F486217
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 937 | 328 | 934 | 123 |
Family's Representative Sequence
| Representative Sequence | 3300005366|Ga0070659_100273229|Ga0070659_1002732293 |
| Length | 124 |
| Sequence | MSGPGPLMILVAGPYRSGTDGDPAMIKANVDAMTATALELHRRGHLPVMGEWFALPLIEVAEAAGDDPDEAYAAIFHPIAEQVLARCDACLRIGGPSEGADRMVATARRLGKTVFTSIAAVPAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 2 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 3 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 103 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 104 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 134 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 200 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 201 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 202 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 203 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 204 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 205 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 206 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 207 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 209 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 210 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 211 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 212 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 213 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 214 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 215 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 216 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 218 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 219 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 220 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 221 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 223 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 224 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 225 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 226 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 227 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 228 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 229 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 230 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 231 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 232 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 239 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 240 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 241 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 242 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 243 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 244 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 245 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 246 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 247 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 248 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 249 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 250 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 251 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 252 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 253 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 254 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 255 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 256 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 257 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 278 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 279 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 280 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 281 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 282 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 283 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 286 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 287 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 288 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 289 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 290 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 291 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 292 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 293 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 294 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 295 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 303 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 304 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 305 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 308 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 309 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 310 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 311 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 312 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 313 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 321 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 323 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 324 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 325 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 326 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 327 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 328 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.68 |
| Metatranscriptomes | 0 |
| Isolates | 0.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.48 |
| Nodule | 0 |
| Rhizoplane | 5.34 |
| Rhizosphere | 85.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24749J21850_1007756 | 3300002076 | Bacteria | 1496 |
| 2 | rootH1_10013630 | 3300003316 | Bacteria | 5119 |
| 3 | rootL2_10012244 | 3300003322 | Bacteria | 2597 |
| 4 | rootL2_10263668 | 3300003322 | Bacteria | 2565 |
| 5 | rootH1_10048311 | 3300003323 | Bacteria | 2181 |
| 6 | Ga0055540_1016407 | 3300003792 | Unclassified | 2109 |
| 7 | Ga0055531_10003055 | 3300003794 | Bacteria | 10844 |
| 8 | Ga0065712_10005764 | 3300005290 | Bacteria | 3381 |
| 9 | Ga0065715_10273969 | 3300005293 | Unclassified | 1103 |
| 10 | Ga0065707_10081818 | 3300005295 | Bacteria | 36625 |
| 11 | Ga0065707_10267991 | 3300005295 | Unclassified | 1079 |
| 12 | Ga0070676_10029108 | 3300005328 | Unclassified | 3140 |
| 13 | Ga0070676_10717149 | 3300005328 | Bacteria | 731 |
| 14 | Ga0070683_100509766 | 3300005329 | Unclassified | 1149 |
| 15 | Ga0070690_100003391 | 3300005330 | Bacteria | 8706 |
| 16 | Ga0070690_101543337 | 3300005330 | Bacteria | 537 |
| 17 | Ga0070670_100014482 | 3300005331 | Bacteria | 6772 |
| 18 | Ga0070670_100101660 | 3300005331 | Unclassified | 2475 |
| 19 | Ga0070670_100701832 | 3300005331 | Bacteria | 910 |
| 20 | Ga0070677_10022234 | 3300005333 | Bacteria | 2333 |
| 21 | Ga0070677_10130591 | 3300005333 | Bacteria | 1146 |
| 22 | Ga0070677_10261781 | 3300005333 | Bacteria | 863 |
| 23 | Ga0070677_10846926 | 3300005333 | Bacteria | 525 |
| 24 | Ga0068869_100000783 | 3300005334 | Bacteria | 18133 |
| 25 | Ga0068869_100005806 | 3300005334 | Bacteria | 7789 |
| 26 | Ga0068869_100046545 | 3300005334 | Bacteria | 3128 |
| 27 | Ga0068869_100057682 | 3300005334 | Bacteria | 2836 |
| 28 | Ga0068869_100097457 | 3300005334 | Bacteria | 2220 |
| 29 | Ga0068869_100225440 | 3300005334 | Unclassified | 1487 |
| 30 | Ga0068869_101018432 | 3300005334 | Bacteria | 722 |
| 31 | Ga0070666_10013641 | 3300005335 | Bacteria | 5161 |
| 32 | Ga0070666_10838080 | 3300005335 | Unclassified | 678 |
| 33 | Ga0070680_100078898 | 3300005336 | Bacteria | 2713 |
| 34 | Ga0070680_100088549 | 3300005336 | Bacteria | 2561 |
| 35 | Ga0070682_100004134 | 3300005337 | Bacteria | 8051 |
| 36 | Ga0070682_100034568 | 3300005337 | Bacteria | 3079 |
| 37 | Ga0070682_100128736 | 3300005337 | Bacteria | 1710 |
| 38 | Ga0068868_100038587 | 3300005338 | Unclassified | 3708 |
| 39 | Ga0068868_100221156 | 3300005338 | Bacteria | 1585 |
| 40 | Ga0068868_100392398 | 3300005338 | Unclassified | 1196 |
| 41 | Ga0070660_101037396 | 3300005339 | Unclassified | 693 |
| 42 | Ga0070660_101155796 | 3300005339 | Bacteria | 656 |
| 43 | Ga0070689_100004010 | 3300005340 | Bacteria | 9898 |
| 44 | Ga0070689_100004027 | 3300005340 | Bacteria | 9884 |
| 45 | Ga0070689_100004215 | 3300005340 | Bacteria | 9698 |
| 46 | Ga0070689_100729463 | 3300005340 | Unclassified | 867 |
| 47 | Ga0070687_100028089 | 3300005343 | Bacteria | 2725 |
| 48 | Ga0070661_100026560 | 3300005344 | Bacteria | 4164 |
| 49 | Ga0070661_100087165 | 3300005344 | Bacteria | 2309 |
| 50 | Ga0070661_100274125 | 3300005344 | Unclassified | 1307 |
| 51 | Ga0070661_100894169 | 3300005344 | Unclassified | 733 |
| 52 | Ga0070661_101129301 | 3300005344 | Bacteria | 654 |
| 53 | Ga0070692_10052322 | 3300005345 | Bacteria | 2127 |
| 54 | Ga0070692_10893209 | 3300005345 | Bacteria | 614 |
| 55 | Ga0070692_11038990 | 3300005345 | Bacteria | 575 |
| 56 | Ga0070668_100425520 | 3300005347 | Bacteria | 1137 |
| 57 | Ga0070668_100740046 | 3300005347 | Bacteria | 870 |
| 58 | Ga0070669_100252509 | 3300005353 | Bacteria | 1404 |
| 59 | Ga0070669_100608776 | 3300005353 | Bacteria | 916 |
| 60 | Ga0070669_100732150 | 3300005353 | Unclassified | 837 |
| 61 | Ga0070675_100030122 | 3300005354 | Bacteria | 4379 |
| 62 | Ga0070675_100065416 | 3300005354 | Bacteria | 3006 |
| 63 | Ga0070675_100387504 | 3300005354 | Bacteria | 1245 |
| 64 | Ga0070675_100819081 | 3300005354 | Bacteria | 851 |
| 65 | Ga0070675_101277372 | 3300005354 | Unclassified | 676 |
| 66 | Ga0070675_101726012 | 3300005354 | Bacteria | 578 |
| 67 | Ga0070671_100224904 | 3300005355 | Unclassified | 1592 |
| 68 | Ga0070671_100350404 | 3300005355 | Unclassified | 1260 |
| 69 | Ga0070671_100436087 | 3300005355 | Bacteria | 1123 |
| 70 | Ga0070671_100498001 | 3300005355 | Unclassified | 1048 |
| 71 | Ga0070671_100992514 | 3300005355 | Bacteria | 735 |
| 72 | Ga0070674_100017744 | 3300005356 | Unclassified | 4484 |
| 73 | Ga0070674_100063485 | 3300005356 | Bacteria | 2585 |
| 74 | Ga0070674_100346536 | 3300005356 | Bacteria | 1198 |
| 75 | Ga0070674_100679970 | 3300005356 | Bacteria | 878 |
| 76 | Ga0070673_100089944 | 3300005364 | Unclassified | 2507 |
| 77 | Ga0070673_100151412 | 3300005364 | Bacteria | 1965 |
| 78 | Ga0070673_100358104 | 3300005364 | Bacteria | 1296 |
| 79 | Ga0070673_100496406 | 3300005364 | Bacteria | 1103 |
| 80 | Ga0070688_100004559 | 3300005365 | Bacteria | 7225 |
| 81 | Ga0070688_100113529 | 3300005365 | Unclassified | 1805 |
| 82 | Ga0070688_100191552 | 3300005365 | Bacteria | 1425 |
| 83 | Ga0070688_100670577 | 3300005365 | Bacteria | 800 |
| 84 | Ga0070688_100938259 | 3300005365 | Unclassified | 684 |
| 85 | Ga0070659_100093309 | 3300005366 | Bacteria | 2415 |
| 86 | Ga0070659_100230223 | 3300005366 | Bacteria | 1531 |
| 87 | Ga0070659_100273229 | 3300005366 | Bacteria | 1405 |
| 88 | Ga0070659_101082012 | 3300005366 | Bacteria | 706 |
| 89 | Ga0070667_100112120 | 3300005367 | Bacteria | 2366 |
| 90 | Ga0070667_100217983 | 3300005367 | Bacteria | 1698 |
| 91 | Ga0070667_100605824 | 3300005367 | Bacteria | 1009 |
| 92 | Ga0070667_100785874 | 3300005367 | Unclassified | 883 |
| 93 | Ga0070709_10169849 | 3300005434 | Unclassified | 1523 |
| 94 | Ga0070714_100216012 | 3300005435 | Bacteria | 1760 |
| 95 | Ga0070713_100304050 | 3300005436 | Unclassified | 1469 |
| 96 | Ga0070701_10028952 | 3300005438 | Bacteria | 2726 |
| 97 | Ga0070701_10615016 | 3300005438 | Unclassified | 721 |
| 98 | Ga0070705_100019887 | 3300005440 | Bacteria | 3541 |
| 99 | Ga0070705_100135379 | 3300005440 | Bacteria | 1613 |
| 100 | Ga0070700_100001744 | 3300005441 | Bacteria | 10932 |
| 101 | Ga0070700_100012034 | 3300005441 | Bacteria | 4809 |
| 102 | Ga0070700_100432251 | 3300005441 | Bacteria | 997 |
| 103 | Ga0070700_100970225 | 3300005441 | Bacteria | 697 |
| 104 | Ga0070694_100003464 | 3300005444 | Bacteria | 9450 |
| 105 | Ga0070694_100039481 | 3300005444 | Bacteria | 3142 |
| 106 | Ga0070694_100214808 | 3300005444 | Bacteria | 1440 |
| 107 | Ga0070694_101293086 | 3300005444 | Bacteria | 613 |
| 108 | Ga0070708_100148228 | 3300005445 | Bacteria | 2181 |
| 109 | Ga0070708_100449583 | 3300005445 | Unclassified | 1215 |
| 110 | Ga0070663_100110139 | 3300005455 | Bacteria | 2068 |
| 111 | Ga0070663_100636538 | 3300005455 | Bacteria | 901 |
| 112 | Ga0070663_100915633 | 3300005455 | Unclassified | 758 |
| 113 | Ga0070663_101034958 | 3300005455 | Bacteria | 715 |
| 114 | Ga0070663_101616042 | 3300005455 | Bacteria | 578 |
| 115 | Ga0070678_100002589 | 3300005456 | Bacteria | 9938 |
| 116 | Ga0070678_100328002 | 3300005456 | Unclassified | 1309 |
| 117 | Ga0070678_100712084 | 3300005456 | Bacteria | 905 |
| 118 | Ga0070662_100016182 | 3300005457 | Bacteria | 5005 |
| 119 | Ga0070662_100104949 | 3300005457 | Bacteria | 2145 |
| 120 | Ga0070662_100172098 | 3300005457 | Unclassified | 1701 |
| 121 | Ga0070681_10007435 | 3300005458 | Bacteria | 10706 |
| 122 | Ga0070681_11488711 | 3300005458 | Unclassified | 601 |
| 123 | Ga0068867_100000607 | 3300005459 | Bacteria | 23750 |
| 124 | Ga0068867_100016935 | 3300005459 | Bacteria | 5179 |
| 125 | Ga0068867_100052765 | 3300005459 | Bacteria | 3001 |
| 126 | Ga0068867_100075645 | 3300005459 | Unclassified | 2526 |
| 127 | Ga0068867_100105147 | 3300005459 | Unclassified | 2161 |
| 128 | Ga0068867_100115762 | 3300005459 | Unclassified | 2065 |
| 129 | Ga0068867_100270765 | 3300005459 | Bacteria | 1388 |
| 130 | Ga0068867_100907994 | 3300005459 | Bacteria | 793 |
| 131 | Ga0068867_101311495 | 3300005459 | Bacteria | 668 |
| 132 | Ga0068867_102370856 | 3300005459 | Unclassified | 505 |
| 133 | Ga0070685_10009078 | 3300005466 | Bacteria | 5131 |
| 134 | Ga0070685_10022874 | 3300005466 | Bacteria | 3413 |
| 135 | Ga0070685_10031471 | 3300005466 | Bacteria | 2965 |
| 136 | Ga0070685_10174741 | 3300005466 | Bacteria | 1378 |
| 137 | Ga0070685_10577612 | 3300005466 | Bacteria | 806 |
| 138 | Ga0070706_100086631 | 3300005467 | Bacteria | 2902 |
| 139 | Ga0070698_100055650 | 3300005471 | Bacteria | 4010 |
| 140 | Ga0070698_101172933 | 3300005471 | Unclassified | 717 |
| 141 | Ga0070699_100312743 | 3300005518 | Bacteria | 1410 |
| 142 | Ga0070679_100169876 | 3300005530 | Unclassified | 2153 |
| 143 | Ga0070679_101161245 | 3300005530 | Unclassified | 717 |
| 144 | Ga0070679_101889668 | 3300005530 | Bacteria | 546 |
| 145 | Ga0070684_100340586 | 3300005535 | Bacteria | 1379 |
| 146 | Ga0068853_100006426 | 3300005539 | Bacteria | 9340 |
| 147 | Ga0068853_100013959 | 3300005539 | Bacteria | 6570 |
| 148 | Ga0068853_100104439 | 3300005539 | Bacteria | 2508 |
| 149 | Ga0068853_100193406 | 3300005539 | Bacteria | 1849 |
| 150 | Ga0068853_100279128 | 3300005539 | Bacteria | 1540 |
| 151 | Ga0068853_100432240 | 3300005539 | Bacteria | 1236 |
| 152 | Ga0068853_100804414 | 3300005539 | Bacteria | 900 |
| 153 | Ga0070672_100237439 | 3300005543 | Bacteria | 1532 |
| 154 | Ga0070672_101069505 | 3300005543 | Bacteria | 716 |
| 155 | Ga0070686_100043769 | 3300005544 | Bacteria | 2810 |
| 156 | Ga0070686_100248248 | 3300005544 | Unclassified | 1299 |
| 157 | Ga0070686_100594612 | 3300005544 | Bacteria | 871 |
| 158 | Ga0070695_100073268 | 3300005545 | Bacteria | 2247 |
| 159 | Ga0070695_100107677 | 3300005545 | Bacteria | 1886 |
| 160 | Ga0070696_100122071 | 3300005546 | Bacteria | 1887 |
| 161 | Ga0070696_100192662 | 3300005546 | Bacteria | 1518 |
| 162 | Ga0070696_100955833 | 3300005546 | Bacteria | 713 |
| 163 | Ga0070693_100197008 | 3300005547 | Bacteria | 1306 |
| 164 | Ga0070665_100067768 | 3300005548 | Bacteria | 3579 |
| 165 | Ga0070665_100069338 | 3300005548 | Bacteria | 3534 |
| 166 | Ga0070665_100075809 | 3300005548 | Bacteria | 3370 |
| 167 | Ga0070665_100112180 | 3300005548 | Bacteria | 2729 |
| 168 | Ga0070665_100466686 | 3300005548 | Bacteria | 1273 |
| 169 | Ga0070704_100112443 | 3300005549 | Unclassified | 2075 |
| 170 | Ga0068855_100026904 | 3300005563 | Bacteria | 6883 |
| 171 | Ga0070664_100001011 | 3300005564 | Bacteria | 22087 |
| 172 | Ga0070664_100007884 | 3300005564 | Bacteria | 8603 |
| 173 | Ga0070664_100011932 | 3300005564 | Bacteria | 7054 |
| 174 | Ga0070664_100039975 | 3300005564 | Bacteria | 3954 |
| 175 | Ga0070664_100136405 | 3300005564 | Unclassified | 2158 |
| 176 | Ga0070664_100139461 | 3300005564 | Bacteria | 2134 |
| 177 | Ga0070664_100605156 | 3300005564 | Unclassified | 1017 |
| 178 | Ga0070664_100944770 | 3300005564 | Bacteria | 809 |
