F486216

General Info

Members Datasets Scaffolds Average Seq Length
937 423 819 298

Family's Representative Sequence

Representative Sequence 3300002704|JGI25155J39150_1000896|JGI25155J39150_10008961
Length 314
Sequence MKKITKAVFPVAGLGSRFLPATKAQPKEMLPIVDKPLIQYAVEEAVEAGITEMIFITGRNKRAIEDHFDKAYELETELEAAGKTKLLEFARNVIPKHINCVYIRQSSPLGLGHAVLCAKSLVGDEPFAVVLADDFMDAPENGKNVLGQMIDVFEQEQKSLLAVQDVPRSDTRQYGIVSTDVDGPYSDRLDVISGIVEKPAPDLAPSTLAVVGRYVLTPAIFDRLENIGKGAGGEIQLTDGIADLMQSETVLAYRYDGRRYDCGSKLGYLKATVAMGAKHAEVGKEFSAYLREVHETDEEAAQVQEAPVRLDKIA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
3 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
4 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
5 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
6 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
7 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
8 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
9 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
10 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
11 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
12 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
13 2643221556 Massilia sp. Root1485 Isolate Unclassified
14 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
15 2643221645 Massilia sp. Root351 Isolate Unclassified
16 2643221658 Variovorax sp. Root411 Isolate Unclassified
17 2643221664 Massilia sp. Root418 Isolate Unclassified
18 2643221672 Variovorax sp. Root434 Isolate Unclassified
19 2643221683 Variovorax sp. Root473 Isolate Unclassified
20 2643221684 Massilia sp. Root133 Isolate Unclassified
21 2738541277 Variovorax sp. GV051 Isolate Unclassified
22 2738541280 Massilia sp. GV090 Isolate Unclassified
23 2738541297 Duganella sp. GV083 Isolate Unclassified
24 2738541300 Massilia sp. GV016 Isolate Unclassified
25 2738541307 Variovorax sp. GV008 Isolate Unclassified
26 2738541357 Duganella sp. GV053 Isolate Unclassified
27 2738543003 Duganella sp. GV066 Isolate Unclassified
28 2738543013 Variovorax sp. BT01 Isolate Unclassified
29 2738543018 Massilia sp. GV045 Isolate Unclassified
30 2738543019 Variovorax sp. GV040 Isolate Unclassified
31 2738543026 Duganella sp. GV089 Isolate Unclassified
32 2738543029 Duganella sp. GV039 Isolate Unclassified
33 2738543030 Massilia sp. GV097 Isolate Unclassified
34 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
35 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
36 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
37 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
38 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
39 2818991436 Collimonas arenae 515 Isolate Unclassified
40 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
41 2818991446 Variovorax sp. 1180 Isolate Unclassified
42 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
43 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
44 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
45 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
46 2842677519 Variovorax sp. R-72495 Isolate Unclassified
47 2842733646 Variovorax sp. R-72446 Isolate Unclassified
48 2842747753 Variovorax sp. R-72060 Isolate Unclassified
49 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
50 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
51 2857564685 Duganella sp. R-74599 Isolate Unclassified
52 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
53 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
54 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
55 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
56 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
57 2885198086 Variovorax sp. 679 Isolate Unclassified
58 2885211737 Variovorax sp. 553 Isolate Unclassified
59 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
60 2899924645 Variovorax sp. 369 Isolate Unclassified
61 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
62 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
63 2904456579 Variovorax sp. 2002 Isolate Unclassified
64 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
65 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
66 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
67 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
68 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
69 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
70 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
71 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
72 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
73 2928037797 Variovorax sp. 1126 Isolate Unclassified
74 2928044640 Variovorax sp. 1128 Isolate Unclassified
75 2928051484 Variovorax sp. 1133 Isolate Unclassified
76 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
77 2928070936 Variovorax gossypii 1167 Isolate Unclassified
78 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
79 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
80 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
81 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
82 2929520902 Variovorax beijingensis 502 Isolate Unclassified
83 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
84 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
85 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
86 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
87 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
88 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
89 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
90 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
91 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
92 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
93 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
94 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
95 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
96 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
97 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
98 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
99 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
100 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
101 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
102 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
103 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
104 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
105 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
106 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
107 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
108 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
109 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
110 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
111 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
112 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
113 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
114 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
115 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
116 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
117 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
118 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
119 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
120 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
121 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
122 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
123 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
124 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
125 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
126 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
127 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
128 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
129 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
130 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
131 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
132 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
133 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
134 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
135 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
136 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
137 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
138 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
139 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
140 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
141 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
142 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
143 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
144 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
145 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
146 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
147 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
148 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
149 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
150 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
151 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
152 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
153 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
154 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
155 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
156 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
157 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
158 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
159 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
160 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
161 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
162 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
163 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
164 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
165 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
166 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
168 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
175 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
176 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
178 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
179 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
180 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
183 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
184 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
185 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
189 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
192 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
194 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
196 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
197 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
224 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
225 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
228 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
229 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
230 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
231 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
232 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
233 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
234 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
235 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
236 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
237 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
238 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
239 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
240 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
241 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
242 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
243 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
244 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
245 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
246 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
247 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
248 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
249 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
250 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
251 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
252 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
253 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
254 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
255 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
256 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
257 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
258 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
259 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
260 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
261 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
262 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
263 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
264 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
265 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
266 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
267 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
268 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
269 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
270 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
271 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
272 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
273 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
274 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
275 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
276 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
277 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
278 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
279 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
280 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
281 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
282 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
283 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
284 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
285 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
286 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
287 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
288 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
289 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
290 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
291 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
292 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
293 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
294 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
295 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
296 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
297 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
