ga0157369_10116821 Ga0157369_101168213 119
724 3300013296 Ga0157374_10003088 Ga0157374_1000308814 119
725 3300013296 Ga0157374_10017683 Ga0157374_100176838 119
726 3300013297 Ga0157378_11744504 Ga0157378_117445041 119
727 3300013306 Ga0163162_10000003 Ga0163162_10000003158 119
728 3300013306 Ga0163162_10855809 Ga0163162_108558091 119
729 3300013307 Ga0157372_10042624 Ga0157372_100426244 119
730 3300013307 Ga0157372_10235370 Ga0157372_102353703 119
731 3300013307 Ga0157372_13442502 Ga0157372_134425022 119
732 3300013308 Ga0157375_10310387 Ga0157375_103103872 119
733 3300014325 Ga0163163_10024708 Ga0163163_100247082 119
734 3300014325 Ga0163163_10037055 Ga0163163_100370553 119
735 3300014325 Ga0163163_11227568 Ga0163163_112275682 119
736 3300014326 Ga0157380_10002108 Ga0157380_100021081 119
737 3300014326 Ga0157380_10002689 Ga0157380_100026896 119
738 3300014326 Ga0157380_10017561 Ga0157380_100175616 119
739 3300014326 Ga0157380_10717490 Ga0157380_107174902 119
740 3300014326 Ga0157380_12116494 Ga0157380_121164942 119
741 3300014968 Ga0157379_10017429 Ga0157379_100174296 119
742 3300014969 Ga0157376_10282658 Ga0157376_102826582 119
743 3300014969 Ga0157376_10439104 Ga0157376_104391042 119
744 3300014969 Ga0157376_11073596 Ga0157376_110735963 119
745 3300014969 Ga0157376_11735144 Ga0157376_117351442 119
746 3300017792 Ga0163161_10872943 Ga0163161_108729432 119
747 3300025273 Ga0209673_1012504 Ga0209673_10125046 119
748 3300025290 Ga0207673_1018235 Ga0207673_10182351 119
749 3300025303 Ga0209051_1004592 Ga0209051_10045924 119
750 3300025304 Ga0209257_1000309 Ga0209257_10003096 119
751 3300025315 Ga0207697_10001907 Ga0207697_1000190710 119
752 3300025315 Ga0207697_10146494 Ga0207697_101464942 119
753 3300025321 Ga0207656_10006854 Ga0207656_100068544 119
754 3300025893 Ga0207682_10000850 Ga0207682_100008505 119
755 3300025901 Ga0207688_10000680 Ga0207688_1000068019 119
756 3300025903 Ga0207680_10043301 Ga0207680_100433013 119
757 3300025903 Ga0207680_10787634 Ga0207680_107876342 119
758 3300025904 Ga0207647_10028610 Ga0207647_100286105 119
759 3300025907 Ga0207645_10002221 Ga0207645_1000222116 119
760 3300025908 Ga0207643_10000188 Ga0207643_1000018841 119
761 3300025908 Ga0207643_10202540 Ga0207643_102025402 119
762 3300025908 Ga0207643_11022632 Ga0207643_110226321 119
763 3300025909 Ga0207705_10427082 Ga0207705_104270821 119
764 3300025917 Ga0207660_11209211 Ga0207660_112092111 119
765 3300025918 Ga0207662_10644454 Ga0207662_106444542 119
766 3300025920 Ga0207649_10374097 Ga0207649_103740972 119
767 3300025920 Ga0207649_10774074 Ga0207649_107740741 119
768 3300025921 Ga0207652_10041101 Ga0207652_100411014 119
769 3300025921 Ga0207652_10330171 Ga0207652_103301711 119
770 3300025921 Ga0207652_11820665 Ga0207652_118206651 119
771 3300025923 Ga0207681_10159293 Ga0207681_101592933 119
772 3300025924 Ga0207694_10039354 Ga0207694_100393546 119
773 3300025925 Ga0207650_10009664 Ga0207650_1000966412 119