| 179 | Ga0070664_101770132 | 3300005564 | Bacteria | 586 |
| 180 | Ga0068857_100038300 | 3300005577 | Bacteria | 4246 |
| 181 | Ga0068857_100061555 | 3300005577 | Bacteria | 3335 |
| 182 | Ga0068857_100215056 | 3300005577 | Bacteria | 1754 |
| 183 | Ga0068857_100506414 | 3300005577 | Bacteria | 1133 |
| 184 | Ga0068857_100859152 | 3300005577 | Unclassified | 869 |
| 185 | Ga0068857_100991811 | 3300005577 | Bacteria | 808 |
| 186 | Ga0068857_101199986 | 3300005577 | Bacteria | 735 |
| 187 | Ga0068854_100013305 | 3300005578 | Bacteria | 5396 |
| 188 | Ga0068854_100036744 | 3300005578 | Unclassified | 3436 |
| 189 | Ga0068854_100049001 | 3300005578 | Bacteria | 3016 |
| 190 | Ga0068854_100128176 | 3300005578 | Bacteria | 1935 |
| 191 | Ga0068854_100454449 | 3300005578 | Bacteria | 1070 |
| 192 | Ga0068856_100289249 | 3300005614 | Bacteria | 1656 |
| 193 | Ga0068856_102216196 | 3300005614 | Bacteria | 558 |
| 194 | Ga0070702_100001586 | 3300005615 | Bacteria | 9373 |
| 195 | Ga0070702_100023630 | 3300005615 | Bacteria | 3270 |
| 196 | Ga0068852_100002484 | 3300005616 | Bacteria | 12701 |
| 197 | Ga0068852_100004129 | 3300005616 | Bacteria | 10225 |
| 198 | Ga0068852_100030350 | 3300005616 | Bacteria | 4449 |
| 199 | Ga0068852_100073262 | 3300005616 | Bacteria | 3012 |
| 200 | Ga0068852_101976455 | 3300005616 | Bacteria | 605 |
| 201 | Ga0068859_100002059 | 3300005617 | Bacteria | 20524 |
| 202 | Ga0068859_100052584 | 3300005617 | Bacteria | 4095 |
| 203 | Ga0068859_100150650 | 3300005617 | Unclassified | 2401 |
| 204 | Ga0068859_100429086 | 3300005617 | Unclassified | 1418 |
| 205 | Ga0068859_100492728 | 3300005617 | Unclassified | 1321 |
| 206 | Ga0068859_101035796 | 3300005617 | Bacteria | 902 |
| 207 | Ga0068859_101935221 | 3300005617 | Unclassified | 651 |
| 208 | Ga0068859_102167318 | 3300005617 | Unclassified | 613 |
| 209 | Ga0068859_102700753 | 3300005617 | Bacteria | 546 |
| 210 | Ga0068864_100004086 | 3300005618 | Bacteria | 11984 |
| 211 | Ga0068864_100083267 | 3300005618 | Bacteria | 2809 |
| 212 | Ga0068864_100377884 | 3300005618 | Unclassified | 1342 |
| 213 | Ga0068864_100718478 | 3300005618 | Bacteria | 977 |
| 214 | Ga0068864_101194915 | 3300005618 | Unclassified | 759 |
| 215 | Ga0068864_101675744 | 3300005618 | Unclassified | 640 |
| 216 | Ga0068866_10004418 | 3300005718 | Bacteria | 5774 |
| 217 | Ga0068866_10006093 | 3300005718 | Bacteria | 5017 |
| 218 | Ga0068866_10012222 | 3300005718 | Bacteria | 3739 |
| 219 | Ga0068866_10234648 | 3300005718 | Bacteria | 1114 |
| 220 | Ga0068866_10617304 | 3300005718 | Bacteria | 734 |
| 221 | Ga0068866_10629930 | 3300005718 | Unclassified | 728 |
| 222 | Ga0068861_100028714 | 3300005719 | Bacteria | 4061 |
| 223 | Ga0068861_100683121 | 3300005719 | Unclassified | 952 |
| 224 | Ga0068861_100805078 | 3300005719 | Unclassified | 882 |
| 225 | Ga0068861_101603467 | 3300005719 | Bacteria | 641 |
| 226 | Ga0068851_10037646 | 3300005834 | Bacteria | 2425 |
| 227 | Ga0068870_10002423 | 3300005840 | Bacteria | 7762 |
| 228 | Ga0068870_10618556 | 3300005840 | Bacteria | 738 |
| 229 | Ga0068863_100046831 | 3300005841 | Unclassified | 4104 |
| 230 | Ga0068863_100321027 | 3300005841 | Bacteria | 1504 |
| 231 | Ga0068863_101146198 | 3300005841 | Bacteria | 783 |
| 232 | Ga0068863_101332415 | 3300005841 | Bacteria | 725 |
| 233 | Ga0068863_102287269 | 3300005841 | Unclassified | 550 |
| 234 | Ga0068863_102463819 | 3300005841 | Unclassified | 530 |
| 235 | Ga0068858_100003646 | 3300005842 | Bacteria | 15233 |
| 236 | Ga0068858_100128869 | 3300005842 | Bacteria | 2371 |
| 237 | Ga0068858_100250366 | 3300005842 | Bacteria | 1683 |
| 238 | Ga0068858_100293938 | 3300005842 | Unclassified | 1549 |
| 239 | Ga0068858_100298131 | 3300005842 | Bacteria | 1537 |
| 240 | Ga0068858_100633933 | 3300005842 | Bacteria | 1038 |
| 241 | Ga0068858_100915076 | 3300005842 | Bacteria | 858 |
| 242 | Ga0068858_101744089 | 3300005842 | Unclassified | 615 |
| 243 | Ga0068860_100000807 | 3300005843 | Bacteria | 35154 |
| 244 | Ga0068860_100047311 | 3300005843 | Bacteria | 4100 |
| 245 | Ga0068860_100133240 | 3300005843 | Bacteria | 2386 |
| 246 | Ga0068860_100379578 | 3300005843 | Bacteria | 1395 |
| 247 | Ga0068862_100025990 | 3300005844 | Bacteria | 4919 |
| 248 | Ga0068862_100048249 | 3300005844 | Bacteria | 3635 |
| 249 | Ga0068862_100356788 | 3300005844 | Bacteria | 1358 |
| 250 | Ga0068862_100375363 | 3300005844 | Bacteria | 1325 |
| 251 | Ga0068862_100723219 | 3300005844 | Unclassified | 966 |
| 252 | Ga0068862_100727145 | 3300005844 | Bacteria | 964 |
| 253 | Ga0068862_100862411 | 3300005844 | Unclassified | 888 |
| 254 | Ga0075365_10571464 | 3300006038 | Bacteria | 800 |
| 255 | Ga0075368_10045248 | 3300006042 | Bacteria | 1738 |
| 256 | Ga0075368_10154623 | 3300006042 | Bacteria | 959 |
| 257 | Ga0075363_100023527 | 3300006048 | Unclassified | 3123 |
| 258 | Ga0075432_10424739 | 3300006058 | Bacteria | 578 |
| 259 | Ga0070716_100158647 | 3300006173 | Unclassified | 1463 |
| 260 | Ga0075362_10001487 | 3300006177 | Bacteria | 7522 |
| 261 | Ga0075367_10006063 | 3300006178 | Bacteria | 6074 |
| 262 | Ga0075367_10016808 | 3300006178 | Bacteria | 4001 |
| 263 | Ga0075367_10202043 | 3300006178 | Bacteria | 1242 |
| 264 | Ga0075367_10343321 | 3300006178 | Bacteria | 942 |
| 265 | Ga0075369_10066687 | 3300006186 | Bacteria | 1579 |
| 266 | Ga0075369_10327161 | 3300006186 | Unclassified | 717 |
| 267 | Ga0075366_10004910 | 3300006195 | Bacteria | 7215 |
| 268 | Ga0075366_10020335 | 3300006195 | Bacteria | 3850 |
| 269 | Ga0075366_10111803 | 3300006195 | Bacteria | 1643 |
| 270 | Ga0075366_10453389 | 3300006195 | Unclassified | 791 |
| 271 | Ga0075366_10794980 | 3300006195 | Bacteria | 588 |
| 272 | Ga0097621_100039285 | 3300006237 | Bacteria | 3801 |
| 273 | Ga0097621_100169616 | 3300006237 | Bacteria | 1880 |
| 274 | Ga0097621_100175303 | 3300006237 | Unclassified | 1850 |
| 275 | Ga0097621_100371119 | 3300006237 | Bacteria | 1276 |
| 276 | Ga0097621_100545068 | 3300006237 | Bacteria | 1055 |
| 277 | Ga0097621_101615824 | 3300006237 | Bacteria | 616 |
| 278 | Ga0075370_10058732 | 3300006353 | Unclassified | 2188 |
| 279 | Ga0075370_10068185 | 3300006353 | Bacteria | 2031 |
| 280 | Ga0075370_10089065 | 3300006353 | Bacteria | 1779 |
| 281 | Ga0075370_10189555 | 3300006353 | Unclassified | 1211 |
| 282 | Ga0075370_10546436 | 3300006353 | Bacteria | 700 |
| 283 | Ga0068871_100021156 | 3300006358 | Bacteria | 4994 |
| 284 | Ga0068871_100368873 | 3300006358 | Bacteria | 1273 |
| 285 | Ga0068871_100407729 | 3300006358 | Bacteria | 1211 |
| 286 | Ga0068871_100845094 | 3300006358 | Bacteria | 846 |
| 287 | Ga0075428_100301804 | 3300006844 | Bacteria | 1722 |
| 288 | Ga0075430_100306148 | 3300006846 | Unclassified | 1314 |
| 289 | Ga0075430_100739134 | 3300006846 | Bacteria | 811 |
| 290 | Ga0075431_100676077 | 3300006847 | Bacteria | 1011 |
| 291 | Ga0075431_100731311 | 3300006847 | Bacteria | 966 |
| 292 | Ga0075431_100941114 | 3300006847 | Unclassified | 832 |
| 293 | Ga0075433_11211947 | 3300006852 | Unclassified | 655 |
| 294 | Ga0075434_100330807 | 3300006871 | Bacteria | 1544 |
| 295 | Ga0075434_101923036 | 3300006871 | Unclassified | 597 |
| 296 | Ga0075429_100476477 | 3300006880 | Unclassified | 1094 |
| 297 | Ga0068865_100018344 | 3300006881 | Bacteria | 4513 |
| 298 | Ga0068865_100132666 | 3300006881 | Bacteria | 1868 |
| 299 | Ga0068865_100380475 | 3300006881 | Bacteria | 1151 |
| 300 | Ga0068865_100405687 | 3300006881 | Bacteria | 1117 |
| 301 | Ga0068865_100548854 | 3300006881 | Unclassified | 970 |
| 302 | Ga0068865_100598196 | 3300006881 | Bacteria | 932 |
| 303 | Ga0068865_100693696 | 3300006881 | Bacteria | 869 |
| 304 | Ga0068865_101284340 | 3300006881 | Bacteria | 650 |
| 305 | Ga0068865_102219962 | 3300006881 | Unclassified | 500 |
| 306 | Ga0097620_100002059 | 3300006931 | Bacteria | 20524 |
| 307 | Ga0097620_100052587 | 3300006931 | Bacteria | 4095 |
| 308 | Ga0097620_100150662 | 3300006931 | Unclassified | 2401 |
| 309 | Ga0097620_100429138 | 3300006931 | Unclassified | 1418 |
| 310 | Ga0097620_100492742 | 3300006931 | Unclassified | 1321 |
| 311 | Ga0097620_100667774 | 3300006931 | Bacteria | 1131 |
| 312 | Ga0097620_100826692 | 3300006931 | Bacteria | 1013 |
| 313 | Ga0097620_101035599 | 3300006931 | Bacteria | 902 |
| 314 | Ga0097620_101934752 | 3300006931 | Unclassified | 651 |
| 315 | Ga0097620_102167485 | 3300006931 | Unclassified | 613 |
| 316 | Ga0097620_102700850 | 3300006931 | Bacteria | 546 |
| 317 | Ga0075435_100957244 | 3300007076 | Bacteria | 747 |
| 318 | Ga0099794_10001490 | 3300007265 | Bacteria | 8206 |
| 319 | Ga0099795_10104898 | 3300007788 | Unclassified | 1113 |
| 320 | Ga0105251_10456859 | 3300009011 | Bacteria | 593 |
| 321 | Ga0105240_10007439 | 3300009093 | Bacteria | 15906 |
| 322 | Ga0105240_10013447 | 3300009093 | Bacteria | 11239 |
| 323 | Ga0105240_10016259 | 3300009093 | Bacteria | 10081 |
| 324 | Ga0105240_10054468 | 3300009093 | Bacteria | 5013 |
| 325 | Ga0111539_10007243 | 3300009094 | Bacteria | 14214 |
| 326 | Ga0111539_10014384 | 3300009094 | Bacteria | 9875 |
| 327 | Ga0111539_10059108 | 3300009094 | Unclassified | 4547 |
| 328 | Ga0111539_10129876 | 3300009094 | Bacteria | 2951 |
| 329 | Ga0111539_10245527 | 3300009094 | Bacteria | 2084 |
| 330 | Ga0111539_10973116 | 3300009094 | Unclassified | 987 |
| 331 | Ga0111539_11866932 | 3300009094 | Unclassified | 697 |
| 332 | Ga0111539_12436754 | 3300009094 | Unclassified | 607 |
| 333 | Ga0111539_12966915 | 3300009094 | Bacteria | 548 |
| 334 | Ga0105245_10005108 | 3300009098 | Bacteria | 11535 |
| 335 | Ga0105245_10048092 | 3300009098 | Bacteria | 3815 |
| 336 | Ga0105245_10110128 | 3300009098 | Bacteria | 2560 |
| 337 | Ga0105245_10297274 | 3300009098 | Bacteria | 1583 |
| 338 | Ga0105245_11049290 | 3300009098 | Bacteria | 860 |
| 339 | Ga0105245_11123365 | 3300009098 | Bacteria | 832 |
| 340 | Ga0105247_10240647 | 3300009101 | Bacteria | 1233 |
| 341 | Ga0105247_10288690 | 3300009101 | Unclassified | 1134 |
| 342 | Ga0105247_10947429 | 3300009101 | Bacteria | 668 |
| 343 | Ga0114129_10058324 | 3300009147 | Bacteria | 5400 |
| 344 | Ga0114129_10103822 | 3300009147 | Bacteria | 3929 |
| 345 | Ga0114129_10295150 | 3300009147 | Bacteria | 2162 |
| 346 | Ga0114129_12008951 | 3300009147 | Unclassified | 699 |
| 347 | Ga0105243_10007489 | 3300009148 | Bacteria | 8387 |
| 348 | Ga0105243_10181574 | 3300009148 | Bacteria | 1830 |
| 349 | Ga0105243_10570986 | 3300009148 | Unclassified | 1084 |
| 350 | Ga0105243_10572261 | 3300009148 | Bacteria | 1083 |
| 351 | Ga0105243_10801532 | 3300009148 | Bacteria | 928 |
| 352 | Ga0105243_10845137 | 3300009148 | Bacteria | 906 |
| 353 | Ga0105243_10979859 | 3300009148 | Bacteria | 847 |
| 354 | Ga0105241_10211209 | 3300009174 | Bacteria | 1626 |
| 355 | Ga0105241_10306870 | 3300009174 | Bacteria | 1364 |
| 356 | Ga0105241_10795868 | 3300009174 | Bacteria | 871 |
| 357 | Ga0105241_10821420 | 3300009174 | Bacteria | 858 |
| 358 | Ga0105241_10879069 | 3300009174 | Unclassified | 831 |
| 359 | Ga0105241_11036023 | 3300009174 | Unclassified | 769 |
| 360 | Ga0105241_11747639 | 3300009174 | Unclassified | 606 |
| 361 | Ga0105242_10001358 | 3300009176 | Bacteria | 19304 |
| 362 | Ga0105242_10076211 | 3300009176 | Bacteria | 2795 |
| 363 | Ga0105242_10233422 | 3300009176 | Bacteria | 1650 |
| 364 | Ga0105242_10732124 | 3300009176 | Unclassified | 971 |
| 365 | Ga0105242_10808984 | 3300009176 | Bacteria | 928 |
| 366 | Ga0105242_12847157 | 3300009176 | Unclassified | 534 |
| 367 | Ga0105248_10016657 | 3300009177 | Bacteria | 8091 |
| 368 | Ga0105248_10023841 | 3300009177 | Bacteria | 6801 |
| 369 | Ga0105248_10079252 | 3300009177 | Bacteria | 3691 |
| 370 | Ga0105248_10270503 | 3300009177 | Bacteria | 1913 |
| 371 | Ga0105248_10336945 | 3300009177 | Bacteria | 1698 |
| 372 | Ga0105248_10486111 | 3300009177 | Bacteria | 1391 |
| 373 | Ga0105248_11054431 | 3300009177 | Bacteria | 919 |
| 374 | Ga0105248_11225207 | 3300009177 | Bacteria | 849 |
| 375 | Ga0105248_12061247 | 3300009177 | Bacteria | 648 |
| 376 | Ga0105237_10003127 | 3300009545 | Bacteria | 19921 |
| 377 | Ga0105237_10007400 | 3300009545 | Bacteria | 12020 |
| 378 | Ga0105237_10008504 | 3300009545 | Bacteria | 11102 |
| 379 | Ga0105237_10062594 | 3300009545 | Bacteria | 3720 |
| 380 | Ga0105237_10124293 | 3300009545 | Bacteria | 2575 |
| 381 | Ga0105237_10710777 | 3300009545 | Bacteria | 1011 |
| 382 | Ga0105237_11418004 | 3300009545 | Bacteria | 701 |
| 383 | Ga0105238_10000630 | 3300009551 | Bacteria | 37045 |
| 384 | Ga0105238_10002427 | 3300009551 | Bacteria | 18694 |
| 385 | Ga0105238_10515568 | 3300009551 | Bacteria | 1198 |
| 386 | Ga0105238_11012466 | 3300009551 | Bacteria | 852 |
| 387 | Ga0105238_11178050 | 3300009551 | Unclassified | 790 |
| 388 | Ga0105249_10001772 | 3300009553 | Bacteria | 18816 |
| 389 | Ga0105249_10013377 | 3300009553 | Bacteria | 7247 |
| 390 | Ga0105249_10206470 | 3300009553 | Bacteria | 1925 |
| 391 | Ga0105249_10354426 | 3300009553 | Bacteria | 1487 |
| 392 | Ga0105249_10872399 | 3300009553 | Bacteria | 966 |
| 393 | Ga0105249_11045354 | 3300009553 | Unclassified | 886 |
| 394 | Ga0105249_11316919 | 3300009553 | Unclassified | 794 |
| 395 | Ga0105249_11367004 | 3300009553 | Bacteria | 780 |
| 396 | Ga0105249_11639595 | 3300009553 | Bacteria | 716 |
| 397 | Ga0105239_10021540 | 3300010375 | Bacteria | 7107 |
| 398 | Ga0105239_10080659 | 3300010375 | Bacteria | 3580 |
| 399 | Ga0105239_10176568 | 3300010375 | Bacteria | 2389 |
| 400 | Ga0105239_10190382 | 3300010375 | Bacteria | 2296 |
| 401 | Ga0105239_10550953 | 3300010375 | Bacteria | 1313 |
| 402 | Ga0105239_10586538 | 3300010375 | Unclassified | 1271 |
| 403 | Ga0105239_11164908 | 3300010375 | Bacteria | 888 |
| 404 | Ga0105239_11224975 | 3300010375 | Unclassified | 865 |
| 405 | Ga0105239_11384705 | 3300010375 | Bacteria | 812 |
| 406 | Ga0105239_12112242 | 3300010375 | Bacteria | 654 |
| 407 | Ga0105246_10066825 | 3300011119 | Bacteria | 2518 |
| 408 | Ga0105246_10362226 | 3300011119 | Unclassified | 1192 |
| 409 | Ga0157371_10350368 | 3300013102 | Bacteria | 1075 |
| 410 | Ga0157371_10821186 | 3300013102 | Bacteria | 701 |
| 411 | Ga0157370_10002445 | 3300013104 | Bacteria | 22405 |
| 412 | Ga0157370_10717849 | 3300013104 | Unclassified | 912 |
| 413 | Ga0157369_10010660 | 3300013105 | Bacteria | 10462 |
| 414 | Ga0157369_10116821 | 3300013105 | Bacteria | 2832 |
| 415 | Ga0157369_10893147 | 3300013105 | Unclassified | 911 |
| 416 | Ga0157374_10003088 | 3300013296 | Bacteria | 13973 |
| 417 | Ga0157374_10017683 | 3300013296 | Bacteria | 6282 |
| 418 | Ga0157374_10026571 | 3300013296 | Bacteria | 5210 |
| 419 | Ga0157378_10002215 | 3300013297 | Bacteria | 17236 |
| 420 | Ga0157378_10057347 | 3300013297 | Unclassified | 3471 |
| 421 | Ga0157378_10106460 | 3300013297 | Bacteria | 2565 |
| 422 | Ga0157378_10129141 | 3300013297 | Bacteria | 2338 |
| 423 | Ga0157378_10155466 | 3300013297 | Unclassified | 2134 |
| 424 | Ga0157378_10235882 | 3300013297 | Bacteria | 1745 |
| 425 | Ga0157378_10395512 | 3300013297 | Bacteria | 1360 |
| 426 | Ga0157378_10710144 | 3300013297 | Unclassified | 1025 |
| 427 | Ga0157378_11744504 | 3300013297 | Bacteria | 670 |
| 428 | Ga0163162_10000003 | 3300013306 | Bacteria | 698280 |
| 429 | Ga0163162_10003082 | 3300013306 | Bacteria | 15919 |
| 430 | Ga0163162_10010455 | 3300013306 | Bacteria | 9021 |
| 431 | Ga0163162_10041418 | 3300013306 | Bacteria | 4608 |
| 432 | Ga0163162_10063827 | 3300013306 | Bacteria | 3727 |
| 433 | Ga0163162_10228430 | 3300013306 | Unclassified | 1991 |
| 434 | Ga0163162_10319374 | 3300013306 | Unclassified | 1686 |
| 435 | Ga0163162_10670972 | 3300013306 | Unclassified | 1160 |
| 436 | Ga0163162_10855809 | 3300013306 | Bacteria | 1024 |
| 437 | Ga0163162_11248506 | 3300013306 | Bacteria | 844 |
| 438 | Ga0163162_11264108 | 3300013306 | Unclassified | 838 |
| 439 | Ga0163162_12535318 | 3300013306 | Bacteria | 590 |
| 440 | Ga0157372_10000656 | 3300013307 | Bacteria | 37971 |
| 441 | Ga0157372_10042624 | 3300013307 | Bacteria | 5021 |
| 442 | Ga0157372_10147119 | 3300013307 | Bacteria | 2717 |
| 443 | Ga0157372_10158348 | 3300013307 | Unclassified | 2616 |
| 444 | Ga0157372_10235370 | 3300013307 | Bacteria | 2124 |
| 445 | Ga0157372_10685374 | 3300013307 | Unclassified | 1193 |
| 446 | Ga0157372_13442502 | 3300013307 | Unclassified | 503 |