298 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
299 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
300 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
301 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
302 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
303 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
304 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
305 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
306 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
307 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
308 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
309 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
310 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
311 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
312 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
313 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
314 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
315 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
316 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
317 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
318 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
319 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
320 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
321 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
322 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
323 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
324 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
325 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
326 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
327 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
328 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
329 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
330 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
331 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
332 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
333 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
334 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
335 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
336 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
337 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
338 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
339 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
340 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
341 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
342 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
343 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
344 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
345 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
346 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
347 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
348 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
349 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
350 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
351 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
352 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
353 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
354 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
355 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
356 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
357 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
358 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
359 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
360 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
361 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
362 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
363 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
364 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
365 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
366 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
367 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
368 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
369 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
370 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
371 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
372 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
373 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
374 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
375 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
376 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
377 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
378 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
379 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
380 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
381 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
382 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
383 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
384 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
387 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
388 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
389 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
390 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
391 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
393 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
394 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
395 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
396 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
397 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
398 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
399 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
400 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
401 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
402 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
403 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
404 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
405 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
406 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
407 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
408 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
409 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
410 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
411 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
412 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
413 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
414 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
415 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
416 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
417 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
418 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
419 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
420 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
421 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
423 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.62
Metatranscriptomes 0.32
Isolates 12.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.29
Nodule 1.28
Rhizoplane 3.2
Rhizosphere 61.47
Stem 0
Stem Tuber 0
Unclassified 16.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2752670 2162886007 Bacteria 1586
2 JGI25155J39150_1000117 3300002704 Bacteria 39472
3 JGI25155J39150_1000134 3300002704 Bacteria 35162
4 JGI25155J39150_1000227 3300002704 Bacteria 22140
5 JGI25155J39150_1000896 3300002704 Bacteria 4175
6 JGI25156J39149_1000108 3300002705 Bacteria 59882
7 JGI25156J39149_1000270 3300002705 Bacteria 35162
8 JGI25156J39149_1006902 3300002705 Bacteria 3049
9 JGI25156J39149_1014331 3300002705 Bacteria 1640
10 JGI25162J39368_1004472 3300002737 Bacteria 3218
11 JGI25154J39366_1000222 3300002738 Bacteria 38773
12 JGI25154J39366_1000247 3300002738 Bacteria 35162
13 JGI25154J39366_1000569 3300002738 Bacteria 18094
14 JGI25154J39366_1000582 3300002738 Bacteria 17719
15 JGI25154J39366_1001350 3300002738 Bacteria 8980
16 JGI25157J39369_1000120 3300002741 Bacteria 67137
17 JGI25157J39369_1000311 3300002741 Bacteria 35146
18 JGI25163J39215_1003006 3300002771 Bacteria 1471
19 JGI25150J39212_1002850 3300002774 Bacteria 4185
20 JGI25165J46597_1000001 3300003214 Bacteria 1111887
21 JGI25161J50226_1005205 3300003374 Bacteria 2573
22 JGI25161J50226_1005307 3300003374 Bacteria 2523
23 Ga0006562J51391_1018386 3300003578 Bacteria 1832
24 Ga0055538_1000001 3300003751 Bacteria 1111887
25 Ga0055538_1000002 3300003751 Bacteria 999437
26 Ga0055538_1000020 3300003751 Bacteria 264193
27 Ga0055539_1000001 3300003752 Bacteria 1111887
28 Ga0055539_1000002 3300003752 Bacteria 999437
29 Ga0055539_1000025 3300003752 Bacteria 264193
30 Ga0055533_1000003 3300003756 Bacteria 1111887
31 Ga0055533_1000004 3300003756 Bacteria 999437
32 Ga0055533_1000034 3300003756 Bacteria 264193
33 Ga0055532_1000023 3300003758 Bacteria 248212
34 Ga0055532_1000051 3300003758 Bacteria 165365
35 Ga0055525_1000002 3300003759 Bacteria 999437
36 Ga0055525_1000003 3300003759 Bacteria 962094
37 Ga0055525_1000044 3300003759 Bacteria 264193
38 Ga0055535_1005122 3300003761 Bacteria 2967
39 Ga0055542_1000022 3300003762 Bacteria 302315
40 Ga0055529_1000138 3300003763 Bacteria 103490
41 Ga0055526_1000411 3300003771 Bacteria 34678
42 Ga0055537_1000134 3300003773 Bacteria 56046
43 Ga0055536_1004046 3300003781 Bacteria 7636
44 Ga0055534_1000088 3300003784 Bacteria 72004
45 Ga0055528_1000630 3300003790 Bacteria 26033
46 Ga0055528_1011813 3300003790 Bacteria 3436
47 Ga0055530_10000962 3300003791 Bacteria 23389
48 Ga0055540_1003446 3300003792 Bacteria 7640
49 Ga0055540_1008455 3300003792 Bacteria 3705
50 Ga0055531_10002924 3300003794 Bacteria 11120
51 Ga0055541_1000001 3300003841 Bacteria 1111887
52 Ga0055541_1000002 3300003841 Bacteria 896405
53 Ga0055541_1000019 3300003841 Bacteria 264193
54 Ga0065704_10085515 3300005289 Bacteria 3206
55 Ga0070682_100012821 3300005337 Bacteria 4811
56 Ga0070660_100016619 3300005339 Bacteria 5345
57 Ga0070661_100090689 3300005344 Bacteria 2263
58 Ga0070669_100177227 3300005353 Bacteria 1666
59 Ga0070674_100052535 3300005356 Bacteria 2811
60 Ga0070659_100015532 3300005366 Bacteria 5702
61 Ga0070705_100047720 3300005440 Bacteria 2477
62 Ga0070694_100005548 3300005444 Bacteria 7640
63 Ga0070663_100154381 3300005455 Bacteria 1763
64 Ga0070663_100184477 3300005455 Bacteria 1620
65 Ga0070678_100038770 3300005456 Bacteria 3357
66 Ga0070662_100028288 3300005457 Bacteria 3900
67 Ga0068867_100179652 3300005459 Bacteria 1682
68 Ga0070665_100024888 3300005548 Bacteria 6032
69 Ga0070665_100068370 3300005548 Bacteria 3562
70 Ga0070665_100653291 3300005548 Bacteria 1065
71 Ga0068855_100000197 3300005563 Bacteria 78127
72 Ga0068855_100001741 3300005563 Bacteria 27181
73 Ga0068855_100011938 3300005563 Bacteria 10503
74 Ga0068855_100015823 3300005563 Bacteria 9074
75 Ga0068855_100144470 3300005563 Bacteria 2710
76 Ga0068855_100176065 3300005563 Bacteria 2421
77 Ga0068855_100567453 3300005563 Bacteria 1227
78 Ga0068857_100042395 3300005577 Bacteria 4037
79 Ga0068854_100002908 3300005578 Bacteria 10624
80 Ga0068854_100051852 3300005578 Bacteria 2941
81 Ga0068852_100006280 3300005616 Bacteria 8579
82 Ga0068852_100193027 3300005616 Bacteria 1923
83 Ga0068852_100347458 3300005616 Bacteria 1447
84 Ga0068859_100075066 3300005617 Bacteria 3421
85 Ga0068851_10033206 3300005834 Bacteria 2571
86 Ga0068851_10104691 3300005834 Bacteria 1505
87 Ga0075363_100024393 3300006048 Bacteria 3074
88 Ga0075364_10096102 3300006051 Bacteria 1970
89 Ga0075362_10013049 3300006177 Bacteria 3316
90 Ga0075366_10024573 3300006195 Bacteria 3514
91 Ga0075366_10026719 3300006195 Bacteria 3382
92 Ga0075366_10051626 3300006195 Bacteria 2443
93 Ga0075370_10034392 3300006353 Bacteria 2840
94 Ga0075370_10126922 3300006353 Bacteria 1487
95 Ga0075370_10150195 3300006353 Bacteria 1365
96 Ga0097620_100075065 3300006931 Bacteria 3421
97 Ga0079104_1029369 3300006946 Bacteria 1386
98 Ga0099826_10000002 3300006948 Bacteria 1125830
99 Ga0099826_10001370 3300006948 Bacteria 14497
100 Ga0105244_10012570 3300009036 Bacteria 4994
101 Ga0105240_10001798 3300009093 Bacteria 36105
102 Ga0105240_10012173 3300009093 Bacteria 11908
103 Ga0105240_10017029 3300009093 Bacteria 9817
104 Ga0105240_10097593 3300009093 Bacteria 3580
105 Ga0105240_10514341 3300009093 Bacteria 1329
106 Ga0105243_10006758 3300009148 Bacteria 8850
107 Ga0105243_10009873 3300009148 Bacteria 7260
108 Ga0105241_10165016 3300009174 Bacteria 1824
109 Ga0105241_10170626 3300009174 Bacteria 1797
110 Ga0105242_10102178 3300009176 Bacteria 2431
111 Ga0105242_10104410 3300009176 Bacteria 2405
112 Ga0105237_10014721 3300009545 Bacteria 8167
113 Ga0105238_10000977 3300009551 Bacteria 29236
114 Ga0105238_10025787 3300009551 Bacteria 5993
115 Ga0105238_10064300 3300009551 Bacteria 3669
116 Ga0105238_10125694 3300009551 Bacteria 2543
117 Ga0105238_10145333 3300009551 Bacteria 2348
118 Ga0105239_10083666 3300010375 Bacteria 3514
119 Ga0105239_10252868 3300010375 Bacteria 1979
120 Ga0105239_10263864 3300010375 Bacteria 1936
121 Ga0105239_10302309 3300010375 Bacteria 1802
122 Ga0105246_10051565 3300011119 Bacteria 2826
123 Ga0157373_10068307 3300013100 Bacteria 2512
124 Ga0157373_10074161 3300013100 Bacteria 2400
125 Ga0157371_10134905 3300013102 Bacteria 1758
126 Ga0157370_10039005 3300013104 Bacteria 4593
127 Ga0157369_10007881 3300013105 Bacteria 12245
128 Ga0157378_10059023 3300013297 Bacteria 3422
129 Ga0163162_10027211 3300013306 Bacteria 5654
130 Ga0157372_10165903 3300013307 Bacteria 2554
131 Ga0157372_10201211 3300013307 Bacteria 2307
132 Ga0182008_10000515 3300014497 Bacteria 29030
133 Ga0182008_10002427 3300014497 Bacteria 11696
134 Ga0182008_10006865 3300014497 Bacteria 6333
135 Ga0182008_10011104 3300014497 Bacteria 4805
136 Ga0182008_10016496 3300014497 Bacteria 3838
137 Ga0182008_10027129 3300014497 Bacteria 2903
138 Ga0182006_1000112 3300015261 Bacteria 87378
139 Ga0182006_1001190 3300015261 Bacteria 16280
140 Ga0182006_1001570 3300015261 Bacteria 13642
141 Ga0182006_1011405 3300015261 Bacteria 3912
142 Ga0182006_1012894 3300015261 Bacteria 3647
143 Ga0182006_1032526 3300015261 Bacteria 2096
144 Ga0182007_10000020 3300015262 Bacteria 194053
145 Ga0182007_10001908 3300015262 Bacteria 10838
146 Ga0182007_10003300 3300015262 Bacteria 7652
147 Ga0182007_10003866 3300015262 Bacteria 6952
148 Ga0182005_1000001 3300015265 Bacteria 1014869
149 Ga0182005_1000662 3300015265 Bacteria 16334
150 Ga0182005_1016651 3300015265 Bacteria 2043
151 Ga0183362_10005 3300015683 Bacteria 437616
152 Ga0163161_10015085 3300017792 Bacteria 5387
153 Ga0163161_10020171 3300017792 Bacteria 4676
154 Ga0163161_10065072 3300017792 Bacteria 2660
155 Ga0213872_10000001 3300021361 Bacteria 662532
156 Ga0213872_10001896 3300021361 Bacteria 12853
157 Ga0213872_10034749 3300021361 Bacteria 2306
158 Ga0224712_10051595 3300022467 Bacteria 1602