774 3300025925 Ga0207650_10079123 Ga0207650_100791233 119
775 3300025925 Ga0207650_10830773 Ga0207650_108307731 119
776 3300025926 Ga0207659_10035434 Ga0207659_100354346 119
777 3300025926 Ga0207659_10133498 Ga0207659_101334981 119
778 3300025926 Ga0207659_11187102 Ga0207659_111871022 119
779 3300025927 Ga0207687_10176843 Ga0207687_101768432 119
780 3300025927 Ga0207687_10789427 Ga0207687_107894272 119
781 3300025931 Ga0207644_10637294 Ga0207644_106372942 119
782 3300025931 Ga0207644_10907408 Ga0207644_109074081 119
783 3300025932 Ga0207690_10466400 Ga0207690_104664002 119
784 3300025933 Ga0207706_10023206 Ga0207706_1002320612 119
785 3300025936 Ga0207670_10311355 Ga0207670_103113553 119
786 3300025937 Ga0207669_10504958 Ga0207669_105049581 119
787 3300025938 Ga0207704_10374697 Ga0207704_103746973 119
788 3300025938 Ga0207704_10631267 Ga0207704_106312672 119
789 3300025940 Ga0207691_10059928 Ga0207691_100599285 119
790 3300025940 Ga0207691_10268705 Ga0207691_102687053 119
791 3300025941 Ga0207711_10122894 Ga0207711_101228942 119
792 3300025941 Ga0207711_10387824 Ga0207711_103878243 119
793 3300025942 Ga0207689_10003034 Ga0207689_1000303424 119
794 3300025944 Ga0207661_10158672 Ga0207661_101586724 119
795 3300025945 Ga0207679_10350033 Ga0207679_103500331 119
796 3300025949 Ga0207667_10017959 Ga0207667_100179594 119
797 3300025949 Ga0207667_10463725 Ga0207667_104637253 119
798 3300025960 Ga0207651_10021076 Ga0207651_100210763 119
799 3300025960 Ga0207651_10186042 Ga0207651_101860422 119
800 3300025960 Ga0207651_10943385 Ga0207651_109433852 119
801 3300025961 Ga0207712_10625193 Ga0207712_106251932 119
802 3300025961 Ga0207712_10752027 Ga0207712_107520271 119
803 3300025972 Ga0207668_11029828 Ga0207668_110298281 119
804 3300025981 Ga0207640_10345344 Ga0207640_103453442 119
805 3300025981 Ga0207640_10419216 Ga0207640_104192162 119
806 3300025986 Ga0207658_10305766 Ga0207658_103057663 119
807 3300026023 Ga0207677_10067833 Ga0207677_100678335 119
808 3300026035 Ga0207703_10385636 Ga0207703_103856362 119
809 3300026041 Ga0207639_10075088 Ga0207639_100750882 119
810 3300026041 Ga0207639_11135618 Ga0207639_111356181 119
811 3300026067 Ga0207678_10006127 Ga0207678_1000612714 119
812 3300026075 Ga0207708_10006587 Ga0207708_100065875 119
813 3300026075 Ga0207708_10425749 Ga0207708_104257492 119
814 3300026078 Ga0207702_10155402 Ga0207702_101554022 119
815 3300026088 Ga0207641_10516476 Ga0207641_105164762 119
816 3300026088 Ga0207641_10528138 Ga0207641_105281382 119
817 3300026089 Ga0207648_10119486 Ga0207648_101194865 119
818 3300026089 Ga0207648_10467606 Ga0207648_104676062 119
819 3300026095 Ga0207676_10001767 Ga0207676_1000176710 119
820 3300026116 Ga0207674_10016255 Ga0207674_1001625511 119
821 3300026116 Ga0207674_10284184 Ga0207674_102841843 119
822 3300026118 Ga0207675_100004912 Ga0207675_10000491222 119
823 3300026121 Ga0207683_10017447 Ga0207683_100174476 119
824 3300026121 Ga0207683_10469893 Ga0207683_104698932 119
825 3300026121 Ga0207683_11078736 Ga0207683_110787361 119
826 3300026142 Ga0207698_10451312 Ga0207698_104513122 119
827 3300027866 Ga0209813_10261256 Ga0209813_102612562 119
828 3300027907 Ga0207428_10394380 Ga0207428_103943802 119
829 3300027907 Ga0207428_10414733 Ga0207428_104147332 119
830 3300028379 Ga0268266_10063426 Ga0268266_100634262 119
831 3300028379 Ga0268266_10387800 Ga0268266_103878002 119
832 3300028381 Ga0268264_10552555 Ga0268264_105525552 119
833 3300028794 Ga0307515_10000265 Ga0307515_1000026517 119
834 3300028794 Ga0307515_10000347 Ga0307515_1000034788 119
835 3300028794 Ga0307515_10002435 Ga0307515_100024359 119
836 3300028794 Ga0307515_10003762 Ga0307515_100037624 119
837 3300028794 Ga0307515_10546302 Ga0307515_105463022 119
838 3300030522 Ga0307512_10120497 Ga0307512_101204972 119
839 3300030522 Ga0307512_10194593 Ga0307512_101945931 119
840 3300031456 Ga0307513_10024660 Ga0307513_100246606 119
841 3300031456 Ga0307513_10133414 Ga0307513_101334143 119
842 3300031456 Ga0307513_10351259 Ga0307513_103512592 119
843 3300031456 Ga0307513_10580467 Ga0307513_105804672 119
844 3300031507 Ga0307509_10021357 Ga0307509_100213575 119
845 3300031548 Ga0307408_100385531 Ga0307408_1003855313 119
846 3300031548 Ga0307408_100958799 Ga0307408_1009587992 119
847 3300031616 Ga0307508_10001686 Ga0307508_1000168618 119
848 3300031649 Ga0307514_10241678 Ga0307514_102416781 119
849 3300031730 Ga0307516_10001538 Ga0307516_1000153818 119
850 3300031901 Ga0307406_10361484 Ga0307406_103614842 119
851 3300031911 Ga0307412_11016713 Ga0307412_110167132 119
852 3300032126 Ga0307415_100786915 Ga0307415_1007869152 119
853 3300033179 Ga0307507_10032282 Ga0307507_100322823 119
854 3300035115 Ga0373941_0041623 Ga0373941_0041623_448_816 119
855 3300035242 Ga0373962_0406256 Ga0373962_0406256_56_424 119
856 3300035725 Ga0373947_0100675 Ga0373947_0100675_990_1361 119
857 3300037068 Ga0373925_0700550 Ga0373925_0700550_77_448 119
858 3300037418 Ga0395900_1101200 Ga0395900_1101200_158_532 119
859 3300039437 Ga0436365_0306342 Ga0436365_0306342_1284_1658 119
860 3300039447 Ga0436361_0128791 Ga0436361_0128791_1355_1714 119
861 3300041404 Ga0439436_0001316 Ga0439436_0001316_5451_5819 119
862 3300041405 Ga0439438_028748 Ga0439438_028748_460_828 119
863 3300041406 Ga0439439_0003403 Ga0439439_0003403_1239_1607 119
864 3300041407 Ga0439447_020516 Ga0439447_020516_938_1306 119
865 3300041410 Ga0439461_0031947 Ga0439461_0031947_678_1046 119
866 3300041411 Ga0439466_0001978 Ga0439466_0001978_1059_1427 119
867 3300041413 Ga0439465_0002208 Ga0439465_0002208_1304_1672 119
868 3300041451 Ga0451791_1225265 Ga0451791_1225265_597_977 119
869 3300041453 Ga0451797_0863558 Ga0451797_0863558_106_531 119
870 3300041456 Ga0451795_0384717 Ga0451795_0384717_22_402 119
871 3300041460 Ga0451802_1010297 Ga0451802_1010297_356_736 119
872 3300041507 Ga0451851_1155442 Ga0451851_1155442_460_840 119