| 447 | Ga0157375_10066469 | 3300013308 | Unclassified | 3600 |
| 448 | Ga0157375_10161094 | 3300013308 | Bacteria | 2385 |
| 449 | Ga0157375_10210023 | 3300013308 | Unclassified | 2104 |
| 450 | Ga0157375_10310387 | 3300013308 | Bacteria | 1741 |
| 451 | Ga0157375_10371297 | 3300013308 | Bacteria | 1597 |
| 452 | Ga0157375_10622839 | 3300013308 | Bacteria | 1237 |
| 453 | Ga0157375_10851285 | 3300013308 | Bacteria | 1058 |
| 454 | Ga0157375_11326942 | 3300013308 | Unclassified | 846 |
| 455 | Ga0163163_10021449 | 3300014325 | Bacteria | 6097 |
| 456 | Ga0163163_10024708 | 3300014325 | Bacteria | 5721 |
| 457 | Ga0163163_10037055 | 3300014325 | Bacteria | 4742 |
| 458 | Ga0163163_10037639 | 3300014325 | Bacteria | 4708 |
| 459 | Ga0163163_10054161 | 3300014325 | Bacteria | 3962 |
| 460 | Ga0163163_10124708 | 3300014325 | Bacteria | 2612 |
| 461 | Ga0163163_10252688 | 3300014325 | Bacteria | 1813 |
| 462 | Ga0163163_10387917 | 3300014325 | Bacteria | 1454 |
| 463 | Ga0163163_11207725 | 3300014325 | Bacteria | 819 |
| 464 | Ga0163163_11227568 | 3300014325 | Bacteria | 812 |
| 465 | Ga0157380_10002108 | 3300014326 | Bacteria | 13337 |
| 466 | Ga0157380_10002689 | 3300014326 | Bacteria | 12060 |
| 467 | Ga0157380_10017561 | 3300014326 | Bacteria | 5295 |
| 468 | Ga0157380_10032589 | 3300014326 | Bacteria | 4010 |
| 469 | Ga0157380_10045490 | 3300014326 | Bacteria | 3444 |
| 470 | Ga0157380_10239085 | 3300014326 | Bacteria | 1636 |
| 471 | Ga0157380_10292688 | 3300014326 | Unclassified | 1496 |
| 472 | Ga0157380_10467604 | 3300014326 | Bacteria | 1216 |
| 473 | Ga0157380_10717490 | 3300014326 | Bacteria | 1007 |
| 474 | Ga0157380_10754884 | 3300014326 | Bacteria | 985 |
| 475 | Ga0157380_11610588 | 3300014326 | Bacteria | 705 |
| 476 | Ga0157380_11669786 | 3300014326 | Bacteria | 694 |
| 477 | Ga0157380_12116494 | 3300014326 | Unclassified | 626 |
| 478 | Ga0157380_12748132 | 3300014326 | Unclassified | 559 |
| 479 | Ga0157377_10444818 | 3300014745 | Unclassified | 893 |
| 480 | Ga0157379_10012056 | 3300014968 | Bacteria | 7553 |
| 481 | Ga0157379_10017429 | 3300014968 | Bacteria | 6324 |
| 482 | Ga0157379_10020519 | 3300014968 | Bacteria | 5843 |
| 483 | Ga0157379_10063543 | 3300014968 | Bacteria | 3300 |
| 484 | Ga0157379_10314365 | 3300014968 | Unclassified | 1429 |
| 485 | Ga0157379_10506164 | 3300014968 | Bacteria | 1120 |
| 486 | Ga0157379_11005087 | 3300014968 | Bacteria | 795 |
| 487 | Ga0157379_11100465 | 3300014968 | Bacteria | 761 |
| 488 | Ga0157379_11803441 | 3300014968 | Unclassified | 601 |
| 489 | Ga0157376_10020301 | 3300014969 | Bacteria | 5137 |
| 490 | Ga0157376_10061796 | 3300014969 | Bacteria | 3150 |
| 491 | Ga0157376_10147511 | 3300014969 | Bacteria | 2118 |
| 492 | Ga0157376_10282658 | 3300014969 | Bacteria | 1563 |
| 493 | Ga0157376_10435668 | 3300014969 | Bacteria | 1275 |
| 494 | Ga0157376_10439104 | 3300014969 | Unclassified | 1270 |
| 495 | Ga0157376_10895325 | 3300014969 | Bacteria | 905 |
| 496 | Ga0157376_11073596 | 3300014969 | Bacteria | 830 |
| 497 | Ga0157376_11675253 | 3300014969 | Bacteria | 671 |
| 498 | Ga0157376_11698879 | 3300014969 | Bacteria | 666 |
| 499 | Ga0157376_11734379 | 3300014969 | Bacteria | 660 |
| 500 | Ga0157376_11735144 | 3300014969 | Bacteria | 660 |
| 501 | Ga0157376_11794174 | 3300014969 | Bacteria | 650 |
| 502 | Ga0157376_11922364 | 3300014969 | Bacteria | 629 |
| 503 | Ga0163161_10159845 | 3300017792 | Bacteria | 1718 |
| 504 | Ga0163161_10605122 | 3300017792 | Bacteria | 904 |
| 505 | Ga0163161_10872943 | 3300017792 | Bacteria | 760 |
| 506 | Ga0163161_12024222 | 3300017792 | Bacteria | 512 |
| 507 | Ga0213876_10143140 | 3300021384 | Bacteria | 1271 |
| 508 | Ga0209673_1012504 | 3300025273 | Bacteria | 3414 |
| 509 | Ga0207673_1018235 | 3300025290 | Bacteria | 939 |
| 510 | Ga0209051_1004592 | 3300025303 | Bacteria | 8425 |
| 511 | Ga0209257_1000309 | 3300025304 | Bacteria | 104166 |
| 512 | Ga0207697_10001907 | 3300025315 | Bacteria | 11108 |
| 513 | Ga0207697_10146494 | 3300025315 | Bacteria | 1026 |
| 514 | Ga0207656_10006854 | 3300025321 | Bacteria | 4124 |
| 515 | Ga0207682_10000850 | 3300025893 | Bacteria | 14174 |
| 516 | Ga0207642_10018161 | 3300025899 | Bacteria | 2693 |
| 517 | Ga0207642_10046203 | 3300025899 | Bacteria | 1938 |
| 518 | Ga0207642_10645851 | 3300025899 | Bacteria | 663 |
| 519 | Ga0207688_10000680 | 3300025901 | Bacteria | 16796 |
| 520 | Ga0207688_10930532 | 3300025901 | Unclassified | 550 |
| 521 | Ga0207680_10043301 | 3300025903 | Bacteria | 2639 |
| 522 | Ga0207680_10787634 | 3300025903 | Bacteria | 682 |
| 523 | Ga0207647_10028610 | 3300025904 | Bacteria | 3617 |
| 524 | Ga0207647_10076768 | 3300025904 | Bacteria | 2009 |
| 525 | Ga0207645_10002221 | 3300025907 | Bacteria | 15483 |
| 526 | Ga0207645_10046224 | 3300025907 | Unclassified | 2781 |
| 527 | Ga0207645_10421765 | 3300025907 | Unclassified | 899 |
| 528 | Ga0207645_10588287 | 3300025907 | Bacteria | 755 |
| 529 | Ga0207645_10767041 | 3300025907 | Bacteria | 656 |
| 530 | Ga0207643_10000188 | 3300025908 | Bacteria | 42556 |
| 531 | Ga0207643_10003877 | 3300025908 | Bacteria | 8046 |
| 532 | Ga0207643_10202540 | 3300025908 | Unclassified | 1209 |
| 533 | Ga0207643_11022632 | 3300025908 | Unclassified | 534 |
| 534 | Ga0207705_10427082 | 3300025909 | Bacteria | 1026 |
| 535 | Ga0207654_11138634 | 3300025911 | Unclassified | 568 |
| 536 | Ga0207707_11336623 | 3300025912 | Unclassified | 574 |
| 537 | Ga0207695_10043435 | 3300025913 | Bacteria | 4790 |
| 538 | Ga0207660_11209211 | 3300025917 | Bacteria | 615 |
| 539 | Ga0207662_10149877 | 3300025918 | Bacteria | 1483 |
| 540 | Ga0207662_10539827 | 3300025918 | Bacteria | 807 |
| 541 | Ga0207662_10644454 | 3300025918 | Bacteria | 739 |
| 542 | Ga0207649_10374097 | 3300025920 | Bacteria | 1060 |
| 543 | Ga0207649_10774074 | 3300025920 | Bacteria | 748 |
| 544 | Ga0207649_11194787 | 3300025920 | Unclassified | 601 |
| 545 | Ga0207652_10041101 | 3300025921 | Bacteria | 3929 |
| 546 | Ga0207652_10330171 | 3300025921 | Unclassified | 1377 |
| 547 | Ga0207652_11820665 | 3300025921 | Bacteria | 514 |
| 548 | Ga0207646_10790638 | 3300025922 | Bacteria | 845 |
| 549 | Ga0207681_10098123 | 3300025923 | Unclassified | 2107 |
| 550 | Ga0207681_10159293 | 3300025923 | Bacteria | 1699 |
| 551 | Ga0207681_11834782 | 3300025923 | Bacteria | 506 |
| 552 | Ga0207694_10039354 | 3300025924 | Bacteria | 3639 |
| 553 | Ga0207650_10009664 | 3300025925 | Bacteria | 6593 |
| 554 | Ga0207650_10041245 | 3300025925 | Bacteria | 3381 |
| 555 | Ga0207650_10079123 | 3300025925 | Unclassified | 2489 |
| 556 | Ga0207650_10830773 | 3300025925 | Bacteria | 783 |
| 557 | Ga0207659_10035434 | 3300025926 | Bacteria | 3449 |
| 558 | Ga0207659_10133498 | 3300025926 | Unclassified | 1919 |
| 559 | Ga0207659_10248453 | 3300025926 | Bacteria | 1442 |
| 560 | Ga0207659_10329937 | 3300025926 | Bacteria | 1261 |
| 561 | Ga0207659_10996802 | 3300025926 | Bacteria | 721 |
| 562 | Ga0207659_11187102 | 3300025926 | Bacteria | 656 |
| 563 | Ga0207687_10013955 | 3300025927 | Bacteria | 5251 |
| 564 | Ga0207687_10176843 | 3300025927 | Bacteria | 1650 |
| 565 | Ga0207687_10363300 | 3300025927 | Bacteria | 1182 |
| 566 | Ga0207687_10399224 | 3300025927 | Bacteria | 1130 |
| 567 | Ga0207687_10789427 | 3300025927 | Bacteria | 809 |
| 568 | Ga0207687_10970987 | 3300025927 | Bacteria | 728 |
| 569 | Ga0207644_10279526 | 3300025931 | Unclassified | 1340 |
| 570 | Ga0207644_10403473 | 3300025931 | Unclassified | 1118 |
| 571 | Ga0207644_10444615 | 3300025931 | Unclassified | 1064 |
| 572 | Ga0207644_10637294 | 3300025931 | Bacteria | 886 |
| 573 | Ga0207644_10907408 | 3300025931 | Bacteria | 738 |
| 574 | Ga0207690_10466400 | 3300025932 | Bacteria | 1017 |
| 575 | Ga0207706_10023206 | 3300025933 | Bacteria | 5572 |
| 576 | Ga0207706_10039291 | 3300025933 | Bacteria | 4194 |
| 577 | Ga0207706_10064005 | 3300025933 | Bacteria | 3238 |
| 578 | Ga0207706_10097186 | 3300025933 | Bacteria | 2590 |
| 579 | Ga0207706_10154534 | 3300025933 | Unclassified | 2018 |
| 580 | Ga0207686_10000532 | 3300025934 | Bacteria | 24670 |
| 581 | Ga0207686_10099083 | 3300025934 | Bacteria | 1942 |
| 582 | Ga0207686_10436684 | 3300025934 | Bacteria | 1004 |
| 583 | Ga0207686_10819497 | 3300025934 | Bacteria | 747 |
| 584 | Ga0207709_10008548 | 3300025935 | Bacteria | 5661 |
| 585 | Ga0207709_10080536 | 3300025935 | Bacteria | 2097 |
| 586 | Ga0207709_10486832 | 3300025935 | Bacteria | 960 |
| 587 | Ga0207670_10052595 | 3300025936 | Bacteria | 2739 |
| 588 | Ga0207670_10311355 | 3300025936 | Bacteria | 1236 |
| 589 | Ga0207670_10489223 | 3300025936 | Bacteria | 997 |
| 590 | Ga0207669_10030931 | 3300025937 | Bacteria | 2983 |
| 591 | Ga0207669_10504958 | 3300025937 | Bacteria | 968 |
| 592 | Ga0207704_10022957 | 3300025938 | Bacteria | 3354 |
| 593 | Ga0207704_10025570 | 3300025938 | Bacteria | 3223 |
| 594 | Ga0207704_10374697 | 3300025938 | Bacteria | 1115 |
| 595 | Ga0207704_10631267 | 3300025938 | Bacteria | 880 |
| 596 | Ga0207704_10693640 | 3300025938 | Bacteria | 842 |
| 597 | Ga0207704_10803835 | 3300025938 | Bacteria | 785 |
| 598 | Ga0207691_10059928 | 3300025940 | Bacteria | 3460 |
| 599 | Ga0207691_10268705 | 3300025940 | Bacteria | 1469 |
| 600 | Ga0207691_10886073 | 3300025940 | Bacteria | 747 |
| 601 | Ga0207711_10014526 | 3300025941 | Bacteria | 6545 |
| 602 | Ga0207711_10122894 | 3300025941 | Bacteria | 2319 |
| 603 | Ga0207711_10387824 | 3300025941 | Bacteria | 1297 |
| 604 | Ga0207711_10559649 | 3300025941 | Unclassified | 1067 |
| 605 | Ga0207711_10608593 | 3300025941 | Unclassified | 1019 |
| 606 | Ga0207689_10000262 | 3300025942 | Bacteria | 47258 |
| 607 | Ga0207689_10001600 | 3300025942 | Bacteria | 21433 |
| 608 | Ga0207689_10003034 | 3300025942 | Bacteria | 15480 |
| 609 | Ga0207689_10034333 | 3300025942 | Unclassified | 4213 |
| 610 | Ga0207689_10090212 | 3300025942 | Unclassified | 2518 |
| 611 | Ga0207689_10142695 | 3300025942 | Unclassified | 1973 |
| 612 | Ga0207689_10941790 | 3300025942 | Bacteria | 729 |
| 613 | Ga0207661_10071203 | 3300025944 | Bacteria | 2841 |
| 614 | Ga0207661_10158672 | 3300025944 | Bacteria | 1961 |
| 615 | Ga0207661_10456935 | 3300025944 | Bacteria | 1164 |
| 616 | Ga0207661_10711611 | 3300025944 | Unclassified | 924 |
| 617 | Ga0207679_10258257 | 3300025945 | Unclassified | 1485 |
| 618 | Ga0207679_10284192 | 3300025945 | Bacteria | 1420 |
| 619 | Ga0207679_10350033 | 3300025945 | Bacteria | 1287 |
| 620 | Ga0207679_11861771 | 3300025945 | Bacteria | 549 |
| 621 | Ga0207667_10017959 | 3300025949 | Bacteria | 7950 |
| 622 | Ga0207667_10463725 | 3300025949 | Bacteria | 1286 |
| 623 | Ga0207651_10021076 | 3300025960 | Bacteria | 3951 |
| 624 | Ga0207651_10186042 | 3300025960 | Bacteria | 1652 |
| 625 | Ga0207651_10820029 | 3300025960 | Bacteria | 826 |
| 626 | Ga0207651_10943385 | 3300025960 | Bacteria | 769 |
| 627 | Ga0207712_10013240 | 3300025961 | Bacteria | 5286 |
| 628 | Ga0207712_10091122 | 3300025961 | Bacteria | 2245 |
| 629 | Ga0207712_10625193 | 3300025961 | Bacteria | 934 |
| 630 | Ga0207712_10752027 | 3300025961 | Unclassified | 854 |
| 631 | Ga0207668_10647254 | 3300025972 | Bacteria | 925 |
| 632 | Ga0207668_11029828 | 3300025972 | Bacteria | 736 |
| 633 | Ga0207668_11375652 | 3300025972 | Bacteria | 636 |
| 634 | Ga0207640_10207980 | 3300025981 | Bacteria | 1488 |
| 635 | Ga0207640_10345344 | 3300025981 | Bacteria | 1194 |
| 636 | Ga0207640_10419216 | 3300025981 | Bacteria | 1095 |
| 637 | Ga0207658_10042515 | 3300025986 | Bacteria | 3297 |
| 638 | Ga0207658_10180401 | 3300025986 | Bacteria | 1747 |
| 639 | Ga0207658_10194728 | 3300025986 | Unclassified | 1688 |
| 640 | Ga0207658_10305766 | 3300025986 | Bacteria | 1371 |
| 641 | Ga0207658_10346714 | 3300025986 | Unclassified | 1292 |
| 642 | Ga0207677_10067833 | 3300026023 | Bacteria | 2500 |
| 643 | Ga0207677_10411035 | 3300026023 | Unclassified | 1150 |
| 644 | Ga0207677_10577116 | 3300026023 | Bacteria | 984 |
| 645 | Ga0207703_10004514 | 3300026035 | Bacteria | 11423 |
| 646 | Ga0207703_10169825 | 3300026035 | Unclassified | 1917 |
| 647 | Ga0207703_10385636 | 3300026035 | Bacteria | 1297 |
| 648 | Ga0207703_11106745 | 3300026035 | Unclassified | 761 |
| 649 | Ga0207703_11119581 | 3300026035 | Bacteria | 756 |
| 650 | Ga0207703_11236044 | 3300026035 | Bacteria | 718 |
| 651 | Ga0207639_10075088 | 3300026041 | Unclassified | 2657 |
| 652 | Ga0207639_10280903 | 3300026041 | Bacteria | 1464 |
| 653 | Ga0207639_10286459 | 3300026041 | Bacteria | 1451 |
| 654 | Ga0207639_10400305 | 3300026041 | Bacteria | 1237 |
| 655 | Ga0207639_10431819 | 3300026041 | Bacteria | 1193 |
| 656 | Ga0207639_10661793 | 3300026041 | Unclassified | 967 |
| 657 | Ga0207639_11135618 | 3300026041 | Bacteria | 733 |
| 658 | Ga0207678_10006127 | 3300026067 | Bacteria | 10696 |
| 659 | Ga0207678_11049804 | 3300026067 | Bacteria | 721 |
| 660 | Ga0207708_10003947 | 3300026075 | Bacteria | 10920 |
| 661 | Ga0207708_10006587 | 3300026075 | Bacteria | 8597 |
| 662 | Ga0207708_10020126 | 3300026075 | Bacteria | 5032 |
| 663 | Ga0207708_10411284 | 3300026075 | Bacteria | 1120 |
| 664 | Ga0207708_10425749 | 3300026075 | Bacteria | 1101 |
| 665 | Ga0207702_10155402 | 3300026078 | Unclassified | 2085 |
| 666 | Ga0207641_10142817 | 3300026088 | Bacteria | 2162 |
| 667 | Ga0207641_10283932 | 3300026088 | Bacteria | 1558 |
| 668 | Ga0207641_10516476 | 3300026088 | Bacteria | 1161 |
| 669 | Ga0207641_10528138 | 3300026088 | Bacteria | 1148 |
| 670 | Ga0207641_10547030 | 3300026088 | Bacteria | 1129 |
| 671 | Ga0207648_10000491 | 3300026089 | Bacteria | 44111 |
| 672 | Ga0207648_10029798 | 3300026089 | Bacteria | 4839 |
| 673 | Ga0207648_10031490 | 3300026089 | Unclassified | 4690 |
| 674 | Ga0207648_10047261 | 3300026089 | Bacteria | 3773 |
| 675 | Ga0207648_10057742 | 3300026089 | Bacteria | 3386 |
| 676 | Ga0207648_10087070 | 3300026089 | Unclassified | 2726 |
| 677 | Ga0207648_10119486 | 3300026089 | Bacteria | 2317 |
| 678 | Ga0207648_10211352 | 3300026089 | Bacteria | 1722 |
| 679 | Ga0207648_10467606 | 3300026089 | Bacteria | 1150 |
| 680 | Ga0207676_10001767 | 3300026095 | Bacteria | 15841 |
| 681 | Ga0207676_10068447 | 3300026095 | Bacteria | 2840 |
| 682 | Ga0207676_10180624 | 3300026095 | Bacteria | 1847 |
| 683 | Ga0207676_10188273 | 3300026095 | Unclassified | 1814 |
| 684 | Ga0207676_10301302 | 3300026095 | Bacteria | 1464 |
| 685 | Ga0207676_10928094 | 3300026095 | Bacteria | 855 |
| 686 | Ga0207674_10016255 | 3300026116 | Bacteria | 8151 |
| 687 | Ga0207674_10074752 | 3300026116 | Bacteria | 3399 |
| 688 | Ga0207674_10284184 | 3300026116 | Bacteria | 1603 |
| 689 | Ga0207674_10368055 | 3300026116 | Bacteria | 1390 |
| 690 | Ga0207674_11433263 | 3300026116 | Bacteria | 660 |
| 691 | Ga0207674_11435934 | 3300026116 | Bacteria | 659 |
| 692 | Ga0207675_100001238 | 3300026118 | Bacteria | 25498 |
| 693 | Ga0207675_100004912 | 3300026118 | Bacteria | 12882 |
| 694 | Ga0207675_100239679 | 3300026118 | Bacteria | 1752 |
| 695 | Ga0207675_100250736 | 3300026118 | Unclassified | 1713 |
| 696 | Ga0207675_100427987 | 3300026118 | Bacteria | 1308 |
| 697 | Ga0207675_101938803 | 3300026118 | Bacteria | 607 |
| 698 | Ga0207683_10007474 | 3300026121 | Bacteria | 9374 |
| 699 | Ga0207683_10017447 | 3300026121 | Bacteria | 6118 |
| 700 | Ga0207683_10469893 | 3300026121 | Unclassified | 1160 |
| 701 | Ga0207683_11078736 | 3300026121 | Bacteria | 745 |
| 702 | Ga0207698_10034858 | 3300026142 | Bacteria | 3675 |
| 703 | Ga0207698_10353884 | 3300026142 | Bacteria | 1388 |
| 704 | Ga0207698_10451312 | 3300026142 | Bacteria | 1241 |
| 705 | Ga0207698_10838248 | 3300026142 | Bacteria | 924 |
| 706 | Ga0209995_1033562 | 3300027471 | Bacteria | 862 |
| 707 | Ga0209995_1096427 | 3300027471 | Unclassified | 509 |
| 708 | Ga0209813_10261256 | 3300027866 | Bacteria | 661 |
| 709 | Ga0207428_10394380 | 3300027907 | Bacteria | 1014 |
| 710 | Ga0207428_10414733 | 3300027907 | Bacteria | 985 |
| 711 | Ga0268266_10063426 | 3300028379 | Bacteria | 3189 |
| 712 | Ga0268266_10387800 | 3300028379 | Bacteria | 1319 |
| 713 | Ga0268266_10768376 | 3300028379 | Unclassified | 930 |
| 714 | Ga0268265_10047352 | 3300028380 | Unclassified | 3221 |
| 715 | Ga0268265_10127567 | 3300028380 | Bacteria | 2108 |
| 716 | Ga0268265_10433938 | 3300028380 | Bacteria | 1223 |
| 717 | Ga0268265_10917746 | 3300028380 | Unclassified | 861 |