159 Ga0209435_100013 3300025206 Bacteria 366789
160 Ga0209435_100028 3300025206 Bacteria 182520
161 Ga0209435_100300 3300025206 Bacteria 11986
162 Ga0209435_100501 3300025206 Bacteria 7723
163 Ga0209784_100002 3300025224 Bacteria 1753105
164 Ga0209784_100004 3300025224 Bacteria 1378156
165 Ga0209566_100003 3300025225 Bacteria 1753105
166 Ga0209566_100004 3300025225 Bacteria 1531866
167 Ga0209674_100004 3300025226 Bacteria 1753105
168 Ga0209674_100006 3300025226 Bacteria 1531866
169 Ga0209672_101007 3300025228 Bacteria 12321
170 Ga0209147_100004 3300025229 Bacteria 1371850
171 Ga0209147_100030 3300025229 Bacteria 366789
172 Ga0209147_103626 3300025229 Bacteria 2897
173 Ga0209563_100006 3300025230 Bacteria 1753105
174 Ga0209563_100007 3300025230 Bacteria 1579402
175 Ga0209563_100009 3300025230 Bacteria 1378156
176 Ga0207427_100254 3300025231 Bacteria 42320
177 Ga0209437_100004 3300025233 Bacteria 1378156
178 Ga0209437_100053 3300025233 Bacteria 375580
179 Ga0209437_100275 3300025233 Bacteria 76419
180 Ga0209258_100009 3300025242 Bacteria 996276
181 Ga0209258_100325 3300025242 Bacteria 72077
182 Ga0209258_100667 3300025242 Bacteria 24373
183 Ga0207425_1000455 3300025245 Bacteria 26503
184 Ga0209646_1000021 3300025246 Bacteria 461083
185 Ga0209646_1000034 3300025246 Bacteria 366789
186 Ga0209646_1000051 3300025246 Bacteria 296525
187 Ga0209646_1000095 3300025246 Bacteria 182520
188 Ga0209646_1000378 3300025246 Bacteria 28778
189 Ga0209026_1000022 3300025250 Bacteria 366789
190 Ga0209026_1000110 3300025250 Bacteria 141989
191 Ga0209026_1005223 3300025250 Bacteria 3554
192 Ga0209026_1014788 3300025250 Bacteria 1295
193 Ga0209677_100003 3300025253 Bacteria 1753105
194 Ga0209677_100005 3300025253 Bacteria 1378156
195 Ga0209677_101197 3300025253 Bacteria 11833
196 Ga0209148_1000007 3300025254 Bacteria 1592273
197 Ga0209148_1000985 3300025254 Bacteria 18369
198 Ga0209759_1000018 3300025256 Bacteria 366789
199 Ga0209759_1000080 3300025256 Bacteria 171186
200 Ga0209759_1000115 3300025256 Bacteria 141877
201 Ga0209759_1000155 3300025256 Bacteria 118819
202 Ga0209759_1000553 3300025256 Bacteria 38286
203 Ga0209129_1000024 3300025258 Bacteria 417268
204 Ga0209129_1000085 3300025258 Bacteria 181765
205 Ga0209129_1005702 3300025258 Bacteria 4294
206 Ga0209233_1000005 3300025261 Bacteria 1531866
207 Ga0209565_1000046 3300025263 Bacteria 226073
208 Ga0209455_1000043 3300025272 Bacteria 413928
209 Ga0209455_1006519 3300025272 Bacteria 3432
210 Ga0209673_1000058 3300025273 Bacteria 269028
211 Ga0209673_1010330 3300025273 Bacteria 3942
212 Ga0209673_1010835 3300025273 Bacteria 3810
213 Ga0209130_1002262 3300025284 Bacteria 9935
214 Ga0209675_1000010 3300025291 Bacteria 541927
215 Ga0209675_1005766 3300025291 Bacteria 5104
216 Ga0209676_1000028 3300025292 Bacteria 559745
217 Ga0209676_1000098 3300025292 Bacteria 234305
218 Ga0209676_1000173 3300025292 Bacteria 153411
219 Ga0209676_1000194 3300025292 Bacteria 136666
220 Ga0209676_1041817 3300025292 Bacteria 1277
221 Ga0209676_1049270 3300025292 Bacteria 1119
222 Ga0209025_1000122 3300025294 Bacteria 206064
223 Ga0209025_1000404 3300025294 Bacteria 87744
224 Ga0209025_1002209 3300025294 Bacteria 21508
225 Ga0209025_1002394 3300025294 Bacteria 20027
226 Ga0209025_1019136 3300025294 Bacteria 3826
227 Ga0209564_1000011 3300025295 Bacteria 822327
228 Ga0209564_1000089 3300025295 Bacteria 249694
229 Ga0209564_1000183 3300025295 Bacteria 150409
230 Ga0209564_1000198 3300025295 Bacteria 138511
231 Ga0209758_1000049 3300025297 Bacteria 345104
232 Ga0209758_1000286 3300025297 Bacteria 99636
233 Ga0209050_1000002 3300025298 Bacteria 1792849
234 Ga0209050_1000122 3300025298 Bacteria 195305
235 Ga0209050_1000554 3300025298 Bacteria 61514
236 Ga0209050_1005757 3300025298 Bacteria 7642
237 Ga0209256_1000098 3300025299 Bacteria 204152
238 Ga0209256_1000140 3300025299 Bacteria 152770
239 Ga0207426_1000038 3300025302 Bacteria 441522
240 Ga0207426_1000053 3300025302 Bacteria 384818
241 Ga0209051_1000015 3300025303 Bacteria 546798
242 Ga0209051_1000159 3300025303 Bacteria 126836
243 Ga0209051_1000194 3300025303 Bacteria 107213
244 Ga0209051_1000282 3300025303 Bacteria 82787
245 Ga0209051_1000597 3300025303 Bacteria 42565
246 Ga0209051_1014777 3300025303 Bacteria 3625
247 Ga0209257_1000002 3300025304 Bacteria 1767052
248 Ga0209257_1004288 3300025304 Bacteria 11233
249 Ga0207656_10010157 3300025321 Bacteria 3516
250 Ga0207656_10044790 3300025321 Bacteria 1891
251 Ga0207655_1002288 3300025728 Bacteria 15755
252 Ga0207705_10000483 3300025909 Bacteria 34144
253 Ga0207654_10083951 3300025911 Bacteria 1924
254 Ga0207695_10001636 3300025913 Bacteria 36191
255 Ga0207695_10011312 3300025913 Bacteria 10818
256 Ga0207695_10013645 3300025913 Bacteria 9675
257 Ga0207695_10128419 3300025913 Bacteria 2494
258 Ga0207671_10012800 3300025914 Bacteria 6724
259 Ga0207671_10018653 3300025914 Bacteria 5316
260 Ga0207657_10001945 3300025919 Bacteria 22301
261 Ga0207649_10339708 3300025920 Bacteria 1108
262 Ga0207694_10000873 3300025924 Bacteria 26821
263 Ga0207694_10039691 3300025924 Bacteria 3623
264 Ga0207694_10075465 3300025924 Bacteria 2639
265 Ga0207694_10154467 3300025924 Bacteria 1850
266 Ga0207694_10158047 3300025924 Bacteria 1830
267 Ga0207687_10094183 3300025927 Bacteria 2191
268 Ga0207690_10062274 3300025932 Bacteria 2539
269 Ga0207690_10072303 3300025932 Bacteria 2382
270 Ga0207706_10025112 3300025933 Bacteria 5342
271 Ga0207706_10109345 3300025933 Bacteria 2433
272 Ga0207686_10057268 3300025934 Bacteria 2453
273 Ga0207686_10126524 3300025934 Bacteria 1747
274 Ga0207709_10000285 3300025935 Bacteria 57630
275 Ga0207709_10004960 3300025935 Bacteria 7618
276 Ga0207709_10058461 3300025935 Bacteria 2396
277 Ga0207667_10000034 3300025949 Bacteria 304569
278 Ga0207667_10000036 3300025949 Bacteria 297966
279 Ga0207667_10007030 3300025949 Bacteria 13597
280 Ga0207667_10081172 3300025949 Bacteria 3359
281 Ga0207667_10092734 3300025949 Bacteria 3119
282 Ga0207667_10099953 3300025949 Bacteria 2993
283 Ga0207667_10146730 3300025949 Bacteria 2429
284 Ga0207667_10427423 3300025949 Bacteria 1347
285 Ga0207651_10457643 3300025960 Bacteria 1096
286 Ga0207640_10023722 3300025981 Bacteria 3691
287 Ga0207640_10238320 3300025981 Bacteria 1404
288 Ga0207658_10302372 3300025986 Bacteria 1379
289 Ga0207639_10010174 3300026041 Bacteria 6508
290 Ga0207639_10379058 3300026041 Bacteria 1270
291 Ga0207678_10287145 3300026067 Bacteria 1413
292 Ga0207648_10057270 3300026089 Bacteria 3400
293 Ga0207648_10263216 3300026089 Bacteria 1539
294 Ga0207674_10264276 3300026116 Bacteria 1668
295 Ga0207683_10166283 3300026121 Bacteria 1996
296 Ga0207683_10175634 3300026121 Bacteria 1941
297 Ga0207698_10009166 3300026142 Bacteria 6292
298 Ga0207698_10067159 3300026142 Bacteria 2827
299 Ga0207698_10476583 3300026142 Bacteria 1210
300 Ga0209282_1000001 3300027666 Bacteria 2450367
301 Ga0209282_1001079 3300027666 Bacteria 14459
302 Ga0207428_10117068 3300027907 Bacteria 2046
303 Ga0268266_10324922 3300028379 Bacteria 1441
304 Ga0268265_10015308 3300028380 Bacteria 5247
305 Ga0307515_10012653 3300028794 Bacteria 15850
306 Ga0316177_1117067 3300030731 Bacteria 2553
307 Ga0316176_1072478 3300030732 Bacteria 2661
308 Ga0314311_1059701 3300030733 Bacteria 1733
309 Ga0316178_1142965 3300030735 Bacteria 7757
310 Ga0316180_1061916 3300030736 Bacteria 1505
311 Ga0316183_1076813 3300030742 Bacteria 4172
312 Ga0316181_1034408 3300030744 Bacteria 3273
313 Ga0316182_1050266 3300030745 Bacteria 2582
314 Ga0265327_10005786 3300031251 Bacteria 10168
315 Ga0265327_10013542 3300031251 Bacteria 5411
316 Ga0307408_100000678 3300031548 Bacteria 28125
317 Ga0307514_10024217 3300031649 Bacteria 4918
318 Ga0265314_10010643 3300031711 Bacteria 7654
319 Ga0307405_10010853 3300031731 Bacteria 4744
320 Ga0307405_10066709 3300031731 Bacteria 2295
321 Ga0307406_10001422 3300031901 Bacteria 13270
322 Ga0307412_10033751 3300031911 Bacteria 3255
323 Ga0307412_10049150 3300031911 Bacteria 2778
324 Ga0307412_10075260 3300031911 Bacteria 2315
325 Ga0307414_10025305 3300032004 Bacteria 3799
326 Ga0307415_100418125 3300032126 Bacteria 1149
327 Ga0373939_0014902 3300035114 Bacteria 2025
328 Ga0373931_0083192 3300035691 Bacteria 1770
329 Ga0395899_0002047 3300037312 Bacteria 16612
330 Ga0395899_0004769 3300037312 Bacteria 10574
331 Ga0395899_0008647 3300037312 Bacteria 7833
332 Ga0395899_0009612 3300037312 Bacteria 7421
333 Ga0395900_0000402 3300037418 Bacteria 62208
334 Ga0395900_0002186 3300037418 Bacteria 21856
335 Ga0395900_0002328 3300037418 Bacteria 21022
336 Ga0395900_0023829 3300037418 Bacteria 6262
337 Ga0395900_0031677 3300037418 Bacteria 5434
338 Ga0395900_0049239 3300037418 Bacteria 4341
339 Ga0395900_0075873 3300037418 Bacteria 3455
340 Ga0395900_0117216 3300037418 Bacteria 2732
341 Ga0395898_0071146 3300037466 Bacteria 3362
342 Ga0395898_0164041 3300037466 Bacteria 2125
343 Ga0395898_0192527 3300037466 Bacteria 1948
344 Ga0395905_0023958 3300037471 Bacteria 5763
345 Ga0395905_0024207 3300037471 Bacteria 5731
346 Ga0395905_0032524 3300037471 Bacteria 4905
347 Ga0395905_0275951 3300037471 Bacteria 1567
348 Ga0395905_0291229 3300037471 Bacteria 1519
349 Ga0395905_0344883 3300037471 Bacteria 1381
350 Ga0395901_0000250 3300038443 Bacteria 66983
351 Ga0395901_0000482 3300038443 Bacteria 46374
352 Ga0395901_0004717 3300038443 Bacteria 13763
353 Ga0395901_0009268 3300038443 Bacteria 9982
354 Ga0395901_0064881 3300038443 Bacteria 3801
355 Ga0395901_0327421 3300038443 Bacteria 1584
356 Ga0436361_0075458 3300039447 Bacteria 23492
357 Ga0436361_0086588 3300039447 Bacteria 17320
358 Ga0436361_0099372 3300039447 Bacteria 18108
359 Ga0436361_0379135 3300039447 Bacteria 12224
360 Ga0436361_0481825 3300039447 Bacteria 7344
361 Ga0436361_0560696 3300039447 Bacteria 5389
362 Ga0436361_0577764 3300039447 Bacteria 2148
363 Ga0436361_1153033 3300039447 Bacteria 2322
364 Ga0439436_0000382 3300041404 Bacteria 11010
365 Ga0439436_0004185 3300041404 Bacteria 4419
366 Ga0439439_0003399 3300041406 Bacteria 3510
367 Ga0439453_0015626 3300041408 Bacteria 1315
368 Ga0439466_0001231 3300041411 Bacteria 9960
369 Ga0439466_0021970 3300041411 Bacteria 2256
370 Ga0439465_0001246 3300041413 Bacteria 8214
371 Ga0439465_0015400 3300041413 Bacteria 2386
372 Ga0439431_0012337 3300041997 Bacteria 1962
373 Ga0439433_0002040 3300041999 Bacteria 4247
374 Ga0439433_0006272 3300041999 Bacteria 2559
375 Ga0439441_016825 3300042001 Bacteria 1307
376 Ga0439442_002770 3300042002 Bacteria 3442
377 Ga0439442_013545 3300042002 Bacteria 1673
378 Ga0439445_0000223 3300042004 Bacteria 10550
379 Ga0439448_0001130 3300042005 Bacteria 6731
380 Ga0439432_001997 3300042006 Bacteria 7723
381 Ga0439432_002220 3300042006 Bacteria 7326
382 Ga0439449_0000209 3300042007 Bacteria 20674
383 Ga0439449_0000215 3300042007 Bacteria 20490
384 Ga0439449_0005047 3300042007 Bacteria 5077
385 Ga0439449_0021863 3300042007 Bacteria 2394
386 Ga0439449_0063778 3300042007 Bacteria 1359
387 Ga0439452_024773 3300042010 Bacteria 1530
388 Ga0439457_003046 3300042014 Bacteria 4641
389 Ga0439462_0013469 3300042015 Bacteria 2095
390 Ga0450923_005020 3300042125 Bacteria 2114
391 Ga0450923_016250 3300042125 Bacteria 1400
392 Ga0450899_006515 3300042135 Bacteria 1264
393 Ga0450907_005113 3300042146 Bacteria 2224
394 Ga0439446_0003872 3300042156 Bacteria 3755
395 Ga0450908_000697 3300042184 Bacteria 6439
396 Ga0450909_003723 3300042185 Bacteria 2167
397 Ga0450909_005523 3300042185 Bacteria 1817
398 Ga0439434_0001906 3300042435 Bacteria 6054
399 Ga0439434_0014465 3300042435 Bacteria 2347
400 Ga0450918_000817 3300042531 Bacteria 6534
401 Ga0466969_0070575 3300044656 Bacteria 1680
402 Ga0466972_0002538 3300044658 Bacteria 9032
403 Ga0466972_0012350 3300044658 Bacteria 4292
404 Ga0466965_0001072 3300044683 Bacteria 10628
405 Ga0466965_0039961 3300044683 Bacteria 2307
406 Ga0466965_0061551 3300044683 Bacteria 1876
407 Ga0466965_0066902 3300044683 Bacteria 1802
408 Ga0466966_0038405 3300044684 Bacteria 3085
409 Ga0466963_0009383 3300044694 Bacteria 5894
410 Ga0466964_0000992 3300044706 Bacteria 9422
411 Ga0466964_0001256 3300044706 Bacteria 8623
412 Ga0466964_0111066 3300044706 Bacteria 1222
413 Ga0466971_0019600 3300044719 Bacteria 3006
414 Ga0466968_0001194 3300044735 Bacteria 9185
415 Ga0466968_0002868 3300044735 Bacteria 6375
416 Ga0466968_0055523 3300044735 Bacteria 1700
417 Ga0466970_0008154 3300044765 Bacteria 5261
418 Ga0466970_0033147 3300044765 Bacteria 2730
419 Ga0466957_0005465 3300044842 Bacteria 7131
420 Ga0466957_0019951 3300044842 Bacteria 3945
421 Ga0466957_0044623 3300044842 Bacteria 2687
422 Ga0451576_0730377 3300045051 Bacteria 1040
423 Ga0466967_0318479 3300045976 Bacteria 1499
424 Ga0495617_000216 3300046452 Bacteria 35255
425 Ga0495617_003012 3300046452 Bacteria 6429
426 Ga0495617_008767 3300046452 Bacteria 3481
427 Ga0495617_015123 3300046452 Bacteria 2618
428 Ga0495627_014963 3300046453 Bacteria 2690
429 Ga0495590_0000002 3300046457 Bacteria 485720
430 Ga0495638_0000367 3300046460 Bacteria 55964
431 Ga0495638_0010640 3300046460 Bacteria 6372
432 Ga0495638_0012288 3300046460 Bacteria 5873
433 Ga0495638_0071080 3300046460 Bacteria 2129
434 Ga0495638_0102593 3300046460 Bacteria 1709
435 Ga0495651_0005781 3300046462 Bacteria 9438
436 Ga0495651_0224859 3300046462 Bacteria 1296
437 Ga0495653_0001714 3300046463 Bacteria 17267
438 Ga0495653_0258326 3300046463 Bacteria 1153
439 Ga0495650_0000224 3300046471 Bacteria 118058
440 Ga0495650_0000521 3300046471 Bacteria 56415
441 Ga0495650_0000631 3300046471 Bacteria 47329
442 Ga0495650_0005201 3300046471 Bacteria 8550
443 Ga0495650_0014288 3300046471 Bacteria 4141
444 Ga0495650_0045766 3300046471 Bacteria 1840
445 Ga0495605_0000028 3300046474 Bacteria 218471
446 Ga0495605_0000325 3300046474 Bacteria 48544
447 Ga0495605_0001338 3300046474 Bacteria 16309
448 Ga0495584_0000153 3300046491 Bacteria 47948
449 Ga0495584_0001517 3300046491 Bacteria 13798
450 Ga0495584_0006647 3300046491 Bacteria 6044
451 Ga0495585_0000206 3300046492 Bacteria 61632
452 Ga0495585_0000353 3300046492 Bacteria 44438
453 Ga0495585_0000563 3300046492 Bacteria 35041
454 Ga0495585_0004163 3300046492 Bacteria 9451
455 Ga0495585_0004455 3300046492 Bacteria 9080
456 Ga0495585_0010007 3300046492 Bacteria 5665
457 Ga0495585_0012096 3300046492 Bacteria 5091
458 Ga0495585_0027642 3300046492 Bacteria 3237
459 Ga0495585_0054779 3300046492 Bacteria 2204
460 Ga0495585_0069864 3300046492 Bacteria 1916
461 Ga0495596_0000680 3300046500 Bacteria 21142
462 Ga0495596_0000699 3300046500 Bacteria 20806
463 Ga0495596_0004429 3300046500 Bacteria 6846
464 Ga0495596_0019756 3300046500 Bacteria 2763
465 Ga0495607_0004790 3300046501 Bacteria 9881
466 Ga0495607_0008801 3300046501 Bacteria 6872
467 Ga0495607_0034547 3300046501 Bacteria 3066
468 Ga0495607_0099855 3300046501 Bacteria 1556
469 Ga0495583_0000424 3300046506 Bacteria 63938
470 Ga0495583_0000537 3300046506 Bacteria 53610
471 Ga0495583_0000741 3300046506 Bacteria 41476