873 3300041997 Ga0439431_0001341 Ga0439431_0001341_2597_2965 119
874 3300041999 Ga0439433_0000590 Ga0439433_0000590_4901_5269 119
875 3300042002 Ga0439442_019855 Ga0439442_019855_639_1007 119
876 3300042004 Ga0439445_0000167 Ga0439445_0000167_10072_10440 119
877 3300042006 Ga0439432_016348 Ga0439432_016348_1304_1672 119
878 3300042006 Ga0439432_211189 Ga0439432_211189_74_442 119
879 3300042007 Ga0439449_0039405 Ga0439449_0039405_640_1008 119
880 3300042010 Ga0439452_008633 Ga0439452_008633_2173_2541 119
881 3300042156 Ga0439446_0017468 Ga0439446_0017468_887_1255 119
882 3300042185 Ga0450909_007456 Ga0450909_007456_362_730 119
883 3300042435 Ga0439434_0000712 Ga0439434_0000712_6629_6997 119
884 3300044694 Ga0466963_1146702 Ga0466963_1146702_175_534 119
885 3300046472 Ga0495580_0159595 Ga0495580_0159595_1085_1456 119
886 3300046492 Ga0495585_0342341 Ga0495585_0342341_147_515 119
887 3300046512 Ga0495610_0069557 Ga0495610_0069557_423_803 119
888 3300046514 Ga0495618_0203502 Ga0495618_0203502_314_694 119
889 3300046519 Ga0495632_0012811 Ga0495632_0012811_3481_3861 119
890 3300046519 Ga0495632_0247542 Ga0495632_0247542_59_439 119
891 3300046537 Ga0495598_0267410 Ga0495598_0267410_118_498 119
892 3300046539 Ga0495621_0365042 Ga0495621_0365042_24_383 119
893 3300046615 Ga0495656_0115467 Ga0495656_0115467_753_1127 119
894 3300046660 Ga0495625_0004683 Ga0495625_0004683_11333_11713 119
895 3300046660 Ga0495625_0776219 Ga0495625_0776219_84_464 119
896 3300046681 Ga0495647_0191009 Ga0495647_0191009_514_876 119
897 3300046683 Ga0495658_0185882 Ga0495658_0185882_824_1204 119
898 3300047446 Ga0495679_116250 Ga0495679_116250_284_658 119
899 3300047472 Ga0495686_0097614 Ga0495686_0097614_393_773 119
900 3300048903 Ga0496100_0251681 Ga0496100_0251681_475_846 119
901 3300048903 Ga0496100_0295744 Ga0496100_0295744_74_460 119
902 3300048904 Ga0496101_0034501 Ga0496101_0034501_2175_2546 119
903 3300048905 Ga0496102_0323085 Ga0496102_0323085_934_1320 119
904 3300048906 Ga0496103_0671372 Ga0496103_0671372_104_463 119
905 3300048907 Ga0496104_0004292 Ga0496104_0004292_9692_10063 119
906 3300048907 Ga0496104_0199685 Ga0496104_0199685_1450_1824 119
907 3300048907 Ga0496104_0489401 Ga0496104_0489401_428_814 119
908 3300048909 Ga0496106_0219399 Ga0496106_0219399_366_737 119
909 3300048910 Ga0496107_0079878 Ga0496107_0079878_31_390 119
910 3300048911 Ga0496108_0005708 Ga0496108_0005708_5699_6070 119
911 3300048912 Ga0496109_0008725 Ga0496109_0008725_4127_4498 119
912 3300048912 Ga0496109_0056385 Ga0496109_0056385_459_845 119
913 3300048913 Ga0496110_0360864 Ga0496110_0360864_540_926 119
914 3300048914 Ga0496111_0456751 Ga0496111_0456751_146_517 119
915 3300048915 Ga0496112_0259752 Ga0496112_0259752_875_1261 119
916 3300048915 Ga0496112_0603738 Ga0496112_0603738_381_749 119
917 3300048916 Ga0496113_0240023 Ga0496113_0240023_666_1037 119
918 3300048918 Ga0496115_0243135 Ga0496115_0243135_962_1336 119
919 3300048918 Ga0496115_0737112 Ga0496115_0737112_254_640 119
920 3300048922 Ga0496119_0151588 Ga0496119_0151588_136_522 119
921 3300049515 Ga0501292_004192 Ga0501292_004192_1161_1526 119
922 3300049521 Ga0501298_119148 Ga0501298_119148_93_452 119
923 3300049526 Ga0501303_006056 Ga0501303_006056_640_1005 119
924 3300049686 Ga0501257_029363 Ga0501257_029363_666_1031 119
925 3300049744 Ga0501083_0059628 Ga0501083_0059628_1031_1429 119
926 3300049762 Ga0501265_012248 Ga0501265_012248_17_382 119
927 3300050493 nmdc:mga0k408_131819_c1 nmdc:mga0k408_131819_c1_786_1166 119
928 3300050493 nmdc:mga0k408_83997_c1 nmdc:mga0k408_83997_c1_374_799 119
929 3300050496 nmdc:mga07m45_196928_c1 nmdc:mga07m45_196928_c1_734_1114 119
930 3300050510 nmdc:mga06r32_245325_c1 nmdc:mga06r32_245325_c1_202_597 119
931 3300050511 nmdc:mga08y16_125428_c1 nmdc:mga08y16_125428_c1_2021_2383 119
932 3300050513 nmdc:mga0rr50_671024_c1 nmdc:mga0rr50_671024_c1_89_460 119
933 3300050515 nmdc:mga0a205_849353_c1 nmdc:mga0a205_849353_c1_342_710 119
934 3300053088 Ga0500644_0037342 Ga0500644_0037342_953_1333 119
935 3300053739 Ga0500587_023225 Ga0500587_023225_70_450 119
936 iso_pu_bacteria 2585428062 2587758868 119
937 iso_pu_bacteria 2885192300 2885195760 119

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o62-assembly1.cif.gz_B crystal structure of a 2`-deoxyribosyltransferase from the psychrophilic bacterium desulfotalea psychrophila. 0.8342 2 106
6evs-assembly1.cif.gz_A characterization of 2-deoxyribosyltransferase from psychrotolerant bacterium bacillus psychrosaccharolyticus: a suitable biocatalyst for the industrial synthesis of antiviral and antitumoral nucleosides 0.7743 2 106
7o62-assembly1.cif.gz_C crystal structure of a 2`-deoxyribosyltransferase from the psychrophilic bacterium desulfotalea psychrophila. 0.7699 2 106
3ry7-assembly1.cif.gz_A-2 crystal structure of sa239 0.7595 68 106
1rk2-assembly2.cif.gz_C e. coli ribokinase complexed with ribose and adp, solved in space group p212121 0.7501 68 106
ID Description Score Start End Superfamily
1t1jA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Hypothetical protein PA1492 0.8006 2 107 3.40.50.10400
3ry7A00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.7595 68 106 3.40.1190.20
af_Q17820_1_342_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7499 69 106 3.40.50.720
3imkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7405 69 113 3.40.50.450
af_A0A0P0V2V1_3_148_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7362 2 106 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A534A374-F1-model_v4 DUF4406 domain-containing protein 0.9926 1 114
AF-A0A1H7X3N7-F1-model_v4 Phosphoglycerate kinase 0.9916 1 115
AF-A0A2L0F0V3-F1-model_v4 NUDIX hydrolase 0.9911 1 115 GO:0016787
AF-A0A1W2FRA8-F1-model_v4 DUF4406 domain-containing protein 0.9903 1 114
AF-A0A0N9IH61-F1-model_v4 NUDIX hydrolase 0.9892 1 114 GO:0016787

Feature Viewer

pLDDT pTM Quality
93.22 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map