| 718 | Ga0268264_10005327 | 3300028381 | Bacteria | 10897 |
| 719 | Ga0268264_10063467 | 3300028381 | Bacteria | 3105 |
| 720 | Ga0268264_10342856 | 3300028381 | Bacteria | 1420 |
| 721 | Ga0268264_10360143 | 3300028381 | Bacteria | 1387 |
| 722 | Ga0268264_10552555 | 3300028381 | Bacteria | 1129 |
| 723 | Ga0268264_10574161 | 3300028381 | Bacteria | 1109 |
| 724 | Ga0307517_10608010 | 3300028786 | Bacteria | 537 |
| 725 | Ga0307515_10000059 | 3300028794 | Bacteria | 257520 |
| 726 | Ga0307515_10000265 | 3300028794 | Bacteria | 129554 |
| 727 | Ga0307515_10000347 | 3300028794 | Bacteria | 114603 |
| 728 | Ga0307515_10002435 | 3300028794 | Bacteria | 40544 |
| 729 | Ga0307515_10003762 | 3300028794 | Bacteria | 31786 |
| 730 | Ga0307515_10546302 | 3300028794 | Bacteria | 768 |
| 731 | Ga0307512_10120497 | 3300030522 | Bacteria | 1688 |
| 732 | Ga0307512_10194593 | 3300030522 | Bacteria | 1111 |
| 733 | Ga0307513_10006201 | 3300031456 | Bacteria | 15675 |
| 734 | Ga0307513_10024660 | 3300031456 | Bacteria | 6992 |
| 735 | Ga0307513_10083106 | 3300031456 | Bacteria | 3294 |
| 736 | Ga0307513_10133414 | 3300031456 | Bacteria | 2424 |
| 737 | Ga0307513_10146015 | 3300031456 | Bacteria | 2283 |
| 738 | Ga0307513_10351259 | 3300031456 | Bacteria | 1222 |
| 739 | Ga0307513_10498207 | 3300031456 | Bacteria | 936 |
| 740 | Ga0307513_10580467 | 3300031456 | Bacteria | 831 |
| 741 | Ga0307513_10657106 | 3300031456 | Bacteria | 755 |
| 742 | Ga0307509_10003931 | 3300031507 | Bacteria | 21948 |
| 743 | Ga0307509_10021357 | 3300031507 | Bacteria | 7320 |
| 744 | Ga0307408_100385531 | 3300031548 | Bacteria | 1199 |
| 745 | Ga0307408_100958799 | 3300031548 | Unclassified | 786 |
| 746 | Ga0307408_101066397 | 3300031548 | Bacteria | 748 |
| 747 | Ga0307508_10001686 | 3300031616 | Bacteria | 24498 |
| 748 | Ga0307508_10002419 | 3300031616 | Bacteria | 19681 |
| 749 | Ga0307508_10401553 | 3300031616 | Bacteria | 962 |
| 750 | Ga0307514_10241678 | 3300031649 | Bacteria | 1080 |
| 751 | Ga0265314_10150042 | 3300031711 | Bacteria | 1431 |
| 752 | Ga0307516_10001538 | 3300031730 | Bacteria | 31719 |
| 753 | Ga0307516_10053528 | 3300031730 | Bacteria | 3946 |
| 754 | Ga0307516_10362362 | 3300031730 | Bacteria | 1114 |
| 755 | Ga0307410_10158797 | 3300031852 | Bacteria | 1692 |
| 756 | Ga0307406_10361484 | 3300031901 | Unclassified | 1138 |
| 757 | Ga0307412_11016713 | 3300031911 | Bacteria | 733 |
| 758 | Ga0307415_100728098 | 3300032126 | Bacteria | 898 |
| 759 | Ga0307415_100786915 | 3300032126 | Bacteria | 867 |
| 760 | Ga0307507_10032282 | 3300033179 | Bacteria | 5470 |
| 761 | Ga0307507_10169869 | 3300033179 | Bacteria | 1587 |
| 762 | Ga0307510_10222308 | 3300033180 | Bacteria | 1398 |
| 763 | Ga0307510_10269257 | 3300033180 | Bacteria | 1180 |
| 764 | Ga0373929_0034657 | 3300035085 | Bacteria | 1096 |
| 765 | Ga0373941_0041623 | 3300035115 | Bacteria | 1423 |
| 766 | Ga0373962_0079264 | 3300035242 | Bacteria | 994 |
| 767 | Ga0373962_0406256 | 3300035242 | Unclassified | 502 |
| 768 | Ga0373927_0164380 | 3300035695 | Bacteria | 1454 |
| 769 | Ga0373933_0626756 | 3300035724 | Unclassified | 707 |
| 770 | Ga0373947_0100675 | 3300035725 | Bacteria | 1816 |
| 771 | Ga0373925_0700550 | 3300037068 | Bacteria | 835 |
| 772 | Ga0395900_1101200 | 3300037418 | Unclassified | 711 |
| 773 | Ga0436365_0306342 | 3300039437 | Bacteria | 13671 |
| 774 | Ga0436365_1894678 | 3300039437 | Bacteria | 43063 |
| 775 | Ga0436361_0128791 | 3300039447 | Bacteria | 2143 |
| 776 | Ga0439436_0001316 | 3300041404 | Bacteria | 7122 |
| 777 | Ga0439438_028748 | 3300041405 | Bacteria | 1493 |
| 778 | Ga0439439_0003403 | 3300041406 | Bacteria | 3509 |
| 779 | Ga0439447_020516 | 3300041407 | Bacteria | 1752 |
| 780 | Ga0439461_0031947 | 3300041410 | Bacteria | 1101 |
| 781 | Ga0439461_0176768 | 3300041410 | Bacteria | 564 |
| 782 | Ga0439466_0001978 | 3300041411 | Bacteria | 8035 |
| 783 | Ga0439466_0056408 | 3300041411 | Bacteria | 1274 |
| 784 | Ga0439465_0000192 | 3300041413 | Bacteria | 15978 |
| 785 | Ga0439465_0002208 | 3300041413 | Bacteria | 6377 |
| 786 | Ga0451791_1225265 | 3300041451 | Bacteria | 1068 |
| 787 | Ga0451793_1678246 | 3300041452 | Unclassified | 639 |
| 788 | Ga0451797_0863558 | 3300041453 | Bacteria | 617 |
| 789 | Ga0451795_0384717 | 3300041456 | Bacteria | 850 |
| 790 | Ga0451800_1433977 | 3300041459 | Bacteria | 996 |
| 791 | Ga0451802_1010297 | 3300041460 | Bacteria | 1449 |
| 792 | Ga0451851_1155442 | 3300041507 | Bacteria | 878 |
| 793 | Ga0451853_0039075 | 3300041512 | Bacteria | 1449 |
| 794 | Ga0451853_1468226 | 3300041512 | Bacteria | 1367 |
| 795 | Ga0451853_2687333 | 3300041512 | Bacteria | 1095 |
| 796 | Ga0439431_0001341 | 3300041997 | Bacteria | 5426 |
| 797 | Ga0439433_0000590 | 3300041999 | Bacteria | 6900 |
| 798 | Ga0439442_019855 | 3300042002 | Bacteria | 1392 |
| 799 | Ga0439445_0000167 | 3300042004 | Bacteria | 11641 |
| 800 | Ga0439432_016348 | 3300042006 | Bacteria | 2498 |
| 801 | Ga0439432_211189 | 3300042006 | Bacteria | 561 |
| 802 | Ga0439449_0039405 | 3300042007 | Bacteria | 1756 |
| 803 | Ga0439449_0046631 | 3300042007 | Bacteria | 1605 |
| 804 | Ga0439452_008633 | 3300042010 | Bacteria | 3052 |
| 805 | Ga0450920_125695 | 3300042122 | Bacteria | 539 |
| 806 | Ga0450897_032760 | 3300042128 | Bacteria | 593 |
| 807 | Ga0450898_076471 | 3300042134 | Bacteria | 676 |
| 808 | Ga0439446_0017468 | 3300042156 | Bacteria | 2005 |
| 809 | Ga0450909_007456 | 3300042185 | Bacteria | 1584 |
| 810 | Ga0439434_0000712 | 3300042435 | Bacteria | 9583 |
| 811 | Ga0451577_0004145 | 3300042876 | Bacteria | 15530 |
| 812 | Ga0466963_1146702 | 3300044694 | Unclassified | 546 |
| 813 | Ga0453684_0000039 | 3300044712 | Bacteria | 697730 |
| 814 | Ga0453684_0023646 | 3300044712 | Bacteria | 9031 |
| 815 | Ga0453684_0198610 | 3300044712 | Bacteria | 2340 |
| 816 | Ga0453684_0329636 | 3300044712 | Unclassified | 1726 |
| 817 | Ga0451576_2461799 | 3300045051 | Unclassified | 532 |
| 818 | Ga0495638_0330326 | 3300046460 | Bacteria | 812 |
| 819 | Ga0495580_0159595 | 3300046472 | Bacteria | 1561 |
| 820 | Ga0495582_0084811 | 3300046473 | Bacteria | 1761 |
| 821 | Ga0495585_0342341 | 3300046492 | Unclassified | 728 |
| 822 | Ga0495608_0432898 | 3300046511 | Unclassified | 802 |
| 823 | Ga0495610_0069557 | 3300046512 | Bacteria | 1647 |
| 824 | Ga0495618_0203502 | 3300046514 | Bacteria | 1253 |
| 825 | Ga0495632_0012811 | 3300046519 | Bacteria | 4814 |
| 826 | Ga0495632_0067042 | 3300046519 | Bacteria | 1731 |
| 827 | Ga0495632_0247542 | 3300046519 | Bacteria | 800 |
| 828 | Ga0495598_0267410 | 3300046537 | Bacteria | 638 |
| 829 | Ga0495621_0365042 | 3300046539 | Bacteria | 608 |
| 830 | Ga0495656_0115467 | 3300046615 | Unclassified | 1261 |
| 831 | Ga0495668_0361514 | 3300046616 | Unclassified | 797 |
| 832 | Ga0495668_0462831 | 3300046616 | Unclassified | 698 |
| 833 | Ga0495625_0004683 | 3300046660 | Bacteria | 12847 |
| 834 | Ga0495625_0016141 | 3300046660 | Bacteria | 5884 |
| 835 | Ga0495625_0776219 | 3300046660 | Bacteria | 559 |
| 836 | Ga0495647_0191009 | 3300046681 | Bacteria | 895 |
| 837 | Ga0495658_0185882 | 3300046683 | Bacteria | 1290 |
| 838 | Ga0495658_0213301 | 3300046683 | Bacteria | 1207 |
| 839 | Ga0495679_116250 | 3300047446 | Archaea | 734 |
| 840 | Ga0495673_0181730 | 3300047469 | Bacteria | 796 |
| 841 | Ga0495686_0097614 | 3300047472 | Bacteria | 1776 |
| 842 | Ga0496100_0251681 | 3300048903 | Bacteria | 1307 |
| 843 | Ga0496100_0295744 | 3300048903 | Bacteria | 1211 |
| 844 | Ga0496100_0712000 | 3300048903 | Bacteria | 784 |
| 845 | Ga0496100_1439728 | 3300048903 | Bacteria | 544 |
| 846 | Ga0496101_0034501 | 3300048904 | Bacteria | 3574 |
| 847 | Ga0496101_0150565 | 3300048904 | Bacteria | 1780 |
| 848 | Ga0496101_0784496 | 3300048904 | Bacteria | 751 |
| 849 | Ga0496102_0323085 | 3300048905 | Bacteria | 1454 |
| 850 | Ga0496103_0671372 | 3300048906 | Bacteria | 658 |
| 851 | Ga0496104_0004292 | 3300048907 | Bacteria | 12392 |
| 852 | Ga0496104_0057193 | 3300048907 | Bacteria | 3690 |
| 853 | Ga0496104_0199685 | 3300048907 | Bacteria | 1912 |
| 854 | Ga0496104_0489401 | 3300048907 | Bacteria | 1141 |
| 855 | Ga0496104_0720424 | 3300048907 | Bacteria | 905 |
| 856 | Ga0496105_0107660 | 3300048908 | Bacteria | 2301 |
| 857 | Ga0496106_0219399 | 3300048909 | Bacteria | 1516 |
| 858 | Ga0496106_0240449 | 3300048909 | Bacteria | 1447 |
| 859 | Ga0496106_0428171 | 3300048909 | Bacteria | 1063 |
| 860 | Ga0496107_0079878 | 3300048910 | Bacteria | 2385 |
| 861 | Ga0496108_0005708 | 3300048911 | Bacteria | 10075 |
| 862 | Ga0496108_0067785 | 3300048911 | Bacteria | 3010 |
| 863 | Ga0496108_0256375 | 3300048911 | Bacteria | 1522 |
| 864 | Ga0496108_0512151 | 3300048911 | Bacteria | 1048 |
| 865 | Ga0496108_0831898 | 3300048911 | Bacteria | 795 |
| 866 | Ga0496109_0008725 | 3300048912 | Bacteria | 8630 |
| 867 | Ga0496109_0056385 | 3300048912 | Bacteria | 3586 |
| 868 | Ga0496109_1069882 | 3300048912 | Unclassified | 744 |
| 869 | Ga0496110_0353976 | 3300048913 | Bacteria | 1338 |
| 870 | Ga0496110_0360864 | 3300048913 | Bacteria | 1324 |
| 871 | Ga0496110_0936536 | 3300048913 | Bacteria | 773 |
| 872 | Ga0496111_0114173 | 3300048914 | Bacteria | 1991 |
| 873 | Ga0496111_0456751 | 3300048914 | Bacteria | 942 |
| 874 | Ga0496111_0771821 | 3300048914 | Bacteria | 697 |
| 875 | Ga0496112_0214172 | 3300048915 | Bacteria | 1883 |
| 876 | Ga0496112_0259752 | 3300048915 | Bacteria | 1686 |
| 877 | Ga0496112_0603738 | 3300048915 | Bacteria | 1029 |
| 878 | Ga0496112_0698379 | 3300048915 | Bacteria | 942 |
| 879 | Ga0496113_0151283 | 3300048916 | Bacteria | 1831 |
| 880 | Ga0496113_0238281 | 3300048916 | Bacteria | 1451 |
| 881 | Ga0496113_0240023 | 3300048916 | Bacteria | 1446 |
| 882 | Ga0496114_0422860 | 3300048917 | Bacteria | 1180 |
| 883 | Ga0496114_0714958 | 3300048917 | Unclassified | 878 |
| 884 | Ga0496115_0243135 | 3300048918 | Bacteria | 1483 |
| 885 | Ga0496115_0737112 | 3300048918 | Bacteria | 772 |
| 886 | Ga0496119_0151588 | 3300048922 | Bacteria | 1242 |
| 887 | Ga0501292_004192 | 3300049515 | Bacteria | 1960 |
| 888 | Ga0501298_119148 | 3300049521 | Bacteria | 620 |
| 889 | Ga0501303_006056 | 3300049526 | Bacteria | 1047 |
| 890 | Ga0501034_0000487 | 3300049571 | Bacteria | 64548 |
| 891 | Ga0501034_0008360 | 3300049571 | Bacteria | 10945 |
| 892 | Ga0501048_0158019 | 3300049582 | Unclassified | 1604 |
| 893 | Ga0501069_0016511 | 3300049585 | Bacteria | 3966 |
| 894 | Ga0501072_0029917 | 3300049588 | Bacteria | 4255 |
| 895 | Ga0501072_0417538 | 3300049588 | Bacteria | 1064 |
| 896 | Ga0501073_0419239 | 3300049589 | Bacteria | 925 |
| 897 | Ga0501074_0220870 | 3300049590 | Bacteria | 1349 |
| 898 | Ga0501077_0549707 | 3300049593 | Bacteria | 741 |
| 899 | Ga0501238_030630 | 3300049671 | Bacteria | 777 |
| 900 | Ga0501252_064573 | 3300049682 | Bacteria | 579 |
| 901 | Ga0501257_029363 | 3300049686 | Bacteria | 1321 |
| 902 | Ga0501080_0370665 | 3300049742 | Bacteria | 1291 |
| 903 | Ga0501083_0059628 | 3300049744 | Bacteria | 2552 |
| 904 | Ga0501083_0417993 | 3300049744 | Bacteria | 872 |
| 905 | Ga0501241_030233 | 3300049758 | Unclassified | 1022 |
| 906 | Ga0501265_012248 | 3300049762 | Bacteria | 1066 |
| 907 | nmdc:mga00v17_460736_c1 | 3300050491 | Unclassified | 825 |
| 908 | nmdc:mga0k408_131819_c1 | 3300050493 | Bacteria | 1484 |
| 909 | nmdc:mga0k408_29009_c1 | 3300050493 | Bacteria | 3148 |
| 910 | nmdc:mga0k408_38329_c1 | 3300050493 | Bacteria | 2751 |
| 911 | nmdc:mga0k408_83997_c1 | 3300050493 | Bacteria | 1545 |
| 912 | nmdc:mga06z11_87728_c1 | 3300050494 | Bacteria | 1683 |
| 913 | nmdc:mga07m45_196928_c1 | 3300050496 | Bacteria | 1172 |
| 914 | nmdc:mga07m45_735693_c1 | 3300050496 | Unclassified | 567 |
| 915 | nmdc:mga09592_1072740_c1 | 3300050508 | Unclassified | 670 |
| 916 | nmdc:mga0qj67_276973_c1 | 3300050509 | Unclassified | 1360 |
| 917 | nmdc:mga06r32_1554084_c1 | 3300050510 | Bacteria | 601 |
| 918 | nmdc:mga06r32_245325_c1 | 3300050510 | Bacteria | 1778 |
| 919 | nmdc:mga06r32_509301_c1 | 3300050510 | Bacteria | 1180 |
| 920 | nmdc:mga08y16_125428_c1 | 3300050511 | Bacteria | 2671 |
| 921 | nmdc:mga08y16_406415_c1 | 3300050511 | Bacteria | 1393 |
| 922 | nmdc:mga0n895_687279_c1 | 3300050512 | Bacteria | 1020 |
| 923 | nmdc:mga0rr50_671024_c1 | 3300050513 | Bacteria | 884 |
| 924 | nmdc:mga0a205_158727_c1 | 3300050515 | Bacteria | 2159 |
| 925 | nmdc:mga0a205_849353_c1 | 3300050515 | Unclassified | 760 |
| 926 | nmdc:mga0sz30_245696_c1 | 3300050516 | Unclassified | 797 |
| 927 | Ga0495601_0565859 | 3300053077 | Unclassified | 731 |
| 928 | Ga0500644_0037342 | 3300053088 | Bacteria | 1587 |
| 929 | Ga0500621_231062 | 3300053126 | Bacteria | 634 |
| 930 | Ga0500658_0039635 | 3300053134 | Bacteria | 1884 |
| 931 | Ga0500559_0075454 | 3300053136 | Bacteria | 1525 |
| 932 | Ga0500568_0109976 | 3300053139 | Bacteria | 1030 |
| 933 | Ga0500587_023225 | 3300053739 | Bacteria | 818 |
| 934 | Ga0530510_0009843 | 3300061734 | Bacteria | 6708 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045051 | Ga0451576_2461799 | Ga0451576_2461799_47_349 | 99 |
| 2 | 3300005549 | Ga0070704_100112443 | Ga0070704_1001124432 | 113 |
| 3 | 3300006880 | Ga0075429_100476477 | Ga0075429_1004764772 | 113 |
| 4 | 3300005331 | Ga0070670_100701832 | Ga0070670_1007018322 | 114 |
| 5 | 3300005344 | Ga0070661_101129301 | Ga0070661_1011293012 | 114 |
| 6 | 3300005345 | Ga0070692_10893209 | Ga0070692_108932092 | 114 |
| 7 | 3300005354 | Ga0070675_101726012 | Ga0070675_1017260121 | 114 |
| 8 | 3300005444 | Ga0070694_101293086 | Ga0070694_1012930862 | 114 |
| 9 | 3300005455 | Ga0070663_101616042 | Ga0070663_1016160421 | 114 |
| 10 | 3300005466 | Ga0070685_10174741 | Ga0070685_101747412 | 114 |
| 11 | 3300005466 | Ga0070685_10577612 | Ga0070685_105776121 | 114 |
| 12 | 3300005518 | Ga0070699_100312743 | Ga0070699_1003127431 | 114 |
| 13 | 3300005564 | Ga0070664_100605156 | Ga0070664_1006051562 | 114 |
| 14 | 3300005577 | Ga0068857_100506414 | Ga0068857_1005064142 | 114 |
| 15 | 3300005615 | Ga0070702_100023630 | Ga0070702_1000236303 | 114 |
| 16 | 3300005617 | Ga0068859_102700753 | Ga0068859_1027007531 | 114 |
| 17 | 3300005618 | Ga0068864_100377884 | Ga0068864_1003778843 | 114 |
| 18 | 3300005718 | Ga0068866_10234648 | Ga0068866_102346482 | 114 |
| 19 | 3300005841 | Ga0068863_101332415 | Ga0068863_1013324152 | 114 |
| 20 | 3300005842 | Ga0068858_100633933 | Ga0068858_1006339331 | 114 |
| 21 | 3300005844 | Ga0068862_100375363 | Ga0068862_1003753633 | 114 |
| 22 | 3300006358 | Ga0068871_100845094 | Ga0068871_1008450942 | 114 |
| 23 | 3300006871 | Ga0075434_100330807 | Ga0075434_1003308073 | 114 |
| 24 | 3300006881 | Ga0068865_100380475 | Ga0068865_1003804752 | 114 |
| 25 | 3300006931 | Ga0097620_102700850 | Ga0097620_1027008502 | 114 |
| 26 | 3300009011 | Ga0105251_10456859 | Ga0105251_104568592 | 114 |
| 27 | 3300009094 | Ga0111539_10014384 | Ga0111539_100143848 | 114 |
| 28 | 3300009098 | Ga0105245_10048092 | Ga0105245_100480924 | 114 |
| 29 | 3300009098 | Ga0105245_11049290 | Ga0105245_110492903 | 114 |
| 30 | 3300009101 | Ga0105247_10240647 | Ga0105247_102406472 | 114 |
| 31 | 3300009148 | Ga0105243_10801532 | Ga0105243_108015322 | 114 |
| 32 | 3300009148 | Ga0105243_10845137 | Ga0105243_108451372 | 114 |
| 33 | 3300009176 | Ga0105242_10233422 | Ga0105242_102334223 | 114 |
| 34 | 3300009177 | Ga0105248_10270503 | Ga0105248_102705033 | 114 |
| 35 | 3300009177 | Ga0105248_11225207 | Ga0105248_112252072 | 114 |
| 36 | 3300009553 | Ga0105249_10872399 | Ga0105249_108723992 | 114 |
| 37 | 3300009553 | Ga0105249_11639595 | Ga0105249_116395952 | 114 |
| 38 | 3300010375 | Ga0105239_10586538 | Ga0105239_105865382 | 114 |
| 39 | 3300010375 | Ga0105239_11384705 | Ga0105239_113847052 | 114 |
| 40 | 3300011119 | Ga0105246_10362226 | Ga0105246_103622262 | 114 |
| 41 | 3300013297 | Ga0157378_10106460 | Ga0157378_101064603 | 114 |
| 42 | 3300013306 | Ga0163162_11248506 | Ga0163162_112485062 | 114 |
| 43 | 3300013308 | Ga0157375_10161094 | Ga0157375_101610941 | 114 |
| 44 | 3300014325 | Ga0163163_10021449 | Ga0163163_100214496 | 114 |
| 45 | 3300014325 | Ga0163163_10037639 | Ga0163163_100376393 | 114 |
| 46 | 3300014325 | Ga0163163_10124708 | Ga0163163_101247082 | 114 |
| 47 | 3300014325 | Ga0163163_10252688 | Ga0163163_102526883 | 114 |
| 48 | 3300014325 | Ga0163163_11207725 | Ga0163163_112077251 | 114 |