472 Ga0495583_0045206 3300046506 Bacteria 2037
473 Ga0495583_0069740 3300046506 Bacteria 1547
474 Ga0495606_0000001 3300046507 Bacteria 592123
475 Ga0495606_0000245 3300046507 Bacteria 95825
476 Ga0495606_0000526 3300046507 Bacteria 61953
477 Ga0495606_0001009 3300046507 Bacteria 40935
478 Ga0495606_0008453 3300046507 Bacteria 8936
479 Ga0495606_0010586 3300046507 Bacteria 7633
480 Ga0495606_0012994 3300046507 Bacteria 6622
481 Ga0495606_0022037 3300046507 Bacteria 4655
482 Ga0495606_0027916 3300046507 Bacteria 3990
483 Ga0495606_0029465 3300046507 Bacteria 3853
484 Ga0495606_0085182 3300046507 Bacteria 1955
485 Ga0495608_0002860 3300046511 Bacteria 12371
486 Ga0495608_0054992 3300046511 Bacteria 2630
487 Ga0495610_0000106 3300046512 Bacteria 97582
488 Ga0495610_0003952 3300046512 Bacteria 11224
489 Ga0495610_0004909 3300046512 Bacteria 9714
490 Ga0495610_0013556 3300046512 Bacteria 4838
491 Ga0495610_0051705 3300046512 Bacteria 1998
492 Ga0495616_0000316 3300046513 Bacteria 38626
493 Ga0495616_0001403 3300046513 Bacteria 16778
494 Ga0495616_0003860 3300046513 Bacteria 9551
495 Ga0495616_0006109 3300046513 Bacteria 7337
496 Ga0495616_0013484 3300046513 Bacteria 4609
497 Ga0495616_0074419 3300046513 Bacteria 1636
498 Ga0495620_0004751 3300046515 Bacteria 7640
499 Ga0495628_0000929 3300046516 Bacteria 26874
500 Ga0495630_0125540 3300046517 Bacteria 1948
501 Ga0495631_0011497 3300046518 Bacteria 4352
502 Ga0495631_0011741 3300046518 Bacteria 4297
503 Ga0495631_0019279 3300046518 Bacteria 3199
504 Ga0495632_0000725 3300046519 Bacteria 29897
505 Ga0495632_0007105 3300046519 Bacteria 7086
506 Ga0495632_0007449 3300046519 Bacteria 6874
507 Ga0495637_0001337 3300046520 Bacteria 14795
508 Ga0495637_0001872 3300046520 Bacteria 12011
509 Ga0495637_0008922 3300046520 Bacteria 4906
510 Ga0495643_0000444 3300046522 Bacteria 53441
511 Ga0495643_0000643 3300046522 Bacteria 41372
512 Ga0495643_0000777 3300046522 Bacteria 35586
513 Ga0495643_0001278 3300046522 Bacteria 24108
514 Ga0495643_0003064 3300046522 Bacteria 12563
515 Ga0495643_0049890 3300046522 Bacteria 2255
516 Ga0495643_0092143 3300046522 Bacteria 1562
517 Ga0495643_0101656 3300046522 Bacteria 1472
518 Ga0495644_0001322 3300046523 Bacteria 10148
519 Ga0495644_0001761 3300046523 Bacteria 8733
520 Ga0495644_0010287 3300046523 Bacteria 3605
521 Ga0495648_0000037 3300046524 Bacteria 195401
522 Ga0495648_0000722 3300046524 Bacteria 35218
523 Ga0495648_0001252 3300046524 Bacteria 25382
524 Ga0495648_0002410 3300046524 Bacteria 17336
525 Ga0495648_0007092 3300046524 Bacteria 9022
526 Ga0495648_0009168 3300046524 Bacteria 7711
527 Ga0495648_0025349 3300046524 Bacteria 4016
528 Ga0495663_0004113 3300046525 Bacteria 4120
529 Ga0495663_0006991 3300046525 Bacteria 3112
530 Ga0495666_0174189 3300046526 Bacteria 995
531 Ga0495642_0000386 3300046528 Bacteria 23828
532 Ga0495642_0009306 3300046528 Bacteria 3761
533 Ga0495642_0012839 3300046528 Bacteria 3233
534 Ga0495642_0015965 3300046528 Bacteria 2923
535 Ga0495642_0027357 3300046528 Bacteria 2269
536 Ga0495642_0054397 3300046528 Bacteria 1650
537 Ga0495652_0002952 3300046529 Bacteria 17113
538 Ga0495652_0010677 3300046529 Bacteria 8319
539 Ga0495654_0000015 3300046530 Bacteria 307873
540 Ga0495654_0012233 3300046530 Bacteria 4615
541 Ga0495609_0000039 3300046538 Bacteria 179384
542 Ga0495609_0000730 3300046538 Bacteria 24990
543 Ga0495609_0001009 3300046538 Bacteria 20017
544 Ga0495609_0007230 3300046538 Bacteria 5569
545 Ga0495609_0008314 3300046538 Bacteria 5089
546 Ga0495609_0008580 3300046538 Bacteria 4995
547 Ga0495609_0014663 3300046538 Bacteria 3680
548 Ga0495621_0031994 3300046539 Bacteria 1807
549 Ga0495597_0000327 3300046542 Bacteria 43101
550 Ga0495597_0000874 3300046542 Bacteria 23420
551 Ga0495597_0023099 3300046542 Bacteria 2878
552 Ga0495597_0042045 3300046542 Bacteria 2039
553 Ga0495597_0077321 3300046542 Bacteria 1426
554 Ga0495597_0098405 3300046542 Bacteria 1235
555 Ga0495645_0008074 3300046543 Bacteria 7334
556 Ga0495622_0002083 3300046557 Bacteria 9775
557 Ga0495622_0052385 3300046557 Bacteria 1893
558 Ga0495633_0000244 3300046558 Bacteria 65398
559 Ga0495633_0000433 3300046558 Bacteria 43302
560 Ga0495633_0007472 3300046558 Bacteria 6284
561 Ga0495633_0011567 3300046558 Bacteria 4749
562 Ga0495633_0049750 3300046558 Bacteria 1977
563 Ga0495656_0000087 3300046615 Bacteria 40520
564 Ga0495656_0014357 3300046615 Bacteria 2969
565 Ga0495656_0062292 3300046615 Bacteria 1631
566 Ga0495668_0000241 3300046616 Bacteria 78040
567 Ga0495668_0002017 3300046616 Bacteria 17725
568 Ga0495668_0003173 3300046616 Bacteria 12642
569 Ga0495668_0003228 3300046616 Bacteria 12435
570 Ga0495668_0003498 3300046616 Bacteria 11713
571 Ga0495668_0005941 3300046616 Bacteria 8108
572 Ga0495668_0056002 3300046616 Bacteria 2177
573 Ga0495668_0107004 3300046616 Bacteria 1529
574 Ga0495668_0148792 3300046616 Bacteria 1282
575 Ga0495611_0007509 3300046648 Bacteria 4627
576 Ga0495611_0027723 3300046648 Bacteria 2477
577 Ga0495611_0031839 3300046648 Bacteria 2323
578 Ga0495625_0000245 3300046660 Bacteria 85443
579 Ga0495625_0002452 3300046660 Bacteria 20039
580 Ga0495625_0002538 3300046660 Bacteria 19640
581 Ga0495625_0006115 3300046660 Bacteria 10786
582 Ga0495625_0006849 3300046660 Bacteria 10066
583 Ga0495625_0010538 3300046660 Bacteria 7635
584 Ga0495625_0018274 3300046660 Bacteria 5477
585 Ga0495625_0062113 3300046660 Bacteria 2641
586 Ga0495625_0162630 3300046660 Bacteria 1494
587 Ga0495635_0083950 3300046663 Bacteria 2180
588 Ga0495635_0243158 3300046663 Bacteria 1214
589 Ga0495659_0000244 3300046664 Bacteria 22578
590 Ga0495659_0000262 3300046664 Bacteria 21388
591 Ga0495659_0026247 3300046664 Bacteria 2000
592 Ga0495661_0000903 3300046665 Bacteria 27258
593 Ga0495661_0001155 3300046665 Bacteria 23050
594 Ga0495661_0003555 3300046665 Bacteria 11481
595 Ga0495661_0019219 3300046665 Bacteria 4482
596 Ga0495661_0021310 3300046665 Bacteria 4226
597 Ga0495661_0037262 3300046665 Bacteria 3037
598 Ga0495661_0043566 3300046665 Bacteria 2757
599 Ga0495661_0142803 3300046665 Bacteria 1301
600 Ga0495588_0000110 3300046674 Bacteria 142825
601 Ga0495588_0007799 3300046674 Bacteria 4888
602 Ga0495657_0044637 3300046675 Bacteria 3014
603 Ga0495646_0012297 3300046680 Bacteria 5443
604 Ga0495646_0165249 3300046680 Bacteria 1223
605 Ga0495658_0020233 3300046683 Bacteria 3489
606 Ga0495669_0006620 3300046684 Bacteria 4847
607 Ga0495670_0013956 3300046691 Bacteria 3951
608 Ga0495670_0023650 3300046691 Bacteria 3032
609 Ga0495670_0029080 3300046691 Bacteria 2741
610 Ga0495670_0030705 3300046691 Bacteria 2669
611 Ga0495670_0061819 3300046691 Bacteria 1883
612 Ga0495670_0103366 3300046691 Bacteria 1469
613 Ga0495671_0000006 3300046692 Bacteria 500471
614 Ga0495671_0000379 3300046692 Bacteria 36536
615 Ga0495671_0008804 3300046692 Bacteria 5668
616 Ga0495671_0013546 3300046692 Bacteria 4409
617 Ga0495671_0035496 3300046692 Bacteria 2531
618 Ga0495671_0037913 3300046692 Bacteria 2436
619 Ga0495649_0009011 3300046694 Bacteria 5959
620 Ga0495649_0024838 3300046694 Bacteria 3340
621 Ga0495589_0000019 3300046794 Bacteria 200814
622 Ga0495589_0000828 3300046794 Bacteria 19423
623 Ga0495589_0030098 3300046794 Bacteria 2735
624 Ga0495589_0171744 3300046794 Bacteria 1030
625 Ga0495600_0000151 3300046809 Bacteria 39828
626 Ga0495660_0000572 3300046810 Bacteria 29701
627 Ga0495660_0006376 3300046810 Bacteria 6985
628 Ga0495636_0004266 3300047318 Bacteria 5610
629 Ga0495636_0011979 3300047318 Bacteria 3436
630 Ga0495672_0000368 3300047320 Bacteria 57095
631 Ga0495672_0000753 3300047320 Bacteria 35468
632 Ga0495672_0003317 3300047320 Bacteria 13913
633 Ga0495672_0004744 3300047320 Bacteria 10974
634 Ga0495672_0018354 3300047320 Bacteria 4647
635 Ga0495676_0228246 3300047321 Bacteria 1280
636 Ga0495683_0000151 3300047323 Bacteria 68310
637 Ga0495683_0004352 3300047323 Bacteria 8069
638 Ga0495683_0014326 3300047323 Bacteria 4131
639 Ga0495683_0016725 3300047323 Bacteria 3806
640 Ga0495683_0038841 3300047323 Bacteria 2408
641 Ga0495687_000059 3300047443 Bacteria 179357
642 Ga0495687_000191 3300047443 Bacteria 88251
643 Ga0495687_005463 3300047443 Bacteria 8090
644 Ga0495687_005550 3300047443 Bacteria 7999
645 Ga0495687_020878 3300047443 Bacteria 3183
646 Ga0495687_033243 3300047443 Bacteria 2342
647 Ga0495677_0000006 3300047445 Bacteria 199230
648 Ga0495677_0000347 3300047445 Bacteria 19957
649 Ga0495677_0003237 3300047445 Bacteria 6351
650 Ga0495677_0005309 3300047445 Bacteria 4888
651 Ga0495677_0007159 3300047445 Bacteria 4178
652 Ga0495677_0051535 3300047445 Bacteria 1515
653 Ga0495685_000381 3300047447 Bacteria 14066
654 Ga0495673_0000003 3300047469 Bacteria 1491337
655 Ga0495673_0000061 3300047469 Bacteria 230647
656 Ga0495673_0000351 3300047469 Bacteria 57305
657 Ga0495673_0015081 3300047469 Bacteria 3994
658 Ga0495673_0020397 3300047469 Bacteria 3300
659 Ga0495681_0010860 3300047470 Bacteria 5478
660 Ga0495681_0024054 3300047470 Bacteria 3219
661 Ga0495686_0000318 3300047472 Bacteria 80125
662 Ga0495686_0001447 3300047472 Bacteria 25867
663 Ga0495686_0009673 3300047472 Bacteria 6923
664 Ga0495686_0080948 3300047472 Bacteria 1984
665 Ga0495602_0008077 3300048088 Bacteria 10998
666 Ga0495602_0029236 3300048088 Bacteria 5254
667 Ga0495615_0008507 3300048090 Bacteria 1986
668 Ga0495615_0011387 3300048090 Bacteria 1806
669 Ga0495626_0000103 3300048091 Bacteria 110163
670 Ga0495626_0000902 3300048091 Bacteria 26250
671 Ga0495626_0011538 3300048091 Bacteria 4672
672 Ga0495626_0015496 3300048091 Bacteria 3899
673 Ga0495626_0042565 3300048091 Bacteria 2133
674 Ga0495626_0106570 3300048091 Bacteria 1217
675 Ga0496100_0092549 3300048903 Bacteria 2066
676 Ga0496100_0123739 3300048903 Bacteria 1813
677 Ga0496101_0034301 3300048904 Bacteria 3583
678 Ga0496101_0036961 3300048904 Bacteria 3461
679 Ga0496102_0000064 3300048905 Bacteria 161979
680 Ga0496102_0062714 3300048905 Bacteria 3404
681 Ga0496102_0116930 3300048905 Bacteria 2488
682 Ga0496103_0014373 3300048906 Bacteria 4702
683 Ga0496103_0075367 3300048906 Bacteria 2116
684 Ga0496103_0094268 3300048906 Bacteria 1891
685 Ga0496104_0005753 3300048907 Bacteria 10852
686 Ga0496104_0079472 3300048907 Bacteria 3126
687 Ga0496104_0644534 3300048907 Bacteria 968
688 Ga0496105_0035394 3300048908 Bacteria 4109
689 Ga0496105_0049351 3300048908 Bacteria 3475
690 Ga0496106_0008358 3300048909 Bacteria 7664
691 Ga0496106_0087580 3300048909 Bacteria 2399
692 Ga0496107_0017885 3300048910 Bacteria 4990
693 Ga0496107_0040214 3300048910 Bacteria 3356
694 Ga0496108_0250056 3300048911 Bacteria 1542
695 Ga0496108_0293163 3300048911 Bacteria 1416
696 Ga0496109_0176197 3300048912 Bacteria 2007
697 Ga0496110_0214430 3300048913 Bacteria 1750
698 Ga0496111_0012430 3300048914 Bacteria 5764
699 Ga0496112_0267585 3300048915 Bacteria 1658
700 Ga0496113_0002265 3300048916 Bacteria 11099
701 Ga0496116_0023412 3300048919 Bacteria 4600
702 Ga0496116_0031289 3300048919 Bacteria 3813
703 Ga0496116_0064515 3300048919 Bacteria 2354
704 Ga0496116_0084815 3300048919 Bacteria 1950
705 Ga0496116_0087056 3300048919 Bacteria 1913
706 Ga0496117_0000094 3300048920 Bacteria 201853
707 Ga0496117_0063595 3300048920 Bacteria 2521
708 Ga0496117_0081812 3300048920 Bacteria 2117
709 Ga0496117_0246570 3300048920 Bacteria 977
710 Ga0496118_0000071 3300048921 Bacteria 201853
711 Ga0496118_0095020 3300048921 Bacteria 2036
712 Ga0496119_0050596 3300048922 Bacteria 2560
713 Ga0496120_0020559 3300048923 Bacteria 4191
714 Ga0496121_0013966 3300048924 Bacteria 8578
715 Ga0496121_0014140 3300048924 Bacteria 8503
716 Ga0496121_0022940 3300048924 Bacteria 6031
717 Ga0496121_0047108 3300048924 Bacteria 3681
718 Ga0496121_0050060 3300048924 Bacteria 3534
719 Ga0496121_0075961 3300048924 Bacteria 2681
720 Ga0496121_0080283 3300048924 Bacteria 2586
721 Ga0496121_0095100 3300048924 Bacteria 2316
722 Ga0496121_0160111 3300048924 Bacteria 1647
723 Ga0496122_0000063 3300048925 Bacteria 241378
724 Ga0496122_0000134 3300048925 Bacteria 171080
725 Ga0496122_0003153 3300048925 Bacteria 22055
726 Ga0496122_0009932 3300048925 Bacteria 9915
727 Ga0496122_0011074 3300048925 Bacteria 9198
728 Ga0496122_0020099 3300048925 Bacteria 6062
729 Ga0496122_0036508 3300048925 Bacteria 3972
730 Ga0496122_0092505 3300048925 Bacteria 2055
731 Ga0496122_0111682 3300048925 Bacteria 1792
732 Ga0496122_0248064 3300048925 Bacteria 998
733 Ga0496123_0000045 3300048926 Bacteria 249294
734 Ga0496123_0000295 3300048926 Bacteria 97562
735 Ga0496123_0000307 3300048926 Bacteria 95174
736 Ga0496123_0001494 3300048926 Bacteria 32476
737 Ga0496123_0002403 3300048926 Bacteria 23383
738 Ga0496123_0012610 3300048926 Bacteria 7185
739 Ga0496123_0023302 3300048926 Bacteria 4741
740 Ga0496123_0096810 3300048926 Bacteria 1731
741 Ga0496124_0004010 3300048927 Bacteria 17524
742 Ga0496124_0014605 3300048927 Bacteria 7584
743 Ga0496124_0025846 3300048927 Bacteria 5307
744 Ga0496124_0052717 3300048927 Bacteria 3454
745 Ga0496124_0055192 3300048927 Bacteria 3359
746 Ga0496124_0083739 3300048927 Bacteria 2616
747 Ga0496125_0001032 3300048928 Bacteria 43195
748 Ga0496125_0004153 3300048928 Bacteria 16888
749 Ga0496125_0009913 3300048928 Bacteria 9687
750 Ga0496125_0011136 3300048928 Bacteria 9020
751 Ga0496125_0015804 3300048928 Bacteria 7274
752 Ga0496125_0045967 3300048928 Bacteria 3668
753 Ga0496125_0069690 3300048928 Bacteria 2757
754 Ga0496125_0119869 3300048928 Bacteria 1880
755 Ga0496125_0188167 3300048928 Bacteria 1366
756 Ga0496126_0008452 3300048929 Bacteria 11107
757 Ga0495678_000391 3300049459 Bacteria 44274
758 Ga0495678_002557 3300049459 Bacteria 12191
759 Ga0495678_003514 3300049459 Bacteria 9640
760 Ga0495678_003907 3300049459 Bacteria 8939
761 Ga0495678_008263 3300049459 Bacteria 5274
762 Ga0495678_011038 3300049459 Bacteria 4345
763 Ga0495682_0000342 3300049460 Bacteria 34442
764 Ga0495682_0000649 3300049460 Bacteria 23246
765 Ga0495682_0004485 3300049460 Bacteria 5960
766 Ga0495682_0010160 3300049460 Bacteria 3656
767 Ga0495682_0024502 3300049460 Bacteria 2249
768 Ga0495682_0063550 3300049460 Bacteria 1331
769 Ga0501034_0266575 3300049571 Bacteria 1655
770 Ga0501036_0028042 3300049572 Bacteria 4760
771 Ga0501073_0263547 3300049589 Bacteria 1189
772 Ga0501235_020320 3300049669 Bacteria 1474
773 Ga0501238_001027 3300049671 Bacteria 3191
774 Ga0501225_0027047 3300049705 Bacteria 1578
775 Ga0501262_000532 3300049759 Bacteria 4534
776 Ga0501035_0001779 3300049822 Bacteria 21773
777 Ga0501044_0225798 3300049823 Bacteria 1822
778 Ga0501044_0305790 3300049823 Bacteria 1518
779 nmdc:mga03683_14532_c1 3300050489 Bacteria 2915
780 nmdc:mga03683_44068_c1 3300050489 Bacteria 1843
781 nmdc:mga03683_48174_c1 3300050489 Bacteria 1771
782 nmdc:mga03n38_22845_c1 3300050490 Bacteria 2537
783 nmdc:mga00v17_35099_c1 3300050491 Bacteria 2567
784 nmdc:mga0k408_11179_c1 3300050493 Bacteria 4880
785 nmdc:mga0k408_19690_c1 3300050493 Bacteria 3774
786 nmdc:mga0k408_34097_c1 3300050493 Bacteria 2913
787 nmdc:mga06z11_129231_c1 3300050494 Bacteria 1417
788 nmdc:mga07m45_2078_c1 3300050496 Bacteria 9300
789 nmdc:mga07m45_23737_c1 3300050496 Bacteria 3355
790 nmdc:mga07m45_9105_c1 3300050496 Bacteria 5129
791 Ga0500610_0004823 3300053079 Bacteria 5429
792 Ga0500646_0023099 3300053090 Bacteria 1666
793 Ga0500651_0000125 3300053093 Bacteria 47146
794 Ga0500651_0053665 3300053093 Bacteria 2528
795 Ga0500641_0152769 3300053096 Bacteria 996
796 Ga0500571_000811 3300053110 Bacteria 13403
797 Ga0500572_033169 3300053111 Bacteria 1455
798 Ga0500593_004926 3300053117 Bacteria 5214
799 Ga0500594_0013942 3300053118 Bacteria 1918
800 Ga0500595_003099 3300053119 Bacteria 7872
801 Ga0500607_007247 3300053121 Bacteria 6879
802 Ga0500608_010325 3300053122 Bacteria 4004
803 Ga0500618_000602 3300053125 Bacteria 22088
804 Ga0500618_000660 3300053125 Bacteria 20531
805 Ga0500618_000824 3300053125 Bacteria 16981
806 Ga0500626_015711 3300053128 Bacteria 3303
807 Ga0500655_002019 3300053133 Bacteria 3775
808 Ga0500658_0001125 3300053134 Bacteria 10937
809 Ga0500658_0002341 3300053134 Bacteria 7344
810 Ga0500559_0012473 3300053136 Bacteria 3611
811 Ga0500568_0002512 3300053139 Bacteria 10731
812 Ga0500574_002077 3300053141 Bacteria 3198
813 Ga0500622_0068864 3300053156 Bacteria 1793
814 Ga0500627_0001087 3300053158 Bacteria 7417
815 Ga0500634_0013841 3300053161 Bacteria 4242
816 Ga0500634_0015330 3300053161 Bacteria 4068
817 Ga0500638_040324 3300053162 Bacteria 2267
818 Ga0587068_005051 3300059641 Bacteria 1780
819 Ga0466962_0066246 3300061719 Bacteria 1724

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042001 Ga0439441_016825 Ga0439441_016825_131_997 254
2 3300049589 Ga0501073_0263547 Ga0501073_0263547_65_931 275
3 3300044842 Ga0466957_0044623 Ga0466957_0044623_142_978 278
4 3300047469 Ga0495673_0000061 Ga0495673_0000061_25312_26160 282
5 3300005440 Ga0070705_100047720 Ga0070705_1000477202 286
6 3300005444 Ga0070694_100005548 Ga0070694_1000055482 286
7 3300005617 Ga0068859_100075066 Ga0068859_1000750663 286
8 3300006931 Ga0097620_100075065 Ga0097620_1000750653 286
9 iso_pu_bacteria 2643221645 2644253436 286
10 iso_pu_bacteria 2643221664 2644355518 286
11 iso_pu_bacteria 2738541280 2738737362 286
12 iso_pu_bacteria 2738541300 2738841591 286
13 iso_pu_bacteria 2738543018 2739272462 286
14 iso_pu_bacteria 2738543030 2739341506 286
15 3300006948 Ga0099826_10000002 Ga0099826_10000002445 287
16 3300027666 Ga0209282_1000001 Ga0209282_1000001707 287
17 3300049671 Ga0501238_001027 Ga0501238_001027_1419_2303 287
18 iso_pu_bacteria 2818991436 2819542817 287
19 iso_pu_bacteria 2511231003 2511250325 288
20 iso_pu_bacteria 2511231026 2511385207 288
21 iso_pu_bacteria 2521172590 2521558663 288
22 iso_pu_bacteria 2548876994 2550695453 288
23 iso_pu_bacteria 2551306416 2553004393 288
24 iso_pu_bacteria 2600255292 2601669135 288
25 iso_pu_bacteria 2643221556 2643799867 288
26 iso_pu_bacteria 2643221684 2644474867 288
27 iso_pu_bacteria 2738541297 2738830175 288
28 iso_pu_bacteria 2738541357 2739153971 288
29 iso_pu_bacteria 2738543003 2739195891 288
30 iso_pu_bacteria 2738543026 2739322367 288
31 iso_pu_bacteria 2738543029 2739340608 288
32 iso_pu_bacteria 2765235838 2765569769 288
33 iso_pu_bacteria 2808606386 2808981876 288
34 iso_pu_bacteria 2808606415 2809131498 288
35 iso_pu_bacteria 2808606418 2809146793 288
36 iso_pu_bacteria 2808606419 2809151120 288
37 iso_pu_bacteria 2818991445 2819591785 288
38 iso_pu_bacteria 2818991449 2819614109 288
39 iso_pu_bacteria 2839094727 2839097290 288
40 iso_pu_bacteria 2852618963 2852622600 288
41 iso_pu_bacteria 2857547612 2857551275 288
42 iso_pu_bacteria 2857564685 2857568468 288
43 iso_pu_bacteria 2884811622 2884815414 288
44 iso_pu_bacteria 2884836552 2884837586 288
45 iso_pu_bacteria 2884852848 2884853877 288
46 iso_pu_bacteria 2885080285 2885084076 288
47 iso_pu_bacteria 2896154374 2896155006 288
48 iso_pu_bacteria 2904439833 2904444043 288
49 iso_pu_bacteria 2904530477 2904534412 288
50 iso_pu_bacteria 2904584206 2904584303 288
51 iso_pu_bacteria 2904589729 2904590772 288
52 iso_pu_bacteria 2904601388 2904603389 288
53 iso_pu_bacteria 2919046199 2919047098 288
54 iso_pu_bacteria 2919079590 2919080607 288
55 iso_pu_bacteria 2923510766 2923512241 288
56 iso_pu_bacteria 2928130867 2928131902 288
57 iso_pu_bacteria 2932410948 2932416389 288
58 iso_pu_bacteria 2932416698 2932417210 288
59 iso_pu_bacteria 8047673197 8047673263 288
60 3300037418 Ga0395900_0049239 Ga0395900_0049239_1502_2377 289
61 3300037471 Ga0395905_0024207 Ga0395905_0024207_513_1388 289
62 3300037471 Ga0395905_0275951 Ga0395905_0275951_247_1122 289
63 3300037471 Ga0395905_0344883 Ga0395905_0344883_21_896 289
64 3300046528 Ga0495642_0015965 Ga0495642_0015965_649_1524 289
65 3300047443 Ga0495687_033243 Ga0495687_033243_783_1658 289
66 3300048907 Ga0496104_0079472 Ga0496104_0079472_571_1446 289
67 3300048908 Ga0496105_0049351 Ga0496105_0049351_2377_3252 289
68 3300048911 Ga0496108_0250056 Ga0496108_0250056_147_1022 289
69 3300048912 Ga0496109_0176197 Ga0496109_0176197_694_1569 289
70 3300048913 Ga0496110_0214430 Ga0496110_0214430_850_1725 289
71 iso_pu_bacteria 2511231003 2511247726 289
72 iso_pu_bacteria 2511231026 2511385444 289
73 iso_pu_bacteria 2521172590 2521558126 289
74 iso_pu_bacteria 2548876994 2550692899 289
75 iso_pu_bacteria 2551306416 2553003252 289
76 iso_pu_bacteria 2765235838 2765569260 289
77 iso_pu_bacteria 2808606386 2808983876 289
78 iso_pu_bacteria 2808606415 2809130936 289
79 iso_pu_bacteria 2808606419 2809150729 289
80 iso_pu_bacteria 2818991445 2819593233 289
81 iso_pu_bacteria 2818991449 2819614730 289
82 iso_pu_bacteria 2839094727 2839095854 289
83 iso_pu_bacteria 2852618963 2852622246 289
84 iso_pu_bacteria 2884811622 2884812381 289
85 iso_pu_bacteria 2884836552 2884838131 289
86 iso_pu_bacteria 2884852848 2884854424 289
87 iso_pu_bacteria 2896154374 2896154460 289
88 iso_pu_bacteria 2904439833 2904441099 289
89 iso_pu_bacteria 2904530477 2904531958 289
90 iso_pu_bacteria 2904584206 2904587816 289
91 iso_pu_bacteria 2904589729 2904590024 289
92 iso_pu_bacteria 2904601388 2904602588 289
93 iso_pu_bacteria 2919046199 2919046590 289
94 iso_pu_bacteria 2919079590 2919079906 289
95 iso_pu_bacteria 2928130867 2928131306 289
96 3300035691 Ga0373931_0083192 Ga0373931_0083192_653_1525 290
97 3300046452 Ga0495617_000216 Ga0495617_000216_5971_6864 290
98 3300046452 Ga0495617_008767 Ga0495617_008767_1290_2183 290
99 3300046452 Ga0495617_015123 Ga0495617_015123_854_1747 290
100 3300046460 Ga0495638_0010640 Ga0495638_0010640_1806_2699 290
101 3300046460 Ga0495638_0012288 Ga0495638_0012288_58_951 290
102 3300046474 Ga0495605_0001338 Ga0495605_0001338_193_1086 290
103 3300046491 Ga0495584_0000153 Ga0495584_0000153_13472_14365 290
104 3300046491 Ga0495584_0006647 Ga0495584_0006647_1835_2728 290
105 3300046492 Ga0495585_0000206 Ga0495585_0000206_7616_8509 290
106 3300046492 Ga0495585_0000353 Ga0495585_0000353_40318_41211 290
107 3300046492 Ga0495585_0000563 Ga0495585_0000563_28431_29324 290
108 3300046492 Ga0495585_0004163 Ga0495585_0004163_5242_6135 290
109 3300046492 Ga0495585_0010007 Ga0495585_0010007_1850_2743 290
110 3300046492 Ga0495585_0012096 Ga0495585_0012096_2231_3124 290
111 3300046492 Ga0495585_0027642 Ga0495585_0027642_1552_2445 290
112 3300046492 Ga0495585_0054779 Ga0495585_0054779_1044_1937 290
113 3300046492 Ga0495585_0069864 Ga0495585_0069864_734_1627 290
114 3300046500 Ga0495596_0000680 Ga0495596_0000680_12090_12983 290
115 3300046500 Ga0495596_0000699 Ga0495596_0000699_3278_4171 290
116 3300046501 Ga0495607_0034547 Ga0495607_0034547_480_1373 290
117 3300046501 Ga0495607_0099855 Ga0495607_0099855_147_1040 290
118 3300046506 Ga0495583_0000424 Ga0495583_0000424_44291_45184 290
119 3300046506 Ga0495583_0000537 Ga0495583_0000537_51896_52789 290
120 3300046506 Ga0495583_0069740 Ga0495583_0069740_22_915 290
121 3300046507 Ga0495606_0000245 Ga0495606_0000245_3683_4579 290
122 3300046507 Ga0495606_0012994 Ga0495606_0012994_598_1470 290
123 3300046507 Ga0495606_0022037 Ga0495606_0022037_1204_2097 290
124 3300046512 Ga0495610_0051705 Ga0495610_0051705_162_1055 290
125 3300046513 Ga0495616_0001403 Ga0495616_0001403_3167_4060 290
126 3300046513 Ga0495616_0006109 Ga0495616_0006109_5747_6640 290
127 3300046513 Ga0495616_0013484 Ga0495616_0013484_1623_2516 290
128 3300046518 Ga0495631_0011497 Ga0495631_0011497_3279_4172 290
129 3300046518 Ga0495631_0019279 Ga0495631_0019279_304_1197 290
130 3300046519 Ga0495632_0007449 Ga0495632_0007449_5666_6559 290
131 3300046520 Ga0495637_0001337 Ga0495637_0001337_3723_4607 290
132 3300046522 Ga0495643_0092143 Ga0495643_0092143_132_1025 290
133 3300046523 Ga0495644_0001322 Ga0495644_0001322_2927_3820 290
134 3300046523 Ga0495644_0001761 Ga0495644_0001761_4914_5807 290
135 3300046523 Ga0495644_0010287 Ga0495644_0010287_456_1349 290
136 3300046524 Ga0495648_0000722 Ga0495648_0000722_28363_29256 290
137 3300046524 Ga0495648_0001252 Ga0495648_0001252_20118_21011 290
138 3300046524 Ga0495648_0025349 Ga0495648_0025349_625_1518 290
139 3300046525 Ga0495663_0004113 Ga0495663_0004113_1666_2559 290
140 3300046525 Ga0495663_0006991 Ga0495663_0006991_478_1371 290
141 3300046528 Ga0495642_0012839 Ga0495642_0012839_1022_1915 290
142 3300046528 Ga0495642_0054397 Ga0495642_0054397_465_1358 290
143 3300046530 Ga0495654_0000015 Ga0495654_0000015_122655_123539 290
144 3300046538 Ga0495609_0007230 Ga0495609_0007230_2695_3588 290
145 3300046538 Ga0495609_0008580 Ga0495609_0008580_3637_4530 290
146 3300046538 Ga0495609_0014663 Ga0495609_0014663_1032_1925 290
147 3300046542 Ga0495597_0023099 Ga0495597_0023099_1372_2265 290
148 3300046542 Ga0495597_0098405 Ga0495597_0098405_11_904 290
149 3300046557 Ga0495622_0052385 Ga0495622_0052385_981_1874 290
150 3300046558 Ga0495633_0011567 Ga0495633_0011567_3496_4389 290
151 3300046558 Ga0495633_0049750 Ga0495633_0049750_519_1412 290
152 3300046615 Ga0495656_0014357 Ga0495656_0014357_1728_2621 290
153 3300046615 Ga0495656_0062292 Ga0495656_0062292_169_1062 290
154 3300046616 Ga0495668_0003498 Ga0495668_0003498_7235_8128 290
155 3300046616 Ga0495668_0107004 Ga0495668_0107004_269_1162 290
156 3300046648 Ga0495611_0007509 Ga0495611_0007509_1631_2524 290
157 3300046648 Ga0495611_0027723 Ga0495611_0027723_152_1045 290
158 3300046648 Ga0495611_0031839 Ga0495611_0031839_1136_2029 290
159 3300046660 Ga0495625_0002452 Ga0495625_0002452_15166_16065 290
160 3300046664 Ga0495659_0000244 Ga0495659_0000244_6639_7532 290
161 3300046664 Ga0495659_0000262 Ga0495659_0000262_6440_7333 290
162 3300046664 Ga0495659_0026247 Ga0495659_0026247_20_913 290
163 3300046665 Ga0495661_0037262 Ga0495661_0037262_1125_2018 290
164 3300046665 Ga0495661_0043566 Ga0495661_0043566_513_1406 290
165 3300046665 Ga0495661_0142803 Ga0495661_0142803_12_905 290
166 3300046684 Ga0495669_0006620 Ga0495669_0006620_1320_2213 290
167 3300046691 Ga0495670_0013956 Ga0495670_0013956_1023_1916 290
168 3300046691 Ga0495670_0029080 Ga0495670_0029080_1787_2680 290
169 3300046691 Ga0495670_0030705 Ga0495670_0030705_929_1822 290
170 3300046691 Ga0495670_0061819 Ga0495670_0061819_325_1218 290
171 3300046692 Ga0495671_0000379 Ga0495671_0000379_6587_7480 290
172 3300046692 Ga0495671_0013546 Ga0495671_0013546_2985_3878 290
173 3300046692 Ga0495671_0035496 Ga0495671_0035496_803_1696 290
174 3300046794 Ga0495589_0171744 Ga0495589_0171744_113_1006 290
175 3300047318 Ga0495636_0004266 Ga0495636_0004266_912_1805 290
176 3300047318 Ga0495636_0011979 Ga0495636_0011979_1672_2553 290
177 3300047320 Ga0495672_0000368 Ga0495672_0000368_12311_13204 290
178 3300047320 Ga0495672_0004744 Ga0495672_0004744_427_1320 290
179 3300047320 Ga0495672_0018354 Ga0495672_0018354_1255_2148 290
180 3300047323 Ga0495683_0000151 Ga0495683_0000151_40678_41571 290
181 3300047323 Ga0495683_0004352 Ga0495683_0004352_3532_4425 290
182 3300047323 Ga0495683_0016725 Ga0495683_0016725_2664_3557 290
183 3300047443 Ga0495687_000191 Ga0495687_000191_86653_87546 290
184 3300047443 Ga0495687_020878 Ga0495687_020878_466_1359 290
185 3300047445 Ga0495677_0005309 Ga0495677_0005309_24_917 290
186 3300047445 Ga0495677_0007159 Ga0495677_0007159_700_1593 290
187 3300047445 Ga0495677_0051535 Ga0495677_0051535_315_1208 290
188 3300047447 Ga0495685_000381 Ga0495685_000381_11651_12544 290
189 3300047469 Ga0495673_0015081 Ga0495673_0015081_1036_1929 290
190 3300047469 Ga0495673_0020397 Ga0495673_0020397_222_1115 290
191 3300047470 Ga0495681_0024054 Ga0495681_0024054_1700_2593 290
192 3300048090 Ga0495615_0011387 Ga0495615_0011387_478_1371 290
193 3300048091 Ga0495626_0011538 Ga0495626_0011538_3202_4095 290
194 3300048091 Ga0495626_0106570 Ga0495626_0106570_156_1049 290
195 3300048905 Ga0496102_0062714 Ga0496102_0062714_1464_2357 290
196 3300049459 Ga0495678_002557 Ga0495678_002557_7518_8411 290
197 3300049460 Ga0495682_0000649 Ga0495682_0000649_18864_19757 290
198 3300049460 Ga0495682_0004485 Ga0495682_0004485_3493_4386 290
199 3300049460 Ga0495682_0024502 Ga0495682_0024502_498_1391 290
200 3300049460 Ga0495682_0063550 Ga0495682_0063550_395_1288 290
201 3300049669 Ga0501235_020320 Ga0501235_020320_370_1263 290
202 3300053125 Ga0500618_000602 Ga0500618_000602_5061_5948 290
203 iso_pu_bacteria 2923510766 2923511374 290
204 3300002771 JGI25163J39215_1003006 JGI25163J39215_10030062 291
205 3300003214 JGI25165J46597_1000001 JGI25165J46597_1000001330 291
206 3300003751 Ga0055538_1000001 Ga0055538_1000001703 291
207 3300003752 Ga0055539_1000001 Ga0055539_1000001703 291
208 3300003756 Ga0055533_1000003 Ga0055533_1000003330 291
209 3300003759 Ga0055525_1000003 Ga0055525_1000003330 291
210 3300003841 Ga0055541_1000001 Ga0055541_1000001330 291
211 3300005337 Ga0070682_100012821 Ga0070682_1000128212 291
212 3300015262 Ga0182007_10003866 Ga0182007_100038665 291
213 3300015265 Ga0182005_1000662 Ga0182005_100066211 291
214 3300025224 Ga0209784_100004 Ga0209784_100004329 291
215 3300025225 Ga0209566_100004 Ga0209566_100004486 291
216 3300025226 Ga0209674_100006 Ga0209674_100006486 291
217 3300025230 Ga0209563_100009 Ga0209563_100009329 291
218 3300025231 Ga0207427_100254 Ga0207427_10025418 291
219 3300025233 Ga0209437_100004 Ga0209437_100004329 291
220 3300025250 Ga0209026_1005223 Ga0209026_10052233 291
221 3300025253 Ga0209677_100005 Ga0209677_100005329 291
222 3300025261 Ga0209233_1000005 Ga0209233_1000005486 291
223 3300031251 Ga0265327_10005786 Ga0265327_100057866 291
224 3300037312 Ga0395899_0004769 Ga0395899_0004769_6916_7791 291
225 3300037466 Ga0395898_0192527 Ga0395898_0192527_241_1116 291
226 3300037471 Ga0395905_0023958 Ga0395905_0023958_3078_3953 291
227 3300038443 Ga0395901_0000482 Ga0395901_0000482_38009_38884 291
228 3300038443 Ga0395901_0004717 Ga0395901_0004717_6027_6902 291
229 3300044658 Ga0466972_0002538 Ga0466972_0002538_5082_5960 291
230 3300044683 Ga0466965_0001072 Ga0466965_0001072_4378_5256 291
231 3300044706 Ga0466964_0111066 Ga0466964_0111066_297_1175 291
232 3300044735 Ga0466968_0002868 Ga0466968_0002868_4462_5340 291