| 49 | 3300014326 | Ga0157380_10032589 | Ga0157380_100325896 | 114 |
| 50 | 3300014326 | Ga0157380_10467604 | Ga0157380_104676042 | 114 |
| 51 | 3300014968 | Ga0157379_10506164 | Ga0157379_105061642 | 114 |
| 52 | 3300014969 | Ga0157376_10895325 | Ga0157376_108953252 | 114 |
| 53 | 3300014969 | Ga0157376_11734379 | Ga0157376_117343792 | 114 |
| 54 | 3300014969 | Ga0157376_11922364 | Ga0157376_119223642 | 114 |
| 55 | 3300017792 | Ga0163161_12024222 | Ga0163161_120242221 | 114 |
| 56 | 3300025926 | Ga0207659_10996802 | Ga0207659_109968021 | 114 |
| 57 | 3300025927 | Ga0207687_10970987 | Ga0207687_109709872 | 114 |
| 58 | 3300025934 | Ga0207686_10099083 | Ga0207686_100990832 | 114 |
| 59 | 3300025938 | Ga0207704_10693640 | Ga0207704_106936402 | 114 |
| 60 | 3300025944 | Ga0207661_10456935 | Ga0207661_104569352 | 114 |
| 61 | 3300025945 | Ga0207679_11861771 | Ga0207679_118617711 | 114 |
| 62 | 3300025972 | Ga0207668_10647254 | Ga0207668_106472542 | 114 |
| 63 | 3300025972 | Ga0207668_11375652 | Ga0207668_113756522 | 114 |
| 64 | 3300026023 | Ga0207677_10411035 | Ga0207677_104110352 | 114 |
| 65 | 3300026035 | Ga0207703_11119581 | Ga0207703_111195812 | 114 |
| 66 | 3300026095 | Ga0207676_10068447 | Ga0207676_100684473 | 114 |
| 67 | 3300026095 | Ga0207676_10301302 | Ga0207676_103013022 | 114 |
| 68 | 3300026116 | Ga0207674_10368055 | Ga0207674_103680552 | 114 |
| 69 | 3300026116 | Ga0207674_11433263 | Ga0207674_114332632 | 114 |
| 70 | 3300028380 | Ga0268265_10433938 | Ga0268265_104339382 | 114 |
| 71 | 3300032126 | Ga0307415_100728098 | Ga0307415_1007280982 | 114 |
| 72 | 3300035085 | Ga0373929_0034657 | Ga0373929_0034657_162_521 | 114 |
| 73 | 3300035242 | Ga0373962_0079264 | Ga0373962_0079264_73_432 | 114 |
| 74 | 3300041452 | Ga0451793_1678246 | Ga0451793_1678246_261_626 | 114 |
| 75 | 3300041512 | Ga0451853_0039075 | Ga0451853_0039075_98_442 | 114 |
| 76 | 3300041512 | Ga0451853_1468226 | Ga0451853_1468226_211_576 | 114 |
| 77 | 3300042122 | Ga0450920_125695 | Ga0450920_125695_145_510 | 114 |
| 78 | 3300044712 | Ga0453684_0023646 | Ga0453684_0023646_5300_5671 | 114 |
| 79 | 3300044712 | Ga0453684_0329636 | Ga0453684_0329636_1071_1442 | 114 |
| 80 | 3300048903 | Ga0496100_0712000 | Ga0496100_0712000_301_663 | 114 |
| 81 | 3300048904 | Ga0496101_0150565 | Ga0496101_0150565_1133_1492 | 114 |
| 82 | 3300048904 | Ga0496101_0784496 | Ga0496101_0784496_228_590 | 114 |
| 83 | 3300048907 | Ga0496104_0057193 | Ga0496104_0057193_96_458 | 114 |
| 84 | 3300048908 | Ga0496105_0107660 | Ga0496105_0107660_419_781 | 114 |
| 85 | 3300048909 | Ga0496106_0240449 | Ga0496106_0240449_842_1204 | 114 |
| 86 | 3300048909 | Ga0496106_0428171 | Ga0496106_0428171_194_553 | 114 |
| 87 | 3300048911 | Ga0496108_0067785 | Ga0496108_0067785_395_754 | 114 |
| 88 | 3300048911 | Ga0496108_0256375 | Ga0496108_0256375_690_1052 | 114 |
| 89 | 3300048911 | Ga0496108_0512151 | Ga0496108_0512151_530_898 | 114 |
| 90 | 3300048911 | Ga0496108_0831898 | Ga0496108_0831898_165_530 | 114 |
| 91 | 3300048912 | Ga0496109_1069882 | Ga0496109_1069882_354_713 | 114 |
| 92 | 3300048913 | Ga0496110_0353976 | Ga0496110_0353976_780_1142 | 114 |
| 93 | 3300048913 | Ga0496110_0936536 | Ga0496110_0936536_367_732 | 114 |
| 94 | 3300048914 | Ga0496111_0114173 | Ga0496111_0114173_1006_1368 | 114 |
| 95 | 3300048914 | Ga0496111_0771821 | Ga0496111_0771821_14_379 | 114 |
| 96 | 3300048915 | Ga0496112_0214172 | Ga0496112_0214172_199_564 | 114 |
| 97 | 3300048915 | Ga0496112_0698379 | Ga0496112_0698379_131_493 | 114 |
| 98 | 3300048916 | Ga0496113_0151283 | Ga0496113_0151283_199_558 | 114 |
| 99 | 3300048916 | Ga0496113_0238281 | Ga0496113_0238281_690_1052 | 114 |
| 100 | 3300048917 | Ga0496114_0422860 | Ga0496114_0422860_525_887 | 114 |
| 101 | 3300049588 | Ga0501072_0417538 | Ga0501072_0417538_391_750 | 114 |
| 102 | 3300049590 | Ga0501074_0220870 | Ga0501074_0220870_489_848 | 114 |
| 103 | 3300049593 | Ga0501077_0549707 | Ga0501077_0549707_38_397 | 114 |
| 104 | 3300050511 | nmdc:mga08y16_406415_c1 | nmdc:mga08y16_406415_c1_142_501 | 114 |
| 105 | 3300050512 | nmdc:mga0n895_687279_c1 | nmdc:mga0n895_687279_c1_227_586 | 114 |
| 106 | 3300050515 | nmdc:mga0a205_158727_c1 | nmdc:mga0a205_158727_c1_784_1143 | 114 |
| 107 | 3300005328 | Ga0070676_10029108 | Ga0070676_100291083 | 115 |
| 108 | 3300005330 | Ga0070690_101543337 | Ga0070690_1015433371 | 115 |
| 109 | 3300005334 | Ga0068869_100005806 | Ga0068869_1000058062 | 115 |
| 110 | 3300005338 | Ga0068868_100038587 | Ga0068868_1000385873 | 115 |
| 111 | 3300005340 | Ga0070689_100729463 | Ga0070689_1007294631 | 115 |
| 112 | 3300005344 | Ga0070661_100274125 | Ga0070661_1002741252 | 115 |
| 113 | 3300005355 | Ga0070671_100350404 | Ga0070671_1003504042 | 115 |
| 114 | 3300005364 | Ga0070673_100089944 | Ga0070673_1000899443 | 115 |
| 115 | 3300005441 | Ga0070700_100970225 | Ga0070700_1009702252 | 115 |
| 116 | 3300005455 | Ga0070663_100636538 | Ga0070663_1006365381 | 115 |
| 117 | 3300005457 | Ga0070662_100172098 | Ga0070662_1001720982 | 115 |
| 118 | 3300005459 | Ga0068867_100115762 | Ga0068867_1001157622 | 115 |
| 119 | 3300005539 | Ga0068853_100432240 | Ga0068853_1004322401 | 115 |
| 120 | 3300005564 | Ga0070664_100136405 | Ga0070664_1001364052 | 115 |
| 121 | 3300005577 | Ga0068857_100859152 | Ga0068857_1008591522 | 115 |
| 122 | 3300005578 | Ga0068854_100036744 | Ga0068854_1000367443 | 115 |
| 123 | 3300005617 | Ga0068859_100150650 | Ga0068859_1001506504 | 115 |
| 124 | 3300005718 | Ga0068866_10617304 | Ga0068866_106173041 | 115 |
| 125 | 3300005841 | Ga0068863_100046831 | Ga0068863_1000468312 | 115 |
| 126 | 3300005842 | Ga0068858_101744089 | Ga0068858_1017440892 | 115 |
| 127 | 3300005844 | Ga0068862_100723219 | Ga0068862_1007232192 | 115 |
| 128 | 3300006881 | Ga0068865_100548854 | Ga0068865_1005488542 | 115 |
| 129 | 3300006931 | Ga0097620_100150662 | Ga0097620_1001506624 | 115 |
| 130 | 3300009174 | Ga0105241_11747639 | Ga0105241_117476392 | 115 |
| 131 | 3300009176 | Ga0105242_10732124 | Ga0105242_107321241 | 115 |
| 132 | 3300010375 | Ga0105239_12112242 | Ga0105239_121122422 | 115 |
| 133 | 3300013102 | Ga0157371_10821186 | Ga0157371_108211862 | 115 |
| 134 | 3300013297 | Ga0157378_10057347 | Ga0157378_100573473 | 115 |
| 135 | 3300013297 | Ga0157378_10129141 | Ga0157378_101291413 | 115 |
| 136 | 3300013306 | Ga0163162_10010455 | Ga0163162_100104553 | 115 |
| 137 | 3300013306 | Ga0163162_10228430 | Ga0163162_102284304 | 115 |
| 138 | 3300013307 | Ga0157372_10685374 | Ga0157372_106853742 | 115 |
| 139 | 3300013308 | Ga0157375_10066469 | Ga0157375_100664693 | 115 |
| 140 | 3300014968 | Ga0157379_10314365 | Ga0157379_103143653 | 115 |
| 141 | 3300014968 | Ga0157379_11100465 | Ga0157379_111004652 | 115 |
| 142 | 3300014969 | Ga0157376_11794174 | Ga0157376_117941741 | 115 |
| 143 | 3300017792 | Ga0163161_10605122 | Ga0163161_106051222 | 115 |
| 144 | 3300025899 | Ga0207642_10645851 | Ga0207642_106458511 | 115 |
| 145 | 3300025901 | Ga0207688_10930532 | Ga0207688_109305322 | 115 |
| 146 | 3300025907 | Ga0207645_10046224 | Ga0207645_100462243 | 115 |
| 147 | 3300025920 | Ga0207649_11194787 | Ga0207649_111947872 | 115 |
| 148 | 3300025923 | Ga0207681_10098123 | Ga0207681_100981232 | 115 |
| 149 | 3300025931 | Ga0207644_10444615 | Ga0207644_104446151 | 115 |
| 150 | 3300025933 | Ga0207706_10154534 | Ga0207706_101545342 | 115 |
| 151 | 3300025942 | Ga0207689_10001600 | Ga0207689_100016006 | 115 |
| 152 | 3300025944 | Ga0207661_10711611 | Ga0207661_107116112 | 115 |
| 153 | 3300025945 | Ga0207679_10258257 | Ga0207679_102582573 | 115 |
| 154 | 3300025986 | Ga0207658_10194728 | Ga0207658_101947282 | 115 |
| 155 | 3300026041 | Ga0207639_10286459 | Ga0207639_102864594 | 115 |
| 156 | 3300026075 | Ga0207708_10411284 | Ga0207708_104112842 | 115 |
| 157 | 3300026089 | Ga0207648_10031490 | Ga0207648_100314902 | 115 |
| 158 | 3300005331 | Ga0070670_100014482 | Ga0070670_10001448211 | 116 |
| 159 | 3300005333 | Ga0070677_10261781 | Ga0070677_102617811 | 116 |
| 160 | 3300005334 | Ga0068869_100225440 | Ga0068869_1002254402 | 116 |
| 161 | 3300005334 | Ga0068869_101018432 | Ga0068869_1010184322 | 116 |
| 162 | 3300005337 | Ga0070682_100034568 | Ga0070682_1000345683 | 116 |
| 163 | 3300005353 | Ga0070669_100608776 | Ga0070669_1006087762 | 116 |
| 164 | 3300005355 | Ga0070671_100224904 | Ga0070671_1002249041 | 116 |
| 165 | 3300005366 | Ga0070659_100273229 | Ga0070659_1002732293 | 116 |
| 166 | 3300005367 | Ga0070667_100605824 | Ga0070667_1006058242 | 116 |
| 167 | 3300005367 | Ga0070667_100785874 | Ga0070667_1007858742 | 116 |
| 168 | 3300005441 | Ga0070700_100012034 | Ga0070700_1000120343 | 116 |
| 169 | 3300005444 | Ga0070694_100003464 | Ga0070694_1000034643 | 116 |
| 170 | 3300005459 | Ga0068867_100000607 | Ga0068867_10000060710 | 116 |
| 171 | 3300005539 | Ga0068853_100804414 | Ga0068853_1008044142 | 116 |
| 172 | 3300005578 | Ga0068854_100128176 | Ga0068854_1001281764 | 116 |
| 173 | 3300005617 | Ga0068859_100429086 | Ga0068859_1004290862 | 116 |
| 174 | 3300005718 | Ga0068866_10004418 | Ga0068866_1000441810 | 116 |
| 175 | 3300005719 | Ga0068861_100028714 | Ga0068861_1000287148 | 116 |
| 176 | 3300005841 | Ga0068863_102287269 | Ga0068863_1022872692 | 116 |
| 177 | 3300005842 | Ga0068858_100293938 | Ga0068858_1002939383 | 116 |
| 178 | 3300005843 | Ga0068860_100000807 | Ga0068860_10000080726 | 116 |
| 179 | 3300005844 | Ga0068862_100025990 | Ga0068862_1000259906 | 116 |
| 180 | 3300006237 | Ga0097621_101615824 | Ga0097621_1016158241 | 116 |
| 181 | 3300006852 | Ga0075433_11211947 | Ga0075433_112119471 | 116 |
| 182 | 3300006931 | Ga0097620_100429138 | Ga0097620_1004291382 | 116 |
| 183 | 3300009093 | Ga0105240_10007439 | Ga0105240_1000743914 | 116 |
| 184 | 3300009093 | Ga0105240_10013447 | Ga0105240_100134476 | 116 |
| 185 | 3300009148 | Ga0105243_10570986 | Ga0105243_105709861 | 116 |
| 186 | 3300009174 | Ga0105241_10306870 | Ga0105241_103068702 | 116 |
| 187 | 3300009545 | Ga0105237_10003127 | Ga0105237_100031278 | 116 |
| 188 | 3300009545 | Ga0105237_10124293 | Ga0105237_101242934 | 116 |
| 189 | 3300009551 | Ga0105238_10002427 | Ga0105238_1000242714 | 116 |
| 190 | 3300009553 | Ga0105249_10001772 | Ga0105249_1000177214 | 116 |
| 191 | 3300010375 | Ga0105239_10021540 | Ga0105239_100215408 | 116 |
| 192 | 3300010375 | Ga0105239_10176568 | Ga0105239_101765682 | 116 |
| 193 | 3300013104 | Ga0157370_10002445 | Ga0157370_1000244522 | 116 |
| 194 | 3300013105 | Ga0157369_10010660 | Ga0157369_100106602 | 116 |
| 195 | 3300013297 | Ga0157378_10002215 | Ga0157378_1000221525 | 116 |
| 196 | 3300013306 | Ga0163162_10003082 | Ga0163162_1000308215 | 116 |
| 197 | 3300013307 | Ga0157372_10000656 | Ga0157372_1000065616 | 116 |
| 198 | 3300013307 | Ga0157372_10158348 | Ga0157372_101583482 | 116 |
| 199 | 3300013308 | Ga0157375_11326942 | Ga0157375_113269422 | 116 |
| 200 | 3300014326 | Ga0157380_10292688 | Ga0157380_102926882 | 116 |
| 201 | 3300014326 | Ga0157380_11669786 | Ga0157380_116697862 | 116 |
| 202 | 3300014968 | Ga0157379_10020519 | Ga0157379_1002051911 | 116 |
| 203 | 3300014969 | Ga0157376_10147511 | Ga0157376_101475111 | 116 |
| 204 | 3300021384 | Ga0213876_10143140 | Ga0213876_101431402 | 116 |
| 205 | 3300025899 | Ga0207642_10046203 | Ga0207642_100462032 | 116 |
| 206 | 3300025907 | Ga0207645_10421765 | Ga0207645_104217652 | 116 |
| 207 | 3300025912 | Ga0207707_11336623 | Ga0207707_113366232 | 116 |
| 208 | 3300025918 | Ga0207662_10539827 | Ga0207662_105398272 | 116 |
| 209 | 3300025925 | Ga0207650_10041245 | Ga0207650_100412455 | 116 |
| 210 | 3300025933 | Ga0207706_10097186 | Ga0207706_100971864 | 116 |
| 211 | 3300025935 | Ga0207709_10486832 | Ga0207709_104868322 | 116 |
| 212 | 3300025938 | Ga0207704_10025570 | Ga0207704_100255706 | 116 |
| 213 | 3300025942 | Ga0207689_10142695 | Ga0207689_101426953 | 116 |
| 214 | 3300025942 | Ga0207689_10941790 | Ga0207689_109417902 | 116 |
| 215 | 3300025961 | Ga0207712_10013240 | Ga0207712_100132408 | 116 |
| 216 | 3300025986 | Ga0207658_10042515 | Ga0207658_100425156 | 116 |
| 217 | 3300025986 | Ga0207658_10346714 | Ga0207658_103467142 | 116 |
| 218 | 3300026023 | Ga0207677_10577116 | Ga0207677_105771161 | 116 |
| 219 | 3300026041 | Ga0207639_10400305 | Ga0207639_104003052 | 116 |
| 220 | 3300026075 | Ga0207708_10020126 | Ga0207708_100201264 | 116 |
| 221 | 3300026089 | Ga0207648_10000491 | Ga0207648_1000049146 | 116 |
| 222 | 3300026118 | Ga0207675_100250736 | Ga0207675_1002507363 | 116 |
| 223 | 3300028380 | Ga0268265_10047352 | Ga0268265_100473521 | 116 |
| 224 | 3300028381 | Ga0268264_10005327 | Ga0268264_100053278 | 116 |
| 225 | 3300028381 | Ga0268264_10342856 | Ga0268264_103428562 | 116 |
| 226 | 3300031852 | Ga0307410_10158797 | Ga0307410_101587972 | 116 |
| 227 | 3300039437 | Ga0436365_1894678 | Ga0436365_1894678_22223_22618 | 116 |
| 228 | 3300041459 | Ga0451800_1433977 | Ga0451800_1433977_241_603 | 116 |
| 229 | 3300042128 | Ga0450897_032760 | Ga0450897_032760_119_481 | 116 |
| 230 | 3300042134 | Ga0450898_076471 | Ga0450898_076471_193_555 | 116 |
| 231 | 3300046460 | Ga0495638_0330326 | Ga0495638_0330326_375_737 | 116 |
| 232 | 3300046519 | Ga0495632_0067042 | Ga0495632_0067042_141_503 | 116 |
| 233 | 3300046660 | Ga0495625_0016141 | Ga0495625_0016141_2807_3169 | 116 |
| 234 | 3300049758 | Ga0501241_030233 | Ga0501241_030233_95_457 | 116 |
| 235 | 3300003316 | rootH1_10013630 | rootH1_100136304 | 117 |
| 236 | 3300003322 | rootL2_10012244 | rootL2_100122442 | 117 |
| 237 | 3300003323 | rootH1_10048311 | rootH1_100483113 | 117 |
| 238 | 3300005295 | Ga0065707_10267991 | Ga0065707_102679912 | 117 |
| 239 | 3300005328 | Ga0070676_10717149 | Ga0070676_107171492 | 117 |
| 240 | 3300005330 | Ga0070690_100003391 | Ga0070690_1000033913 | 117 |
| 241 | 3300005334 | Ga0068869_100000783 | Ga0068869_10000078320 | 117 |
| 242 | 3300005334 | Ga0068869_100046545 | Ga0068869_1000465454 | 117 |
| 243 | 3300005334 | Ga0068869_100057682 | Ga0068869_1000576823 | 117 |
| 244 | 3300005335 | Ga0070666_10013641 | Ga0070666_100136414 | 117 |
| 245 | 3300005335 | Ga0070666_10838080 | Ga0070666_108380801 | 117 |
| 246 | 3300005336 | Ga0070680_100078898 | Ga0070680_1000788983 | 117 |
| 247 | 3300005337 | Ga0070682_100128736 | Ga0070682_1001287362 | 117 |
| 248 | 3300005338 | Ga0068868_100392398 | Ga0068868_1003923983 | 117 |
| 249 | 3300005339 | Ga0070660_101037396 | Ga0070660_1010373961 | 117 |
| 250 | 3300005340 | Ga0070689_100004027 | Ga0070689_1000040278 | 117 |
| 251 | 3300005340 | Ga0070689_100004215 | Ga0070689_1000042159 | 117 |
| 252 | 3300005343 | Ga0070687_100028089 | Ga0070687_1000280892 | 117 |
| 253 | 3300005345 | Ga0070692_10052322 | Ga0070692_100523223 | 117 |
| 254 | 3300005347 | Ga0070668_100740046 | Ga0070668_1007400461 | 117 |
| 255 | 3300005353 | Ga0070669_100732150 | Ga0070669_1007321502 | 117 |
| 256 | 3300005354 | Ga0070675_100387504 | Ga0070675_1003875042 | 117 |
| 257 | 3300005354 | Ga0070675_100819081 | Ga0070675_1008190811 | 117 |
| 258 | 3300005354 | Ga0070675_101277372 | Ga0070675_1012773721 | 117 |
| 259 | 3300005356 | Ga0070674_100017744 | Ga0070674_1000177442 | 117 |
| 260 | 3300005356 | Ga0070674_100063485 | Ga0070674_1000634852 | 117 |
| 261 | 3300005364 | Ga0070673_100151412 | Ga0070673_1001514122 | 117 |
| 262 | 3300005365 | Ga0070688_100113529 | Ga0070688_1001135292 | 117 |
| 263 | 3300005365 | Ga0070688_100670577 | Ga0070688_1006705771 | 117 |
| 264 | 3300005365 | Ga0070688_100938259 | Ga0070688_1009382591 | 117 |
| 265 | 3300005366 | Ga0070659_100230223 | Ga0070659_1002302232 | 117 |
| 266 | 3300005367 | Ga0070667_100112120 | Ga0070667_1001121202 | 117 |
| 267 | 3300005434 | Ga0070709_10169849 | Ga0070709_101698491 | 117 |
| 268 | 3300005436 | Ga0070713_100304050 | Ga0070713_1003040501 | 117 |
| 269 | 3300005438 | Ga0070701_10028952 | Ga0070701_100289523 | 117 |
| 270 | 3300005438 | Ga0070701_10615016 | Ga0070701_106150161 | 117 |
| 271 | 3300005440 | Ga0070705_100019887 | Ga0070705_1000198874 | 117 |
| 272 | 3300005440 | Ga0070705_100135379 | Ga0070705_1001353791 | 117 |
| 273 | 3300005441 | Ga0070700_100001744 | Ga0070700_10000174411 | 117 |
| 274 | 3300005444 | Ga0070694_100039481 | Ga0070694_1000394812 | 117 |
| 275 | 3300005444 | Ga0070694_100214808 | Ga0070694_1002148082 | 117 |
| 276 | 3300005445 | Ga0070708_100148228 | Ga0070708_1001482282 | 117 |
| 277 | 3300005445 | Ga0070708_100449583 | Ga0070708_1004495832 | 117 |
| 278 | 3300005455 | Ga0070663_100110139 | Ga0070663_1001101392 | 117 |