233 3300044765 Ga0466970_0008154 Ga0466970_0008154_3906_4859 291
234 3300044765 Ga0466970_0033147 Ga0466970_0033147_249_1124 291
235 3300046462 Ga0495651_0005781 Ga0495651_0005781_8448_9323 291
236 3300046463 Ga0495653_0001714 Ga0495653_0001714_5476_6351 291
237 3300046463 Ga0495653_0258326 Ga0495653_0258326_177_1052 291
238 3300046511 Ga0495608_0002860 Ga0495608_0002860_9376_10251 291
239 3300046511 Ga0495608_0054992 Ga0495608_0054992_141_1016 291
240 3300046516 Ga0495628_0000929 Ga0495628_0000929_6974_7849 291
241 3300046529 Ga0495652_0002952 Ga0495652_0002952_12278_13153 291
242 3300046529 Ga0495652_0010677 Ga0495652_0010677_3801_4676 291
243 3300046543 Ga0495645_0008074 Ga0495645_0008074_4022_4897 291
244 3300046663 Ga0495635_0083950 Ga0495635_0083950_393_1268 291
245 3300046675 Ga0495657_0044637 Ga0495657_0044637_535_1410 291
246 3300046680 Ga0495646_0012297 Ga0495646_0012297_1120_1995 291
247 3300046809 Ga0495600_0000151 Ga0495600_0000151_23432_24307 291
248 3300048088 Ga0495602_0008077 Ga0495602_0008077_3447_4322 291
249 3300048088 Ga0495602_0029236 Ga0495602_0029236_3795_4670 291
250 3300048903 Ga0496100_0123739 Ga0496100_0123739_65_940 291
251 3300048927 Ga0496124_0014605 Ga0496124_0014605_3359_4252 291
252 3300048928 Ga0496125_0001032 Ga0496125_0001032_14199_15074 291
253 3300049823 Ga0501044_0305790 Ga0501044_0305790_254_1129 291
254 3300053119 Ga0500595_003099 Ga0500595_003099_1712_2587 291
255 iso_pu_bacteria 2842733646 2842734239 291
256 iso_pu_bacteria 2842747753 2842749504 291
257 iso_pu_bacteria 2928115317 2928117606 291
258 3300002704 JGI25155J39150_1000117 JGI25155J39150_100011710 292
259 3300002704 JGI25155J39150_1000134 JGI25155J39150_100013436 292
260 3300002704 JGI25155J39150_1000227 JGI25155J39150_10002275 292
261 3300002704 JGI25155J39150_1000896 JGI25155J39150_10008961 292
262 3300002705 JGI25156J39149_1000108 JGI25156J39149_100010847 292
263 3300002705 JGI25156J39149_1000270 JGI25156J39149_10002703 292
264 3300002705 JGI25156J39149_1006902 JGI25156J39149_10069023 292
265 3300002705 JGI25156J39149_1014331 JGI25156J39149_10143311 292
266 3300002737 JGI25162J39368_1004472 JGI25162J39368_10044722 292
267 3300002738 JGI25154J39366_1000222 JGI25154J39366_100022210 292
268 3300002738 JGI25154J39366_1000247 JGI25154J39366_10002473 292
269 3300002738 JGI25154J39366_1000569 JGI25154J39366_10005699 292
270 3300002738 JGI25154J39366_1000582 JGI25154J39366_10005823 292
271 3300002738 JGI25154J39366_1001350 JGI25154J39366_10013501 292
272 3300002741 JGI25157J39369_1000120 JGI25157J39369_100012029 292
273 3300002741 JGI25157J39369_1000311 JGI25157J39369_10003113 292
274 3300003751 Ga0055538_1000002 Ga0055538_1000002527 292
275 3300003751 Ga0055538_1000020 Ga0055538_1000020149 292
276 3300003752 Ga0055539_1000002 Ga0055539_1000002527 292
277 3300003752 Ga0055539_1000025 Ga0055539_1000025149 292
278 3300003756 Ga0055533_1000004 Ga0055533_1000004527 292
279 3300003756 Ga0055533_1000034 Ga0055533_100003494 292
280 3300003758 Ga0055532_1000023 Ga0055532_10000233 292
281 3300003758 Ga0055532_1000051 Ga0055532_1000051107 292
282 3300003759 Ga0055525_1000002 Ga0055525_1000002527 292
283 3300003759 Ga0055525_1000044 Ga0055525_1000044149 292
284 3300003761 Ga0055535_1005122 Ga0055535_10051222 292
285 3300003763 Ga0055529_1000138 Ga0055529_100013812 292
286 3300003771 Ga0055526_1000411 Ga0055526_10004115 292
287 3300003841 Ga0055541_1000002 Ga0055541_1000002316 292
288 3300003841 Ga0055541_1000019 Ga0055541_1000019149 292
289 3300005339 Ga0070660_100016619 Ga0070660_1000166193 292
290 3300005344 Ga0070661_100090689 Ga0070661_1000906892 292
291 3300005366 Ga0070659_100015532 Ga0070659_1000155323 292
292 3300005455 Ga0070663_100184477 Ga0070663_1001844772 292
293 3300005563 Ga0068855_100000197 Ga0068855_10000019738 292
294 3300005563 Ga0068855_100001741 Ga0068855_10000174110 292
295 3300005563 Ga0068855_100011938 Ga0068855_1000119383 292
296 3300005563 Ga0068855_100015823 Ga0068855_1000158239 292
297 3300005563 Ga0068855_100176065 Ga0068855_1001760652 292
298 3300005563 Ga0068855_100567453 Ga0068855_1005674531 292
299 3300005578 Ga0068854_100002908 Ga0068854_10000290812 292
300 3300005578 Ga0068854_100051852 Ga0068854_1000518522 292
301 3300005616 Ga0068852_100006280 Ga0068852_1000062804 292
302 3300005616 Ga0068852_100193027 Ga0068852_1001930271 292
303 3300005616 Ga0068852_100347458 Ga0068852_1003474582 292
304 3300005834 Ga0068851_10104691 Ga0068851_101046912 292
305 3300009093 Ga0105240_10001798 Ga0105240_1000179834 292
306 3300009093 Ga0105240_10012173 Ga0105240_1001217314 292
307 3300009093 Ga0105240_10017029 Ga0105240_100170295 292
308 3300009093 Ga0105240_10097593 Ga0105240_100975933 292
309 3300009093 Ga0105240_10514341 Ga0105240_105143412 292
310 3300009174 Ga0105241_10170626 Ga0105241_101706263 292
311 3300009545 Ga0105237_10014721 Ga0105237_100147213 292
312 3300009551 Ga0105238_10000977 Ga0105238_1000097721 292
313 3300009551 Ga0105238_10025787 Ga0105238_100257873 292
314 3300009551 Ga0105238_10125694 Ga0105238_101256942 292
315 3300010375 Ga0105239_10083666 Ga0105239_100836664 292
316 3300010375 Ga0105239_10263864 Ga0105239_102638642 292
317 3300010375 Ga0105239_10302309 Ga0105239_103023092 292
318 3300013297 Ga0157378_10059023 Ga0157378_100590232 292
319 3300013307 Ga0157372_10165903 Ga0157372_101659034 292
320 3300014497 Ga0182008_10000515 Ga0182008_1000051520 292
321 3300014497 Ga0182008_10027129 Ga0182008_100271294 292
322 3300015261 Ga0182006_1000112 Ga0182006_100011249 292
323 3300015261 Ga0182006_1001190 Ga0182006_100119016 292
324 3300015261 Ga0182006_1011405 Ga0182006_10114052 292
325 3300015261 Ga0182006_1032526 Ga0182006_10325262 292
326 3300015262 Ga0182007_10000020 Ga0182007_1000002057 292
327 3300015265 Ga0182005_1000001 Ga0182005_100000158 292
328 3300017792 Ga0163161_10015085 Ga0163161_100150853 292
329 3300021361 Ga0213872_10000001 Ga0213872_10000001302 292
330 3300021361 Ga0213872_10001896 Ga0213872_100018964 292
331 3300021361 Ga0213872_10034749 Ga0213872_100347493 292
332 3300022467 Ga0224712_10051595 Ga0224712_100515951 292
333 3300025206 Ga0209435_100013 Ga0209435_100013115 292
334 3300025206 Ga0209435_100028 Ga0209435_10002831 292
335 3300025206 Ga0209435_100300 Ga0209435_10030016 292
336 3300025206 Ga0209435_100501 Ga0209435_1005015 292
337 3300025224 Ga0209784_100002 Ga0209784_100002152 292
338 3300025224 Ga0209784_100002 Ga0209784_100002754 292
339 3300025225 Ga0209566_100003 Ga0209566_100003152 292
340 3300025225 Ga0209566_100003 Ga0209566_100003754 292
341 3300025226 Ga0209674_100004 Ga0209674_100004152 292
342 3300025226 Ga0209674_100004 Ga0209674_100004754 292
343 3300025229 Ga0209147_100004 Ga0209147_100004362 292
344 3300025229 Ga0209147_100030 Ga0209147_100030239 292
345 3300025230 Ga0209563_100006 Ga0209563_100006152 292
346 3300025230 Ga0209563_100006 Ga0209563_100006754 292
347 3300025230 Ga0209563_100007 Ga0209563_100007300 292
348 3300025233 Ga0209437_100053 Ga0209437_100053289 292
349 3300025233 Ga0209437_100275 Ga0209437_10027553 292
350 3300025242 Ga0209258_100325 Ga0209258_10032517 292
351 3300025242 Ga0209258_100667 Ga0209258_1006679 292
352 3300025245 Ga0207425_1000455 Ga0207425_100045526 292
353 3300025246 Ga0209646_1000021 Ga0209646_1000021158 292
354 3300025246 Ga0209646_1000034 Ga0209646_1000034115 292
355 3300025246 Ga0209646_1000051 Ga0209646_1000051255 292
356 3300025246 Ga0209646_1000095 Ga0209646_100009531 292
357 3300025246 Ga0209646_1000378 Ga0209646_10003781 292
358 3300025250 Ga0209026_1000022 Ga0209026_1000022115 292
359 3300025250 Ga0209026_1000110 Ga0209026_100011031 292
360 3300025250 Ga0209026_1014788 Ga0209026_10147881 292
361 3300025253 Ga0209677_100003 Ga0209677_100003152 292
362 3300025253 Ga0209677_100003 Ga0209677_100003754 292
363 3300025253 Ga0209677_101197 Ga0209677_1011974 292
364 3300025254 Ga0209148_1000985 Ga0209148_10009854 292
365 3300025256 Ga0209759_1000018 Ga0209759_1000018115 292
366 3300025256 Ga0209759_1000080 Ga0209759_1000080101 292
367 3300025256 Ga0209759_1000115 Ga0209759_100011531 292
368 3300025256 Ga0209759_1000155 Ga0209759_100015579 292
369 3300025256 Ga0209759_1000553 Ga0209759_100055338 292
370 3300025272 Ga0209455_1000043 Ga0209455_100004384 292
371 3300025272 Ga0209455_1006519 Ga0209455_10065192 292
372 3300025294 Ga0209025_1002209 Ga0209025_100220914 292
373 3300025295 Ga0209564_1000011 Ga0209564_1000011314 292
374 3300025295 Ga0209564_1000089 Ga0209564_1000089181 292
375 3300025297 Ga0209758_1000286 Ga0209758_100028681 292
376 3300025321 Ga0207656_10044790 Ga0207656_100447902 292
377 3300025909 Ga0207705_10000483 Ga0207705_100004836 292
378 3300025911 Ga0207654_10083951 Ga0207654_100839512 292
379 3300025913 Ga0207695_10001636 Ga0207695_1000163634 292
380 3300025913 Ga0207695_10011312 Ga0207695_1001131212 292
381 3300025913 Ga0207695_10013645 Ga0207695_100136454 292
382 3300025913 Ga0207695_10128419 Ga0207695_101284192 292
383 3300025914 Ga0207671_10012800 Ga0207671_100128005 292
384 3300025914 Ga0207671_10018653 Ga0207671_100186533 292
385 3300025919 Ga0207657_10001945 Ga0207657_100019454 292
386 3300025920 Ga0207649_10339708 Ga0207649_103397081 292
387 3300025924 Ga0207694_10000873 Ga0207694_1000087330 292
388 3300025924 Ga0207694_10039691 Ga0207694_100396913 292
389 3300025924 Ga0207694_10154467 Ga0207694_101544672 292
390 3300025927 Ga0207687_10094183 Ga0207687_100941831 292
391 3300025932 Ga0207690_10062274 Ga0207690_100622742 292
392 3300025932 Ga0207690_10072303 Ga0207690_100723032 292
393 3300025933 Ga0207706_10109345 Ga0207706_101093452 292
394 3300025949 Ga0207667_10000034 Ga0207667_10000034243 292
395 3300025949 Ga0207667_10000036 Ga0207667_1000003639 292
396 3300025949 Ga0207667_10007030 Ga0207667_1000703012 292
397 3300025949 Ga0207667_10081172 Ga0207667_100811722 292
398 3300025949 Ga0207667_10092734 Ga0207667_100927342 292
399 3300025949 Ga0207667_10146730 Ga0207667_101467302 292
400 3300025949 Ga0207667_10427423 Ga0207667_104274231 292
401 3300025981 Ga0207640_10023722 Ga0207640_100237222 292
402 3300025981 Ga0207640_10238320 Ga0207640_102383202 292
403 3300026089 Ga0207648_10057270 Ga0207648_100572702 292
404 3300026116 Ga0207674_10264276 Ga0207674_102642762 292
405 3300026142 Ga0207698_10009166 Ga0207698_100091662 292
406 3300026142 Ga0207698_10067159 Ga0207698_100671592 292
407 3300026142 Ga0207698_10476583 Ga0207698_104765832 292
408 3300031548 Ga0307408_100000678 Ga0307408_10000067817 292
409 3300031711 Ga0265314_10010643 Ga0265314_100106439 292
410 3300032004 Ga0307414_10025305 Ga0307414_100253053 292
411 3300035114 Ga0373939_0014902 Ga0373939_0014902_778_1677 292
412 3300037312 Ga0395899_0002047 Ga0395899_0002047_12180_13070 292
413 3300037312 Ga0395899_0008647 Ga0395899_0008647_6885_7775 292
414 3300037312 Ga0395899_0009612 Ga0395899_0009612_178_1068 292
415 3300037418 Ga0395900_0000402 Ga0395900_0000402_3675_4565 292
416 3300037418 Ga0395900_0002186 Ga0395900_0002186_3712_4602 292
417 3300037418 Ga0395900_0002328 Ga0395900_0002328_11185_12075 292
418 3300037418 Ga0395900_0023829 Ga0395900_0023829_2183_3073 292
419 3300037418 Ga0395900_0031677 Ga0395900_0031677_1313_2203 292
420 3300037418 Ga0395900_0075873 Ga0395900_0075873_2509_3399 292
421 3300037418 Ga0395900_0117216 Ga0395900_0117216_596_1486 292
422 3300037466 Ga0395898_0071146 Ga0395898_0071146_1347_2237 292
423 3300037466 Ga0395898_0164041 Ga0395898_0164041_679_1569 292
424 3300037471 Ga0395905_0032524 Ga0395905_0032524_857_1747 292
425 3300037471 Ga0395905_0291229 Ga0395905_0291229_176_1066 292
426 3300038443 Ga0395901_0000250 Ga0395901_0000250_33109_33999 292
427 3300038443 Ga0395901_0009268 Ga0395901_0009268_3712_4602 292
428 3300038443 Ga0395901_0064881 Ga0395901_0064881_2201_3091 292
429 3300038443 Ga0395901_0327421 Ga0395901_0327421_450_1340 292
430 3300039447 Ga0436361_0075458 Ga0436361_0075458_3663_4562 292
431 3300039447 Ga0436361_0086588 Ga0436361_0086588_2636_3649 292
432 3300039447 Ga0436361_0099372 Ga0436361_0099372_4250_5128 292
433 3300039447 Ga0436361_0379135 Ga0436361_0379135_3620_4519 292
434 3300039447 Ga0436361_0481825 Ga0436361_0481825_743_1642 292
435 3300039447 Ga0436361_0560696 Ga0436361_0560696_23_916 292
436 3300039447 Ga0436361_0577764 Ga0436361_0577764_473_1372 292
437 3300039447 Ga0436361_1153033 Ga0436361_1153033_46_945 292
438 3300041408 Ga0439453_0015626 Ga0439453_0015626_130_1020 292
439 3300042005 Ga0439448_0001130 Ga0439448_0001130_1946_2836 292
440 3300042007 Ga0439449_0063778 Ga0439449_0063778_84_974 292
441 3300044656 Ga0466969_0070575 Ga0466969_0070575_630_1520 292
442 3300044658 Ga0466972_0012350 Ga0466972_0012350_989_1879 292
443 3300044683 Ga0466965_0039961 Ga0466965_0039961_492_1382 292
444 3300044683 Ga0466965_0066902 Ga0466965_0066902_708_1598 292
445 3300044684 Ga0466966_0038405 Ga0466966_0038405_574_1464 292
446 3300044694 Ga0466963_0009383 Ga0466963_0009383_211_1101 292
447 3300044706 Ga0466964_0000992 Ga0466964_0000992_837_1727 292
448 3300044706 Ga0466964_0001256 Ga0466964_0001256_3683_4573 292
449 3300044719 Ga0466971_0019600 Ga0466971_0019600_797_1687 292
450 3300044735 Ga0466968_0001194 Ga0466968_0001194_5777_6667 292
451 3300044842 Ga0466957_0005465 Ga0466957_0005465_2552_3442 292
452 3300044842 Ga0466957_0019951 Ga0466957_0019951_1440_2327 292
453 3300045051 Ga0451576_0730377 Ga0451576_0730377_79_957 292
454 3300045976 Ga0466967_0318479 Ga0466967_0318479_316_1206 292
455 3300046452 Ga0495617_003012 Ga0495617_003012_237_1115 292
456 3300046457 Ga0495590_0000002 Ga0495590_0000002_56844_57746 292
457 3300046460 Ga0495638_0000367 Ga0495638_0000367_18916_19818 292
458 3300046460 Ga0495638_0102593 Ga0495638_0102593_221_1120 292
459 3300046471 Ga0495650_0000224 Ga0495650_0000224_44807_45694 292
460 3300046471 Ga0495650_0000521 Ga0495650_0000521_50366_51265 292
461 3300046471 Ga0495650_0000631 Ga0495650_0000631_40356_41243 292
462 3300046471 Ga0495650_0005201 Ga0495650_0005201_758_1657 292
463 3300046471 Ga0495650_0014288 Ga0495650_0014288_1822_2715 292
464 3300046471 Ga0495650_0045766 Ga0495650_0045766_34_933 292
465 3300046474 Ga0495605_0000028 Ga0495605_0000028_8956_9855 292
466 3300046474 Ga0495605_0000325 Ga0495605_0000325_19698_20588 292
467 3300046491 Ga0495584_0001517 Ga0495584_0001517_3774_4664 292
468 3300046492 Ga0495585_0004455 Ga0495585_0004455_2675_3613 292
469 3300046500 Ga0495596_0004429 Ga0495596_0004429_2710_3597 292
470 3300046500 Ga0495596_0019756 Ga0495596_0019756_470_1354 292
471 3300046501 Ga0495607_0004790 Ga0495607_0004790_3909_4808 292
472 3300046501 Ga0495607_0008801 Ga0495607_0008801_3621_4511 292
473 3300046506 Ga0495583_0000741 Ga0495583_0000741_5481_6383 292
474 3300046506 Ga0495583_0045206 Ga0495583_0045206_998_1882 292
475 3300046507 Ga0495606_0000001 Ga0495606_0000001_570879_571778 292
476 3300046507 Ga0495606_0000526 Ga0495606_0000526_3672_4577 292
477 3300046507 Ga0495606_0001009 Ga0495606_0001009_28016_28915 292
478 3300046507 Ga0495606_0008453 Ga0495606_0008453_5216_6094 292
479 3300046507 Ga0495606_0010586 Ga0495606_0010586_3548_4447 292
480 3300046507 Ga0495606_0027916 Ga0495606_0027916_471_1355 292
481 3300046507 Ga0495606_0029465 Ga0495606_0029465_88_978 292
482 3300046507 Ga0495606_0085182 Ga0495606_0085182_274_1164 292
483 3300046512 Ga0495610_0000106 Ga0495610_0000106_29393_30292 292
484 3300046512 Ga0495610_0003952 Ga0495610_0003952_10190_11068 292
485 3300046512 Ga0495610_0004909 Ga0495610_0004909_3727_4623 292
486 3300046512 Ga0495610_0013556 Ga0495610_0013556_2848_3747 292
487 3300046513 Ga0495616_0000316 Ga0495616_0000316_16461_17360 292
488 3300046513 Ga0495616_0074419 Ga0495616_0074419_510_1400 292
489 3300046519 Ga0495632_0000725 Ga0495632_0000725_3772_4659 292
490 3300046519 Ga0495632_0007105 Ga0495632_0007105_2221_3111 292
491 3300046520 Ga0495637_0008922 Ga0495637_0008922_1003_1902 292
492 3300046522 Ga0495643_0000444 Ga0495643_0000444_5404_6300 292
493 3300046522 Ga0495643_0000643 Ga0495643_0000643_35337_36239 292
494 3300046522 Ga0495643_0000777 Ga0495643_0000777_7522_8412 292
495 3300046522 Ga0495643_0001278 Ga0495643_0001278_6831_7730 292
496 3300046522 Ga0495643_0003064 Ga0495643_0003064_8600_9490 292
497 3300046522 Ga0495643_0049890 Ga0495643_0049890_635_1522 292
498 3300046524 Ga0495648_0000037 Ga0495648_0000037_3624_4526 292
499 3300046524 Ga0495648_0002410 Ga0495648_0002410_5749_6636 292
500 3300046524 Ga0495648_0007092 Ga0495648_0007092_1218_2108 292
501 3300046524 Ga0495648_0009168 Ga0495648_0009168_5334_6230 292
502 3300046528 Ga0495642_0000386 Ga0495642_0000386_22367_23257 292
503 3300046528 Ga0495642_0009306 Ga0495642_0009306_67_960 292
504 3300046528 Ga0495642_0027357 Ga0495642_0027357_226_1116 292
505 3300046530 Ga0495654_0012233 Ga0495654_0012233_115_1053 292
506 3300046538 Ga0495609_0000039 Ga0495609_0000039_155660_156550 292
507 3300046538 Ga0495609_0000730 Ga0495609_0000730_17964_18851 292
508 3300046538 Ga0495609_0001009 Ga0495609_0001009_15537_16439 292
509 3300046538 Ga0495609_0008314 Ga0495609_0008314_411_1307 292
510 3300046542 Ga0495597_0000327 Ga0495597_0000327_35291_36187 292
511 3300046542 Ga0495597_0000874 Ga0495597_0000874_18920_19822 292
512 3300046542 Ga0495597_0042045 Ga0495597_0042045_988_1881 292
513 3300046542 Ga0495597_0077321 Ga0495597_0077321_351_1232 292
514 3300046557 Ga0495622_0002083 Ga0495622_0002083_3644_4546 292
515 3300046558 Ga0495633_0000244 Ga0495633_0000244_35470_36360 292
516 3300046558 Ga0495633_0000433 Ga0495633_0000433_19140_20042 292
517 3300046558 Ga0495633_0007472 Ga0495633_0007472_625_1518 292
518 3300046616 Ga0495668_0000241 Ga0495668_0000241_24350_25249 292
519 3300046616 Ga0495668_0002017 Ga0495668_0002017_5345_6247 292
520 3300046616 Ga0495668_0003173 Ga0495668_0003173_8023_8910 292
521 3300046616 Ga0495668_0003228 Ga0495668_0003228_7822_8760 292
522 3300046616 Ga0495668_0005941 Ga0495668_0005941_2300_3199 292
523 3300046616 Ga0495668_0148792 Ga0495668_0148792_164_1057 292
524 3300046660 Ga0495625_0002538 Ga0495625_0002538_6165_7052 292
525 3300046660 Ga0495625_0006115 Ga0495625_0006115_2980_3879 292
526 3300046660 Ga0495625_0006849 Ga0495625_0006849_5541_6443 292
527 3300046660 Ga0495625_0010538 Ga0495625_0010538_6415_7356 292
528 3300046660 Ga0495625_0018274 Ga0495625_0018274_4036_4932 292
529 3300046665 Ga0495661_0000903 Ga0495661_0000903_3588_4478 292
530 3300046665 Ga0495661_0001155 Ga0495661_0001155_13161_14054 292
531 3300046665 Ga0495661_0003555 Ga0495661_0003555_7518_8408 292
532 3300046665 Ga0495661_0019219 Ga0495661_0019219_975_1913 292
533 3300046665 Ga0495661_0021310 Ga0495661_0021310_945_1835 292
534 3300046674 Ga0495588_0000110 Ga0495588_0000110_90985_91875 292
535 3300046692 Ga0495671_0000006 Ga0495671_0000006_436476_437375 292
536 3300046692 Ga0495671_0008804 Ga0495671_0008804_187_1125 292
537 3300046694 Ga0495649_0009011 Ga0495649_0009011_3599_4495 292
538 3300046694 Ga0495649_0024838 Ga0495649_0024838_1429_2316 292
539 3300046794 Ga0495589_0000019 Ga0495589_0000019_157431_158321 292
540 3300046794 Ga0495589_0000828 Ga0495589_0000828_7590_8480 292
541 3300046794 Ga0495589_0030098 Ga0495589_0030098_1073_1960 292
542 3300046810 Ga0495660_0000572 Ga0495660_0000572_3662_4552 292
543 3300046810 Ga0495660_0006376 Ga0495660_0006376_5146_6084 292
544 3300047320 Ga0495672_0000753 Ga0495672_0000753_29378_30274 292
545 3300047320 Ga0495672_0003317 Ga0495672_0003317_8734_9621 292
546 3300047323 Ga0495683_0014326 Ga0495683_0014326_1309_2196 292
547 3300047323 Ga0495683_0038841 Ga0495683_0038841_1041_1925 292
548 3300047443 Ga0495687_000059 Ga0495687_000059_155660_156550 292
549 3300047443 Ga0495687_005463 Ga0495687_005463_7112_8002 292
550 3300047443 Ga0495687_005550 Ga0495687_005550_7028_7918 292
551 3300047445 Ga0495677_0000006 Ga0495677_0000006_42681_43571 292
552 3300047445 Ga0495677_0000347 Ga0495677_0000347_750_1637 292
553 3300047445 Ga0495677_0003237 Ga0495677_0003237_3584_4474 292
554 3300047469 Ga0495673_0000003 Ga0495673_0000003_710626_711525 292
555 3300047469 Ga0495673_0000351 Ga0495673_0000351_47965_48903 292
556 3300047470 Ga0495681_0010860 Ga0495681_0010860_928_1812 292
557 3300047472 Ga0495686_0000318 Ga0495686_0000318_43425_44312 292
558 3300047472 Ga0495686_0001447 Ga0495686_0001447_8271_9158 292
559 3300047472 Ga0495686_0009673 Ga0495686_0009673_5032_5931 292
560 3300047472 Ga0495686_0080948 Ga0495686_0080948_342_1280 292
561 3300048091 Ga0495626_0000103 Ga0495626_0000103_84908_85798 292
562 3300048091 Ga0495626_0000902 Ga0495626_0000902_3587_4477 292
563 3300048091 Ga0495626_0015496 Ga0495626_0015496_948_1835 292
564 3300048091 Ga0495626_0042565 Ga0495626_0042565_430_1329 292
565 3300048905 Ga0496102_0000064 Ga0496102_0000064_7494_8399 292
566 3300048906 Ga0496103_0075367 Ga0496103_0075367_858_1763 292
567 3300048907 Ga0496104_0644534 Ga0496104_0644534_54_944 292
568 3300048909 Ga0496106_0008358 Ga0496106_0008358_4538_5428 292
569 3300048910 Ga0496107_0017885 Ga0496107_0017885_1098_1988 292
570 3300048914 Ga0496111_0012430 Ga0496111_0012430_4090_4983 292
571 3300048916 Ga0496113_0002265 Ga0496113_0002265_6792_7682 292
572 3300048919 Ga0496116_0023412 Ga0496116_0023412_3451_4350 292
573 3300048919 Ga0496116_0084815 Ga0496116_0084815_501_1388 292
574 3300048920 Ga0496117_0000094 Ga0496117_0000094_135185_136078 292
575 3300048920 Ga0496117_0246570 Ga0496117_0246570_53_940 292
576 3300048921 Ga0496118_0000071 Ga0496118_0000071_135185_136078 292
577 3300048921 Ga0496118_0095020 Ga0496118_0095020_826_1713 292
578 3300048923 Ga0496120_0020559 Ga0496120_0020559_708_1607 292
579 3300048924 Ga0496121_0013966 Ga0496121_0013966_3602_4495 292
580 3300048924 Ga0496121_0014140 Ga0496121_0014140_3159_4103 292
581 3300048924 Ga0496121_0022940 Ga0496121_0022940_3649_4536 292
582 3300048924 Ga0496121_0047108 Ga0496121_0047108_1458_2357 292
583 3300048924 Ga0496121_0050060 Ga0496121_0050060_2244_3137 292
584 3300048924 Ga0496121_0160111 Ga0496121_0160111_679_1566 292
585 3300048925 Ga0496122_0000134 Ga0496122_0000134_134419_135360 292
586 3300048925 Ga0496122_0003153 Ga0496122_0003153_14230_15117 292
587 3300048925 Ga0496122_0009932 Ga0496122_0009932_2399_3292 292
588 3300048925 Ga0496122_0011074 Ga0496122_0011074_1242_2132 292
589 3300048925 Ga0496122_0020099 Ga0496122_0020099_1416_2306 292
590 3300048925 Ga0496122_0092505 Ga0496122_0092505_92_991 292
591 3300048925 Ga0496122_0248064 Ga0496122_0248064_36_935 292
592 3300048926 Ga0496123_0000295 Ga0496123_0000295_41100_41987 292
593 3300048926 Ga0496123_0000307 Ga0496123_0000307_60124_61065 292
594 3300048926 Ga0496123_0001494 Ga0496123_0001494_20652_21551 292
595 3300048926 Ga0496123_0002403 Ga0496123_0002403_4999_5892 292
596 3300048926 Ga0496123_0012610 Ga0496123_0012610_1064_1954 292
597 3300048926 Ga0496123_0023302 Ga0496123_0023302_513_1403 292
598 3300048927 Ga0496124_0004010 Ga0496124_0004010_9199_10089 292
599 3300048927 Ga0496124_0055192 Ga0496124_0055192_2260_3159 292
600 3300048928 Ga0496125_0004153 Ga0496125_0004153_14999_15940 292
601 3300048928 Ga0496125_0009913 Ga0496125_0009913_5542_6429 292
602 3300048928 Ga0496125_0011136 Ga0496125_0011136_3112_3999 292
603 3300048928 Ga0496125_0069690 Ga0496125_0069690_453_1394 292
604 3300048928 Ga0496125_0188167 Ga0496125_0188167_406_1299 292
605 3300048929 Ga0496126_0008452 Ga0496126_0008452_8644_9543 292
606 3300049459 Ga0495678_000391 Ga0495678_000391_29741_30625 292
607 3300049459 Ga0495678_003514 Ga0495678_003514_5146_6042 292
608 3300049459 Ga0495678_003907 Ga0495678_003907_5052_5954 292
609 3300049459 Ga0495678_008263 Ga0495678_008263_1850_2752 292
610 3300049459 Ga0495678_011038 Ga0495678_011038_1192_2079 292
611 3300049460 Ga0495682_0000342 Ga0495682_0000342_3728_4612 292
612 3300049460 Ga0495682_0010160 Ga0495682_0010160_2252_3145 292
613 3300049572 Ga0501036_0028042 Ga0501036_0028042_229_1119 292
614 3300049822 Ga0501035_0001779 Ga0501035_0001779_6433_7323 292
615 3300049823 Ga0501044_0225798 Ga0501044_0225798_526_1416 292
616 3300053125 Ga0500618_000660 Ga0500618_000660_15307_16341 292
617 3300053125 Ga0500618_000824 Ga0500618_000824_11281_12207 292
618 3300059641 Ga0587068_005051 Ga0587068_005051_317_1207 292
619 3300061719 Ga0466962_0066246 Ga0466962_0066246_335_1225 292
620 iso_pu_bacteria 2513020051 2513227688 292
621 iso_pu_bacteria 2599185214 2599625615 292
622 iso_pu_bacteria 2599185226 2599673628 292
623 iso_pu_bacteria 2599185227 2599683298 292
624 iso_pu_bacteria 2599185229 2599695214 292
625 iso_pu_bacteria 2643221628 2644162296 292
626 iso_pu_bacteria 2643221658 2644324457 292
627 iso_pu_bacteria 2643221672 2644396298 292
628 iso_pu_bacteria 2738541277 2738719201 292
629 iso_pu_bacteria 2738541307 2738880222 292
630 iso_pu_bacteria 2738543013 2739248079 292
631 iso_pu_bacteria 2738543019 2739281963 292
632 iso_pu_bacteria 2818991446 2819599702 292
633 iso_pu_bacteria 2831265667 2831271765 292
634 iso_pu_bacteria 2838054893 2838055614 292
635 iso_pu_bacteria 2842677519 2842682663 292
636 iso_pu_bacteria 2885192300 2885194778 292
637 iso_pu_bacteria 2885198086 2885200852 292
638 iso_pu_bacteria 2885211737 2885214365 292
639 iso_pu_bacteria 2899924645 2899927665 292
640 iso_pu_bacteria 2904449895 2904450633 292
641 iso_pu_bacteria 2904456579 2904459867 292
642 iso_pu_bacteria 2904541872 2904549834 292
643 iso_pu_bacteria 2919462493 2919462838 292
644 iso_pu_bacteria 2928037797 2928042058 292
645 iso_pu_bacteria 2928044640 2928049622 292
646 iso_pu_bacteria 2928051484 2928051704 292
647 iso_pu_bacteria 2928064002 2928065605 292
648 iso_pu_bacteria 2928070936 2928073072 292
649 iso_pu_bacteria 2928084124 2928086859 292
650 iso_pu_bacteria 2929160207 2929161804 292
651 iso_pu_bacteria 2929520902 2929521350 292
652 iso_pu_bacteria 2945972063 2945973408 292
653 iso_pu_bacteria 2945984333 2945990801 292
654 iso_pu_bacteria 2954767861 2954770990 292
655 iso_pu_bacteria 2643221683 2644464660 293
656 3300005353 Ga0070669_100177227 Ga0070669_1001772272 295
657 3300005548 Ga0070665_100068370 Ga0070665_1000683702 295
658 3300048919 Ga0496116_0064515 Ga0496116_0064515_802_1689 295
659 3300048925 Ga0496122_0000063 Ga0496122_0000063_67524_68411 295
660 3300048926 Ga0496123_0000045 Ga0496123_0000045_117949_118836 295
661 3300048926 Ga0496123_0096810 Ga0496123_0096810_437_1324 295
662 3300048927 Ga0496124_0025846 Ga0496124_0025846_4046_4933 295
663 3300049571 Ga0501034_0266575 Ga0501034_0266575_333_1220 295
664 3300053090 Ga0500646_0023099 Ga0500646_0023099_29_916 295
665 3300053093 Ga0500651_0053665 Ga0500651_0053665_286_1173 295
666 3300053136 Ga0500559_0012473 Ga0500559_0012473_363_1250 295
667 3300053156 Ga0500622_0068864 Ga0500622_0068864_413_1300 295
668 2162886007 SwRhRL2b_contig_2752670 SwRhRL2b_0788.00002700 296
669 3300002774 JGI25150J39212_1002850 JGI25150J39212_10028502 296
670 3300003374 JGI25161J50226_1005205 JGI25161J50226_10052053 296
671 3300003374 JGI25161J50226_1005307 JGI25161J50226_10053074 296
672 3300003578 Ga0006562J51391_1018386 Ga0006562J51391_10183862 296
673 3300003762 Ga0055542_1000022 Ga0055542_1000022167 296
674 3300003773 Ga0055537_1000134 Ga0055537_100013419 296
675 3300003781 Ga0055536_1004046 Ga0055536_10040468 296
676 3300003784 Ga0055534_1000088 Ga0055534_100008819 296
677 3300003790 Ga0055528_1000630 Ga0055528_100063018 296
678 3300003790 Ga0055528_1011813 Ga0055528_10118132 296
679 3300003791 Ga0055530_10000962 Ga0055530_100009622 296
680 3300003792 Ga0055540_1003446 Ga0055540_10034462 296
681 3300003792 Ga0055540_1008455 Ga0055540_10084552 296
682 3300003794 Ga0055531_10002924 Ga0055531_100029242 296
683 3300005289 Ga0065704_10085515 Ga0065704_100855152 296
684 3300005356 Ga0070674_100052535 Ga0070674_1000525353 296
685 3300005455 Ga0070663_100154381 Ga0070663_1001543813 296
686 3300005456 Ga0070678_100038770 Ga0070678_1000387702 296
687 3300005457 Ga0070662_100028288 Ga0070662_1000282882 296
688 3300005459 Ga0068867_100179652 Ga0068867_1001796522 296
689 3300005548 Ga0070665_100024888 Ga0070665_1000248888 296
690 3300005548 Ga0070665_100653291 Ga0070665_1006532912 296
691 3300005563 Ga0068855_100144470 Ga0068855_1001444704 296
692 3300005577 Ga0068857_100042395 Ga0068857_1000423955 296
693 3300005834 Ga0068851_10033206 Ga0068851_100332062 296
694 3300006048 Ga0075363_100024393 Ga0075363_1000243934 296
695 3300006051 Ga0075364_10096102 Ga0075364_100961023 296
696 3300006177 Ga0075362_10013049 Ga0075362_100130494 296
697 3300006195 Ga0075366_10024573 Ga0075366_100245732 296
698 3300006195 Ga0075366_10026719 Ga0075366_100267192 296
699 3300006195 Ga0075366_10051626 Ga0075366_100516262 296
700 3300006353 Ga0075370_10034392 Ga0075370_100343923 296
701 3300006353 Ga0075370_10126922 Ga0075370_101269221 296
702 3300006353 Ga0075370_10150195 Ga0075370_101501951 296
703 3300006946 Ga0079104_1029369 Ga0079104_10293692 296
704 3300006948 Ga0099826_10001370 Ga0099826_1000137015 296
705 3300009036 Ga0105244_10012570 Ga0105244_100125702 296
706 3300009148 Ga0105243_10006758 Ga0105243_1000675810 296
707 3300009148 Ga0105243_10009873 Ga0105243_100098738 296
708 3300009174 Ga0105241_10165016 Ga0105241_101650162 296
709 3300009176 Ga0105242_10102178 Ga0105242_101021782 296
710 3300009176 Ga0105242_10104410 Ga0105242_101044102 296
711 3300009551 Ga0105238_10064300 Ga0105238_100643004 296
712 3300009551 Ga0105238_10145333 Ga0105238_101453332 296
713 3300010375 Ga0105239_10252868 Ga0105239_102528682 296
714 3300011119 Ga0105246_10051565 Ga0105246_100515652 296
715 3300013100 Ga0157373_10068307 Ga0157373_100683072 296
716 3300013100 Ga0157373_10074161 Ga0157373_100741612 296
717 3300013102 Ga0157371_10134905 Ga0157371_101349051 296
718 3300013104 Ga0157370_10039005 Ga0157370_100390054 296
719 3300013105 Ga0157369_10007881 Ga0157369_1000788110 296
720 3300013306 Ga0163162_10027211 Ga0163162_100272117 296
721 3300013307 Ga0157372_10201211 Ga0157372_102012112 296
722 3300014497 Ga0182008_10002427 Ga0182008_1000242713 296
723 3300014497 Ga0182008_10006865 Ga0182008_100068652 296
724 3300014497 Ga0182008_10011104 Ga0182008_100111042 296
725 3300014497 Ga0182008_10016496 Ga0182008_100164962 296
726 3300015261 Ga0182006_1001570 Ga0182006_10015702 296
727 3300015261 Ga0182006_1012894 Ga0182006_10128942 296
728 3300015262 Ga0182007_10001908 Ga0182007_1000190812 296
729 3300015262 Ga0182007_10003300 Ga0182007_100033002 296
730 3300015265 Ga0182005_1016651 Ga0182005_10166514 296
731 3300015683 Ga0183362_10005 Ga0183362_10005419 296
732 3300017792 Ga0163161_10020171 Ga0163161_100201712 296
733 3300017792 Ga0163161_10065072 Ga0163161_100650722 296
734 3300025228 Ga0209672_101007 Ga0209672_1010077 296
735 3300025229 Ga0209147_103626 Ga0209147_1036264 296
736 3300025242 Ga0209258_100009 Ga0209258_100009830 296
737 3300025254 Ga0209148_1000007 Ga0209148_1000007830 296
738 3300025258 Ga0209129_1000024 Ga0209129_1000024241 296
739 3300025258 Ga0209129_1000085 Ga0209129_100008521 296
740 3300025258 Ga0209129_1005702 Ga0209129_10057022 296
741 3300025263 Ga0209565_1000046 Ga0209565_1000046136 296
742 3300025273 Ga0209673_1000058 Ga0209673_100005842 296
743 3300025273 Ga0209673_1010330 Ga0209673_10103302 296
744 3300025273 Ga0209673_1010835 Ga0209673_10108352 296
745 3300025284 Ga0209130_1002262 Ga0209130_10022627 296
746 3300025291 Ga0209675_1000010 Ga0209675_1000010223 296
747 3300025291 Ga0209675_1005766 Ga0209675_10057662 296
748 3300025292 Ga0209676_1000028 Ga0209676_100002898 296
749 3300025292 Ga0209676_1000098 Ga0209676_1000098192 296
750 3300025292 Ga0209676_1000173 Ga0209676_1000173101 296
751 3300025292 Ga0209676_1000194 Ga0209676_100019435 296
752 3300025292 Ga0209676_1041817 Ga0209676_10418171 296
753 3300025292 Ga0209676_1049270 Ga0209676_10492701 296
754 3300025294 Ga0209025_1000122 Ga0209025_100012220 296
755 3300025294 Ga0209025_1000404 Ga0209025_100040412 296
756 3300025294 Ga0209025_1002394 Ga0209025_100239414 296
757 3300025294 Ga0209025_1019136 Ga0209025_10191364 296
758 3300025295 Ga0209564_1000183 Ga0209564_100018397 296
759 3300025295 Ga0209564_1000198 Ga0209564_100019887 296
760 3300025297 Ga0209758_1000049 Ga0209758_1000049160 296
761 3300025298 Ga0209050_1000002 Ga0209050_1000002145 296
762 3300025298 Ga0209050_1000122 Ga0209050_1000122133 296
763 3300025298 Ga0209050_1000554 Ga0209050_100055454 296
764 3300025298 Ga0209050_1005757 Ga0209050_100575710 296
765 3300025299 Ga0209256_1000098 Ga0209256_1000098162 296
766 3300025299 Ga0209256_1000140 Ga0209256_100014097 296
767 3300025302 Ga0207426_1000038 Ga0207426_1000038162 296
768 3300025302 Ga0207426_1000053 Ga0207426_1000053196 296
769 3300025303 Ga0209051_1000015 Ga0209051_100001527 296
770 3300025303 Ga0209051_1000159 Ga0209051_100015920 296
771 3300025303 Ga0209051_1000194 Ga0209051_100019419 296
772 3300025303 Ga0209051_1000282 Ga0209051_100028247 296
773 3300025303 Ga0209051_1000597 Ga0209051_100059710 296
774 3300025303 Ga0209051_1014777 Ga0209051_10147774 296
775 3300025304 Ga0209257_1000002 Ga0209257_100000254 296
776 3300025304 Ga0209257_1004288 Ga0209257_100428811 296
777 3300025321 Ga0207656_10010157 Ga0207656_100101572 296
778 3300025728 Ga0207655_1002288 Ga0207655_100228813 296
779 3300025924 Ga0207694_10075465 Ga0207694_100754652 296
780 3300025924 Ga0207694_10158047 Ga0207694_101580473 296
781 3300025933 Ga0207706_10025112 Ga0207706_100251126 296
782 3300025934 Ga0207686_10057268 Ga0207686_100572682 296
783 3300025934 Ga0207686_10126524 Ga0207686_101265242 296
784 3300025935 Ga0207709_10000285 Ga0207709_1000028510 296
785 3300025935 Ga0207709_10004960 Ga0207709_100049602 296
786 3300025935 Ga0207709_10058461 Ga0207709_100584612 296
787 3300025949 Ga0207667_10099953 Ga0207667_100999532 296
788 3300025960 Ga0207651_10457643 Ga0207651_104576431 296
789 3300025986 Ga0207658_10302372 Ga0207658_103023723 296
790 3300026041 Ga0207639_10010174 Ga0207639_100101742 296
791 3300026041 Ga0207639_10379058 Ga0207639_103790581 296
792 3300026067 Ga0207678_10287145 Ga0207678_102871453 296
793 3300026089 Ga0207648_10263216 Ga0207648_102632162 296
794 3300026121 Ga0207683_10166283 Ga0207683_101662832 296
795 3300026121 Ga0207683_10175634 Ga0207683_101756342 296
796 3300027666 Ga0209282_1001079 Ga0209282_10010797 296
797 3300027907 Ga0207428_10117068 Ga0207428_101170682 296
798 3300028379 Ga0268266_10324922 Ga0268266_103249223 296
799 3300028380 Ga0268265_10015308 Ga0268265_100153083 296
800 3300028794 Ga0307515_10012653 Ga0307515_100126538 296
801 3300030731 Ga0316177_1117067 Ga0316177_11170672 296
802 3300030732 Ga0316176_1072478 Ga0316176_10724782 296
803 3300030733 Ga0314311_1059701 Ga0314311_10597011 296
804 3300030735 Ga0316178_1142965 Ga0316178_11429655 296
805 3300030736 Ga0316180_1061916 Ga0316180_10619161 296
806 3300030742 Ga0316183_1076813 Ga0316183_10768132 296
807 3300030744 Ga0316181_1034408 Ga0316181_10344082 296
808 3300030745 Ga0316182_1050266 Ga0316182_10502662 296
809 3300031251 Ga0265327_10013542 Ga0265327_100135428 296
810 3300031649 Ga0307514_10024217 Ga0307514_100242173 296
811 3300031731 Ga0307405_10010853 Ga0307405_100108532 296
812 3300031731 Ga0307405_10066709 Ga0307405_100667092 296
813 3300031901 Ga0307406_10001422 Ga0307406_1000142210 296
814 3300031911 Ga0307412_10033751 Ga0307412_100337514 296
815 3300031911 Ga0307412_10049150 Ga0307412_100491503 296
816 3300031911 Ga0307412_10075260 Ga0307412_100752602 296
817 3300032126 Ga0307415_100418125 Ga0307415_1004181251 296
818 3300041404 Ga0439436_0000382 Ga0439436_0000382_9253_10143 296
819 3300041404 Ga0439436_0004185 Ga0439436_0004185_1094_1984 296
820 3300041406 Ga0439439_0003399 Ga0439439_0003399_1190_2080 296
821 3300041411 Ga0439466_0001231 Ga0439466_0001231_7459_8349 296
822 3300041411 Ga0439466_0021970 Ga0439466_0021970_1089_1979 296
823 3300041413 Ga0439465_0001246 Ga0439465_0001246_1510_2400 296
824 3300041413 Ga0439465_0015400 Ga0439465_0015400_1134_2024 296
825 3300041997 Ga0439431_0012337 Ga0439431_0012337_717_1607 296
826 3300041999 Ga0439433_0002040 Ga0439433_0002040_950_1840 296
827 3300041999 Ga0439433_0006272 Ga0439433_0006272_647_1537 296
828 3300042002 Ga0439442_002770 Ga0439442_002770_988_1878 296
829 3300042002 Ga0439442_013545 Ga0439442_013545_274_1164 296
830 3300042004 Ga0439445_0000223 Ga0439445_0000223_826_1716 296
831 3300042006 Ga0439432_001997 Ga0439432_001997_2413_3303 296
832 3300042006 Ga0439432_002220 Ga0439432_002220_3083_3973 296
833 3300042007 Ga0439449_0000209 Ga0439449_0000209_15120_16010 296
834 3300042007 Ga0439449_0000215 Ga0439449_0000215_6911_7801 296
835 3300042007 Ga0439449_0005047 Ga0439449_0005047_3807_4697 296
836 3300042007 Ga0439449_0021863 Ga0439449_0021863_1041_1931 296
837 3300042010 Ga0439452_024773 Ga0439452_024773_176_1066 296
838 3300042014 Ga0439457_003046 Ga0439457_003046_1115_2005 296
839 3300042015 Ga0439462_0013469 Ga0439462_0013469_711_1601 296
840 3300042125 Ga0450923_005020 Ga0450923_005020_95_985 296
841 3300042125 Ga0450923_016250 Ga0450923_016250_55_945 296
842 3300042135 Ga0450899_006515 Ga0450899_006515_322_1212 296
843 3300042146 Ga0450907_005113 Ga0450907_005113_1253_2143 296
844 3300042156 Ga0439446_0003872 Ga0439446_0003872_1175_2065 296
845 3300042184 Ga0450908_000697 Ga0450908_000697_49_939 296
846 3300042185 Ga0450909_003723 Ga0450909_003723_886_1776 296
847 3300042185 Ga0450909_005523 Ga0450909_005523_192_1082 296
848 3300042435 Ga0439434_0001906 Ga0439434_0001906_2715_3605 296
849 3300042435 Ga0439434_0014465 Ga0439434_0014465_788_1678 296
850 3300042531 Ga0450918_000817 Ga0450918_000817_580_1470 296
851 3300044683 Ga0466965_0061551 Ga0466965_0061551_49_939 296
852 3300044735 Ga0466968_0055523 Ga0466968_0055523_267_1187 296
853 3300046453 Ga0495627_014963 Ga0495627_014963_1528_2418 296
854 3300046460 Ga0495638_0071080 Ga0495638_0071080_186_1076 296
855 3300046462 Ga0495651_0224859 Ga0495651_0224859_346_1236 296
856 3300046513 Ga0495616_0003860 Ga0495616_0003860_1029_1919 296
857 3300046515 Ga0495620_0004751 Ga0495620_0004751_2261_3151 296
858 3300046517 Ga0495630_0125540 Ga0495630_0125540_280_1170 296
859 3300046518 Ga0495631_0011741 Ga0495631_0011741_1449_2339 296
860 3300046520 Ga0495637_0001872 Ga0495637_0001872_8790_9680 296
861 3300046522 Ga0495643_0101656 Ga0495643_0101656_14_904 296
862 3300046526 Ga0495666_0174189 Ga0495666_0174189_64_954 296
863 3300046539 Ga0495621_0031994 Ga0495621_0031994_98_988 296
864 3300046615 Ga0495656_0000087 Ga0495656_0000087_1411_2301 296
865 3300046616 Ga0495668_0056002 Ga0495668_0056002_928_1818 296
866 3300046660 Ga0495625_0000245 Ga0495625_0000245_72709_73599 296
867 3300046660 Ga0495625_0062113 Ga0495625_0062113_810_1700 296
868 3300046660 Ga0495625_0162630 Ga0495625_0162630_264_1154 296
869 3300046663 Ga0495635_0243158 Ga0495635_0243158_252_1142 296
870 3300046674 Ga0495588_0007799 Ga0495588_0007799_2612_3502 296
871 3300046680 Ga0495646_0165249 Ga0495646_0165249_308_1198 296
872 3300046683 Ga0495658_0020233 Ga0495658_0020233_129_1019 296
873 3300046691 Ga0495670_0023650 Ga0495670_0023650_1934_2824 296
874 3300046691 Ga0495670_0103366 Ga0495670_0103366_560_1450 296
875 3300046692 Ga0495671_0037913 Ga0495671_0037913_397_1287 296
876 3300047321 Ga0495676_0228246 Ga0495676_0228246_292_1182 296
877 3300048090 Ga0495615_0008507 Ga0495615_0008507_354_1244 296
878 3300048903 Ga0496100_0092549 Ga0496100_0092549_598_1488 296
879 3300048904 Ga0496101_0034301 Ga0496101_0034301_649_1539 296
880 3300048904 Ga0496101_0036961 Ga0496101_0036961_617_1507 296
881 3300048905 Ga0496102_0116930 Ga0496102_0116930_990_1880 296
882 3300048906 Ga0496103_0014373 Ga0496103_0014373_471_1361 296
883 3300048906 Ga0496103_0094268 Ga0496103_0094268_124_1014 296
884 3300048907 Ga0496104_0005753 Ga0496104_0005753_9028_9918 296
885 3300048908 Ga0496105_0035394 Ga0496105_0035394_741_1631 296
886 3300048909 Ga0496106_0087580 Ga0496106_0087580_890_1780 296
887 3300048910 Ga0496107_0040214 Ga0496107_0040214_716_1606 296
888 3300048911 Ga0496108_0293163 Ga0496108_0293163_66_956 296
889 3300048915 Ga0496112_0267585 Ga0496112_0267585_363_1253 296
890 3300048919 Ga0496116_0031289 Ga0496116_0031289_1965_2855 296
891 3300048919 Ga0496116_0087056 Ga0496116_0087056_342_1232 296
892 3300048920 Ga0496117_0063595 Ga0496117_0063595_40_930 296
893 3300048920 Ga0496117_0081812 Ga0496117_0081812_1052_1942 296
894 3300048922 Ga0496119_0050596 Ga0496119_0050596_728_1618 296
895 3300048924 Ga0496121_0075961 Ga0496121_0075961_1356_2246 296
896 3300048924 Ga0496121_0080283 Ga0496121_0080283_784_1674 296
897 3300048924 Ga0496121_0095100 Ga0496121_0095100_67_957 296
898 3300048925 Ga0496122_0036508 Ga0496122_0036508_1035_1925 296
899 3300048925 Ga0496122_0111682 Ga0496122_0111682_317_1207 296
900 3300048927 Ga0496124_0052717 Ga0496124_0052717_1154_2044 296
901 3300048927 Ga0496124_0083739 Ga0496124_0083739_705_1595 296
902 3300048928 Ga0496125_0015804 Ga0496125_0015804_5402_6292 296
903 3300048928 Ga0496125_0045967 Ga0496125_0045967_877_1767 296
904 3300048928 Ga0496125_0119869 Ga0496125_0119869_233_1123 296
905 3300049705 Ga0501225_0027047 Ga0501225_0027047_401_1291 296
906 3300049759 Ga0501262_000532 Ga0501262_000532_2631_3521 296
907 3300050489 nmdc:mga03683_14532_c1 nmdc:mga03683_14532_c1_1524_2414 296
908 3300050489 nmdc:mga03683_44068_c1 nmdc:mga03683_44068_c1_855_1745 296
909 3300050489 nmdc:mga03683_48174_c1 nmdc:mga03683_48174_c1_53_943 296
910 3300050490 nmdc:mga03n38_22845_c1 nmdc:mga03n38_22845_c1_1175_2065 296
911 3300050491 nmdc:mga00v17_35099_c1 nmdc:mga00v17_35099_c1_528_1418 296
912 3300050493 nmdc:mga0k408_11179_c1 nmdc:mga0k408_11179_c1_2057_2947 296
913 3300050493 nmdc:mga0k408_19690_c1 nmdc:mga0k408_19690_c1_2215_3105 296
914 3300050493 nmdc:mga0k408_34097_c1 nmdc:mga0k408_34097_c1_738_1628 296
915 3300050494 nmdc:mga06z11_129231_c1 nmdc:mga06z11_129231_c1_324_1214 296
916 3300050496 nmdc:mga07m45_2078_c1 nmdc:mga07m45_2078_c1_1506_2396 296
917 3300050496 nmdc:mga07m45_23737_c1 nmdc:mga07m45_23737_c1_222_1112 296
918 3300050496 nmdc:mga07m45_9105_c1 nmdc:mga07m45_9105_c1_3238_4128 296
919 3300053079 Ga0500610_0004823 Ga0500610_0004823_815_1705 296
920 3300053093 Ga0500651_0000125 Ga0500651_0000125_38325_39215 296
921 3300053096 Ga0500641_0152769 Ga0500641_0152769_39_929 296
922 3300053110 Ga0500571_000811 Ga0500571_000811_5626_6516 296
923 3300053111 Ga0500572_033169 Ga0500572_033169_43_933 296
924 3300053117 Ga0500593_004926 Ga0500593_004926_1276_2166 296
925 3300053118 Ga0500594_0013942 Ga0500594_0013942_840_1730 296
926 3300053121 Ga0500607_007247 Ga0500607_007247_2616_3506 296
927 3300053122 Ga0500608_010325 Ga0500608_010325_1649_2539 296
928 3300053128 Ga0500626_015711 Ga0500626_015711_1375_2265 296
929 3300053133 Ga0500655_002019 Ga0500655_002019_1499_2389 296
930 3300053134 Ga0500658_0001125 Ga0500658_0001125_1389_2279 296
931 3300053134 Ga0500658_0002341 Ga0500658_0002341_3733_4623 296
932 3300053139 Ga0500568_0002512 Ga0500568_0002512_7260_8150 296
933 3300053141 Ga0500574_002077 Ga0500574_002077_144_1034 296
934 3300053158 Ga0500627_0001087 Ga0500627_0001087_846_1736 296
935 3300053161 Ga0500634_0013841 Ga0500634_0013841_2690_3580 296
936 3300053161 Ga0500634_0015330 Ga0500634_0015330_1412_2302 296
937 3300053162 Ga0500638_040324 Ga0500638_040324_991_1881 296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

6

278

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ve7-assembly1.cif.gz_A crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp 0.8983 7 294
5j49-assembly1.cif.gz_A crystal structure of udp-glucose pyrophosporylase / utp-glucose-1-phosphate uridylyltransferase from burkholderia xenovorans 0.8959 7 292
5i1f-assembly1.cif.gz_A-2 crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate-glucose 0.8943 7 293
5ve7-assembly1.cif.gz_A crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp 0.8922 7 294
3juk-assembly1.cif.gz_D the crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose 0.8843 8 273
ID Description Score Start End Superfamily
3jukA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8855 8 273 3.90.550.10
af_Q2G1T6_1_286_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8716 7 294 3.90.550.10
af_Q58730_1_282_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8634 8 292 3.90.550.10
af_Q2G1T6_1_286_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8632 7 294 3.90.550.10
2ux8B00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8559 8 293 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A658J916-F1-model_v4 deleted 0.9808 148 244
AF-X1NAW7-F1-model_v4 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) 0.978 106 237 GO:0003983
GO:0006011
GO:0009058
AF-A0A4Q2L7R5-F1-model_v4 deleted 0.9737 133 249
AF-X0Y2Y7-F1-model_v4 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) 0.9712 114 259 GO:0003983
GO:0006011
GO:0009058
AF-A0A3D5DBI4-F1-model_v4 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (UDP-glucose pyrophosphorylase) (Uridine diphosphoglucose pyrophosphorylase) 0.9656 113 293 GO:0003983
GO:0006011
GO:0009058

Feature Viewer

pLDDT pTM Quality
84.23 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map