| 279 | 3300005455 | Ga0070663_100915633 | Ga0070663_1009156332 | 117 |
| 280 | 3300005455 | Ga0070663_101034958 | Ga0070663_1010349581 | 117 |
| 281 | 3300005456 | Ga0070678_100002589 | Ga0070678_1000025897 | 117 |
| 282 | 3300005456 | Ga0070678_100328002 | Ga0070678_1003280022 | 117 |
| 283 | 3300005456 | Ga0070678_100712084 | Ga0070678_1007120841 | 117 |
| 284 | 3300005457 | Ga0070662_100016182 | Ga0070662_1000161824 | 117 |
| 285 | 3300005457 | Ga0070662_100104949 | Ga0070662_1001049492 | 117 |
| 286 | 3300005458 | Ga0070681_10007435 | Ga0070681_100074355 | 117 |
| 287 | 3300005459 | Ga0068867_100016935 | Ga0068867_1000169354 | 117 |
| 288 | 3300005459 | Ga0068867_100052765 | Ga0068867_1000527653 | 117 |
| 289 | 3300005459 | Ga0068867_100075645 | Ga0068867_1000756454 | 117 |
| 290 | 3300005459 | Ga0068867_100105147 | Ga0068867_1001051472 | 117 |
| 291 | 3300005459 | Ga0068867_100270765 | Ga0068867_1002707652 | 117 |
| 292 | 3300005459 | Ga0068867_100907994 | Ga0068867_1009079942 | 117 |
| 293 | 3300005466 | Ga0070685_10022874 | Ga0070685_100228744 | 117 |
| 294 | 3300005466 | Ga0070685_10031471 | Ga0070685_100314712 | 117 |
| 295 | 3300005467 | Ga0070706_100086631 | Ga0070706_1000866313 | 117 |
| 296 | 3300005471 | Ga0070698_100055650 | Ga0070698_1000556504 | 117 |
| 297 | 3300005471 | Ga0070698_101172933 | Ga0070698_1011729332 | 117 |
| 298 | 3300005530 | Ga0070679_101161245 | Ga0070679_1011612451 | 117 |
| 299 | 3300005539 | Ga0068853_100006426 | Ga0068853_1000064265 | 117 |
| 300 | 3300005539 | Ga0068853_100193406 | Ga0068853_1001934063 | 117 |
| 301 | 3300005539 | Ga0068853_100279128 | Ga0068853_1002791282 | 117 |
| 302 | 3300005543 | Ga0070672_101069505 | Ga0070672_1010695052 | 117 |
| 303 | 3300005544 | Ga0070686_100043769 | Ga0070686_1000437693 | 117 |
| 304 | 3300005544 | Ga0070686_100248248 | Ga0070686_1002482482 | 117 |
| 305 | 3300005544 | Ga0070686_100594612 | Ga0070686_1005946122 | 117 |
| 306 | 3300005545 | Ga0070695_100073268 | Ga0070695_1000732682 | 117 |
| 307 | 3300005545 | Ga0070695_100107677 | Ga0070695_1001076772 | 117 |
| 308 | 3300005546 | Ga0070696_100122071 | Ga0070696_1001220711 | 117 |
| 309 | 3300005546 | Ga0070696_100955833 | Ga0070696_1009558332 | 117 |
| 310 | 3300005547 | Ga0070693_100197008 | Ga0070693_1001970082 | 117 |
| 311 | 3300005548 | Ga0070665_100067768 | Ga0070665_1000677687 | 117 |
| 312 | 3300005548 | Ga0070665_100069338 | Ga0070665_1000693381 | 117 |
| 313 | 3300005564 | Ga0070664_100039975 | Ga0070664_1000399753 | 117 |
| 314 | 3300005564 | Ga0070664_100139461 | Ga0070664_1001394612 | 117 |
| 315 | 3300005564 | Ga0070664_100944770 | Ga0070664_1009447702 | 117 |
| 316 | 3300005564 | Ga0070664_101770132 | Ga0070664_1017701321 | 117 |
| 317 | 3300005577 | Ga0068857_100061555 | Ga0068857_1000615554 | 117 |
| 318 | 3300005577 | Ga0068857_100991811 | Ga0068857_1009918111 | 117 |
| 319 | 3300005577 | Ga0068857_101199986 | Ga0068857_1011999862 | 117 |
| 320 | 3300005578 | Ga0068854_100049001 | Ga0068854_1000490013 | 117 |
| 321 | 3300005615 | Ga0070702_100001586 | Ga0070702_1000015863 | 117 |
| 322 | 3300005616 | Ga0068852_100002484 | Ga0068852_1000024848 | 117 |
| 323 | 3300005616 | Ga0068852_100004129 | Ga0068852_1000041298 | 117 |
| 324 | 3300005616 | Ga0068852_100030350 | Ga0068852_1000303507 | 117 |
| 325 | 3300005616 | Ga0068852_101976455 | Ga0068852_1019764551 | 117 |
| 326 | 3300005617 | Ga0068859_100002059 | Ga0068859_10000205911 | 117 |
| 327 | 3300005617 | Ga0068859_100492728 | Ga0068859_1004927282 | 117 |
| 328 | 3300005617 | Ga0068859_102167318 | Ga0068859_1021673182 | 117 |
| 329 | 3300005618 | Ga0068864_100083267 | Ga0068864_1000832674 | 117 |
| 330 | 3300005618 | Ga0068864_100718478 | Ga0068864_1007184781 | 117 |
| 331 | 3300005618 | Ga0068864_101194915 | Ga0068864_1011949151 | 117 |
| 332 | 3300005618 | Ga0068864_101675744 | Ga0068864_1016757441 | 117 |
| 333 | 3300005718 | Ga0068866_10012222 | Ga0068866_100122224 | 117 |
| 334 | 3300005718 | Ga0068866_10629930 | Ga0068866_106299301 | 117 |
| 335 | 3300005719 | Ga0068861_100683121 | Ga0068861_1006831213 | 117 |
| 336 | 3300005719 | Ga0068861_100805078 | Ga0068861_1008050782 | 117 |
| 337 | 3300005719 | Ga0068861_101603467 | Ga0068861_1016034672 | 117 |
| 338 | 3300005840 | Ga0068870_10618556 | Ga0068870_106185562 | 117 |
| 339 | 3300005841 | Ga0068863_100321027 | Ga0068863_1003210273 | 117 |
| 340 | 3300005841 | Ga0068863_101146198 | Ga0068863_1011461982 | 117 |
| 341 | 3300005841 | Ga0068863_102463819 | Ga0068863_1024638191 | 117 |
| 342 | 3300005842 | Ga0068858_100003646 | Ga0068858_10000364610 | 117 |
| 343 | 3300005842 | Ga0068858_100128869 | Ga0068858_1001288692 | 117 |
| 344 | 3300005842 | Ga0068858_100250366 | Ga0068858_1002503662 | 117 |
| 345 | 3300005842 | Ga0068858_100915076 | Ga0068858_1009150762 | 117 |
| 346 | 3300005843 | Ga0068860_100133240 | Ga0068860_1001332401 | 117 |
| 347 | 3300005843 | Ga0068860_100379578 | Ga0068860_1003795781 | 117 |
| 348 | 3300005844 | Ga0068862_100048249 | Ga0068862_1000482494 | 117 |
| 349 | 3300005844 | Ga0068862_100727145 | Ga0068862_1007271452 | 117 |
| 350 | 3300005844 | Ga0068862_100862411 | Ga0068862_1008624111 | 117 |
| 351 | 3300006038 | Ga0075365_10571464 | Ga0075365_105714642 | 117 |
| 352 | 3300006042 | Ga0075368_10045248 | Ga0075368_100452482 | 117 |
| 353 | 3300006048 | Ga0075363_100023527 | Ga0075363_1000235272 | 117 |
| 354 | 3300006173 | Ga0070716_100158647 | Ga0070716_1001586472 | 117 |
| 355 | 3300006177 | Ga0075362_10001487 | Ga0075362_100014878 | 117 |
| 356 | 3300006178 | Ga0075367_10006063 | Ga0075367_100060635 | 117 |
| 357 | 3300006178 | Ga0075367_10016808 | Ga0075367_100168085 | 117 |
| 358 | 3300006178 | Ga0075367_10343321 | Ga0075367_103433212 | 117 |
| 359 | 3300006186 | Ga0075369_10066687 | Ga0075369_100666872 | 117 |
| 360 | 3300006186 | Ga0075369_10327161 | Ga0075369_103271612 | 117 |
| 361 | 3300006195 | Ga0075366_10004910 | Ga0075366_100049104 | 117 |
| 362 | 3300006195 | Ga0075366_10020335 | Ga0075366_100203352 | 117 |
| 363 | 3300006195 | Ga0075366_10453389 | Ga0075366_104533892 | 117 |
| 364 | 3300006237 | Ga0097621_100039285 | Ga0097621_1000392856 | 117 |
| 365 | 3300006237 | Ga0097621_100169616 | Ga0097621_1001696163 | 117 |
| 366 | 3300006237 | Ga0097621_100545068 | Ga0097621_1005450682 | 117 |
| 367 | 3300006353 | Ga0075370_10058732 | Ga0075370_100587323 | 117 |
| 368 | 3300006353 | Ga0075370_10068185 | Ga0075370_100681854 | 117 |
| 369 | 3300006353 | Ga0075370_10089065 | Ga0075370_100890653 | 117 |
| 370 | 3300006353 | Ga0075370_10189555 | Ga0075370_101895552 | 117 |
| 371 | 3300006358 | Ga0068871_100021156 | Ga0068871_1000211565 | 117 |
| 372 | 3300006358 | Ga0068871_100368873 | Ga0068871_1003688732 | 117 |
| 373 | 3300006846 | Ga0075430_100739134 | Ga0075430_1007391342 | 117 |
| 374 | 3300006847 | Ga0075431_100731311 | Ga0075431_1007313112 | 117 |
| 375 | 3300006871 | Ga0075434_101923036 | Ga0075434_1019230362 | 117 |
| 376 | 3300006881 | Ga0068865_100018344 | Ga0068865_1000183444 | 117 |
| 377 | 3300006881 | Ga0068865_100598196 | Ga0068865_1005981962 | 117 |
| 378 | 3300006881 | Ga0068865_100693696 | Ga0068865_1006936962 | 117 |
| 379 | 3300006881 | Ga0068865_101284340 | Ga0068865_1012843402 | 117 |
| 380 | 3300006881 | Ga0068865_102219962 | Ga0068865_1022199621 | 117 |
| 381 | 3300006931 | Ga0097620_100002059 | Ga0097620_10000205911 | 117 |
| 382 | 3300006931 | Ga0097620_100492742 | Ga0097620_1004927422 | 117 |
| 383 | 3300006931 | Ga0097620_100667774 | Ga0097620_1006677743 | 117 |
| 384 | 3300006931 | Ga0097620_100826692 | Ga0097620_1008266922 | 117 |
| 385 | 3300006931 | Ga0097620_102167485 | Ga0097620_1021674852 | 117 |
| 386 | 3300007265 | Ga0099794_10001490 | Ga0099794_100014907 | 117 |
| 387 | 3300007788 | Ga0099795_10104898 | Ga0099795_101048982 | 117 |
| 388 | 3300009093 | Ga0105240_10016259 | Ga0105240_100162592 | 117 |
| 389 | 3300009093 | Ga0105240_10054468 | Ga0105240_100544685 | 117 |
| 390 | 3300009094 | Ga0111539_10059108 | Ga0111539_100591085 | 117 |
| 391 | 3300009094 | Ga0111539_10973116 | Ga0111539_109731161 | 117 |
| 392 | 3300009094 | Ga0111539_11866932 | Ga0111539_118669322 | 117 |
| 393 | 3300009094 | Ga0111539_12966915 | Ga0111539_129669151 | 117 |
| 394 | 3300009098 | Ga0105245_10005108 | Ga0105245_1000510812 | 117 |
| 395 | 3300009098 | Ga0105245_10110128 | Ga0105245_101101284 | 117 |
| 396 | 3300009098 | Ga0105245_10297274 | Ga0105245_102972743 | 117 |
| 397 | 3300009101 | Ga0105247_10288690 | Ga0105247_102886902 | 117 |
| 398 | 3300009147 | Ga0114129_10103822 | Ga0114129_101038222 | 117 |
| 399 | 3300009147 | Ga0114129_10295150 | Ga0114129_102951502 | 117 |
| 400 | 3300009148 | Ga0105243_10007489 | Ga0105243_100074895 | 117 |
| 401 | 3300009148 | Ga0105243_10181574 | Ga0105243_101815743 | 117 |
| 402 | 3300009148 | Ga0105243_10572261 | Ga0105243_105722611 | 117 |
| 403 | 3300009148 | Ga0105243_10979859 | Ga0105243_109798592 | 117 |
| 404 | 3300009174 | Ga0105241_10211209 | Ga0105241_102112092 | 117 |
| 405 | 3300009174 | Ga0105241_10879069 | Ga0105241_108790692 | 117 |
| 406 | 3300009176 | Ga0105242_10001358 | Ga0105242_1000135819 | 117 |
| 407 | 3300009176 | Ga0105242_12847157 | Ga0105242_128471571 | 117 |
| 408 | 3300009177 | Ga0105248_10016657 | Ga0105248_1001665711 | 117 |
| 409 | 3300009177 | Ga0105248_10023841 | Ga0105248_100238412 | 117 |
| 410 | 3300009177 | Ga0105248_10079252 | Ga0105248_100792524 | 117 |
| 411 | 3300009177 | Ga0105248_10336945 | Ga0105248_103369453 | 117 |
| 412 | 3300009177 | Ga0105248_11054431 | Ga0105248_110544312 | 117 |
| 413 | 3300009545 | Ga0105237_10007400 | Ga0105237_100074003 | 117 |
| 414 | 3300009545 | Ga0105237_10008504 | Ga0105237_100085049 | 117 |
| 415 | 3300009545 | Ga0105237_10062594 | Ga0105237_100625942 | 117 |
| 416 | 3300009545 | Ga0105237_11418004 | Ga0105237_114180041 | 117 |
| 417 | 3300009551 | Ga0105238_10000630 | Ga0105238_100006309 | 117 |
| 418 | 3300009551 | Ga0105238_10515568 | Ga0105238_105155682 | 117 |
| 419 | 3300009551 | Ga0105238_11012466 | Ga0105238_110124662 | 117 |
| 420 | 3300009551 | Ga0105238_11178050 | Ga0105238_111780502 | 117 |
| 421 | 3300009553 | Ga0105249_10013377 | Ga0105249_100133772 | 117 |
| 422 | 3300009553 | Ga0105249_11316919 | Ga0105249_113169191 | 117 |
| 423 | 3300009553 | Ga0105249_11367004 | Ga0105249_113670041 | 117 |
| 424 | 3300010375 | Ga0105239_10080659 | Ga0105239_100806592 | 117 |
| 425 | 3300010375 | Ga0105239_10190382 | Ga0105239_101903821 | 117 |
| 426 | 3300010375 | Ga0105239_11224975 | Ga0105239_112249752 | 117 |
| 427 | 3300013104 | Ga0157370_10717849 | Ga0157370_107178491 | 117 |
| 428 | 3300013105 | Ga0157369_10893147 | Ga0157369_108931472 | 117 |
| 429 | 3300013296 | Ga0157374_10026571 | Ga0157374_100265713 | 117 |
| 430 | 3300013297 | Ga0157378_10155466 | Ga0157378_101554664 | 117 |
| 431 | 3300013297 | Ga0157378_10235882 | Ga0157378_102358824 | 117 |
| 432 | 3300013297 | Ga0157378_10395512 | Ga0157378_103955122 | 117 |
| 433 | 3300013297 | Ga0157378_10710144 | Ga0157378_107101442 | 117 |
| 434 | 3300013306 | Ga0163162_10041418 | Ga0163162_100414182 | 117 |
| 435 | 3300013306 | Ga0163162_10063827 | Ga0163162_100638272 | 117 |
| 436 | 3300013306 | Ga0163162_10319374 | Ga0163162_103193742 | 117 |
| 437 | 3300013306 | Ga0163162_10670972 | Ga0163162_106709722 | 117 |
| 438 | 3300013306 | Ga0163162_11264108 | Ga0163162_112641082 | 117 |
| 439 | 3300013306 | Ga0163162_12535318 | Ga0163162_125353181 | 117 |
| 440 | 3300013307 | Ga0157372_10147119 | Ga0157372_101471191 | 117 |
| 441 | 3300013308 | Ga0157375_10210023 | Ga0157375_102100232 | 117 |
| 442 | 3300013308 | Ga0157375_10371297 | Ga0157375_103712972 | 117 |
| 443 | 3300013308 | Ga0157375_10622839 | Ga0157375_106228392 | 117 |
| 444 | 3300013308 | Ga0157375_10851285 | Ga0157375_108512851 | 117 |
| 445 | 3300014325 | Ga0163163_10054161 | Ga0163163_100541616 | 117 |
| 446 | 3300014325 | Ga0163163_10387917 | Ga0163163_103879172 | 117 |
| 447 | 3300014326 | Ga0157380_10045490 | Ga0157380_100454904 | 117 |
| 448 | 3300014326 | Ga0157380_10239085 | Ga0157380_102390852 | 117 |
| 449 | 3300014326 | Ga0157380_10754884 | Ga0157380_107548842 | 117 |
| 450 | 3300014326 | Ga0157380_12748132 | Ga0157380_127481321 | 117 |
| 451 | 3300014745 | Ga0157377_10444818 | Ga0157377_104448182 | 117 |
| 452 | 3300014968 | Ga0157379_10012056 | Ga0157379_100120568 | 117 |
| 453 | 3300014968 | Ga0157379_10063543 | Ga0157379_100635432 | 117 |
| 454 | 3300014968 | Ga0157379_11005087 | Ga0157379_110050872 | 117 |
| 455 | 3300014968 | Ga0157379_11803441 | Ga0157379_118034411 | 117 |
| 456 | 3300014969 | Ga0157376_10020301 | Ga0157376_100203012 | 117 |
| 457 | 3300014969 | Ga0157376_10061796 | Ga0157376_100617964 | 117 |
| 458 | 3300014969 | Ga0157376_10435668 | Ga0157376_104356682 | 117 |
| 459 | 3300014969 | Ga0157376_11675253 | Ga0157376_116752531 | 117 |
| 460 | 3300014969 | Ga0157376_11698879 | Ga0157376_116988792 | 117 |
| 461 | 3300017792 | Ga0163161_10159845 | Ga0163161_101598453 | 117 |
| 462 | 3300025899 | Ga0207642_10018161 | Ga0207642_100181615 | 117 |
| 463 | 3300025904 | Ga0207647_10076768 | Ga0207647_100767682 | 117 |
| 464 | 3300025907 | Ga0207645_10588287 | Ga0207645_105882872 | 117 |
| 465 | 3300025907 | Ga0207645_10767041 | Ga0207645_107670412 | 117 |
| 466 | 3300025908 | Ga0207643_10003877 | Ga0207643_100038778 | 117 |
| 467 | 3300025911 | Ga0207654_11138634 | Ga0207654_111386341 | 117 |
| 468 | 3300025913 | Ga0207695_10043435 | Ga0207695_100434355 | 117 |
| 469 | 3300025918 | Ga0207662_10149877 | Ga0207662_101498772 | 117 |
| 470 | 3300025922 | Ga0207646_10790638 | Ga0207646_107906381 | 117 |
| 471 | 3300025926 | Ga0207659_10248453 | Ga0207659_102484533 | 117 |
| 472 | 3300025926 | Ga0207659_10329937 | Ga0207659_103299372 | 117 |
| 473 | 3300025927 | Ga0207687_10013955 | Ga0207687_100139556 | 117 |
| 474 | 3300025927 | Ga0207687_10363300 | Ga0207687_103633002 | 117 |
| 475 | 3300025927 | Ga0207687_10399224 | Ga0207687_103992242 | 117 |
| 476 | 3300025931 | Ga0207644_10403473 | Ga0207644_104034732 | 117 |
| 477 | 3300025933 | Ga0207706_10039291 | Ga0207706_100392913 | 117 |
| 478 | 3300025933 | Ga0207706_10064005 | Ga0207706_100640052 | 117 |
| 479 | 3300025934 | Ga0207686_10000532 | Ga0207686_1000053218 | 117 |
| 480 | 3300025934 | Ga0207686_10436684 | Ga0207686_104366842 | 117 |
| 481 | 3300025934 | Ga0207686_10819497 | Ga0207686_108194972 | 117 |
| 482 | 3300025935 | Ga0207709_10008548 | Ga0207709_100085482 | 117 |
| 483 | 3300025935 | Ga0207709_10080536 | Ga0207709_100805361 | 117 |
| 484 | 3300025936 | Ga0207670_10052595 | Ga0207670_100525953 | 117 |
| 485 | 3300025936 | Ga0207670_10489223 | Ga0207670_104892231 | 117 |
| 486 | 3300025937 | Ga0207669_10030931 | Ga0207669_100309314 | 117 |
| 487 | 3300025938 | Ga0207704_10022957 | Ga0207704_100229574 | 117 |
| 488 | 3300025938 | Ga0207704_10803835 | Ga0207704_108038351 | 117 |
| 489 | 3300025940 | Ga0207691_10886073 | Ga0207691_108860732 | 117 |
| 490 | 3300025941 | Ga0207711_10014526 | Ga0207711_1001452610 | 117 |
| 491 | 3300025941 | Ga0207711_10559649 | Ga0207711_105596493 | 117 |
| 492 | 3300025941 | Ga0207711_10608593 | Ga0207711_106085932 | 117 |
| 493 | 3300025942 | Ga0207689_10000262 | Ga0207689_100002623 | 117 |
| 494 | 3300025942 | Ga0207689_10034333 | Ga0207689_100343335 | 117 |
| 495 | 3300025942 | Ga0207689_10090212 | Ga0207689_100902122 | 117 |
| 496 | 3300025944 | Ga0207661_10071203 | Ga0207661_100712034 | 117 |
| 497 | 3300025945 | Ga0207679_10284192 | Ga0207679_102841922 | 117 |
| 498 | 3300025960 | Ga0207651_10820029 | Ga0207651_108200291 | 117 |
| 499 | 3300025961 | Ga0207712_10091122 | Ga0207712_100911223 | 117 |
| 500 | 3300025981 | Ga0207640_10207980 | Ga0207640_102079803 | 117 |
| 501 | 3300025986 | Ga0207658_10180401 | Ga0207658_101804014 | 117 |
| 502 | 3300026035 | Ga0207703_10004514 | Ga0207703_1000451413 | 117 |
| 503 | 3300026035 | Ga0207703_10169825 | Ga0207703_101698252 | 117 |
| 504 | 3300026035 | Ga0207703_11106745 | Ga0207703_111067451 | 117 |
| 505 | 3300026035 | Ga0207703_11236044 | Ga0207703_112360441 | 117 |
| 506 | 3300026041 | Ga0207639_10280903 | Ga0207639_102809033 | 117 |
| 507 | 3300026041 | Ga0207639_10431819 | Ga0207639_104318193 | 117 |
| 508 | 3300026041 | Ga0207639_10661793 | Ga0207639_106617932 | 117 |
| 509 | 3300026067 | Ga0207678_11049804 | Ga0207678_110498041 | 117 |
| 510 | 3300026075 | Ga0207708_10003947 | Ga0207708_100039473 | 117 |
| 511 | 3300026088 | Ga0207641_10142817 | Ga0207641_101428172 | 117 |
| 512 | 3300026088 | Ga0207641_10283932 | Ga0207641_102839322 | 117 |
| 513 | 3300026088 | Ga0207641_10547030 | Ga0207641_105470302 | 117 |
| 514 | 3300026089 | Ga0207648_10029798 | Ga0207648_100297984 | 117 |
| 515 | 3300026089 | Ga0207648_10047261 | Ga0207648_100472614 | 117 |
| 516 | 3300026089 | Ga0207648_10057742 | Ga0207648_100577423 | 117 |
| 517 | 3300026089 | Ga0207648_10087070 | Ga0207648_100870702 | 117 |
| 518 | 3300026089 | Ga0207648_10211352 | Ga0207648_102113521 | 117 |
| 519 | 3300026095 | Ga0207676_10180624 | Ga0207676_101806242 | 117 |
| 520 | 3300026095 | Ga0207676_10188273 | Ga0207676_101882733 | 117 |
| 521 | 3300026095 | Ga0207676_10928094 | Ga0207676_109280942 | 117 |
| 522 | 3300026116 | Ga0207674_10074752 | Ga0207674_100747524 | 117 |
| 523 | 3300026116 | Ga0207674_11435934 | Ga0207674_114359342 | 117 |
| 524 | 3300026118 | Ga0207675_100001238 | Ga0207675_10000123826 | 117 |
| 525 | 3300026118 | Ga0207675_100239679 | Ga0207675_1002396792 | 117 |
| 526 | 3300026118 | Ga0207675_100427987 | Ga0207675_1004279873 | 117 |
| 527 | 3300026118 | Ga0207675_101938803 | Ga0207675_1019388031 | 117 |
| 528 | 3300026121 | Ga0207683_10007474 | Ga0207683_1000747410 | 117 |
| 529 | 3300026142 | Ga0207698_10034858 | Ga0207698_100348584 | 117 |
| 530 | 3300026142 | Ga0207698_10353884 | Ga0207698_103538842 | 117 |
| 531 | 3300026142 | Ga0207698_10838248 | Ga0207698_108382482 | 117 |
| 532 | 3300028379 | Ga0268266_10768376 | Ga0268266_107683762 | 117 |
| 533 | 3300028380 | Ga0268265_10127567 | Ga0268265_101275673 | 117 |
| 534 | 3300028380 | Ga0268265_10917746 | Ga0268265_109177462 | 117 |
| 535 | 3300028381 | Ga0268264_10063467 | Ga0268264_100634675 | 117 |
| 536 | 3300028381 | Ga0268264_10574161 | Ga0268264_105741611 | 117 |
| 537 | 3300028786 | Ga0307517_10608010 | Ga0307517_106080101 | 117 |
| 538 | 3300031456 | Ga0307513_10006201 | Ga0307513_100062018 | 117 |
| 539 | 3300031456 | Ga0307513_10083106 | Ga0307513_100831063 | 117 |
| 540 | 3300031456 | Ga0307513_10657106 | Ga0307513_106571061 | 117 |
| 541 | 3300031507 | Ga0307509_10003931 | Ga0307509_100039318 | 117 |
| 542 | 3300031616 | Ga0307508_10002419 | Ga0307508_100024198 | 117 |
| 543 | 3300031616 | Ga0307508_10401553 | Ga0307508_104015532 | 117 |
| 544 | 3300031730 | Ga0307516_10053528 | Ga0307516_100535284 | 117 |
| 545 | 3300031730 | Ga0307516_10362362 | Ga0307516_103623622 | 117 |
| 546 | 3300033179 | Ga0307507_10169869 | Ga0307507_101698694 | 117 |
| 547 | 3300033180 | Ga0307510_10222308 | Ga0307510_102223082 | 117 |
| 548 | 3300033180 | Ga0307510_10269257 | Ga0307510_102692573 | 117 |
| 549 | 3300035724 | Ga0373933_0626756 | Ga0373933_0626756_70_435 | 117 |
| 550 | 3300041411 | Ga0439466_0056408 | Ga0439466_0056408_754_1128 | 117 |
| 551 | 3300044712 | Ga0453684_0198610 | Ga0453684_0198610_26_391 | 117 |
| 552 | 3300046616 | Ga0495668_0361514 | Ga0495668_0361514_59_424 | 117 |
| 553 | 3300046616 | Ga0495668_0462831 | Ga0495668_0462831_72_458 | 117 |
| 554 | 3300047469 | Ga0495673_0181730 | Ga0495673_0181730_290_655 | 117 |
| 555 | 3300048903 | Ga0496100_1439728 | Ga0496100_1439728_64_438 | 117 |
| 556 | 3300048907 | Ga0496104_0720424 | Ga0496104_0720424_49_423 | 117 |
| 557 | 3300048917 | Ga0496114_0714958 | Ga0496114_0714958_410_796 | 117 |
| 558 | 3300049571 | Ga0501034_0000487 | Ga0501034_0000487_37895_38263 | 117 |
| 559 | 3300049571 | Ga0501034_0008360 | Ga0501034_0008360_2014_2382 | 117 |
| 560 | 3300049582 | Ga0501048_0158019 | Ga0501048_0158019_697_1077 | 117 |
| 561 | 3300049588 | Ga0501072_0029917 | Ga0501072_0029917_299_667 | 117 |
| 562 | 3300049589 | Ga0501073_0419239 | Ga0501073_0419239_424_798 | 117 |
| 563 | 3300049671 | Ga0501238_030630 | Ga0501238_030630_277_651 | 117 |
| 564 | 3300049682 | Ga0501252_064573 | Ga0501252_064573_148_522 | 117 |
| 565 | 3300049742 | Ga0501080_0370665 | Ga0501080_0370665_236_610 | 117 |
| 566 | 3300049744 | Ga0501083_0417993 | Ga0501083_0417993_424_792 | 117 |
| 567 | 3300050491 | nmdc:mga00v17_460736_c1 | nmdc:mga00v17_460736_c1_230_598 | 117 |
| 568 | 3300050493 | nmdc:mga0k408_29009_c1 | nmdc:mga0k408_29009_c1_1926_2291 | 117 |
| 569 | 3300050493 | nmdc:mga0k408_38329_c1 | nmdc:mga0k408_38329_c1_359_727 | 117 |
| 570 | 3300050494 | nmdc:mga06z11_87728_c1 | nmdc:mga06z11_87728_c1_557_925 | 117 |
| 571 | 3300050496 | nmdc:mga07m45_735693_c1 | nmdc:mga07m45_735693_c1_113_478 | 117 |
| 572 | 3300050510 | nmdc:mga06r32_1554084_c1 | nmdc:mga06r32_1554084_c1_51_437 | 117 |
| 573 | 3300050516 | nmdc:mga0sz30_245696_c1 | nmdc:mga0sz30_245696_c1_235_603 | 117 |
| 574 | 3300053126 | Ga0500621_231062 | Ga0500621_231062_152_517 | 117 |
| 575 | iso_pu_bacteria | 2904419702 | 2904424025 | 117 |
| 576 | 3300005355 | Ga0070671_100498001 | Ga0070671_1004980012 | 118 |
| 577 | 3300005459 | Ga0068867_102370856 | Ga0068867_1023708561 | 118 |
| 578 | 3300005617 | Ga0068859_101035796 | Ga0068859_1010357962 | 118 |
| 579 | 3300006844 | Ga0075428_100301804 | Ga0075428_1003018042 | 118 |
| 580 | 3300006846 | Ga0075430_100306148 | Ga0075430_1003061482 | 118 |
| 581 | 3300006847 | Ga0075431_100941114 | Ga0075431_1009411142 | 118 |
| 582 | 3300006931 | Ga0097620_101035599 | Ga0097620_1010355992 | 118 |
| 583 | 3300009094 | Ga0111539_10245527 | Ga0111539_102455271 | 118 |
| 584 | 3300009147 | Ga0114129_10058324 | Ga0114129_100583247 | 118 |
| 585 | 3300009147 | Ga0114129_12008951 | Ga0114129_120089512 | 118 |
| 586 | 3300014326 | Ga0157380_11610588 | Ga0157380_116105881 | 118 |
| 587 | 3300025923 | Ga0207681_11834782 | Ga0207681_118347821 | 118 |
| 588 | 3300025931 | Ga0207644_10279526 | Ga0207644_102795263 | 118 |
| 589 | 3300027471 | Ga0209995_1033562 | Ga0209995_10335622 | 118 |
| 590 | 3300027471 | Ga0209995_1096427 | Ga0209995_10964272 | 118 |
| 591 | 3300028381 | Ga0268264_10360143 | Ga0268264_103601432 | 118 |
| 592 | 3300028794 | Ga0307515_10000059 | Ga0307515_1000005974 | 118 |
| 593 | 3300031456 | Ga0307513_10146015 | Ga0307513_101460151 | 118 |
| 594 | 3300031456 | Ga0307513_10498207 | Ga0307513_104982073 | 118 |
| 595 | 3300031548 | Ga0307408_101066397 | Ga0307408_1010663971 | 118 |
| 596 | 3300031711 | Ga0265314_10150042 | Ga0265314_101500422 | 118 |
| 597 | 3300035695 | Ga0373927_0164380 | Ga0373927_0164380_418_774 | 118 |
| 598 | 3300041410 | Ga0439461_0176768 | Ga0439461_0176768_91_447 | 118 |
| 599 | 3300041413 | Ga0439465_0000192 | Ga0439465_0000192_9668_10024 | 118 |
| 600 | 3300041512 | Ga0451853_2687333 | Ga0451853_2687333_107_463 | 118 |
| 601 | 3300042007 | Ga0439449_0046631 | Ga0439449_0046631_516_884 | 118 |
| 602 | 3300042876 | Ga0451577_0004145 | Ga0451577_0004145_9736_10092 | 118 |
| 603 | 3300044712 | Ga0453684_0000039 | Ga0453684_0000039_555224_555580 | 118 |
| 604 | 3300046473 | Ga0495582_0084811 | Ga0495582_0084811_1395_1751 | 118 |
| 605 | 3300046511 | Ga0495608_0432898 | Ga0495608_0432898_59_415 | 118 |
| 606 | 3300046683 | Ga0495658_0213301 | Ga0495658_0213301_233_589 | 118 |
| 607 | 3300049585 | Ga0501069_0016511 | Ga0501069_0016511_2990_3370 | 118 |
| 608 | 3300050508 | nmdc:mga09592_1072740_c1 | nmdc:mga09592_1072740_c1_83_451 | 118 |
| 609 | 3300050509 | nmdc:mga0qj67_276973_c1 | nmdc:mga0qj67_276973_c1_742_1110 | 118 |
| 610 | 3300050510 | nmdc:mga06r32_509301_c1 | nmdc:mga06r32_509301_c1_505_873 | 118 |
| 611 | 3300053077 | Ga0495601_0565859 | Ga0495601_0565859_115_471 | 118 |
| 612 | 3300053134 | Ga0500658_0039635 | Ga0500658_0039635_667_1026 | 118 |
| 613 | 3300053136 | Ga0500559_0075454 | Ga0500559_0075454_615_1010 | 118 |
| 614 | 3300053139 | Ga0500568_0109976 | Ga0500568_0109976_515_874 | 118 |
| 615 | 3300061734 | Ga0530510_0009843 | Ga0530510_0009843_327_707 | 118 |
| 616 | 3300002076 | JGI24749J21850_1007756 | JGI24749J21850_10077563 | 119 |
| 617 | 3300003322 | rootL2_10263668 | rootL2_102636682 | 119 |
| 618 | 3300003792 | Ga0055540_1016407 | Ga0055540_10164072 | 119 |
| 619 | 3300003794 | Ga0055531_10003055 | Ga0055531_100030555 | 119 |
| 620 | 3300005290 | Ga0065712_10005764 | Ga0065712_100057641 | 119 |
| 621 | 3300005293 | Ga0065715_10273969 | Ga0065715_102739692 | 119 |
| 622 | 3300005295 | Ga0065707_10081818 | Ga0065707_1008181831 | 119 |
| 623 | 3300005329 | Ga0070683_100509766 | Ga0070683_1005097662 | 119 |
| 624 | 3300005331 | Ga0070670_100101660 | Ga0070670_1001016603 | 119 |
| 625 | 3300005333 | Ga0070677_10022234 | Ga0070677_100222342 | 119 |
| 626 | 3300005333 | Ga0070677_10130591 | Ga0070677_101305912 | 119 |
| 627 | 3300005333 | Ga0070677_10846926 | Ga0070677_108469261 | 119 |
| 628 | 3300005334 | Ga0068869_100097457 | Ga0068869_1000974571 | 119 |
| 629 | 3300005336 | Ga0070680_100088549 | Ga0070680_1000885493 | 119 |
| 630 | 3300005337 | Ga0070682_100004134 | Ga0070682_10000413411 | 119 |
| 631 | 3300005338 | Ga0068868_100221156 | Ga0068868_1002211562 | 119 |
| 632 | 3300005339 | Ga0070660_101155796 | Ga0070660_1011557961 | 119 |
| 633 | 3300005340 | Ga0070689_100004010 | Ga0070689_10000401013 | 119 |
| 634 | 3300005344 | Ga0070661_100026560 | Ga0070661_1000265609 | 119 |
| 635 | 3300005344 | Ga0070661_100087165 | Ga0070661_1000871654 | 119 |
| 636 | 3300005344 | Ga0070661_100894169 | Ga0070661_1008941691 | 119 |
| 637 | 3300005345 | Ga0070692_11038990 | Ga0070692_110389901 | 119 |
| 638 | 3300005347 | Ga0070668_100425520 | Ga0070668_1004255202 | 119 |
| 639 | 3300005353 | Ga0070669_100252509 | Ga0070669_1002525092 | 119 |
| 640 | 3300005354 | Ga0070675_100030122 | Ga0070675_1000301225 | 119 |
| 641 | 3300005354 | Ga0070675_100065416 | Ga0070675_1000654165 | 119 |
| 642 | 3300005355 | Ga0070671_100436087 | Ga0070671_1004360872 | 119 |
| 643 | 3300005355 | Ga0070671_100992514 | Ga0070671_1009925142 | 119 |
| 644 | 3300005356 | Ga0070674_100346536 | Ga0070674_1003465362 | 119 |
| 645 | 3300005356 | Ga0070674_100679970 | Ga0070674_1006799702 | 119 |
| 646 | 3300005364 | Ga0070673_100358104 | Ga0070673_1003581043 | 119 |
| 647 | 3300005364 | Ga0070673_100496406 | Ga0070673_1004964063 | 119 |
| 648 | 3300005365 | Ga0070688_100004559 | Ga0070688_1000045596 | 119 |
| 649 | 3300005365 | Ga0070688_100191552 | Ga0070688_1001915522 | 119 |
| 650 | 3300005366 | Ga0070659_100093309 | Ga0070659_1000933092 | 119 |
| 651 | 3300005366 | Ga0070659_101082012 | Ga0070659_1010820122 | 119 |
| 652 | 3300005367 | Ga0070667_100217983 | Ga0070667_1002179833 | 119 |
| 653 | 3300005435 | Ga0070714_100216012 | Ga0070714_1002160122 | 119 |
| 654 | 3300005441 | Ga0070700_100432251 | Ga0070700_1004322511 | 119 |
| 655 | 3300005458 | Ga0070681_11488711 | Ga0070681_114887111 | 119 |
| 656 | 3300005459 | Ga0068867_101311495 | Ga0068867_1013114951 | 119 |
| 657 | 3300005466 | Ga0070685_10009078 | Ga0070685_100090786 | 119 |
| 658 | 3300005530 | Ga0070679_100169876 | Ga0070679_1001698763 | 119 |
| 659 | 3300005530 | Ga0070679_101889668 | Ga0070679_1018896681 | 119 |
| 660 | 3300005535 | Ga0070684_100340586 | Ga0070684_1003405862 | 119 |
| 661 | 3300005539 | Ga0068853_100013959 | Ga0068853_1000139594 | 119 |
| 662 | 3300005539 | Ga0068853_100104439 | Ga0068853_1001044393 | 119 |
| 663 | 3300005543 | Ga0070672_100237439 | Ga0070672_1002374393 | 119 |
| 664 | 3300005546 | Ga0070696_100192662 | Ga0070696_1001926622 | 119 |
| 665 | 3300005548 | Ga0070665_100075809 | Ga0070665_1000758097 | 119 |
| 666 | 3300005548 | Ga0070665_100112180 | Ga0070665_1001121802 | 119 |
| 667 | 3300005548 | Ga0070665_100466686 | Ga0070665_1004666862 | 119 |
| 668 | 3300005563 | Ga0068855_100026904 | Ga0068855_1000269043 | 119 |
| 669 | 3300005564 | Ga0070664_100001011 | Ga0070664_1000010115 | 119 |
| 670 | 3300005564 | Ga0070664_100007884 | Ga0070664_1000078842 | 119 |
| 671 | 3300005564 | Ga0070664_100011932 | Ga0070664_10001193213 | 119 |
| 672 | 3300005577 | Ga0068857_100038300 | Ga0068857_1000383005 | 119 |
| 673 | 3300005577 | Ga0068857_100215056 | Ga0068857_1002150563 | 119 |
| 674 | 3300005578 | Ga0068854_100013305 | Ga0068854_1000133052 | 119 |
| 675 | 3300005578 | Ga0068854_100454449 | Ga0068854_1004544492 | 119 |
| 676 | 3300005614 | Ga0068856_100289249 | Ga0068856_1002892492 | 119 |
| 677 | 3300005614 | Ga0068856_102216196 | Ga0068856_1022161962 | 119 |
| 678 | 3300005616 | Ga0068852_100073262 | Ga0068852_1000732626 | 119 |
| 679 | 3300005617 | Ga0068859_100052584 | Ga0068859_1000525842 | 119 |
| 680 | 3300005617 | Ga0068859_101935221 | Ga0068859_1019352212 | 119 |
| 681 | 3300005618 | Ga0068864_100004086 | Ga0068864_10000408610 | 119 |
| 682 | 3300005718 | Ga0068866_10006093 | Ga0068866_1000609310 | 119 |
| 683 | 3300005834 | Ga0068851_10037646 | Ga0068851_100376463 | 119 |
| 684 | 3300005840 | Ga0068870_10002423 | Ga0068870_1000242310 | 119 |
| 685 | 3300005842 | Ga0068858_100298131 | Ga0068858_1002981312 | 119 |
| 686 | 3300005843 | Ga0068860_100047311 | Ga0068860_1000473115 | 119 |
| 687 | 3300005844 | Ga0068862_100356788 | Ga0068862_1003567883 | 119 |
| 688 | 3300006042 | Ga0075368_10154623 | Ga0075368_101546232 | 119 |
| 689 | 3300006058 | Ga0075432_10424739 | Ga0075432_104247391 | 119 |
| 690 | 3300006178 | Ga0075367_10202043 | Ga0075367_102020432 | 119 |
| 691 | 3300006195 | Ga0075366_10111803 | Ga0075366_101118032 | 119 |
| 692 | 3300006195 | Ga0075366_10794980 | Ga0075366_107949802 | 119 |
| 693 | 3300006237 | Ga0097621_100175303 | Ga0097621_1001753032 | 119 |
| 694 | 3300006237 | Ga0097621_100371119 | Ga0097621_1003711192 | 119 |
| 695 | 3300006353 | Ga0075370_10546436 | Ga0075370_105464362 | 119 |
| 696 | 3300006358 | Ga0068871_100407729 | Ga0068871_1004077292 | 119 |
| 697 | 3300006847 | Ga0075431_100676077 | Ga0075431_1006760773 | 119 |
| 698 | 3300006881 | Ga0068865_100132666 | Ga0068865_1001326662 | 119 |
| 699 | 3300006881 | Ga0068865_100405687 | Ga0068865_1004056872 | 119 |
| 700 | 3300006931 | Ga0097620_100052587 | Ga0097620_1000525872 | 119 |
| 701 | 3300006931 | Ga0097620_101934752 | Ga0097620_1019347522 | 119 |
| 702 | 3300007076 | Ga0075435_100957244 | Ga0075435_1009572442 | 119 |
| 703 | 3300009094 | Ga0111539_10007243 | Ga0111539_1000724313 | 119 |
| 704 | 3300009094 | Ga0111539_10129876 | Ga0111539_101298764 | 119 |
| 705 | 3300009094 | Ga0111539_12436754 | Ga0111539_124367541 | 119 |
| 706 | 3300009098 | Ga0105245_11123365 | Ga0105245_111233651 | 119 |
| 707 | 3300009101 | Ga0105247_10947429 | Ga0105247_109474291 | 119 |
| 708 | 3300009174 | Ga0105241_10795868 | Ga0105241_107958682 | 119 |
| 709 | 3300009174 | Ga0105241_10821420 | Ga0105241_108214202 | 119 |
| 710 | 3300009174 | Ga0105241_11036023 | Ga0105241_110360232 | 119 |
| 711 | 3300009176 | Ga0105242_10076211 | Ga0105242_100762112 | 119 |
| 712 | 3300009176 | Ga0105242_10808984 | Ga0105242_108089841 | 119 |
| 713 | 3300009177 | Ga0105248_10486111 | Ga0105248_104861112 | 119 |
| 714 | 3300009177 | Ga0105248_12061247 | Ga0105248_120612472 | 119 |
| 715 | 3300009545 | Ga0105237_10710777 | Ga0105237_107107772 | 119 |
| 716 | 3300009553 | Ga0105249_10206470 | Ga0105249_102064702 | 119 |
| 717 | 3300009553 | Ga0105249_10354426 | Ga0105249_103544262 | 119 |
| 718 | 3300009553 | Ga0105249_11045354 | Ga0105249_110453542 | 119 |
| 719 | 3300010375 | Ga0105239_10550953 | Ga0105239_105509533 | 119 |
| 720 | 3300010375 | Ga0105239_11164908 | Ga0105239_111649082 | 119 |
| 721 | 3300011119 | Ga0105246_10066825 | Ga0105246_100668254 | 119 |
| 722 | 3300013102 | Ga0157371_10350368 | Ga0157371_103503682 | 119 |
| 723 | 3300013105 | Ga0157369_10116821 | Ga0157369_101168213 | 119 |
| 724 | 3300013296 | Ga0157374_10003088 | Ga0157374_1000308814 | 119 |
| 725 | 3300013296 | Ga0157374_10017683 | Ga0157374_100176838 | 119 |
| 726 | 3300013297 | Ga0157378_11744504 | Ga0157378_117445041 | 119 |
| 727 | 3300013306 | Ga0163162_10000003 | Ga0163162_10000003158 | 119 |
| 728 | 3300013306 | Ga0163162_10855809 | Ga0163162_108558091 | 119 |
| 729 | 3300013307 | Ga0157372_10042624 | Ga0157372_100426244 | 119 |
| 730 | 3300013307 | Ga0157372_10235370 | Ga0157372_102353703 | 119 |
| 731 | 3300013307 | Ga0157372_13442502 | Ga0157372_134425022 | 119 |
| 732 | 3300013308 | Ga0157375_10310387 | Ga0157375_103103872 | 119 |
| 733 | 3300014325 | Ga0163163_10024708 | Ga0163163_100247082 | 119 |
| 734 | 3300014325 | Ga0163163_10037055 | Ga0163163_100370553 | 119 |
| 735 | 3300014325 | Ga0163163_11227568 | Ga0163163_112275682 | 119 |
| 736 | 3300014326 | Ga0157380_10002108 | Ga0157380_100021081 | 119 |
| 737 | 3300014326 | Ga0157380_10002689 | Ga0157380_100026896 | 119 |
| 738 | 3300014326 | Ga0157380_10017561 | Ga0157380_100175616 | 119 |
| 739 | 3300014326 | Ga0157380_10717490 | Ga0157380_107174902 | 119 |
| 740 | 3300014326 | Ga0157380_12116494 | Ga0157380_121164942 | 119 |
| 741 | 3300014968 | Ga0157379_10017429 | Ga0157379_100174296 | 119 |
| 742 | 3300014969 | Ga0157376_10282658 | Ga0157376_102826582 | 119 |
| 743 | 3300014969 | Ga0157376_10439104 | Ga0157376_104391042 | 119 |
| 744 | 3300014969 | Ga0157376_11073596 | Ga0157376_110735963 | 119 |
| 745 | 3300014969 | Ga0157376_11735144 | Ga0157376_117351442 | 119 |
| 746 | 3300017792 | Ga0163161_10872943 | Ga0163161_108729432 | 119 |
| 747 | 3300025273 | Ga0209673_1012504 | Ga0209673_10125046 | 119 |
| 748 | 3300025290 | Ga0207673_1018235 | Ga0207673_10182351 | 119 |
| 749 | 3300025303 | Ga0209051_1004592 | Ga0209051_10045924 | 119 |
| 750 | 3300025304 | Ga0209257_1000309 | Ga0209257_10003096 | 119 |
| 751 | 3300025315 | Ga0207697_10001907 | Ga0207697_1000190710 | 119 |
| 752 | 3300025315 | Ga0207697_10146494 | Ga0207697_101464942 | 119 |
| 753 | 3300025321 | Ga0207656_10006854 | Ga0207656_100068544 | 119 |
| 754 | 3300025893 | Ga0207682_10000850 | Ga0207682_100008505 | 119 |
| 755 | 3300025901 | Ga0207688_10000680 | Ga0207688_1000068019 | 119 |
| 756 | 3300025903 | Ga0207680_10043301 | Ga0207680_100433013 | 119 |
| 757 | 3300025903 | Ga0207680_10787634 | Ga0207680_107876342 | 119 |
| 758 | 3300025904 | Ga0207647_10028610 | Ga0207647_100286105 | 119 |
| 759 | 3300025907 | Ga0207645_10002221 | Ga0207645_1000222116 | 119 |
| 760 | 3300025908 | Ga0207643_10000188 | Ga0207643_1000018841 | 119 |
| 761 | 3300025908 | Ga0207643_10202540 | Ga0207643_102025402 | 119 |
| 762 | 3300025908 | Ga0207643_11022632 | Ga0207643_110226321 | 119 |
| 763 | 3300025909 | Ga0207705_10427082 | Ga0207705_104270821 | 119 |
| 764 | 3300025917 | Ga0207660_11209211 | Ga0207660_112092111 | 119 |
| 765 | 3300025918 | Ga0207662_10644454 | Ga0207662_106444542 | 119 |
| 766 | 3300025920 | Ga0207649_10374097 | Ga0207649_103740972 | 119 |
| 767 | 3300025920 | Ga0207649_10774074 | Ga0207649_107740741 | 119 |
| 768 | 3300025921 | Ga0207652_10041101 | Ga0207652_100411014 | 119 |
| 769 | 3300025921 | Ga0207652_10330171 | Ga0207652_103301711 | 119 |
| 770 | 3300025921 | Ga0207652_11820665 | Ga0207652_118206651 | 119 |
| 771 | 3300025923 | Ga0207681_10159293 | Ga0207681_101592933 | 119 |
| 772 | 3300025924 | Ga0207694_10039354 | Ga0207694_100393546 | 119 |
| 773 | 3300025925 | Ga0207650_10009664 | Ga0207650_1000966412 | 119 |
| 774 | 3300025925 | Ga0207650_10079123 | Ga0207650_100791233 | 119 |
| 775 | 3300025925 | Ga0207650_10830773 | Ga0207650_108307731 | 119 |
| 776 | 3300025926 | Ga0207659_10035434 | Ga0207659_100354346 | 119 |
| 777 | 3300025926 | Ga0207659_10133498 | Ga0207659_101334981 | 119 |
| 778 | 3300025926 | Ga0207659_11187102 | Ga0207659_111871022 | 119 |
| 779 | 3300025927 | Ga0207687_10176843 | Ga0207687_101768432 | 119 |
| 780 | 3300025927 | Ga0207687_10789427 | Ga0207687_107894272 | 119 |
| 781 | 3300025931 | Ga0207644_10637294 | Ga0207644_106372942 | 119 |
| 782 | 3300025931 | Ga0207644_10907408 | Ga0207644_109074081 | 119 |
| 783 | 3300025932 | Ga0207690_10466400 | Ga0207690_104664002 | 119 |
| 784 | 3300025933 | Ga0207706_10023206 | Ga0207706_1002320612 | 119 |
| 785 | 3300025936 | Ga0207670_10311355 | Ga0207670_103113553 | 119 |
| 786 | 3300025937 | Ga0207669_10504958 | Ga0207669_105049581 | 119 |
| 787 | 3300025938 | Ga0207704_10374697 | Ga0207704_103746973 | 119 |
| 788 | 3300025938 | Ga0207704_10631267 | Ga0207704_106312672 | 119 |
| 789 | 3300025940 | Ga0207691_10059928 | Ga0207691_100599285 | 119 |
| 790 | 3300025940 | Ga0207691_10268705 | Ga0207691_102687053 | 119 |
| 791 | 3300025941 | Ga0207711_10122894 | Ga0207711_101228942 | 119 |
| 792 | 3300025941 | Ga0207711_10387824 | Ga0207711_103878243 | 119 |
| 793 | 3300025942 | Ga0207689_10003034 | Ga0207689_1000303424 | 119 |
| 794 | 3300025944 | Ga0207661_10158672 | Ga0207661_101586724 | 119 |
| 795 | 3300025945 | Ga0207679_10350033 | Ga0207679_103500331 | 119 |
| 796 | 3300025949 | Ga0207667_10017959 | Ga0207667_100179594 | 119 |
| 797 | 3300025949 | Ga0207667_10463725 | Ga0207667_104637253 | 119 |
| 798 | 3300025960 | Ga0207651_10021076 | Ga0207651_100210763 | 119 |
| 799 | 3300025960 | Ga0207651_10186042 | Ga0207651_101860422 | 119 |
| 800 | 3300025960 | Ga0207651_10943385 | Ga0207651_109433852 | 119 |
| 801 | 3300025961 | Ga0207712_10625193 | Ga0207712_106251932 | 119 |
| 802 | 3300025961 | Ga0207712_10752027 | Ga0207712_107520271 | 119 |
| 803 | 3300025972 | Ga0207668_11029828 | Ga0207668_110298281 | 119 |
| 804 | 3300025981 | Ga0207640_10345344 | Ga0207640_103453442 | 119 |
| 805 | 3300025981 | Ga0207640_10419216 | Ga0207640_104192162 | 119 |
| 806 | 3300025986 | Ga0207658_10305766 | Ga0207658_103057663 | 119 |
| 807 | 3300026023 | Ga0207677_10067833 | Ga0207677_100678335 | 119 |
| 808 | 3300026035 | Ga0207703_10385636 | Ga0207703_103856362 | 119 |
| 809 | 3300026041 | Ga0207639_10075088 | Ga0207639_100750882 | 119 |
| 810 | 3300026041 | Ga0207639_11135618 | Ga0207639_111356181 | 119 |
| 811 | 3300026067 | Ga0207678_10006127 | Ga0207678_1000612714 | 119 |
| 812 | 3300026075 | Ga0207708_10006587 | Ga0207708_100065875 | 119 |
| 813 | 3300026075 | Ga0207708_10425749 | Ga0207708_104257492 | 119 |
| 814 | 3300026078 | Ga0207702_10155402 | Ga0207702_101554022 | 119 |
| 815 | 3300026088 | Ga0207641_10516476 | Ga0207641_105164762 | 119 |
| 816 | 3300026088 | Ga0207641_10528138 | Ga0207641_105281382 | 119 |
| 817 | 3300026089 | Ga0207648_10119486 | Ga0207648_101194865 | 119 |
| 818 | 3300026089 | Ga0207648_10467606 | Ga0207648_104676062 | 119 |
| 819 | 3300026095 | Ga0207676_10001767 | Ga0207676_1000176710 | 119 |
| 820 | 3300026116 | Ga0207674_10016255 | Ga0207674_1001625511 | 119 |
| 821 | 3300026116 | Ga0207674_10284184 | Ga0207674_102841843 | 119 |
| 822 | 3300026118 | Ga0207675_100004912 | Ga0207675_10000491222 | 119 |
| 823 | 3300026121 | Ga0207683_10017447 | Ga0207683_100174476 | 119 |
| 824 | 3300026121 | Ga0207683_10469893 | Ga0207683_104698932 | 119 |
| 825 | 3300026121 | Ga0207683_11078736 | Ga0207683_110787361 | 119 |
| 826 | 3300026142 | Ga0207698_10451312 | Ga0207698_104513122 | 119 |
| 827 | 3300027866 | Ga0209813_10261256 | Ga0209813_102612562 | 119 |
| 828 | 3300027907 | Ga0207428_10394380 | Ga0207428_103943802 | 119 |
| 829 | 3300027907 | Ga0207428_10414733 | Ga0207428_104147332 | 119 |
| 830 | 3300028379 | Ga0268266_10063426 | Ga0268266_100634262 | 119 |
| 831 | 3300028379 | Ga0268266_10387800 | Ga0268266_103878002 | 119 |
| 832 | 3300028381 | Ga0268264_10552555 | Ga0268264_105525552 | 119 |
| 833 | 3300028794 | Ga0307515_10000265 | Ga0307515_1000026517 | 119 |
| 834 | 3300028794 | Ga0307515_10000347 | Ga0307515_1000034788 | 119 |
| 835 | 3300028794 | Ga0307515_10002435 | Ga0307515_100024359 | 119 |
| 836 | 3300028794 | Ga0307515_10003762 | Ga0307515_100037624 | 119 |
| 837 | 3300028794 | Ga0307515_10546302 | Ga0307515_105463022 | 119 |
| 838 | 3300030522 | Ga0307512_10120497 | Ga0307512_101204972 | 119 |
| 839 | 3300030522 | Ga0307512_10194593 | Ga0307512_101945931 | 119 |
| 840 | 3300031456 | Ga0307513_10024660 | Ga0307513_100246606 | 119 |
| 841 | 3300031456 | Ga0307513_10133414 | Ga0307513_101334143 | 119 |
| 842 | 3300031456 | Ga0307513_10351259 | Ga0307513_103512592 | 119 |
| 843 | 3300031456 | Ga0307513_10580467 | Ga0307513_105804672 | 119 |
| 844 | 3300031507 | Ga0307509_10021357 | Ga0307509_100213575 | 119 |
| 845 | 3300031548 | Ga0307408_100385531 | Ga0307408_1003855313 | 119 |
| 846 | 3300031548 | Ga0307408_100958799 | Ga0307408_1009587992 | 119 |
| 847 | 3300031616 | Ga0307508_10001686 | Ga0307508_1000168618 | 119 |
| 848 | 3300031649 | Ga0307514_10241678 | Ga0307514_102416781 | 119 |
| 849 | 3300031730 | Ga0307516_10001538 | Ga0307516_1000153818 | 119 |
| 850 | 3300031901 | Ga0307406_10361484 | Ga0307406_103614842 | 119 |
| 851 | 3300031911 | Ga0307412_11016713 | Ga0307412_110167132 | 119 |
| 852 | 3300032126 | Ga0307415_100786915 | Ga0307415_1007869152 | 119 |
| 853 | 3300033179 | Ga0307507_10032282 | Ga0307507_100322823 | 119 |
| 854 | 3300035115 | Ga0373941_0041623 | Ga0373941_0041623_448_816 | 119 |
| 855 | 3300035242 | Ga0373962_0406256 | Ga0373962_0406256_56_424 | 119 |
| 856 | 3300035725 | Ga0373947_0100675 | Ga0373947_0100675_990_1361 | 119 |
| 857 | 3300037068 | Ga0373925_0700550 | Ga0373925_0700550_77_448 | 119 |
| 858 | 3300037418 | Ga0395900_1101200 | Ga0395900_1101200_158_532 | 119 |
| 859 | 3300039437 | Ga0436365_0306342 | Ga0436365_0306342_1284_1658 | 119 |
| 860 | 3300039447 | Ga0436361_0128791 | Ga0436361_0128791_1355_1714 | 119 |
| 861 | 3300041404 | Ga0439436_0001316 | Ga0439436_0001316_5451_5819 | 119 |
| 862 | 3300041405 | Ga0439438_028748 | Ga0439438_028748_460_828 | 119 |
| 863 | 3300041406 | Ga0439439_0003403 | Ga0439439_0003403_1239_1607 | 119 |
| 864 | 3300041407 | Ga0439447_020516 | Ga0439447_020516_938_1306 | 119 |
| 865 | 3300041410 | Ga0439461_0031947 | Ga0439461_0031947_678_1046 | 119 |
| 866 | 3300041411 | Ga0439466_0001978 | Ga0439466_0001978_1059_1427 | 119 |
| 867 | 3300041413 | Ga0439465_0002208 | Ga0439465_0002208_1304_1672 | 119 |
| 868 | 3300041451 | Ga0451791_1225265 | Ga0451791_1225265_597_977 | 119 |
| 869 | 3300041453 | Ga0451797_0863558 | Ga0451797_0863558_106_531 | 119 |
| 870 | 3300041456 | Ga0451795_0384717 | Ga0451795_0384717_22_402 | 119 |
| 871 | 3300041460 | Ga0451802_1010297 | Ga0451802_1010297_356_736 | 119 |
| 872 | 3300041507 | Ga0451851_1155442 | Ga0451851_1155442_460_840 | 119 |
| 873 | 3300041997 | Ga0439431_0001341 | Ga0439431_0001341_2597_2965 | 119 |
| 874 | 3300041999 | Ga0439433_0000590 | Ga0439433_0000590_4901_5269 | 119 |
| 875 | 3300042002 | Ga0439442_019855 | Ga0439442_019855_639_1007 | 119 |
| 876 | 3300042004 | Ga0439445_0000167 | Ga0439445_0000167_10072_10440 | 119 |
| 877 | 3300042006 | Ga0439432_016348 | Ga0439432_016348_1304_1672 | 119 |
| 878 | 3300042006 | Ga0439432_211189 | Ga0439432_211189_74_442 | 119 |
| 879 | 3300042007 | Ga0439449_0039405 | Ga0439449_0039405_640_1008 | 119 |
| 880 | 3300042010 | Ga0439452_008633 | Ga0439452_008633_2173_2541 | 119 |
| 881 | 3300042156 | Ga0439446_0017468 | Ga0439446_0017468_887_1255 | 119 |
| 882 | 3300042185 | Ga0450909_007456 | Ga0450909_007456_362_730 | 119 |
| 883 | 3300042435 | Ga0439434_0000712 | Ga0439434_0000712_6629_6997 | 119 |
| 884 | 3300044694 | Ga0466963_1146702 | Ga0466963_1146702_175_534 | 119 |
| 885 | 3300046472 | Ga0495580_0159595 | Ga0495580_0159595_1085_1456 | 119 |
| 886 | 3300046492 | Ga0495585_0342341 | Ga0495585_0342341_147_515 | 119 |
| 887 | 3300046512 | Ga0495610_0069557 | Ga0495610_0069557_423_803 | 119 |
| 888 | 3300046514 | Ga0495618_0203502 | Ga0495618_0203502_314_694 | 119 |
| 889 | 3300046519 | Ga0495632_0012811 | Ga0495632_0012811_3481_3861 | 119 |
| 890 | 3300046519 | Ga0495632_0247542 | Ga0495632_0247542_59_439 | 119 |
| 891 | 3300046537 | Ga0495598_0267410 | Ga0495598_0267410_118_498 | 119 |
| 892 | 3300046539 | Ga0495621_0365042 | Ga0495621_0365042_24_383 | 119 |
| 893 | 3300046615 | Ga0495656_0115467 | Ga0495656_0115467_753_1127 | 119 |
| 894 | 3300046660 | Ga0495625_0004683 | Ga0495625_0004683_11333_11713 | 119 |
| 895 | 3300046660 | Ga0495625_0776219 | Ga0495625_0776219_84_464 | 119 |
| 896 | 3300046681 | Ga0495647_0191009 | Ga0495647_0191009_514_876 | 119 |
| 897 | 3300046683 | Ga0495658_0185882 | Ga0495658_0185882_824_1204 | 119 |
| 898 | 3300047446 | Ga0495679_116250 | Ga0495679_116250_284_658 | 119 |
| 899 | 3300047472 | Ga0495686_0097614 | Ga0495686_0097614_393_773 | 119 |
| 900 | 3300048903 | Ga0496100_0251681 | Ga0496100_0251681_475_846 | 119 |
| 901 | 3300048903 | Ga0496100_0295744 | Ga0496100_0295744_74_460 | 119 |
| 902 | 3300048904 | Ga0496101_0034501 | Ga0496101_0034501_2175_2546 | 119 |
| 903 | 3300048905 | Ga0496102_0323085 | Ga0496102_0323085_934_1320 | 119 |
| 904 | 3300048906 | Ga0496103_0671372 | Ga0496103_0671372_104_463 | 119 |
| 905 | 3300048907 | Ga0496104_0004292 | Ga0496104_0004292_9692_10063 | 119 |
| 906 | 3300048907 | Ga0496104_0199685 | Ga0496104_0199685_1450_1824 | 119 |
| 907 | 3300048907 | Ga0496104_0489401 | Ga0496104_0489401_428_814 | 119 |
| 908 | 3300048909 | Ga0496106_0219399 | Ga0496106_0219399_366_737 | 119 |
| 909 | 3300048910 | Ga0496107_0079878 | Ga0496107_0079878_31_390 | 119 |
| 910 | 3300048911 | Ga0496108_0005708 | Ga0496108_0005708_5699_6070 | 119 |
| 911 | 3300048912 | Ga0496109_0008725 | Ga0496109_0008725_4127_4498 | 119 |
| 912 | 3300048912 | Ga0496109_0056385 | Ga0496109_0056385_459_845 | 119 |
| 913 | 3300048913 | Ga0496110_0360864 | Ga0496110_0360864_540_926 | 119 |
| 914 | 3300048914 | Ga0496111_0456751 | Ga0496111_0456751_146_517 | 119 |
| 915 | 3300048915 | Ga0496112_0259752 | Ga0496112_0259752_875_1261 | 119 |
| 916 | 3300048915 | Ga0496112_0603738 | Ga0496112_0603738_381_749 | 119 |
| 917 | 3300048916 | Ga0496113_0240023 | Ga0496113_0240023_666_1037 | 119 |
| 918 | 3300048918 | Ga0496115_0243135 | Ga0496115_0243135_962_1336 | 119 |
| 919 | 3300048918 | Ga0496115_0737112 | Ga0496115_0737112_254_640 | 119 |
| 920 | 3300048922 | Ga0496119_0151588 | Ga0496119_0151588_136_522 | 119 |
| 921 | 3300049515 | Ga0501292_004192 | Ga0501292_004192_1161_1526 | 119 |
| 922 | 3300049521 | Ga0501298_119148 | Ga0501298_119148_93_452 | 119 |
| 923 | 3300049526 | Ga0501303_006056 | Ga0501303_006056_640_1005 | 119 |
| 924 | 3300049686 | Ga0501257_029363 | Ga0501257_029363_666_1031 | 119 |
| 925 | 3300049744 | Ga0501083_0059628 | Ga0501083_0059628_1031_1429 | 119 |
| 926 | 3300049762 | Ga0501265_012248 | Ga0501265_012248_17_382 | 119 |
| 927 | 3300050493 | nmdc:mga0k408_131819_c1 | nmdc:mga0k408_131819_c1_786_1166 | 119 |
| 928 | 3300050493 | nmdc:mga0k408_83997_c1 | nmdc:mga0k408_83997_c1_374_799 | 119 |
| 929 | 3300050496 | nmdc:mga07m45_196928_c1 | nmdc:mga07m45_196928_c1_734_1114 | 119 |
| 930 | 3300050510 | nmdc:mga06r32_245325_c1 | nmdc:mga06r32_245325_c1_202_597 | 119 |
| 931 | 3300050511 | nmdc:mga08y16_125428_c1 | nmdc:mga08y16_125428_c1_2021_2383 | 119 |
| 932 | 3300050513 | nmdc:mga0rr50_671024_c1 | nmdc:mga0rr50_671024_c1_89_460 | 119 |
| 933 | 3300050515 | nmdc:mga0a205_849353_c1 | nmdc:mga0a205_849353_c1_342_710 | 119 |
| 934 | 3300053088 | Ga0500644_0037342 | Ga0500644_0037342_953_1333 | 119 |
| 935 | 3300053739 | Ga0500587_023225 | Ga0500587_023225_70_450 | 119 |
| 936 | iso_pu_bacteria | 2585428062 | 2587758868 | 119 |
| 937 | iso_pu_bacteria | 2885192300 | 2885195760 | 119 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7o62-assembly1.cif.gz_B | crystal structure of a 2`-deoxyribosyltransferase from the psychrophilic bacterium desulfotalea psychrophila. | 0.8342 | 2 | 106 |
| 6evs-assembly1.cif.gz_A | characterization of 2-deoxyribosyltransferase from psychrotolerant bacterium bacillus psychrosaccharolyticus: a suitable biocatalyst for the industrial synthesis of antiviral and antitumoral nucleosides | 0.7743 | 2 | 106 |
| 7o62-assembly1.cif.gz_C | crystal structure of a 2`-deoxyribosyltransferase from the psychrophilic bacterium desulfotalea psychrophila. | 0.7699 | 2 | 106 |
| 3ry7-assembly1.cif.gz_A-2 | crystal structure of sa239 | 0.7595 | 68 | 106 |
| 1rk2-assembly2.cif.gz_C | e. coli ribokinase complexed with ribose and adp, solved in space group p212121 | 0.7501 | 68 | 106 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1t1jA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Hypothetical protein PA1492 | 0.8006 | 2 | 107 | 3.40.50.10400 |
| 3ry7A00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.7595 | 68 | 106 | 3.40.1190.20 |
| af_Q17820_1_342_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.7499 | 69 | 106 | 3.40.50.720 |
| 3imkA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7405 | 69 | 113 | 3.40.50.450 |
| af_A0A0P0V2V1_3_148_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.7362 | 2 | 106 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534A374-F1-model_v4 | DUF4406 domain-containing protein | 0.9926 | 1 | 114 |
|
| AF-A0A1H7X3N7-F1-model_v4 | Phosphoglycerate kinase | 0.9916 | 1 | 115 |
|
| AF-A0A2L0F0V3-F1-model_v4 | NUDIX hydrolase | 0.9911 | 1 | 115 |
GO:0016787
|
| AF-A0A1W2FRA8-F1-model_v4 | DUF4406 domain-containing protein | 0.9903 | 1 | 114 |
|
| AF-A0A0N9IH61-F1-model_v4 | NUDIX hydrolase | 0.9892 | 1 | 114 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar