F486216
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 937 | 423 | 819 | 298 |
Family's Representative Sequence
| Representative Sequence | 3300002704|JGI25155J39150_1000896|JGI25155J39150_10008961 |
| Length | 314 |
| Sequence | MKKITKAVFPVAGLGSRFLPATKAQPKEMLPIVDKPLIQYAVEEAVEAGITEMIFITGRNKRAIEDHFDKAYELETELEAAGKTKLLEFARNVIPKHINCVYIRQSSPLGLGHAVLCAKSLVGDEPFAVVLADDFMDAPENGKNVLGQMIDVFEQEQKSLLAVQDVPRSDTRQYGIVSTDVDGPYSDRLDVISGIVEKPAPDLAPSTLAVVGRYVLTPAIFDRLENIGKGAGGEIQLTDGIADLMQSETVLAYRYDGRRYDCGSKLGYLKATVAMGAKHAEVGKEFSAYLREVHETDEEAAQVQEAPVRLDKIA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 3 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 4 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 5 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 6 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 7 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 8 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 9 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 10 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 11 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 12 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 13 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 14 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 15 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 16 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 17 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 18 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 19 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 20 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 21 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 22 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 23 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 24 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 25 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 26 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 27 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 28 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 29 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 30 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 31 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 32 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 33 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 34 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 35 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 36 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 37 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 38 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 39 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 40 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 41 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 42 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 43 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 44 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 45 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 46 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 47 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 48 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 49 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 50 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 51 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 52 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 53 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 54 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 55 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 56 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 57 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 58 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 59 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 60 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 61 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 62 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 63 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 64 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 65 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 66 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 67 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 68 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 69 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 70 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 71 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 72 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 73 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 74 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 75 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 76 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 77 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 78 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 79 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 80 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 81 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 82 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 83 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 84 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 85 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 86 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 87 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 88 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 89 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 90 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 91 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 92 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 93 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 94 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 95 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 96 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 97 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 98 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 99 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 100 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 101 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 102 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 103 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 104 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 105 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 106 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 107 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 108 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 109 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 110 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 111 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 112 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 113 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 114 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 115 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 116 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 117 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 124 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 128 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 130 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 131 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 132 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 133 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 134 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 135 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 136 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 137 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 138 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 139 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 140 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 142 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 143 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 160 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 161 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 162 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 163 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 164 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 166 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 167 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 168 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 179 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 180 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 183 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 186 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 190 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 196 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 224 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 225 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 228 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 229 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 230 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 231 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 232 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 233 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 234 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 235 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 236 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 237 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 238 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 239 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 241 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 242 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 243 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 244 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 245 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 246 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 248 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 249 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 250 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 251 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 252 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 253 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 254 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 255 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 256 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 257 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 258 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 259 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 260 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 261 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 262 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 263 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 264 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 265 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 266 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 267 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 268 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 269 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 270 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 271 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 272 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 273 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 274 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 275 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 276 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 277 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 278 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 279 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 280 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 281 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 282 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 283 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 284 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 285 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 286 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 287 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 288 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 289 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 360 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 361 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 362 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 363 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 364 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 365 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 368 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 369 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 370 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 371 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 372 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 373 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 374 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 375 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 376 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 377 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 378 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 379 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 380 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 381 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 382 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 388 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 389 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 390 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 391 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 394 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 395 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 396 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 397 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 398 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 399 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 400 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 401 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 402 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 403 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 404 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 405 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 406 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 407 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 408 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 409 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 410 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 411 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 412 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 413 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 414 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 415 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 416 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 417 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 418 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 419 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 420 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 421 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 423 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.62 |
| Metatranscriptomes | 0.32 |
| Isolates | 12.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.29 |
| Nodule | 1.28 |
| Rhizoplane | 3.2 |
| Rhizosphere | 61.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2752670 | 2162886007 | Bacteria | 1586 |
| 2 | JGI25155J39150_1000117 | 3300002704 | Bacteria | 39472 |
| 3 | JGI25155J39150_1000134 | 3300002704 | Bacteria | 35162 |
| 4 | JGI25155J39150_1000227 | 3300002704 | Bacteria | 22140 |
| 5 | JGI25155J39150_1000896 | 3300002704 | Bacteria | 4175 |
| 6 | JGI25156J39149_1000108 | 3300002705 | Bacteria | 59882 |
| 7 | JGI25156J39149_1000270 | 3300002705 | Bacteria | 35162 |
| 8 | JGI25156J39149_1006902 | 3300002705 | Bacteria | 3049 |
| 9 | JGI25156J39149_1014331 | 3300002705 | Bacteria | 1640 |
| 10 | JGI25162J39368_1004472 | 3300002737 | Bacteria | 3218 |
| 11 | JGI25154J39366_1000222 | 3300002738 | Bacteria | 38773 |
| 12 | JGI25154J39366_1000247 | 3300002738 | Bacteria | 35162 |
| 13 | JGI25154J39366_1000569 | 3300002738 | Bacteria | 18094 |
| 14 | JGI25154J39366_1000582 | 3300002738 | Bacteria | 17719 |
| 15 | JGI25154J39366_1001350 | 3300002738 | Bacteria | 8980 |
| 16 | JGI25157J39369_1000120 | 3300002741 | Bacteria | 67137 |
| 17 | JGI25157J39369_1000311 | 3300002741 | Bacteria | 35146 |
| 18 | JGI25163J39215_1003006 | 3300002771 | Bacteria | 1471 |
| 19 | JGI25150J39212_1002850 | 3300002774 | Bacteria | 4185 |
| 20 | JGI25165J46597_1000001 | 3300003214 | Bacteria | 1111887 |
| 21 | JGI25161J50226_1005205 | 3300003374 | Bacteria | 2573 |
| 22 | JGI25161J50226_1005307 | 3300003374 | Bacteria | 2523 |
| 23 | Ga0006562J51391_1018386 | 3300003578 | Bacteria | 1832 |
| 24 | Ga0055538_1000001 | 3300003751 | Bacteria | 1111887 |
| 25 | Ga0055538_1000002 | 3300003751 | Bacteria | 999437 |
| 26 | Ga0055538_1000020 | 3300003751 | Bacteria | 264193 |
| 27 | Ga0055539_1000001 | 3300003752 | Bacteria | 1111887 |
| 28 | Ga0055539_1000002 | 3300003752 | Bacteria | 999437 |
| 29 | Ga0055539_1000025 | 3300003752 | Bacteria | 264193 |
| 30 | Ga0055533_1000003 | 3300003756 | Bacteria | 1111887 |
| 31 | Ga0055533_1000004 | 3300003756 | Bacteria | 999437 |
| 32 | Ga0055533_1000034 | 3300003756 | Bacteria | 264193 |
| 33 | Ga0055532_1000023 | 3300003758 | Bacteria | 248212 |
| 34 | Ga0055532_1000051 | 3300003758 | Bacteria | 165365 |
| 35 | Ga0055525_1000002 | 3300003759 | Bacteria | 999437 |
| 36 | Ga0055525_1000003 | 3300003759 | Bacteria | 962094 |
| 37 | Ga0055525_1000044 | 3300003759 | Bacteria | 264193 |
| 38 | Ga0055535_1005122 | 3300003761 | Bacteria | 2967 |
| 39 | Ga0055542_1000022 | 3300003762 | Bacteria | 302315 |
| 40 | Ga0055529_1000138 | 3300003763 | Bacteria | 103490 |
| 41 | Ga0055526_1000411 | 3300003771 | Bacteria | 34678 |
| 42 | Ga0055537_1000134 | 3300003773 | Bacteria | 56046 |
| 43 | Ga0055536_1004046 | 3300003781 | Bacteria | 7636 |
| 44 | Ga0055534_1000088 | 3300003784 | Bacteria | 72004 |
| 45 | Ga0055528_1000630 | 3300003790 | Bacteria | 26033 |
| 46 | Ga0055528_1011813 | 3300003790 | Bacteria | 3436 |
| 47 | Ga0055530_10000962 | 3300003791 | Bacteria | 23389 |
| 48 | Ga0055540_1003446 | 3300003792 | Bacteria | 7640 |
| 49 | Ga0055540_1008455 | 3300003792 | Bacteria | 3705 |
| 50 | Ga0055531_10002924 | 3300003794 | Bacteria | 11120 |
| 51 | Ga0055541_1000001 | 3300003841 | Bacteria | 1111887 |
| 52 | Ga0055541_1000002 | 3300003841 | Bacteria | 896405 |
| 53 | Ga0055541_1000019 | 3300003841 | Bacteria | 264193 |
| 54 | Ga0065704_10085515 | 3300005289 | Bacteria | 3206 |
| 55 | Ga0070682_100012821 | 3300005337 | Bacteria | 4811 |
| 56 | Ga0070660_100016619 | 3300005339 | Bacteria | 5345 |
| 57 | Ga0070661_100090689 | 3300005344 | Bacteria | 2263 |
| 58 | Ga0070669_100177227 | 3300005353 | Bacteria | 1666 |
| 59 | Ga0070674_100052535 | 3300005356 | Bacteria | 2811 |
| 60 | Ga0070659_100015532 | 3300005366 | Bacteria | 5702 |
| 61 | Ga0070705_100047720 | 3300005440 | Bacteria | 2477 |
| 62 | Ga0070694_100005548 | 3300005444 | Bacteria | 7640 |
| 63 | Ga0070663_100154381 | 3300005455 | Bacteria | 1763 |
| 64 | Ga0070663_100184477 | 3300005455 | Bacteria | 1620 |
| 65 | Ga0070678_100038770 | 3300005456 | Bacteria | 3357 |
| 66 | Ga0070662_100028288 | 3300005457 | Bacteria | 3900 |
| 67 | Ga0068867_100179652 | 3300005459 | Bacteria | 1682 |
| 68 | Ga0070665_100024888 | 3300005548 | Bacteria | 6032 |
| 69 | Ga0070665_100068370 | 3300005548 | Bacteria | 3562 |
| 70 | Ga0070665_100653291 | 3300005548 | Bacteria | 1065 |
| 71 | Ga0068855_100000197 | 3300005563 | Bacteria | 78127 |
| 72 | Ga0068855_100001741 | 3300005563 | Bacteria | 27181 |
| 73 | Ga0068855_100011938 | 3300005563 | Bacteria | 10503 |
| 74 | Ga0068855_100015823 | 3300005563 | Bacteria | 9074 |
| 75 | Ga0068855_100144470 | 3300005563 | Bacteria | 2710 |
| 76 | Ga0068855_100176065 | 3300005563 | Bacteria | 2421 |
| 77 | Ga0068855_100567453 | 3300005563 | Bacteria | 1227 |
| 78 | Ga0068857_100042395 | 3300005577 | Bacteria | 4037 |
| 79 | Ga0068854_100002908 | 3300005578 | Bacteria | 10624 |
| 80 | Ga0068854_100051852 | 3300005578 | Bacteria | 2941 |
| 81 | Ga0068852_100006280 | 3300005616 | Bacteria | 8579 |
| 82 | Ga0068852_100193027 | 3300005616 | Bacteria | 1923 |
| 83 | Ga0068852_100347458 | 3300005616 | Bacteria | 1447 |
| 84 | Ga0068859_100075066 | 3300005617 | Bacteria | 3421 |
| 85 | Ga0068851_10033206 | 3300005834 | Bacteria | 2571 |
| 86 | Ga0068851_10104691 | 3300005834 | Bacteria | 1505 |
| 87 | Ga0075363_100024393 | 3300006048 | Bacteria | 3074 |
| 88 | Ga0075364_10096102 | 3300006051 | Bacteria | 1970 |
| 89 | Ga0075362_10013049 | 3300006177 | Bacteria | 3316 |
| 90 | Ga0075366_10024573 | 3300006195 | Bacteria | 3514 |
| 91 | Ga0075366_10026719 | 3300006195 | Bacteria | 3382 |
| 92 | Ga0075366_10051626 | 3300006195 | Bacteria | 2443 |
| 93 | Ga0075370_10034392 | 3300006353 | Bacteria | 2840 |
| 94 | Ga0075370_10126922 | 3300006353 | Bacteria | 1487 |
| 95 | Ga0075370_10150195 | 3300006353 | Bacteria | 1365 |
| 96 | Ga0097620_100075065 | 3300006931 | Bacteria | 3421 |
| 97 | Ga0079104_1029369 | 3300006946 | Bacteria | 1386 |
| 98 | Ga0099826_10000002 | 3300006948 | Bacteria | 1125830 |
| 99 | Ga0099826_10001370 | 3300006948 | Bacteria | 14497 |
| 100 | Ga0105244_10012570 | 3300009036 | Bacteria | 4994 |
| 101 | Ga0105240_10001798 | 3300009093 | Bacteria | 36105 |
| 102 | Ga0105240_10012173 | 3300009093 | Bacteria | 11908 |
| 103 | Ga0105240_10017029 | 3300009093 | Bacteria | 9817 |
| 104 | Ga0105240_10097593 | 3300009093 | Bacteria | 3580 |
| 105 | Ga0105240_10514341 | 3300009093 | Bacteria | 1329 |
| 106 | Ga0105243_10006758 | 3300009148 | Bacteria | 8850 |
| 107 | Ga0105243_10009873 | 3300009148 | Bacteria | 7260 |
| 108 | Ga0105241_10165016 | 3300009174 | Bacteria | 1824 |
| 109 | Ga0105241_10170626 | 3300009174 | Bacteria | 1797 |
| 110 | Ga0105242_10102178 | 3300009176 | Bacteria | 2431 |
| 111 | Ga0105242_10104410 | 3300009176 | Bacteria | 2405 |
| 112 | Ga0105237_10014721 | 3300009545 | Bacteria | 8167 |
| 113 | Ga0105238_10000977 | 3300009551 | Bacteria | 29236 |
| 114 | Ga0105238_10025787 | 3300009551 | Bacteria | 5993 |
| 115 | Ga0105238_10064300 | 3300009551 | Bacteria | 3669 |
| 116 | Ga0105238_10125694 | 3300009551 | Bacteria | 2543 |
| 117 | Ga0105238_10145333 | 3300009551 | Bacteria | 2348 |
| 118 | Ga0105239_10083666 | 3300010375 | Bacteria | 3514 |
| 119 | Ga0105239_10252868 | 3300010375 | Bacteria | 1979 |
| 120 | Ga0105239_10263864 | 3300010375 | Bacteria | 1936 |
| 121 | Ga0105239_10302309 | 3300010375 | Bacteria | 1802 |
| 122 | Ga0105246_10051565 | 3300011119 | Bacteria | 2826 |
| 123 | Ga0157373_10068307 | 3300013100 | Bacteria | 2512 |
| 124 | Ga0157373_10074161 | 3300013100 | Bacteria | 2400 |
| 125 | Ga0157371_10134905 | 3300013102 | Bacteria | 1758 |
| 126 | Ga0157370_10039005 | 3300013104 | Bacteria | 4593 |
| 127 | Ga0157369_10007881 | 3300013105 | Bacteria | 12245 |
| 128 | Ga0157378_10059023 | 3300013297 | Bacteria | 3422 |
| 129 | Ga0163162_10027211 | 3300013306 | Bacteria | 5654 |
| 130 | Ga0157372_10165903 | 3300013307 | Bacteria | 2554 |
| 131 | Ga0157372_10201211 | 3300013307 | Bacteria | 2307 |
| 132 | Ga0182008_10000515 | 3300014497 | Bacteria | 29030 |
| 133 | Ga0182008_10002427 | 3300014497 | Bacteria | 11696 |
| 134 | Ga0182008_10006865 | 3300014497 | Bacteria | 6333 |
| 135 | Ga0182008_10011104 | 3300014497 | Bacteria | 4805 |
| 136 | Ga0182008_10016496 | 3300014497 | Bacteria | 3838 |
| 137 | Ga0182008_10027129 | 3300014497 | Bacteria | 2903 |
| 138 | Ga0182006_1000112 | 3300015261 | Bacteria | 87378 |
| 139 | Ga0182006_1001190 | 3300015261 | Bacteria | 16280 |
| 140 | Ga0182006_1001570 | 3300015261 | Bacteria | 13642 |
| 141 | Ga0182006_1011405 | 3300015261 | Bacteria | 3912 |
| 142 | Ga0182006_1012894 | 3300015261 | Bacteria | 3647 |
| 143 | Ga0182006_1032526 | 3300015261 | Bacteria | 2096 |
| 144 | Ga0182007_10000020 | 3300015262 | Bacteria | 194053 |
| 145 | Ga0182007_10001908 | 3300015262 | Bacteria | 10838 |
| 146 | Ga0182007_10003300 | 3300015262 | Bacteria | 7652 |
| 147 | Ga0182007_10003866 | 3300015262 | Bacteria | 6952 |
| 148 | Ga0182005_1000001 | 3300015265 | Bacteria | 1014869 |
| 149 | Ga0182005_1000662 | 3300015265 | Bacteria | 16334 |
| 150 | Ga0182005_1016651 | 3300015265 | Bacteria | 2043 |
| 151 | Ga0183362_10005 | 3300015683 | Bacteria | 437616 |
| 152 | Ga0163161_10015085 | 3300017792 | Bacteria | 5387 |
| 153 | Ga0163161_10020171 | 3300017792 | Bacteria | 4676 |
| 154 | Ga0163161_10065072 | 3300017792 | Bacteria | 2660 |
| 155 | Ga0213872_10000001 | 3300021361 | Bacteria | 662532 |
| 156 | Ga0213872_10001896 | 3300021361 | Bacteria | 12853 |
| 157 | Ga0213872_10034749 | 3300021361 | Bacteria | 2306 |
| 158 | Ga0224712_10051595 | 3300022467 | Bacteria | 1602 |
| 159 | Ga0209435_100013 | 3300025206 | Bacteria | 366789 |
| 160 | Ga0209435_100028 | 3300025206 | Bacteria | 182520 |
| 161 | Ga0209435_100300 | 3300025206 | Bacteria | 11986 |
| 162 | Ga0209435_100501 | 3300025206 | Bacteria | 7723 |
| 163 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 164 | Ga0209784_100004 | 3300025224 | Bacteria | 1378156 |
| 165 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 166 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 167 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 168 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 169 | Ga0209672_101007 | 3300025228 | Bacteria | 12321 |
| 170 | Ga0209147_100004 | 3300025229 | Bacteria | 1371850 |
| 171 | Ga0209147_100030 | 3300025229 | Bacteria | 366789 |
| 172 | Ga0209147_103626 | 3300025229 | Bacteria | 2897 |
| 173 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 174 | Ga0209563_100007 | 3300025230 | Bacteria | 1579402 |
| 175 | Ga0209563_100009 | 3300025230 | Bacteria | 1378156 |
| 176 | Ga0207427_100254 | 3300025231 | Bacteria | 42320 |
| 177 | Ga0209437_100004 | 3300025233 | Bacteria | 1378156 |
| 178 | Ga0209437_100053 | 3300025233 | Bacteria | 375580 |
| 179 | Ga0209437_100275 | 3300025233 | Bacteria | 76419 |
| 180 | Ga0209258_100009 | 3300025242 | Bacteria | 996276 |
| 181 | Ga0209258_100325 | 3300025242 | Bacteria | 72077 |
| 182 | Ga0209258_100667 | 3300025242 | Bacteria | 24373 |
| 183 | Ga0207425_1000455 | 3300025245 | Bacteria | 26503 |
| 184 | Ga0209646_1000021 | 3300025246 | Bacteria | 461083 |
| 185 | Ga0209646_1000034 | 3300025246 | Bacteria | 366789 |
| 186 | Ga0209646_1000051 | 3300025246 | Bacteria | 296525 |
| 187 | Ga0209646_1000095 | 3300025246 | Bacteria | 182520 |
| 188 | Ga0209646_1000378 | 3300025246 | Bacteria | 28778 |
| 189 | Ga0209026_1000022 | 3300025250 | Bacteria | 366789 |
| 190 | Ga0209026_1000110 | 3300025250 | Bacteria | 141989 |
| 191 | Ga0209026_1005223 | 3300025250 | Bacteria | 3554 |
| 192 | Ga0209026_1014788 | 3300025250 | Bacteria | 1295 |
| 193 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 194 | Ga0209677_100005 | 3300025253 | Bacteria | 1378156 |
| 195 | Ga0209677_101197 | 3300025253 | Bacteria | 11833 |
| 196 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 197 | Ga0209148_1000985 | 3300025254 | Bacteria | 18369 |
| 198 | Ga0209759_1000018 | 3300025256 | Bacteria | 366789 |
| 199 | Ga0209759_1000080 | 3300025256 | Bacteria | 171186 |
| 200 | Ga0209759_1000115 | 3300025256 | Bacteria | 141877 |
| 201 | Ga0209759_1000155 | 3300025256 | Bacteria | 118819 |
| 202 | Ga0209759_1000553 | 3300025256 | Bacteria | 38286 |
| 203 | Ga0209129_1000024 | 3300025258 | Bacteria | 417268 |
| 204 | Ga0209129_1000085 | 3300025258 | Bacteria | 181765 |
| 205 | Ga0209129_1005702 | 3300025258 | Bacteria | 4294 |
| 206 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 207 | Ga0209565_1000046 | 3300025263 | Bacteria | 226073 |
| 208 | Ga0209455_1000043 | 3300025272 | Bacteria | 413928 |
| 209 | Ga0209455_1006519 | 3300025272 | Bacteria | 3432 |
| 210 | Ga0209673_1000058 | 3300025273 | Bacteria | 269028 |
| 211 | Ga0209673_1010330 | 3300025273 | Bacteria | 3942 |
| 212 | Ga0209673_1010835 | 3300025273 | Bacteria | 3810 |
| 213 | Ga0209130_1002262 | 3300025284 | Bacteria | 9935 |
| 214 | Ga0209675_1000010 | 3300025291 | Bacteria | 541927 |
| 215 | Ga0209675_1005766 | 3300025291 | Bacteria | 5104 |
| 216 | Ga0209676_1000028 | 3300025292 | Bacteria | 559745 |
| 217 | Ga0209676_1000098 | 3300025292 | Bacteria | 234305 |
| 218 | Ga0209676_1000173 | 3300025292 | Bacteria | 153411 |
| 219 | Ga0209676_1000194 | 3300025292 | Bacteria | 136666 |
| 220 | Ga0209676_1041817 | 3300025292 | Bacteria | 1277 |
| 221 | Ga0209676_1049270 | 3300025292 | Bacteria | 1119 |
| 222 | Ga0209025_1000122 | 3300025294 | Bacteria | 206064 |
| 223 | Ga0209025_1000404 | 3300025294 | Bacteria | 87744 |
| 224 | Ga0209025_1002209 | 3300025294 | Bacteria | 21508 |
| 225 | Ga0209025_1002394 | 3300025294 | Bacteria | 20027 |
| 226 | Ga0209025_1019136 | 3300025294 | Bacteria | 3826 |
| 227 | Ga0209564_1000011 | 3300025295 | Bacteria | 822327 |
| 228 | Ga0209564_1000089 | 3300025295 | Bacteria | 249694 |
| 229 | Ga0209564_1000183 | 3300025295 | Bacteria | 150409 |
| 230 | Ga0209564_1000198 | 3300025295 | Bacteria | 138511 |
| 231 | Ga0209758_1000049 | 3300025297 | Bacteria | 345104 |
| 232 | Ga0209758_1000286 | 3300025297 | Bacteria | 99636 |
| 233 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 234 | Ga0209050_1000122 | 3300025298 | Bacteria | 195305 |
| 235 | Ga0209050_1000554 | 3300025298 | Bacteria | 61514 |
| 236 | Ga0209050_1005757 | 3300025298 | Bacteria | 7642 |
| 237 | Ga0209256_1000098 | 3300025299 | Bacteria | 204152 |
| 238 | Ga0209256_1000140 | 3300025299 | Bacteria | 152770 |
| 239 | Ga0207426_1000038 | 3300025302 | Bacteria | 441522 |
| 240 | Ga0207426_1000053 | 3300025302 | Bacteria | 384818 |
| 241 | Ga0209051_1000015 | 3300025303 | Bacteria | 546798 |
| 242 | Ga0209051_1000159 | 3300025303 | Bacteria | 126836 |
| 243 | Ga0209051_1000194 | 3300025303 | Bacteria | 107213 |
| 244 | Ga0209051_1000282 | 3300025303 | Bacteria | 82787 |
| 245 | Ga0209051_1000597 | 3300025303 | Bacteria | 42565 |
| 246 | Ga0209051_1014777 | 3300025303 | Bacteria | 3625 |
| 247 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 248 | Ga0209257_1004288 | 3300025304 | Bacteria | 11233 |
| 249 | Ga0207656_10010157 | 3300025321 | Bacteria | 3516 |
| 250 | Ga0207656_10044790 | 3300025321 | Bacteria | 1891 |
| 251 | Ga0207655_1002288 | 3300025728 | Bacteria | 15755 |
| 252 | Ga0207705_10000483 | 3300025909 | Bacteria | 34144 |
| 253 | Ga0207654_10083951 | 3300025911 | Bacteria | 1924 |
| 254 | Ga0207695_10001636 | 3300025913 | Bacteria | 36191 |
| 255 | Ga0207695_10011312 | 3300025913 | Bacteria | 10818 |
| 256 | Ga0207695_10013645 | 3300025913 | Bacteria | 9675 |
| 257 | Ga0207695_10128419 | 3300025913 | Bacteria | 2494 |
| 258 | Ga0207671_10012800 | 3300025914 | Bacteria | 6724 |
| 259 | Ga0207671_10018653 | 3300025914 | Bacteria | 5316 |
| 260 | Ga0207657_10001945 | 3300025919 | Bacteria | 22301 |
| 261 | Ga0207649_10339708 | 3300025920 | Bacteria | 1108 |
| 262 | Ga0207694_10000873 | 3300025924 | Bacteria | 26821 |
| 263 | Ga0207694_10039691 | 3300025924 | Bacteria | 3623 |
| 264 | Ga0207694_10075465 | 3300025924 | Bacteria | 2639 |
| 265 | Ga0207694_10154467 | 3300025924 | Bacteria | 1850 |
| 266 | Ga0207694_10158047 | 3300025924 | Bacteria | 1830 |
| 267 | Ga0207687_10094183 | 3300025927 | Bacteria | 2191 |
| 268 | Ga0207690_10062274 | 3300025932 | Bacteria | 2539 |
| 269 | Ga0207690_10072303 | 3300025932 | Bacteria | 2382 |
| 270 | Ga0207706_10025112 | 3300025933 | Bacteria | 5342 |
| 271 | Ga0207706_10109345 | 3300025933 | Bacteria | 2433 |
| 272 | Ga0207686_10057268 | 3300025934 | Bacteria | 2453 |
| 273 | Ga0207686_10126524 | 3300025934 | Bacteria | 1747 |
| 274 | Ga0207709_10000285 | 3300025935 | Bacteria | 57630 |
| 275 | Ga0207709_10004960 | 3300025935 | Bacteria | 7618 |
| 276 | Ga0207709_10058461 | 3300025935 | Bacteria | 2396 |
| 277 | Ga0207667_10000034 | 3300025949 | Bacteria | 304569 |
| 278 | Ga0207667_10000036 | 3300025949 | Bacteria | 297966 |
| 279 | Ga0207667_10007030 | 3300025949 | Bacteria | 13597 |
| 280 | Ga0207667_10081172 | 3300025949 | Bacteria | 3359 |
| 281 | Ga0207667_10092734 | 3300025949 | Bacteria | 3119 |
| 282 | Ga0207667_10099953 | 3300025949 | Bacteria | 2993 |
| 283 | Ga0207667_10146730 | 3300025949 | Bacteria | 2429 |
| 284 | Ga0207667_10427423 | 3300025949 | Bacteria | 1347 |
| 285 | Ga0207651_10457643 | 3300025960 | Bacteria | 1096 |
| 286 | Ga0207640_10023722 | 3300025981 | Bacteria | 3691 |
| 287 | Ga0207640_10238320 | 3300025981 | Bacteria | 1404 |
| 288 | Ga0207658_10302372 | 3300025986 | Bacteria | 1379 |
| 289 | Ga0207639_10010174 | 3300026041 | Bacteria | 6508 |
| 290 | Ga0207639_10379058 | 3300026041 | Bacteria | 1270 |
| 291 | Ga0207678_10287145 | 3300026067 | Bacteria | 1413 |
| 292 | Ga0207648_10057270 | 3300026089 | Bacteria | 3400 |
| 293 | Ga0207648_10263216 | 3300026089 | Bacteria | 1539 |
| 294 | Ga0207674_10264276 | 3300026116 | Bacteria | 1668 |
| 295 | Ga0207683_10166283 | 3300026121 | Bacteria | 1996 |
| 296 | Ga0207683_10175634 | 3300026121 | Bacteria | 1941 |
| 297 | Ga0207698_10009166 | 3300026142 | Bacteria | 6292 |
| 298 | Ga0207698_10067159 | 3300026142 | Bacteria | 2827 |
| 299 | Ga0207698_10476583 | 3300026142 | Bacteria | 1210 |
| 300 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 301 | Ga0209282_1001079 | 3300027666 | Bacteria | 14459 |
| 302 | Ga0207428_10117068 | 3300027907 | Bacteria | 2046 |
| 303 | Ga0268266_10324922 | 3300028379 | Bacteria | 1441 |
| 304 | Ga0268265_10015308 | 3300028380 | Bacteria | 5247 |
| 305 | Ga0307515_10012653 | 3300028794 | Bacteria | 15850 |
| 306 | Ga0316177_1117067 | 3300030731 | Bacteria | 2553 |
| 307 | Ga0316176_1072478 | 3300030732 | Bacteria | 2661 |
| 308 | Ga0314311_1059701 | 3300030733 | Bacteria | 1733 |
| 309 | Ga0316178_1142965 | 3300030735 | Bacteria | 7757 |
| 310 | Ga0316180_1061916 | 3300030736 | Bacteria | 1505 |
| 311 | Ga0316183_1076813 | 3300030742 | Bacteria | 4172 |
| 312 | Ga0316181_1034408 | 3300030744 | Bacteria | 3273 |
| 313 | Ga0316182_1050266 | 3300030745 | Bacteria | 2582 |
| 314 | Ga0265327_10005786 | 3300031251 | Bacteria | 10168 |
| 315 | Ga0265327_10013542 | 3300031251 | Bacteria | 5411 |
| 316 | Ga0307408_100000678 | 3300031548 | Bacteria | 28125 |
| 317 | Ga0307514_10024217 | 3300031649 | Bacteria | 4918 |
| 318 | Ga0265314_10010643 | 3300031711 | Bacteria | 7654 |
| 319 | Ga0307405_10010853 | 3300031731 | Bacteria | 4744 |
| 320 | Ga0307405_10066709 | 3300031731 | Bacteria | 2295 |
| 321 | Ga0307406_10001422 | 3300031901 | Bacteria | 13270 |
| 322 | Ga0307412_10033751 | 3300031911 | Bacteria | 3255 |
| 323 | Ga0307412_10049150 | 3300031911 | Bacteria | 2778 |
| 324 | Ga0307412_10075260 | 3300031911 | Bacteria | 2315 |
| 325 | Ga0307414_10025305 | 3300032004 | Bacteria | 3799 |
| 326 | Ga0307415_100418125 | 3300032126 | Bacteria | 1149 |
| 327 | Ga0373939_0014902 | 3300035114 | Bacteria | 2025 |
| 328 | Ga0373931_0083192 | 3300035691 | Bacteria | 1770 |
| 329 | Ga0395899_0002047 | 3300037312 | Bacteria | 16612 |
| 330 | Ga0395899_0004769 | 3300037312 | Bacteria | 10574 |
| 331 | Ga0395899_0008647 | 3300037312 | Bacteria | 7833 |
| 332 | Ga0395899_0009612 | 3300037312 | Bacteria | 7421 |
| 333 | Ga0395900_0000402 | 3300037418 | Bacteria | 62208 |
| 334 | Ga0395900_0002186 | 3300037418 | Bacteria | 21856 |
| 335 | Ga0395900_0002328 | 3300037418 | Bacteria | 21022 |
| 336 | Ga0395900_0023829 | 3300037418 | Bacteria | 6262 |
| 337 | Ga0395900_0031677 | 3300037418 | Bacteria | 5434 |
| 338 | Ga0395900_0049239 | 3300037418 | Bacteria | 4341 |
| 339 | Ga0395900_0075873 | 3300037418 | Bacteria | 3455 |
| 340 | Ga0395900_0117216 | 3300037418 | Bacteria | 2732 |
| 341 | Ga0395898_0071146 | 3300037466 | Bacteria | 3362 |
| 342 | Ga0395898_0164041 | 3300037466 | Bacteria | 2125 |
| 343 | Ga0395898_0192527 | 3300037466 | Bacteria | 1948 |
| 344 | Ga0395905_0023958 | 3300037471 | Bacteria | 5763 |
| 345 | Ga0395905_0024207 | 3300037471 | Bacteria | 5731 |
| 346 | Ga0395905_0032524 | 3300037471 | Bacteria | 4905 |
| 347 | Ga0395905_0275951 | 3300037471 | Bacteria | 1567 |
| 348 | Ga0395905_0291229 | 3300037471 | Bacteria | 1519 |
| 349 | Ga0395905_0344883 | 3300037471 | Bacteria | 1381 |
| 350 | Ga0395901_0000250 | 3300038443 | Bacteria | 66983 |
| 351 | Ga0395901_0000482 | 3300038443 | Bacteria | 46374 |
| 352 | Ga0395901_0004717 | 3300038443 | Bacteria | 13763 |
| 353 | Ga0395901_0009268 | 3300038443 | Bacteria | 9982 |
| 354 | Ga0395901_0064881 | 3300038443 | Bacteria | 3801 |
| 355 | Ga0395901_0327421 | 3300038443 | Bacteria | 1584 |
| 356 | Ga0436361_0075458 | 3300039447 | Bacteria | 23492 |
| 357 | Ga0436361_0086588 | 3300039447 | Bacteria | 17320 |
| 358 | Ga0436361_0099372 | 3300039447 | Bacteria | 18108 |
| 359 | Ga0436361_0379135 | 3300039447 | Bacteria | 12224 |
| 360 | Ga0436361_0481825 | 3300039447 | Bacteria | 7344 |
| 361 | Ga0436361_0560696 | 3300039447 | Bacteria | 5389 |
| 362 | Ga0436361_0577764 | 3300039447 | Bacteria | 2148 |
| 363 | Ga0436361_1153033 | 3300039447 | Bacteria | 2322 |
| 364 | Ga0439436_0000382 | 3300041404 | Bacteria | 11010 |
| 365 | Ga0439436_0004185 | 3300041404 | Bacteria | 4419 |
| 366 | Ga0439439_0003399 | 3300041406 | Bacteria | 3510 |
| 367 | Ga0439453_0015626 | 3300041408 | Bacteria | 1315 |
| 368 | Ga0439466_0001231 | 3300041411 | Bacteria | 9960 |
| 369 | Ga0439466_0021970 | 3300041411 | Bacteria | 2256 |
| 370 | Ga0439465_0001246 | 3300041413 | Bacteria | 8214 |
| 371 | Ga0439465_0015400 | 3300041413 | Bacteria | 2386 |
| 372 | Ga0439431_0012337 | 3300041997 | Bacteria | 1962 |
| 373 | Ga0439433_0002040 | 3300041999 | Bacteria | 4247 |
| 374 | Ga0439433_0006272 | 3300041999 | Bacteria | 2559 |
| 375 | Ga0439441_016825 | 3300042001 | Bacteria | 1307 |
| 376 | Ga0439442_002770 | 3300042002 | Bacteria | 3442 |
| 377 | Ga0439442_013545 | 3300042002 | Bacteria | 1673 |
| 378 | Ga0439445_0000223 | 3300042004 | Bacteria | 10550 |
| 379 | Ga0439448_0001130 | 3300042005 | Bacteria | 6731 |
| 380 | Ga0439432_001997 | 3300042006 | Bacteria | 7723 |
| 381 | Ga0439432_002220 | 3300042006 | Bacteria | 7326 |
| 382 | Ga0439449_0000209 | 3300042007 | Bacteria | 20674 |
| 383 | Ga0439449_0000215 | 3300042007 | Bacteria | 20490 |
| 384 | Ga0439449_0005047 | 3300042007 | Bacteria | 5077 |
| 385 | Ga0439449_0021863 | 3300042007 | Bacteria | 2394 |
| 386 | Ga0439449_0063778 | 3300042007 | Bacteria | 1359 |
| 387 | Ga0439452_024773 | 3300042010 | Bacteria | 1530 |
| 388 | Ga0439457_003046 | 3300042014 | Bacteria | 4641 |
| 389 | Ga0439462_0013469 | 3300042015 | Bacteria | 2095 |
| 390 | Ga0450923_005020 | 3300042125 | Bacteria | 2114 |
| 391 | Ga0450923_016250 | 3300042125 | Bacteria | 1400 |
| 392 | Ga0450899_006515 | 3300042135 | Bacteria | 1264 |
| 393 | Ga0450907_005113 | 3300042146 | Bacteria | 2224 |
| 394 | Ga0439446_0003872 | 3300042156 | Bacteria | 3755 |
| 395 | Ga0450908_000697 | 3300042184 | Bacteria | 6439 |
| 396 | Ga0450909_003723 | 3300042185 | Bacteria | 2167 |
| 397 | Ga0450909_005523 | 3300042185 | Bacteria | 1817 |
| 398 | Ga0439434_0001906 | 3300042435 | Bacteria | 6054 |
| 399 | Ga0439434_0014465 | 3300042435 | Bacteria | 2347 |
| 400 | Ga0450918_000817 | 3300042531 | Bacteria | 6534 |
| 401 | Ga0466969_0070575 | 3300044656 | Bacteria | 1680 |
| 402 | Ga0466972_0002538 | 3300044658 | Bacteria | 9032 |
| 403 | Ga0466972_0012350 | 3300044658 | Bacteria | 4292 |
| 404 | Ga0466965_0001072 | 3300044683 | Bacteria | 10628 |
| 405 | Ga0466965_0039961 | 3300044683 | Bacteria | 2307 |
| 406 | Ga0466965_0061551 | 3300044683 | Bacteria | 1876 |
| 407 | Ga0466965_0066902 | 3300044683 | Bacteria | 1802 |
| 408 | Ga0466966_0038405 | 3300044684 | Bacteria | 3085 |
| 409 | Ga0466963_0009383 | 3300044694 | Bacteria | 5894 |
| 410 | Ga0466964_0000992 | 3300044706 | Bacteria | 9422 |
| 411 | Ga0466964_0001256 | 3300044706 | Bacteria | 8623 |
| 412 | Ga0466964_0111066 | 3300044706 | Bacteria | 1222 |
| 413 | Ga0466971_0019600 | 3300044719 | Bacteria | 3006 |
| 414 | Ga0466968_0001194 | 3300044735 | Bacteria | 9185 |
| 415 | Ga0466968_0002868 | 3300044735 | Bacteria | 6375 |
| 416 | Ga0466968_0055523 | 3300044735 | Bacteria | 1700 |
| 417 | Ga0466970_0008154 | 3300044765 | Bacteria | 5261 |
| 418 | Ga0466970_0033147 | 3300044765 | Bacteria | 2730 |
| 419 | Ga0466957_0005465 | 3300044842 | Bacteria | 7131 |
| 420 | Ga0466957_0019951 | 3300044842 | Bacteria | 3945 |
| 421 | Ga0466957_0044623 | 3300044842 | Bacteria | 2687 |
| 422 | Ga0451576_0730377 | 3300045051 | Bacteria | 1040 |
| 423 | Ga0466967_0318479 | 3300045976 | Bacteria | 1499 |
| 424 | Ga0495617_000216 | 3300046452 | Bacteria | 35255 |
| 425 | Ga0495617_003012 | 3300046452 | Bacteria | 6429 |
| 426 | Ga0495617_008767 | 3300046452 | Bacteria | 3481 |
| 427 | Ga0495617_015123 | 3300046452 | Bacteria | 2618 |
| 428 | Ga0495627_014963 | 3300046453 | Bacteria | 2690 |
| 429 | Ga0495590_0000002 | 3300046457 | Bacteria | 485720 |
| 430 | Ga0495638_0000367 | 3300046460 | Bacteria | 55964 |
| 431 | Ga0495638_0010640 | 3300046460 | Bacteria | 6372 |
| 432 | Ga0495638_0012288 | 3300046460 | Bacteria | 5873 |
| 433 | Ga0495638_0071080 | 3300046460 | Bacteria | 2129 |
| 434 | Ga0495638_0102593 | 3300046460 | Bacteria | 1709 |
| 435 | Ga0495651_0005781 | 3300046462 | Bacteria | 9438 |
| 436 | Ga0495651_0224859 | 3300046462 | Bacteria | 1296 |
| 437 | Ga0495653_0001714 | 3300046463 | Bacteria | 17267 |
| 438 | Ga0495653_0258326 | 3300046463 | Bacteria | 1153 |
| 439 | Ga0495650_0000224 | 3300046471 | Bacteria | 118058 |
| 440 | Ga0495650_0000521 | 3300046471 | Bacteria | 56415 |
| 441 | Ga0495650_0000631 | 3300046471 | Bacteria | 47329 |
| 442 | Ga0495650_0005201 | 3300046471 | Bacteria | 8550 |
| 443 | Ga0495650_0014288 | 3300046471 | Bacteria | 4141 |
| 444 | Ga0495650_0045766 | 3300046471 | Bacteria | 1840 |
| 445 | Ga0495605_0000028 | 3300046474 | Bacteria | 218471 |
| 446 | Ga0495605_0000325 | 3300046474 | Bacteria | 48544 |
| 447 | Ga0495605_0001338 | 3300046474 | Bacteria | 16309 |
| 448 | Ga0495584_0000153 | 3300046491 | Bacteria | 47948 |
| 449 | Ga0495584_0001517 | 3300046491 | Bacteria | 13798 |
| 450 | Ga0495584_0006647 | 3300046491 | Bacteria | 6044 |
| 451 | Ga0495585_0000206 | 3300046492 | Bacteria | 61632 |
| 452 | Ga0495585_0000353 | 3300046492 | Bacteria | 44438 |
| 453 | Ga0495585_0000563 | 3300046492 | Bacteria | 35041 |
| 454 | Ga0495585_0004163 | 3300046492 | Bacteria | 9451 |
| 455 | Ga0495585_0004455 | 3300046492 | Bacteria | 9080 |
| 456 | Ga0495585_0010007 | 3300046492 | Bacteria | 5665 |
| 457 | Ga0495585_0012096 | 3300046492 | Bacteria | 5091 |
| 458 | Ga0495585_0027642 | 3300046492 | Bacteria | 3237 |
| 459 | Ga0495585_0054779 | 3300046492 | Bacteria | 2204 |
| 460 | Ga0495585_0069864 | 3300046492 | Bacteria | 1916 |
| 461 | Ga0495596_0000680 | 3300046500 | Bacteria | 21142 |
| 462 | Ga0495596_0000699 | 3300046500 | Bacteria | 20806 |
| 463 | Ga0495596_0004429 | 3300046500 | Bacteria | 6846 |
| 464 | Ga0495596_0019756 | 3300046500 | Bacteria | 2763 |
| 465 | Ga0495607_0004790 | 3300046501 | Bacteria | 9881 |
| 466 | Ga0495607_0008801 | 3300046501 | Bacteria | 6872 |
| 467 | Ga0495607_0034547 | 3300046501 | Bacteria | 3066 |
| 468 | Ga0495607_0099855 | 3300046501 | Bacteria | 1556 |
| 469 | Ga0495583_0000424 | 3300046506 | Bacteria | 63938 |
| 470 | Ga0495583_0000537 | 3300046506 | Bacteria | 53610 |
| 471 | Ga0495583_0000741 | 3300046506 | Bacteria | 41476 |
| 472 | Ga0495583_0045206 | 3300046506 | Bacteria | 2037 |
| 473 | Ga0495583_0069740 | 3300046506 | Bacteria | 1547 |
| 474 | Ga0495606_0000001 | 3300046507 | Bacteria | 592123 |
| 475 | Ga0495606_0000245 | 3300046507 | Bacteria | 95825 |
| 476 | Ga0495606_0000526 | 3300046507 | Bacteria | 61953 |
| 477 | Ga0495606_0001009 | 3300046507 | Bacteria | 40935 |
| 478 | Ga0495606_0008453 | 3300046507 | Bacteria | 8936 |
| 479 | Ga0495606_0010586 | 3300046507 | Bacteria | 7633 |
| 480 | Ga0495606_0012994 | 3300046507 | Bacteria | 6622 |
| 481 | Ga0495606_0022037 | 3300046507 | Bacteria | 4655 |
| 482 | Ga0495606_0027916 | 3300046507 | Bacteria | 3990 |
| 483 | Ga0495606_0029465 | 3300046507 | Bacteria | 3853 |
| 484 | Ga0495606_0085182 | 3300046507 | Bacteria | 1955 |
| 485 | Ga0495608_0002860 | 3300046511 | Bacteria | 12371 |
| 486 | Ga0495608_0054992 | 3300046511 | Bacteria | 2630 |
| 487 | Ga0495610_0000106 | 3300046512 | Bacteria | 97582 |
| 488 | Ga0495610_0003952 | 3300046512 | Bacteria | 11224 |
| 489 | Ga0495610_0004909 | 3300046512 | Bacteria | 9714 |
| 490 | Ga0495610_0013556 | 3300046512 | Bacteria | 4838 |
| 491 | Ga0495610_0051705 | 3300046512 | Bacteria | 1998 |
| 492 | Ga0495616_0000316 | 3300046513 | Bacteria | 38626 |
| 493 | Ga0495616_0001403 | 3300046513 | Bacteria | 16778 |
| 494 | Ga0495616_0003860 | 3300046513 | Bacteria | 9551 |
| 495 | Ga0495616_0006109 | 3300046513 | Bacteria | 7337 |
| 496 | Ga0495616_0013484 | 3300046513 | Bacteria | 4609 |
| 497 | Ga0495616_0074419 | 3300046513 | Bacteria | 1636 |
| 498 | Ga0495620_0004751 | 3300046515 | Bacteria | 7640 |
| 499 | Ga0495628_0000929 | 3300046516 | Bacteria | 26874 |
| 500 | Ga0495630_0125540 | 3300046517 | Bacteria | 1948 |
| 501 | Ga0495631_0011497 | 3300046518 | Bacteria | 4352 |
| 502 | Ga0495631_0011741 | 3300046518 | Bacteria | 4297 |
| 503 | Ga0495631_0019279 | 3300046518 | Bacteria | 3199 |
| 504 | Ga0495632_0000725 | 3300046519 | Bacteria | 29897 |
| 505 | Ga0495632_0007105 | 3300046519 | Bacteria | 7086 |
| 506 | Ga0495632_0007449 | 3300046519 | Bacteria | 6874 |
| 507 | Ga0495637_0001337 | 3300046520 | Bacteria | 14795 |
| 508 | Ga0495637_0001872 | 3300046520 | Bacteria | 12011 |
| 509 | Ga0495637_0008922 | 3300046520 | Bacteria | 4906 |
| 510 | Ga0495643_0000444 | 3300046522 | Bacteria | 53441 |
| 511 | Ga0495643_0000643 | 3300046522 | Bacteria | 41372 |
| 512 | Ga0495643_0000777 | 3300046522 | Bacteria | 35586 |
| 513 | Ga0495643_0001278 | 3300046522 | Bacteria | 24108 |
| 514 | Ga0495643_0003064 | 3300046522 | Bacteria | 12563 |
| 515 | Ga0495643_0049890 | 3300046522 | Bacteria | 2255 |
| 516 | Ga0495643_0092143 | 3300046522 | Bacteria | 1562 |
| 517 | Ga0495643_0101656 | 3300046522 | Bacteria | 1472 |
| 518 | Ga0495644_0001322 | 3300046523 | Bacteria | 10148 |
| 519 | Ga0495644_0001761 | 3300046523 | Bacteria | 8733 |
| 520 | Ga0495644_0010287 | 3300046523 | Bacteria | 3605 |
| 521 | Ga0495648_0000037 | 3300046524 | Bacteria | 195401 |
| 522 | Ga0495648_0000722 | 3300046524 | Bacteria | 35218 |
| 523 | Ga0495648_0001252 | 3300046524 | Bacteria | 25382 |
| 524 | Ga0495648_0002410 | 3300046524 | Bacteria | 17336 |
| 525 | Ga0495648_0007092 | 3300046524 | Bacteria | 9022 |
| 526 | Ga0495648_0009168 | 3300046524 | Bacteria | 7711 |
| 527 | Ga0495648_0025349 | 3300046524 | Bacteria | 4016 |
| 528 | Ga0495663_0004113 | 3300046525 | Bacteria | 4120 |
| 529 | Ga0495663_0006991 | 3300046525 | Bacteria | 3112 |
| 530 | Ga0495666_0174189 | 3300046526 | Bacteria | 995 |
| 531 | Ga0495642_0000386 | 3300046528 | Bacteria | 23828 |
| 532 | Ga0495642_0009306 | 3300046528 | Bacteria | 3761 |
| 533 | Ga0495642_0012839 | 3300046528 | Bacteria | 3233 |
| 534 | Ga0495642_0015965 | 3300046528 | Bacteria | 2923 |
| 535 | Ga0495642_0027357 | 3300046528 | Bacteria | 2269 |
| 536 | Ga0495642_0054397 | 3300046528 | Bacteria | 1650 |
| 537 | Ga0495652_0002952 | 3300046529 | Bacteria | 17113 |
| 538 | Ga0495652_0010677 | 3300046529 | Bacteria | 8319 |
| 539 | Ga0495654_0000015 | 3300046530 | Bacteria | 307873 |
| 540 | Ga0495654_0012233 | 3300046530 | Bacteria | 4615 |
| 541 | Ga0495609_0000039 | 3300046538 | Bacteria | 179384 |
| 542 | Ga0495609_0000730 | 3300046538 | Bacteria | 24990 |
| 543 | Ga0495609_0001009 | 3300046538 | Bacteria | 20017 |
| 544 | Ga0495609_0007230 | 3300046538 | Bacteria | 5569 |
| 545 | Ga0495609_0008314 | 3300046538 | Bacteria | 5089 |
| 546 | Ga0495609_0008580 | 3300046538 | Bacteria | 4995 |
| 547 | Ga0495609_0014663 | 3300046538 | Bacteria | 3680 |
| 548 | Ga0495621_0031994 | 3300046539 | Bacteria | 1807 |
| 549 | Ga0495597_0000327 | 3300046542 | Bacteria | 43101 |
| 550 | Ga0495597_0000874 | 3300046542 | Bacteria | 23420 |
| 551 | Ga0495597_0023099 | 3300046542 | Bacteria | 2878 |
| 552 | Ga0495597_0042045 | 3300046542 | Bacteria | 2039 |
| 553 | Ga0495597_0077321 | 3300046542 | Bacteria | 1426 |
| 554 | Ga0495597_0098405 | 3300046542 | Bacteria | 1235 |
| 555 | Ga0495645_0008074 | 3300046543 | Bacteria | 7334 |
| 556 | Ga0495622_0002083 | 3300046557 | Bacteria | 9775 |
| 557 | Ga0495622_0052385 | 3300046557 | Bacteria | 1893 |
| 558 | Ga0495633_0000244 | 3300046558 | Bacteria | 65398 |
| 559 | Ga0495633_0000433 | 3300046558 | Bacteria | 43302 |
| 560 | Ga0495633_0007472 | 3300046558 | Bacteria | 6284 |
| 561 | Ga0495633_0011567 | 3300046558 | Bacteria | 4749 |
| 562 | Ga0495633_0049750 | 3300046558 | Bacteria | 1977 |
| 563 | Ga0495656_0000087 | 3300046615 | Bacteria | 40520 |
| 564 | Ga0495656_0014357 | 3300046615 | Bacteria | 2969 |
| 565 | Ga0495656_0062292 | 3300046615 | Bacteria | 1631 |
| 566 | Ga0495668_0000241 | 3300046616 | Bacteria | 78040 |
| 567 | Ga0495668_0002017 | 3300046616 | Bacteria | 17725 |
| 568 | Ga0495668_0003173 | 3300046616 | Bacteria | 12642 |
| 569 | Ga0495668_0003228 | 3300046616 | Bacteria | 12435 |
| 570 | Ga0495668_0003498 | 3300046616 | Bacteria | 11713 |
| 571 | Ga0495668_0005941 | 3300046616 | Bacteria | 8108 |
| 572 | Ga0495668_0056002 | 3300046616 | Bacteria | 2177 |
| 573 | Ga0495668_0107004 | 3300046616 | Bacteria | 1529 |
| 574 | Ga0495668_0148792 | 3300046616 | Bacteria | 1282 |
| 575 | Ga0495611_0007509 | 3300046648 | Bacteria | 4627 |
| 576 | Ga0495611_0027723 | 3300046648 | Bacteria | 2477 |
| 577 | Ga0495611_0031839 | 3300046648 | Bacteria | 2323 |
| 578 | Ga0495625_0000245 | 3300046660 | Bacteria | 85443 |
| 579 | Ga0495625_0002452 | 3300046660 | Bacteria | 20039 |
| 580 | Ga0495625_0002538 | 3300046660 | Bacteria | 19640 |
| 581 | Ga0495625_0006115 | 3300046660 | Bacteria | 10786 |
| 582 | Ga0495625_0006849 | 3300046660 | Bacteria | 10066 |
| 583 | Ga0495625_0010538 | 3300046660 | Bacteria | 7635 |
| 584 | Ga0495625_0018274 | 3300046660 | Bacteria | 5477 |
| 585 | Ga0495625_0062113 | 3300046660 | Bacteria | 2641 |
| 586 | Ga0495625_0162630 | 3300046660 | Bacteria | 1494 |
| 587 | Ga0495635_0083950 | 3300046663 | Bacteria | 2180 |
| 588 | Ga0495635_0243158 | 3300046663 | Bacteria | 1214 |
| 589 | Ga0495659_0000244 | 3300046664 | Bacteria | 22578 |
| 590 | Ga0495659_0000262 | 3300046664 | Bacteria | 21388 |
| 591 | Ga0495659_0026247 | 3300046664 | Bacteria | 2000 |
| 592 | Ga0495661_0000903 | 3300046665 | Bacteria | 27258 |
| 593 | Ga0495661_0001155 | 3300046665 | Bacteria | 23050 |
| 594 | Ga0495661_0003555 | 3300046665 | Bacteria | 11481 |
| 595 | Ga0495661_0019219 | 3300046665 | Bacteria | 4482 |
| 596 | Ga0495661_0021310 | 3300046665 | Bacteria | 4226 |
| 597 | Ga0495661_0037262 | 3300046665 | Bacteria | 3037 |
| 598 | Ga0495661_0043566 | 3300046665 | Bacteria | 2757 |
| 599 | Ga0495661_0142803 | 3300046665 | Bacteria | 1301 |
| 600 | Ga0495588_0000110 | 3300046674 | Bacteria | 142825 |
| 601 | Ga0495588_0007799 | 3300046674 | Bacteria | 4888 |
| 602 | Ga0495657_0044637 | 3300046675 | Bacteria | 3014 |
| 603 | Ga0495646_0012297 | 3300046680 | Bacteria | 5443 |
| 604 | Ga0495646_0165249 | 3300046680 | Bacteria | 1223 |
| 605 | Ga0495658_0020233 | 3300046683 | Bacteria | 3489 |
| 606 | Ga0495669_0006620 | 3300046684 | Bacteria | 4847 |
| 607 | Ga0495670_0013956 | 3300046691 | Bacteria | 3951 |
| 608 | Ga0495670_0023650 | 3300046691 | Bacteria | 3032 |
| 609 | Ga0495670_0029080 | 3300046691 | Bacteria | 2741 |
| 610 | Ga0495670_0030705 | 3300046691 | Bacteria | 2669 |
| 611 | Ga0495670_0061819 | 3300046691 | Bacteria | 1883 |
| 612 | Ga0495670_0103366 | 3300046691 | Bacteria | 1469 |
| 613 | Ga0495671_0000006 | 3300046692 | Bacteria | 500471 |
| 614 | Ga0495671_0000379 | 3300046692 | Bacteria | 36536 |
| 615 | Ga0495671_0008804 | 3300046692 | Bacteria | 5668 |
| 616 | Ga0495671_0013546 | 3300046692 | Bacteria | 4409 |
| 617 | Ga0495671_0035496 | 3300046692 | Bacteria | 2531 |
| 618 | Ga0495671_0037913 | 3300046692 | Bacteria | 2436 |
| 619 | Ga0495649_0009011 | 3300046694 | Bacteria | 5959 |
| 620 | Ga0495649_0024838 | 3300046694 | Bacteria | 3340 |
| 621 | Ga0495589_0000019 | 3300046794 | Bacteria | 200814 |
| 622 | Ga0495589_0000828 | 3300046794 | Bacteria | 19423 |
| 623 | Ga0495589_0030098 | 3300046794 | Bacteria | 2735 |
| 624 | Ga0495589_0171744 | 3300046794 | Bacteria | 1030 |
| 625 | Ga0495600_0000151 | 3300046809 | Bacteria | 39828 |
| 626 | Ga0495660_0000572 | 3300046810 | Bacteria | 29701 |
| 627 | Ga0495660_0006376 | 3300046810 | Bacteria | 6985 |
| 628 | Ga0495636_0004266 | 3300047318 | Bacteria | 5610 |
| 629 | Ga0495636_0011979 | 3300047318 | Bacteria | 3436 |
| 630 | Ga0495672_0000368 | 3300047320 | Bacteria | 57095 |
| 631 | Ga0495672_0000753 | 3300047320 | Bacteria | 35468 |
| 632 | Ga0495672_0003317 | 3300047320 | Bacteria | 13913 |
| 633 | Ga0495672_0004744 | 3300047320 | Bacteria | 10974 |
| 634 | Ga0495672_0018354 | 3300047320 | Bacteria | 4647 |
| 635 | Ga0495676_0228246 | 3300047321 | Bacteria | 1280 |
| 636 | Ga0495683_0000151 | 3300047323 | Bacteria | 68310 |
| 637 | Ga0495683_0004352 | 3300047323 | Bacteria | 8069 |
| 638 | Ga0495683_0014326 | 3300047323 | Bacteria | 4131 |
| 639 | Ga0495683_0016725 | 3300047323 | Bacteria | 3806 |
| 640 | Ga0495683_0038841 | 3300047323 | Bacteria | 2408 |
| 641 | Ga0495687_000059 | 3300047443 | Bacteria | 179357 |
| 642 | Ga0495687_000191 | 3300047443 | Bacteria | 88251 |
| 643 | Ga0495687_005463 | 3300047443 | Bacteria | 8090 |
| 644 | Ga0495687_005550 | 3300047443 | Bacteria | 7999 |
| 645 | Ga0495687_020878 | 3300047443 | Bacteria | 3183 |
| 646 | Ga0495687_033243 | 3300047443 | Bacteria | 2342 |
| 647 | Ga0495677_0000006 | 3300047445 | Bacteria | 199230 |
| 648 | Ga0495677_0000347 | 3300047445 | Bacteria | 19957 |
| 649 | Ga0495677_0003237 | 3300047445 | Bacteria | 6351 |
| 650 | Ga0495677_0005309 | 3300047445 | Bacteria | 4888 |
| 651 | Ga0495677_0007159 | 3300047445 | Bacteria | 4178 |
| 652 | Ga0495677_0051535 | 3300047445 | Bacteria | 1515 |
| 653 | Ga0495685_000381 | 3300047447 | Bacteria | 14066 |
| 654 | Ga0495673_0000003 | 3300047469 | Bacteria | 1491337 |
| 655 | Ga0495673_0000061 | 3300047469 | Bacteria | 230647 |
| 656 | Ga0495673_0000351 | 3300047469 | Bacteria | 57305 |
| 657 | Ga0495673_0015081 | 3300047469 | Bacteria | 3994 |
| 658 | Ga0495673_0020397 | 3300047469 | Bacteria | 3300 |
| 659 | Ga0495681_0010860 | 3300047470 | Bacteria | 5478 |
| 660 | Ga0495681_0024054 | 3300047470 | Bacteria | 3219 |
| 661 | Ga0495686_0000318 | 3300047472 | Bacteria | 80125 |
| 662 | Ga0495686_0001447 | 3300047472 | Bacteria | 25867 |
| 663 | Ga0495686_0009673 | 3300047472 | Bacteria | 6923 |
| 664 | Ga0495686_0080948 | 3300047472 | Bacteria | 1984 |
| 665 | Ga0495602_0008077 | 3300048088 | Bacteria | 10998 |
| 666 | Ga0495602_0029236 | 3300048088 | Bacteria | 5254 |
| 667 | Ga0495615_0008507 | 3300048090 | Bacteria | 1986 |
| 668 | Ga0495615_0011387 | 3300048090 | Bacteria | 1806 |
| 669 | Ga0495626_0000103 | 3300048091 | Bacteria | 110163 |
| 670 | Ga0495626_0000902 | 3300048091 | Bacteria | 26250 |
| 671 | Ga0495626_0011538 | 3300048091 | Bacteria | 4672 |
| 672 | Ga0495626_0015496 | 3300048091 | Bacteria | 3899 |
| 673 | Ga0495626_0042565 | 3300048091 | Bacteria | 2133 |
| 674 | Ga0495626_0106570 | 3300048091 | Bacteria | 1217 |
| 675 | Ga0496100_0092549 | 3300048903 | Bacteria | 2066 |
| 676 | Ga0496100_0123739 | 3300048903 | Bacteria | 1813 |
| 677 | Ga0496101_0034301 | 3300048904 | Bacteria | 3583 |
| 678 | Ga0496101_0036961 | 3300048904 | Bacteria | 3461 |
| 679 | Ga0496102_0000064 | 3300048905 | Bacteria | 161979 |
| 680 | Ga0496102_0062714 | 3300048905 | Bacteria | 3404 |
| 681 | Ga0496102_0116930 | 3300048905 | Bacteria | 2488 |
| 682 | Ga0496103_0014373 | 3300048906 | Bacteria | 4702 |
| 683 | Ga0496103_0075367 | 3300048906 | Bacteria | 2116 |
| 684 | Ga0496103_0094268 | 3300048906 | Bacteria | 1891 |
| 685 | Ga0496104_0005753 | 3300048907 | Bacteria | 10852 |
| 686 | Ga0496104_0079472 | 3300048907 | Bacteria | 3126 |
| 687 | Ga0496104_0644534 | 3300048907 | Bacteria | 968 |
| 688 | Ga0496105_0035394 | 3300048908 | Bacteria | 4109 |
| 689 | Ga0496105_0049351 | 3300048908 | Bacteria | 3475 |
| 690 | Ga0496106_0008358 | 3300048909 | Bacteria | 7664 |
| 691 | Ga0496106_0087580 | 3300048909 | Bacteria | 2399 |
| 692 | Ga0496107_0017885 | 3300048910 | Bacteria | 4990 |
| 693 | Ga0496107_0040214 | 3300048910 | Bacteria | 3356 |
| 694 | Ga0496108_0250056 | 3300048911 | Bacteria | 1542 |
| 695 | Ga0496108_0293163 | 3300048911 | Bacteria | 1416 |
| 696 | Ga0496109_0176197 | 3300048912 | Bacteria | 2007 |
| 697 | Ga0496110_0214430 | 3300048913 | Bacteria | 1750 |
| 698 | Ga0496111_0012430 | 3300048914 | Bacteria | 5764 |
| 699 | Ga0496112_0267585 | 3300048915 | Bacteria | 1658 |
| 700 | Ga0496113_0002265 | 3300048916 | Bacteria | 11099 |
| 701 | Ga0496116_0023412 | 3300048919 | Bacteria | 4600 |
| 702 | Ga0496116_0031289 | 3300048919 | Bacteria | 3813 |
| 703 | Ga0496116_0064515 | 3300048919 | Bacteria | 2354 |
| 704 | Ga0496116_0084815 | 3300048919 | Bacteria | 1950 |
| 705 | Ga0496116_0087056 | 3300048919 | Bacteria | 1913 |
| 706 | Ga0496117_0000094 | 3300048920 | Bacteria | 201853 |
| 707 | Ga0496117_0063595 | 3300048920 | Bacteria | 2521 |
| 708 | Ga0496117_0081812 | 3300048920 | Bacteria | 2117 |
| 709 | Ga0496117_0246570 | 3300048920 | Bacteria | 977 |
| 710 | Ga0496118_0000071 | 3300048921 | Bacteria | 201853 |
| 711 | Ga0496118_0095020 | 3300048921 | Bacteria | 2036 |
| 712 | Ga0496119_0050596 | 3300048922 | Bacteria | 2560 |
| 713 | Ga0496120_0020559 | 3300048923 | Bacteria | 4191 |
| 714 | Ga0496121_0013966 | 3300048924 | Bacteria | 8578 |
| 715 | Ga0496121_0014140 | 3300048924 | Bacteria | 8503 |
| 716 | Ga0496121_0022940 | 3300048924 | Bacteria | 6031 |
| 717 | Ga0496121_0047108 | 3300048924 | Bacteria | 3681 |
| 718 | Ga0496121_0050060 | 3300048924 | Bacteria | 3534 |
| 719 | Ga0496121_0075961 | 3300048924 | Bacteria | 2681 |
| 720 | Ga0496121_0080283 | 3300048924 | Bacteria | 2586 |
| 721 | Ga0496121_0095100 | 3300048924 | Bacteria | 2316 |
| 722 | Ga0496121_0160111 | 3300048924 | Bacteria | 1647 |
| 723 | Ga0496122_0000063 | 3300048925 | Bacteria | 241378 |
| 724 | Ga0496122_0000134 | 3300048925 | Bacteria | 171080 |
| 725 | Ga0496122_0003153 | 3300048925 | Bacteria | 22055 |
| 726 | Ga0496122_0009932 | 3300048925 | Bacteria | 9915 |
| 727 | Ga0496122_0011074 | 3300048925 | Bacteria | 9198 |
| 728 | Ga0496122_0020099 | 3300048925 | Bacteria | 6062 |
| 729 | Ga0496122_0036508 | 3300048925 | Bacteria | 3972 |
| 730 | Ga0496122_0092505 | 3300048925 | Bacteria | 2055 |
| 731 | Ga0496122_0111682 | 3300048925 | Bacteria | 1792 |
| 732 | Ga0496122_0248064 | 3300048925 | Bacteria | 998 |
| 733 | Ga0496123_0000045 | 3300048926 | Bacteria | 249294 |
| 734 | Ga0496123_0000295 | 3300048926 | Bacteria | 97562 |
| 735 | Ga0496123_0000307 | 3300048926 | Bacteria | 95174 |
| 736 | Ga0496123_0001494 | 3300048926 | Bacteria | 32476 |
| 737 | Ga0496123_0002403 | 3300048926 | Bacteria | 23383 |
| 738 | Ga0496123_0012610 | 3300048926 | Bacteria | 7185 |
| 739 | Ga0496123_0023302 | 3300048926 | Bacteria | 4741 |
| 740 | Ga0496123_0096810 | 3300048926 | Bacteria | 1731 |
| 741 | Ga0496124_0004010 | 3300048927 | Bacteria | 17524 |
| 742 | Ga0496124_0014605 | 3300048927 | Bacteria | 7584 |
| 743 | Ga0496124_0025846 | 3300048927 | Bacteria | 5307 |
| 744 | Ga0496124_0052717 | 3300048927 | Bacteria | 3454 |
| 745 | Ga0496124_0055192 | 3300048927 | Bacteria | 3359 |
| 746 | Ga0496124_0083739 | 3300048927 | Bacteria | 2616 |
| 747 | Ga0496125_0001032 | 3300048928 | Bacteria | 43195 |
| 748 | Ga0496125_0004153 | 3300048928 | Bacteria | 16888 |
| 749 | Ga0496125_0009913 | 3300048928 | Bacteria | 9687 |
| 750 | Ga0496125_0011136 | 3300048928 | Bacteria | 9020 |
| 751 | Ga0496125_0015804 | 3300048928 | Bacteria | 7274 |
| 752 | Ga0496125_0045967 | 3300048928 | Bacteria | 3668 |
| 753 | Ga0496125_0069690 | 3300048928 | Bacteria | 2757 |
| 754 | Ga0496125_0119869 | 3300048928 | Bacteria | 1880 |
| 755 | Ga0496125_0188167 | 3300048928 | Bacteria | 1366 |
| 756 | Ga0496126_0008452 | 3300048929 | Bacteria | 11107 |
| 757 | Ga0495678_000391 | 3300049459 | Bacteria | 44274 |
| 758 | Ga0495678_002557 | 3300049459 | Bacteria | 12191 |
| 759 | Ga0495678_003514 | 3300049459 | Bacteria | 9640 |
| 760 | Ga0495678_003907 | 3300049459 | Bacteria | 8939 |
| 761 | Ga0495678_008263 | 3300049459 | Bacteria | 5274 |
| 762 | Ga0495678_011038 | 3300049459 | Bacteria | 4345 |
| 763 | Ga0495682_0000342 | 3300049460 | Bacteria | 34442 |
| 764 | Ga0495682_0000649 | 3300049460 | Bacteria | 23246 |
| 765 | Ga0495682_0004485 | 3300049460 | Bacteria | 5960 |
| 766 | Ga0495682_0010160 | 3300049460 | Bacteria | 3656 |
| 767 | Ga0495682_0024502 | 3300049460 | Bacteria | 2249 |
| 768 | Ga0495682_0063550 | 3300049460 | Bacteria | 1331 |
| 769 | Ga0501034_0266575 | 3300049571 | Bacteria | 1655 |
| 770 | Ga0501036_0028042 | 3300049572 | Bacteria | 4760 |
| 771 | Ga0501073_0263547 | 3300049589 | Bacteria | 1189 |
| 772 | Ga0501235_020320 | 3300049669 | Bacteria | 1474 |
| 773 | Ga0501238_001027 | 3300049671 | Bacteria | 3191 |
| 774 | Ga0501225_0027047 | 3300049705 | Bacteria | 1578 |
| 775 | Ga0501262_000532 | 3300049759 | Bacteria | 4534 |
| 776 | Ga0501035_0001779 | 3300049822 | Bacteria | 21773 |
| 777 | Ga0501044_0225798 | 3300049823 | Bacteria | 1822 |
| 778 | Ga0501044_0305790 | 3300049823 | Bacteria | 1518 |
| 779 | nmdc:mga03683_14532_c1 | 3300050489 | Bacteria | 2915 |
| 780 | nmdc:mga03683_44068_c1 | 3300050489 | Bacteria | 1843 |
| 781 | nmdc:mga03683_48174_c1 | 3300050489 | Bacteria | 1771 |
| 782 | nmdc:mga03n38_22845_c1 | 3300050490 | Bacteria | 2537 |
| 783 | nmdc:mga00v17_35099_c1 | 3300050491 | Bacteria | 2567 |
| 784 | nmdc:mga0k408_11179_c1 | 3300050493 | Bacteria | 4880 |
| 785 | nmdc:mga0k408_19690_c1 | 3300050493 | Bacteria | 3774 |
| 786 | nmdc:mga0k408_34097_c1 | 3300050493 | Bacteria | 2913 |
| 787 | nmdc:mga06z11_129231_c1 | 3300050494 | Bacteria | 1417 |
| 788 | nmdc:mga07m45_2078_c1 | 3300050496 | Bacteria | 9300 |
| 789 | nmdc:mga07m45_23737_c1 | 3300050496 | Bacteria | 3355 |
| 790 | nmdc:mga07m45_9105_c1 | 3300050496 | Bacteria | 5129 |
| 791 | Ga0500610_0004823 | 3300053079 | Bacteria | 5429 |
| 792 | Ga0500646_0023099 | 3300053090 | Bacteria | 1666 |
| 793 | Ga0500651_0000125 | 3300053093 | Bacteria | 47146 |
| 794 | Ga0500651_0053665 | 3300053093 | Bacteria | 2528 |
| 795 | Ga0500641_0152769 | 3300053096 | Bacteria | 996 |
| 796 | Ga0500571_000811 | 3300053110 | Bacteria | 13403 |
| 797 | Ga0500572_033169 | 3300053111 | Bacteria | 1455 |
| 798 | Ga0500593_004926 | 3300053117 | Bacteria | 5214 |
| 799 | Ga0500594_0013942 | 3300053118 | Bacteria | 1918 |
| 800 | Ga0500595_003099 | 3300053119 | Bacteria | 7872 |
| 801 | Ga0500607_007247 | 3300053121 | Bacteria | 6879 |
| 802 | Ga0500608_010325 | 3300053122 | Bacteria | 4004 |
| 803 | Ga0500618_000602 | 3300053125 | Bacteria | 22088 |
| 804 | Ga0500618_000660 | 3300053125 | Bacteria | 20531 |
| 805 | Ga0500618_000824 | 3300053125 | Bacteria | 16981 |
| 806 | Ga0500626_015711 | 3300053128 | Bacteria | 3303 |
| 807 | Ga0500655_002019 | 3300053133 | Bacteria | 3775 |
| 808 | Ga0500658_0001125 | 3300053134 | Bacteria | 10937 |
| 809 | Ga0500658_0002341 | 3300053134 | Bacteria | 7344 |
| 810 | Ga0500559_0012473 | 3300053136 | Bacteria | 3611 |
| 811 | Ga0500568_0002512 | 3300053139 | Bacteria | 10731 |
| 812 | Ga0500574_002077 | 3300053141 | Bacteria | 3198 |
| 813 | Ga0500622_0068864 | 3300053156 | Bacteria | 1793 |
| 814 | Ga0500627_0001087 | 3300053158 | Bacteria | 7417 |
| 815 | Ga0500634_0013841 | 3300053161 | Bacteria | 4242 |
| 816 | Ga0500634_0015330 | 3300053161 | Bacteria | 4068 |
| 817 | Ga0500638_040324 | 3300053162 | Bacteria | 2267 |
| 818 | Ga0587068_005051 | 3300059641 | Bacteria | 1780 |
| 819 | Ga0466962_0066246 | 3300061719 | Bacteria | 1724 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042001 | Ga0439441_016825 | Ga0439441_016825_131_997 | 254 |
| 2 | 3300049589 | Ga0501073_0263547 | Ga0501073_0263547_65_931 | 275 |
| 3 | 3300044842 | Ga0466957_0044623 | Ga0466957_0044623_142_978 | 278 |
| 4 | 3300047469 | Ga0495673_0000061 | Ga0495673_0000061_25312_26160 | 282 |
| 5 | 3300005440 | Ga0070705_100047720 | Ga0070705_1000477202 | 286 |
| 6 | 3300005444 | Ga0070694_100005548 | Ga0070694_1000055482 | 286 |
| 7 | 3300005617 | Ga0068859_100075066 | Ga0068859_1000750663 | 286 |
| 8 | 3300006931 | Ga0097620_100075065 | Ga0097620_1000750653 | 286 |
| 9 | iso_pu_bacteria | 2643221645 | 2644253436 | 286 |
| 10 | iso_pu_bacteria | 2643221664 | 2644355518 | 286 |
| 11 | iso_pu_bacteria | 2738541280 | 2738737362 | 286 |
| 12 | iso_pu_bacteria | 2738541300 | 2738841591 | 286 |
| 13 | iso_pu_bacteria | 2738543018 | 2739272462 | 286 |
| 14 | iso_pu_bacteria | 2738543030 | 2739341506 | 286 |
| 15 | 3300006948 | Ga0099826_10000002 | Ga0099826_10000002445 | 287 |
| 16 | 3300027666 | Ga0209282_1000001 | Ga0209282_1000001707 | 287 |
| 17 | 3300049671 | Ga0501238_001027 | Ga0501238_001027_1419_2303 | 287 |
| 18 | iso_pu_bacteria | 2818991436 | 2819542817 | 287 |
| 19 | iso_pu_bacteria | 2511231003 | 2511250325 | 288 |
| 20 | iso_pu_bacteria | 2511231026 | 2511385207 | 288 |
| 21 | iso_pu_bacteria | 2521172590 | 2521558663 | 288 |
| 22 | iso_pu_bacteria | 2548876994 | 2550695453 | 288 |
| 23 | iso_pu_bacteria | 2551306416 | 2553004393 | 288 |
| 24 | iso_pu_bacteria | 2600255292 | 2601669135 | 288 |
| 25 | iso_pu_bacteria | 2643221556 | 2643799867 | 288 |
| 26 | iso_pu_bacteria | 2643221684 | 2644474867 | 288 |
| 27 | iso_pu_bacteria | 2738541297 | 2738830175 | 288 |
| 28 | iso_pu_bacteria | 2738541357 | 2739153971 | 288 |
| 29 | iso_pu_bacteria | 2738543003 | 2739195891 | 288 |
| 30 | iso_pu_bacteria | 2738543026 | 2739322367 | 288 |
| 31 | iso_pu_bacteria | 2738543029 | 2739340608 | 288 |
| 32 | iso_pu_bacteria | 2765235838 | 2765569769 | 288 |
| 33 | iso_pu_bacteria | 2808606386 | 2808981876 | 288 |
| 34 | iso_pu_bacteria | 2808606415 | 2809131498 | 288 |
| 35 | iso_pu_bacteria | 2808606418 | 2809146793 | 288 |
| 36 | iso_pu_bacteria | 2808606419 | 2809151120 | 288 |
| 37 | iso_pu_bacteria | 2818991445 | 2819591785 | 288 |
| 38 | iso_pu_bacteria | 2818991449 | 2819614109 | 288 |
| 39 | iso_pu_bacteria | 2839094727 | 2839097290 | 288 |
| 40 | iso_pu_bacteria | 2852618963 | 2852622600 | 288 |
| 41 | iso_pu_bacteria | 2857547612 | 2857551275 | 288 |
| 42 | iso_pu_bacteria | 2857564685 | 2857568468 | 288 |
| 43 | iso_pu_bacteria | 2884811622 | 2884815414 | 288 |
| 44 | iso_pu_bacteria | 2884836552 | 2884837586 | 288 |
| 45 | iso_pu_bacteria | 2884852848 | 2884853877 | 288 |
| 46 | iso_pu_bacteria | 2885080285 | 2885084076 | 288 |
| 47 | iso_pu_bacteria | 2896154374 | 2896155006 | 288 |
| 48 | iso_pu_bacteria | 2904439833 | 2904444043 | 288 |
| 49 | iso_pu_bacteria | 2904530477 | 2904534412 | 288 |
| 50 | iso_pu_bacteria | 2904584206 | 2904584303 | 288 |
| 51 | iso_pu_bacteria | 2904589729 | 2904590772 | 288 |
| 52 | iso_pu_bacteria | 2904601388 | 2904603389 | 288 |
| 53 | iso_pu_bacteria | 2919046199 | 2919047098 | 288 |
| 54 | iso_pu_bacteria | 2919079590 | 2919080607 | 288 |
| 55 | iso_pu_bacteria | 2923510766 | 2923512241 | 288 |
| 56 | iso_pu_bacteria | 2928130867 | 2928131902 | 288 |
| 57 | iso_pu_bacteria | 2932410948 | 2932416389 | 288 |
| 58 | iso_pu_bacteria | 2932416698 | 2932417210 | 288 |
| 59 | iso_pu_bacteria | 8047673197 | 8047673263 | 288 |
| 60 | 3300037418 | Ga0395900_0049239 | Ga0395900_0049239_1502_2377 | 289 |
| 61 | 3300037471 | Ga0395905_0024207 | Ga0395905_0024207_513_1388 | 289 |
| 62 | 3300037471 | Ga0395905_0275951 | Ga0395905_0275951_247_1122 | 289 |
| 63 | 3300037471 | Ga0395905_0344883 | Ga0395905_0344883_21_896 | 289 |
| 64 | 3300046528 | Ga0495642_0015965 | Ga0495642_0015965_649_1524 | 289 |
| 65 | 3300047443 | Ga0495687_033243 | Ga0495687_033243_783_1658 | 289 |
| 66 | 3300048907 | Ga0496104_0079472 | Ga0496104_0079472_571_1446 | 289 |
| 67 | 3300048908 | Ga0496105_0049351 | Ga0496105_0049351_2377_3252 | 289 |
| 68 | 3300048911 | Ga0496108_0250056 | Ga0496108_0250056_147_1022 | 289 |
| 69 | 3300048912 | Ga0496109_0176197 | Ga0496109_0176197_694_1569 | 289 |
| 70 | 3300048913 | Ga0496110_0214430 | Ga0496110_0214430_850_1725 | 289 |
| 71 | iso_pu_bacteria | 2511231003 | 2511247726 | 289 |
| 72 | iso_pu_bacteria | 2511231026 | 2511385444 | 289 |
| 73 | iso_pu_bacteria | 2521172590 | 2521558126 | 289 |
| 74 | iso_pu_bacteria | 2548876994 | 2550692899 | 289 |
| 75 | iso_pu_bacteria | 2551306416 | 2553003252 | 289 |
| 76 | iso_pu_bacteria | 2765235838 | 2765569260 | 289 |
| 77 | iso_pu_bacteria | 2808606386 | 2808983876 | 289 |
| 78 | iso_pu_bacteria | 2808606415 | 2809130936 | 289 |
| 79 | iso_pu_bacteria | 2808606419 | 2809150729 | 289 |
| 80 | iso_pu_bacteria | 2818991445 | 2819593233 | 289 |
| 81 | iso_pu_bacteria | 2818991449 | 2819614730 | 289 |
| 82 | iso_pu_bacteria | 2839094727 | 2839095854 | 289 |
| 83 | iso_pu_bacteria | 2852618963 | 2852622246 | 289 |
| 84 | iso_pu_bacteria | 2884811622 | 2884812381 | 289 |
| 85 | iso_pu_bacteria | 2884836552 | 2884838131 | 289 |
| 86 | iso_pu_bacteria | 2884852848 | 2884854424 | 289 |
| 87 | iso_pu_bacteria | 2896154374 | 2896154460 | 289 |
| 88 | iso_pu_bacteria | 2904439833 | 2904441099 | 289 |
| 89 | iso_pu_bacteria | 2904530477 | 2904531958 | 289 |
| 90 | iso_pu_bacteria | 2904584206 | 2904587816 | 289 |
| 91 | iso_pu_bacteria | 2904589729 | 2904590024 | 289 |
| 92 | iso_pu_bacteria | 2904601388 | 2904602588 | 289 |
| 93 | iso_pu_bacteria | 2919046199 | 2919046590 | 289 |
| 94 | iso_pu_bacteria | 2919079590 | 2919079906 | 289 |
| 95 | iso_pu_bacteria | 2928130867 | 2928131306 | 289 |
| 96 | 3300035691 | Ga0373931_0083192 | Ga0373931_0083192_653_1525 | 290 |
| 97 | 3300046452 | Ga0495617_000216 | Ga0495617_000216_5971_6864 | 290 |
| 98 | 3300046452 | Ga0495617_008767 | Ga0495617_008767_1290_2183 | 290 |
| 99 | 3300046452 | Ga0495617_015123 | Ga0495617_015123_854_1747 | 290 |
| 100 | 3300046460 | Ga0495638_0010640 | Ga0495638_0010640_1806_2699 | 290 |
| 101 | 3300046460 | Ga0495638_0012288 | Ga0495638_0012288_58_951 | 290 |
| 102 | 3300046474 | Ga0495605_0001338 | Ga0495605_0001338_193_1086 | 290 |
| 103 | 3300046491 | Ga0495584_0000153 | Ga0495584_0000153_13472_14365 | 290 |
| 104 | 3300046491 | Ga0495584_0006647 | Ga0495584_0006647_1835_2728 | 290 |
| 105 | 3300046492 | Ga0495585_0000206 | Ga0495585_0000206_7616_8509 | 290 |
| 106 | 3300046492 | Ga0495585_0000353 | Ga0495585_0000353_40318_41211 | 290 |
| 107 | 3300046492 | Ga0495585_0000563 | Ga0495585_0000563_28431_29324 | 290 |
| 108 | 3300046492 | Ga0495585_0004163 | Ga0495585_0004163_5242_6135 | 290 |
| 109 | 3300046492 | Ga0495585_0010007 | Ga0495585_0010007_1850_2743 | 290 |
| 110 | 3300046492 | Ga0495585_0012096 | Ga0495585_0012096_2231_3124 | 290 |
| 111 | 3300046492 | Ga0495585_0027642 | Ga0495585_0027642_1552_2445 | 290 |
| 112 | 3300046492 | Ga0495585_0054779 | Ga0495585_0054779_1044_1937 | 290 |
| 113 | 3300046492 | Ga0495585_0069864 | Ga0495585_0069864_734_1627 | 290 |
| 114 | 3300046500 | Ga0495596_0000680 | Ga0495596_0000680_12090_12983 | 290 |
| 115 | 3300046500 | Ga0495596_0000699 | Ga0495596_0000699_3278_4171 | 290 |
| 116 | 3300046501 | Ga0495607_0034547 | Ga0495607_0034547_480_1373 | 290 |
| 117 | 3300046501 | Ga0495607_0099855 | Ga0495607_0099855_147_1040 | 290 |
| 118 | 3300046506 | Ga0495583_0000424 | Ga0495583_0000424_44291_45184 | 290 |
| 119 | 3300046506 | Ga0495583_0000537 | Ga0495583_0000537_51896_52789 | 290 |
| 120 | 3300046506 | Ga0495583_0069740 | Ga0495583_0069740_22_915 | 290 |
| 121 | 3300046507 | Ga0495606_0000245 | Ga0495606_0000245_3683_4579 | 290 |
| 122 | 3300046507 | Ga0495606_0012994 | Ga0495606_0012994_598_1470 | 290 |
| 123 | 3300046507 | Ga0495606_0022037 | Ga0495606_0022037_1204_2097 | 290 |
| 124 | 3300046512 | Ga0495610_0051705 | Ga0495610_0051705_162_1055 | 290 |
| 125 | 3300046513 | Ga0495616_0001403 | Ga0495616_0001403_3167_4060 | 290 |
| 126 | 3300046513 | Ga0495616_0006109 | Ga0495616_0006109_5747_6640 | 290 |
| 127 | 3300046513 | Ga0495616_0013484 | Ga0495616_0013484_1623_2516 | 290 |
| 128 | 3300046518 | Ga0495631_0011497 | Ga0495631_0011497_3279_4172 | 290 |
| 129 | 3300046518 | Ga0495631_0019279 | Ga0495631_0019279_304_1197 | 290 |
| 130 | 3300046519 | Ga0495632_0007449 | Ga0495632_0007449_5666_6559 | 290 |
| 131 | 3300046520 | Ga0495637_0001337 | Ga0495637_0001337_3723_4607 | 290 |
| 132 | 3300046522 | Ga0495643_0092143 | Ga0495643_0092143_132_1025 | 290 |
| 133 | 3300046523 | Ga0495644_0001322 | Ga0495644_0001322_2927_3820 | 290 |
| 134 | 3300046523 | Ga0495644_0001761 | Ga0495644_0001761_4914_5807 | 290 |
| 135 | 3300046523 | Ga0495644_0010287 | Ga0495644_0010287_456_1349 | 290 |
| 136 | 3300046524 | Ga0495648_0000722 | Ga0495648_0000722_28363_29256 | 290 |
| 137 | 3300046524 | Ga0495648_0001252 | Ga0495648_0001252_20118_21011 | 290 |
| 138 | 3300046524 | Ga0495648_0025349 | Ga0495648_0025349_625_1518 | 290 |
| 139 | 3300046525 | Ga0495663_0004113 | Ga0495663_0004113_1666_2559 | 290 |
| 140 | 3300046525 | Ga0495663_0006991 | Ga0495663_0006991_478_1371 | 290 |
| 141 | 3300046528 | Ga0495642_0012839 | Ga0495642_0012839_1022_1915 | 290 |
| 142 | 3300046528 | Ga0495642_0054397 | Ga0495642_0054397_465_1358 | 290 |
| 143 | 3300046530 | Ga0495654_0000015 | Ga0495654_0000015_122655_123539 | 290 |
| 144 | 3300046538 | Ga0495609_0007230 | Ga0495609_0007230_2695_3588 | 290 |
| 145 | 3300046538 | Ga0495609_0008580 | Ga0495609_0008580_3637_4530 | 290 |
| 146 | 3300046538 | Ga0495609_0014663 | Ga0495609_0014663_1032_1925 | 290 |
| 147 | 3300046542 | Ga0495597_0023099 | Ga0495597_0023099_1372_2265 | 290 |
| 148 | 3300046542 | Ga0495597_0098405 | Ga0495597_0098405_11_904 | 290 |
| 149 | 3300046557 | Ga0495622_0052385 | Ga0495622_0052385_981_1874 | 290 |
| 150 | 3300046558 | Ga0495633_0011567 | Ga0495633_0011567_3496_4389 | 290 |
| 151 | 3300046558 | Ga0495633_0049750 | Ga0495633_0049750_519_1412 | 290 |
| 152 | 3300046615 | Ga0495656_0014357 | Ga0495656_0014357_1728_2621 | 290 |
| 153 | 3300046615 | Ga0495656_0062292 | Ga0495656_0062292_169_1062 | 290 |
| 154 | 3300046616 | Ga0495668_0003498 | Ga0495668_0003498_7235_8128 | 290 |
| 155 | 3300046616 | Ga0495668_0107004 | Ga0495668_0107004_269_1162 | 290 |
| 156 | 3300046648 | Ga0495611_0007509 | Ga0495611_0007509_1631_2524 | 290 |
| 157 | 3300046648 | Ga0495611_0027723 | Ga0495611_0027723_152_1045 | 290 |
| 158 | 3300046648 | Ga0495611_0031839 | Ga0495611_0031839_1136_2029 | 290 |
| 159 | 3300046660 | Ga0495625_0002452 | Ga0495625_0002452_15166_16065 | 290 |
| 160 | 3300046664 | Ga0495659_0000244 | Ga0495659_0000244_6639_7532 | 290 |
| 161 | 3300046664 | Ga0495659_0000262 | Ga0495659_0000262_6440_7333 | 290 |
| 162 | 3300046664 | Ga0495659_0026247 | Ga0495659_0026247_20_913 | 290 |
| 163 | 3300046665 | Ga0495661_0037262 | Ga0495661_0037262_1125_2018 | 290 |
| 164 | 3300046665 | Ga0495661_0043566 | Ga0495661_0043566_513_1406 | 290 |
| 165 | 3300046665 | Ga0495661_0142803 | Ga0495661_0142803_12_905 | 290 |
| 166 | 3300046684 | Ga0495669_0006620 | Ga0495669_0006620_1320_2213 | 290 |
| 167 | 3300046691 | Ga0495670_0013956 | Ga0495670_0013956_1023_1916 | 290 |
| 168 | 3300046691 | Ga0495670_0029080 | Ga0495670_0029080_1787_2680 | 290 |
| 169 | 3300046691 | Ga0495670_0030705 | Ga0495670_0030705_929_1822 | 290 |
| 170 | 3300046691 | Ga0495670_0061819 | Ga0495670_0061819_325_1218 | 290 |
| 171 | 3300046692 | Ga0495671_0000379 | Ga0495671_0000379_6587_7480 | 290 |
| 172 | 3300046692 | Ga0495671_0013546 | Ga0495671_0013546_2985_3878 | 290 |
| 173 | 3300046692 | Ga0495671_0035496 | Ga0495671_0035496_803_1696 | 290 |
| 174 | 3300046794 | Ga0495589_0171744 | Ga0495589_0171744_113_1006 | 290 |
| 175 | 3300047318 | Ga0495636_0004266 | Ga0495636_0004266_912_1805 | 290 |
| 176 | 3300047318 | Ga0495636_0011979 | Ga0495636_0011979_1672_2553 | 290 |
| 177 | 3300047320 | Ga0495672_0000368 | Ga0495672_0000368_12311_13204 | 290 |
| 178 | 3300047320 | Ga0495672_0004744 | Ga0495672_0004744_427_1320 | 290 |
| 179 | 3300047320 | Ga0495672_0018354 | Ga0495672_0018354_1255_2148 | 290 |
| 180 | 3300047323 | Ga0495683_0000151 | Ga0495683_0000151_40678_41571 | 290 |
| 181 | 3300047323 | Ga0495683_0004352 | Ga0495683_0004352_3532_4425 | 290 |
| 182 | 3300047323 | Ga0495683_0016725 | Ga0495683_0016725_2664_3557 | 290 |
| 183 | 3300047443 | Ga0495687_000191 | Ga0495687_000191_86653_87546 | 290 |
| 184 | 3300047443 | Ga0495687_020878 | Ga0495687_020878_466_1359 | 290 |
| 185 | 3300047445 | Ga0495677_0005309 | Ga0495677_0005309_24_917 | 290 |
| 186 | 3300047445 | Ga0495677_0007159 | Ga0495677_0007159_700_1593 | 290 |
| 187 | 3300047445 | Ga0495677_0051535 | Ga0495677_0051535_315_1208 | 290 |
| 188 | 3300047447 | Ga0495685_000381 | Ga0495685_000381_11651_12544 | 290 |
| 189 | 3300047469 | Ga0495673_0015081 | Ga0495673_0015081_1036_1929 | 290 |
| 190 | 3300047469 | Ga0495673_0020397 | Ga0495673_0020397_222_1115 | 290 |
| 191 | 3300047470 | Ga0495681_0024054 | Ga0495681_0024054_1700_2593 | 290 |
| 192 | 3300048090 | Ga0495615_0011387 | Ga0495615_0011387_478_1371 | 290 |
| 193 | 3300048091 | Ga0495626_0011538 | Ga0495626_0011538_3202_4095 | 290 |
| 194 | 3300048091 | Ga0495626_0106570 | Ga0495626_0106570_156_1049 | 290 |
| 195 | 3300048905 | Ga0496102_0062714 | Ga0496102_0062714_1464_2357 | 290 |
| 196 | 3300049459 | Ga0495678_002557 | Ga0495678_002557_7518_8411 | 290 |
| 197 | 3300049460 | Ga0495682_0000649 | Ga0495682_0000649_18864_19757 | 290 |
| 198 | 3300049460 | Ga0495682_0004485 | Ga0495682_0004485_3493_4386 | 290 |
| 199 | 3300049460 | Ga0495682_0024502 | Ga0495682_0024502_498_1391 | 290 |
| 200 | 3300049460 | Ga0495682_0063550 | Ga0495682_0063550_395_1288 | 290 |
| 201 | 3300049669 | Ga0501235_020320 | Ga0501235_020320_370_1263 | 290 |
| 202 | 3300053125 | Ga0500618_000602 | Ga0500618_000602_5061_5948 | 290 |
| 203 | iso_pu_bacteria | 2923510766 | 2923511374 | 290 |
| 204 | 3300002771 | JGI25163J39215_1003006 | JGI25163J39215_10030062 | 291 |
| 205 | 3300003214 | JGI25165J46597_1000001 | JGI25165J46597_1000001330 | 291 |
| 206 | 3300003751 | Ga0055538_1000001 | Ga0055538_1000001703 | 291 |
| 207 | 3300003752 | Ga0055539_1000001 | Ga0055539_1000001703 | 291 |
| 208 | 3300003756 | Ga0055533_1000003 | Ga0055533_1000003330 | 291 |
| 209 | 3300003759 | Ga0055525_1000003 | Ga0055525_1000003330 | 291 |
| 210 | 3300003841 | Ga0055541_1000001 | Ga0055541_1000001330 | 291 |
| 211 | 3300005337 | Ga0070682_100012821 | Ga0070682_1000128212 | 291 |
| 212 | 3300015262 | Ga0182007_10003866 | Ga0182007_100038665 | 291 |
| 213 | 3300015265 | Ga0182005_1000662 | Ga0182005_100066211 | 291 |
| 214 | 3300025224 | Ga0209784_100004 | Ga0209784_100004329 | 291 |
| 215 | 3300025225 | Ga0209566_100004 | Ga0209566_100004486 | 291 |
| 216 | 3300025226 | Ga0209674_100006 | Ga0209674_100006486 | 291 |
| 217 | 3300025230 | Ga0209563_100009 | Ga0209563_100009329 | 291 |
| 218 | 3300025231 | Ga0207427_100254 | Ga0207427_10025418 | 291 |
| 219 | 3300025233 | Ga0209437_100004 | Ga0209437_100004329 | 291 |
| 220 | 3300025250 | Ga0209026_1005223 | Ga0209026_10052233 | 291 |
| 221 | 3300025253 | Ga0209677_100005 | Ga0209677_100005329 | 291 |
| 222 | 3300025261 | Ga0209233_1000005 | Ga0209233_1000005486 | 291 |
| 223 | 3300031251 | Ga0265327_10005786 | Ga0265327_100057866 | 291 |
| 224 | 3300037312 | Ga0395899_0004769 | Ga0395899_0004769_6916_7791 | 291 |
| 225 | 3300037466 | Ga0395898_0192527 | Ga0395898_0192527_241_1116 | 291 |
| 226 | 3300037471 | Ga0395905_0023958 | Ga0395905_0023958_3078_3953 | 291 |
| 227 | 3300038443 | Ga0395901_0000482 | Ga0395901_0000482_38009_38884 | 291 |
| 228 | 3300038443 | Ga0395901_0004717 | Ga0395901_0004717_6027_6902 | 291 |
| 229 | 3300044658 | Ga0466972_0002538 | Ga0466972_0002538_5082_5960 | 291 |
| 230 | 3300044683 | Ga0466965_0001072 | Ga0466965_0001072_4378_5256 | 291 |
| 231 | 3300044706 | Ga0466964_0111066 | Ga0466964_0111066_297_1175 | 291 |
| 232 | 3300044735 | Ga0466968_0002868 | Ga0466968_0002868_4462_5340 | 291 |
| 233 | 3300044765 | Ga0466970_0008154 | Ga0466970_0008154_3906_4859 | 291 |
| 234 | 3300044765 | Ga0466970_0033147 | Ga0466970_0033147_249_1124 | 291 |
| 235 | 3300046462 | Ga0495651_0005781 | Ga0495651_0005781_8448_9323 | 291 |
| 236 | 3300046463 | Ga0495653_0001714 | Ga0495653_0001714_5476_6351 | 291 |
| 237 | 3300046463 | Ga0495653_0258326 | Ga0495653_0258326_177_1052 | 291 |
| 238 | 3300046511 | Ga0495608_0002860 | Ga0495608_0002860_9376_10251 | 291 |
| 239 | 3300046511 | Ga0495608_0054992 | Ga0495608_0054992_141_1016 | 291 |
| 240 | 3300046516 | Ga0495628_0000929 | Ga0495628_0000929_6974_7849 | 291 |
| 241 | 3300046529 | Ga0495652_0002952 | Ga0495652_0002952_12278_13153 | 291 |
| 242 | 3300046529 | Ga0495652_0010677 | Ga0495652_0010677_3801_4676 | 291 |
| 243 | 3300046543 | Ga0495645_0008074 | Ga0495645_0008074_4022_4897 | 291 |
| 244 | 3300046663 | Ga0495635_0083950 | Ga0495635_0083950_393_1268 | 291 |
| 245 | 3300046675 | Ga0495657_0044637 | Ga0495657_0044637_535_1410 | 291 |
| 246 | 3300046680 | Ga0495646_0012297 | Ga0495646_0012297_1120_1995 | 291 |
| 247 | 3300046809 | Ga0495600_0000151 | Ga0495600_0000151_23432_24307 | 291 |
| 248 | 3300048088 | Ga0495602_0008077 | Ga0495602_0008077_3447_4322 | 291 |
| 249 | 3300048088 | Ga0495602_0029236 | Ga0495602_0029236_3795_4670 | 291 |
| 250 | 3300048903 | Ga0496100_0123739 | Ga0496100_0123739_65_940 | 291 |
| 251 | 3300048927 | Ga0496124_0014605 | Ga0496124_0014605_3359_4252 | 291 |
| 252 | 3300048928 | Ga0496125_0001032 | Ga0496125_0001032_14199_15074 | 291 |
| 253 | 3300049823 | Ga0501044_0305790 | Ga0501044_0305790_254_1129 | 291 |
| 254 | 3300053119 | Ga0500595_003099 | Ga0500595_003099_1712_2587 | 291 |
| 255 | iso_pu_bacteria | 2842733646 | 2842734239 | 291 |
| 256 | iso_pu_bacteria | 2842747753 | 2842749504 | 291 |
| 257 | iso_pu_bacteria | 2928115317 | 2928117606 | 291 |
| 258 | 3300002704 | JGI25155J39150_1000117 | JGI25155J39150_100011710 | 292 |
| 259 | 3300002704 | JGI25155J39150_1000134 | JGI25155J39150_100013436 | 292 |
| 260 | 3300002704 | JGI25155J39150_1000227 | JGI25155J39150_10002275 | 292 |
| 261 | 3300002704 | JGI25155J39150_1000896 | JGI25155J39150_10008961 | 292 |
| 262 | 3300002705 | JGI25156J39149_1000108 | JGI25156J39149_100010847 | 292 |
| 263 | 3300002705 | JGI25156J39149_1000270 | JGI25156J39149_10002703 | 292 |
| 264 | 3300002705 | JGI25156J39149_1006902 | JGI25156J39149_10069023 | 292 |
| 265 | 3300002705 | JGI25156J39149_1014331 | JGI25156J39149_10143311 | 292 |
| 266 | 3300002737 | JGI25162J39368_1004472 | JGI25162J39368_10044722 | 292 |
| 267 | 3300002738 | JGI25154J39366_1000222 | JGI25154J39366_100022210 | 292 |
| 268 | 3300002738 | JGI25154J39366_1000247 | JGI25154J39366_10002473 | 292 |
| 269 | 3300002738 | JGI25154J39366_1000569 | JGI25154J39366_10005699 | 292 |
| 270 | 3300002738 | JGI25154J39366_1000582 | JGI25154J39366_10005823 | 292 |
| 271 | 3300002738 | JGI25154J39366_1001350 | JGI25154J39366_10013501 | 292 |
| 272 | 3300002741 | JGI25157J39369_1000120 | JGI25157J39369_100012029 | 292 |
| 273 | 3300002741 | JGI25157J39369_1000311 | JGI25157J39369_10003113 | 292 |
| 274 | 3300003751 | Ga0055538_1000002 | Ga0055538_1000002527 | 292 |
| 275 | 3300003751 | Ga0055538_1000020 | Ga0055538_1000020149 | 292 |
| 276 | 3300003752 | Ga0055539_1000002 | Ga0055539_1000002527 | 292 |
| 277 | 3300003752 | Ga0055539_1000025 | Ga0055539_1000025149 | 292 |
| 278 | 3300003756 | Ga0055533_1000004 | Ga0055533_1000004527 | 292 |
| 279 | 3300003756 | Ga0055533_1000034 | Ga0055533_100003494 | 292 |
| 280 | 3300003758 | Ga0055532_1000023 | Ga0055532_10000233 | 292 |
| 281 | 3300003758 | Ga0055532_1000051 | Ga0055532_1000051107 | 292 |
| 282 | 3300003759 | Ga0055525_1000002 | Ga0055525_1000002527 | 292 |
| 283 | 3300003759 | Ga0055525_1000044 | Ga0055525_1000044149 | 292 |
| 284 | 3300003761 | Ga0055535_1005122 | Ga0055535_10051222 | 292 |
| 285 | 3300003763 | Ga0055529_1000138 | Ga0055529_100013812 | 292 |
| 286 | 3300003771 | Ga0055526_1000411 | Ga0055526_10004115 | 292 |
| 287 | 3300003841 | Ga0055541_1000002 | Ga0055541_1000002316 | 292 |
| 288 | 3300003841 | Ga0055541_1000019 | Ga0055541_1000019149 | 292 |
| 289 | 3300005339 | Ga0070660_100016619 | Ga0070660_1000166193 | 292 |
| 290 | 3300005344 | Ga0070661_100090689 | Ga0070661_1000906892 | 292 |
| 291 | 3300005366 | Ga0070659_100015532 | Ga0070659_1000155323 | 292 |
| 292 | 3300005455 | Ga0070663_100184477 | Ga0070663_1001844772 | 292 |
| 293 | 3300005563 | Ga0068855_100000197 | Ga0068855_10000019738 | 292 |
| 294 | 3300005563 | Ga0068855_100001741 | Ga0068855_10000174110 | 292 |
| 295 | 3300005563 | Ga0068855_100011938 | Ga0068855_1000119383 | 292 |
| 296 | 3300005563 | Ga0068855_100015823 | Ga0068855_1000158239 | 292 |
| 297 | 3300005563 | Ga0068855_100176065 | Ga0068855_1001760652 | 292 |
| 298 | 3300005563 | Ga0068855_100567453 | Ga0068855_1005674531 | 292 |
| 299 | 3300005578 | Ga0068854_100002908 | Ga0068854_10000290812 | 292 |
| 300 | 3300005578 | Ga0068854_100051852 | Ga0068854_1000518522 | 292 |
| 301 | 3300005616 | Ga0068852_100006280 | Ga0068852_1000062804 | 292 |
| 302 | 3300005616 | Ga0068852_100193027 | Ga0068852_1001930271 | 292 |
| 303 | 3300005616 | Ga0068852_100347458 | Ga0068852_1003474582 | 292 |
| 304 | 3300005834 | Ga0068851_10104691 | Ga0068851_101046912 | 292 |
| 305 | 3300009093 | Ga0105240_10001798 | Ga0105240_1000179834 | 292 |
| 306 | 3300009093 | Ga0105240_10012173 | Ga0105240_1001217314 | 292 |
| 307 | 3300009093 | Ga0105240_10017029 | Ga0105240_100170295 | 292 |
| 308 | 3300009093 | Ga0105240_10097593 | Ga0105240_100975933 | 292 |
| 309 | 3300009093 | Ga0105240_10514341 | Ga0105240_105143412 | 292 |
| 310 | 3300009174 | Ga0105241_10170626 | Ga0105241_101706263 | 292 |
| 311 | 3300009545 | Ga0105237_10014721 | Ga0105237_100147213 | 292 |
| 312 | 3300009551 | Ga0105238_10000977 | Ga0105238_1000097721 | 292 |
| 313 | 3300009551 | Ga0105238_10025787 | Ga0105238_100257873 | 292 |
| 314 | 3300009551 | Ga0105238_10125694 | Ga0105238_101256942 | 292 |
| 315 | 3300010375 | Ga0105239_10083666 | Ga0105239_100836664 | 292 |
| 316 | 3300010375 | Ga0105239_10263864 | Ga0105239_102638642 | 292 |
| 317 | 3300010375 | Ga0105239_10302309 | Ga0105239_103023092 | 292 |
| 318 | 3300013297 | Ga0157378_10059023 | Ga0157378_100590232 | 292 |
| 319 | 3300013307 | Ga0157372_10165903 | Ga0157372_101659034 | 292 |
| 320 | 3300014497 | Ga0182008_10000515 | Ga0182008_1000051520 | 292 |
| 321 | 3300014497 | Ga0182008_10027129 | Ga0182008_100271294 | 292 |
| 322 | 3300015261 | Ga0182006_1000112 | Ga0182006_100011249 | 292 |
| 323 | 3300015261 | Ga0182006_1001190 | Ga0182006_100119016 | 292 |
| 324 | 3300015261 | Ga0182006_1011405 | Ga0182006_10114052 | 292 |
| 325 | 3300015261 | Ga0182006_1032526 | Ga0182006_10325262 | 292 |
| 326 | 3300015262 | Ga0182007_10000020 | Ga0182007_1000002057 | 292 |
| 327 | 3300015265 | Ga0182005_1000001 | Ga0182005_100000158 | 292 |
| 328 | 3300017792 | Ga0163161_10015085 | Ga0163161_100150853 | 292 |
| 329 | 3300021361 | Ga0213872_10000001 | Ga0213872_10000001302 | 292 |
| 330 | 3300021361 | Ga0213872_10001896 | Ga0213872_100018964 | 292 |
| 331 | 3300021361 | Ga0213872_10034749 | Ga0213872_100347493 | 292 |
| 332 | 3300022467 | Ga0224712_10051595 | Ga0224712_100515951 | 292 |
| 333 | 3300025206 | Ga0209435_100013 | Ga0209435_100013115 | 292 |
| 334 | 3300025206 | Ga0209435_100028 | Ga0209435_10002831 | 292 |
| 335 | 3300025206 | Ga0209435_100300 | Ga0209435_10030016 | 292 |
| 336 | 3300025206 | Ga0209435_100501 | Ga0209435_1005015 | 292 |
| 337 | 3300025224 | Ga0209784_100002 | Ga0209784_100002152 | 292 |
| 338 | 3300025224 | Ga0209784_100002 | Ga0209784_100002754 | 292 |
| 339 | 3300025225 | Ga0209566_100003 | Ga0209566_100003152 | 292 |
| 340 | 3300025225 | Ga0209566_100003 | Ga0209566_100003754 | 292 |
| 341 | 3300025226 | Ga0209674_100004 | Ga0209674_100004152 | 292 |
| 342 | 3300025226 | Ga0209674_100004 | Ga0209674_100004754 | 292 |
| 343 | 3300025229 | Ga0209147_100004 | Ga0209147_100004362 | 292 |
| 344 | 3300025229 | Ga0209147_100030 | Ga0209147_100030239 | 292 |
| 345 | 3300025230 | Ga0209563_100006 | Ga0209563_100006152 | 292 |
| 346 | 3300025230 | Ga0209563_100006 | Ga0209563_100006754 | 292 |
| 347 | 3300025230 | Ga0209563_100007 | Ga0209563_100007300 | 292 |
| 348 | 3300025233 | Ga0209437_100053 | Ga0209437_100053289 | 292 |
| 349 | 3300025233 | Ga0209437_100275 | Ga0209437_10027553 | 292 |
| 350 | 3300025242 | Ga0209258_100325 | Ga0209258_10032517 | 292 |
| 351 | 3300025242 | Ga0209258_100667 | Ga0209258_1006679 | 292 |
| 352 | 3300025245 | Ga0207425_1000455 | Ga0207425_100045526 | 292 |
| 353 | 3300025246 | Ga0209646_1000021 | Ga0209646_1000021158 | 292 |
| 354 | 3300025246 | Ga0209646_1000034 | Ga0209646_1000034115 | 292 |
| 355 | 3300025246 | Ga0209646_1000051 | Ga0209646_1000051255 | 292 |
| 356 | 3300025246 | Ga0209646_1000095 | Ga0209646_100009531 | 292 |
| 357 | 3300025246 | Ga0209646_1000378 | Ga0209646_10003781 | 292 |
| 358 | 3300025250 | Ga0209026_1000022 | Ga0209026_1000022115 | 292 |
| 359 | 3300025250 | Ga0209026_1000110 | Ga0209026_100011031 | 292 |
| 360 | 3300025250 | Ga0209026_1014788 | Ga0209026_10147881 | 292 |
| 361 | 3300025253 | Ga0209677_100003 | Ga0209677_100003152 | 292 |
| 362 | 3300025253 | Ga0209677_100003 | Ga0209677_100003754 | 292 |
| 363 | 3300025253 | Ga0209677_101197 | Ga0209677_1011974 | 292 |
| 364 | 3300025254 | Ga0209148_1000985 | Ga0209148_10009854 | 292 |
| 365 | 3300025256 | Ga0209759_1000018 | Ga0209759_1000018115 | 292 |
| 366 | 3300025256 | Ga0209759_1000080 | Ga0209759_1000080101 | 292 |
| 367 | 3300025256 | Ga0209759_1000115 | Ga0209759_100011531 | 292 |
| 368 | 3300025256 | Ga0209759_1000155 | Ga0209759_100015579 | 292 |
| 369 | 3300025256 | Ga0209759_1000553 | Ga0209759_100055338 | 292 |
| 370 | 3300025272 | Ga0209455_1000043 | Ga0209455_100004384 | 292 |
| 371 | 3300025272 | Ga0209455_1006519 | Ga0209455_10065192 | 292 |
| 372 | 3300025294 | Ga0209025_1002209 | Ga0209025_100220914 | 292 |
| 373 | 3300025295 | Ga0209564_1000011 | Ga0209564_1000011314 | 292 |
| 374 | 3300025295 | Ga0209564_1000089 | Ga0209564_1000089181 | 292 |
| 375 | 3300025297 | Ga0209758_1000286 | Ga0209758_100028681 | 292 |
| 376 | 3300025321 | Ga0207656_10044790 | Ga0207656_100447902 | 292 |
| 377 | 3300025909 | Ga0207705_10000483 | Ga0207705_100004836 | 292 |
| 378 | 3300025911 | Ga0207654_10083951 | Ga0207654_100839512 | 292 |
| 379 | 3300025913 | Ga0207695_10001636 | Ga0207695_1000163634 | 292 |
| 380 | 3300025913 | Ga0207695_10011312 | Ga0207695_1001131212 | 292 |
| 381 | 3300025913 | Ga0207695_10013645 | Ga0207695_100136454 | 292 |
| 382 | 3300025913 | Ga0207695_10128419 | Ga0207695_101284192 | 292 |
| 383 | 3300025914 | Ga0207671_10012800 | Ga0207671_100128005 | 292 |
| 384 | 3300025914 | Ga0207671_10018653 | Ga0207671_100186533 | 292 |
| 385 | 3300025919 | Ga0207657_10001945 | Ga0207657_100019454 | 292 |
| 386 | 3300025920 | Ga0207649_10339708 | Ga0207649_103397081 | 292 |
| 387 | 3300025924 | Ga0207694_10000873 | Ga0207694_1000087330 | 292 |
| 388 | 3300025924 | Ga0207694_10039691 | Ga0207694_100396913 | 292 |
| 389 | 3300025924 | Ga0207694_10154467 | Ga0207694_101544672 | 292 |
| 390 | 3300025927 | Ga0207687_10094183 | Ga0207687_100941831 | 292 |
| 391 | 3300025932 | Ga0207690_10062274 | Ga0207690_100622742 | 292 |
| 392 | 3300025932 | Ga0207690_10072303 | Ga0207690_100723032 | 292 |
| 393 | 3300025933 | Ga0207706_10109345 | Ga0207706_101093452 | 292 |
| 394 | 3300025949 | Ga0207667_10000034 | Ga0207667_10000034243 | 292 |
| 395 | 3300025949 | Ga0207667_10000036 | Ga0207667_1000003639 | 292 |
| 396 | 3300025949 | Ga0207667_10007030 | Ga0207667_1000703012 | 292 |
| 397 | 3300025949 | Ga0207667_10081172 | Ga0207667_100811722 | 292 |
| 398 | 3300025949 | Ga0207667_10092734 | Ga0207667_100927342 | 292 |
| 399 | 3300025949 | Ga0207667_10146730 | Ga0207667_101467302 | 292 |
| 400 | 3300025949 | Ga0207667_10427423 | Ga0207667_104274231 | 292 |
| 401 | 3300025981 | Ga0207640_10023722 | Ga0207640_100237222 | 292 |
| 402 | 3300025981 | Ga0207640_10238320 | Ga0207640_102383202 | 292 |
| 403 | 3300026089 | Ga0207648_10057270 | Ga0207648_100572702 | 292 |
| 404 | 3300026116 | Ga0207674_10264276 | Ga0207674_102642762 | 292 |
| 405 | 3300026142 | Ga0207698_10009166 | Ga0207698_100091662 | 292 |
| 406 | 3300026142 | Ga0207698_10067159 | Ga0207698_100671592 | 292 |
| 407 | 3300026142 | Ga0207698_10476583 | Ga0207698_104765832 | 292 |
| 408 | 3300031548 | Ga0307408_100000678 | Ga0307408_10000067817 | 292 |
| 409 | 3300031711 | Ga0265314_10010643 | Ga0265314_100106439 | 292 |
| 410 | 3300032004 | Ga0307414_10025305 | Ga0307414_100253053 | 292 |
| 411 | 3300035114 | Ga0373939_0014902 | Ga0373939_0014902_778_1677 | 292 |
| 412 | 3300037312 | Ga0395899_0002047 | Ga0395899_0002047_12180_13070 | 292 |
| 413 | 3300037312 | Ga0395899_0008647 | Ga0395899_0008647_6885_7775 | 292 |
| 414 | 3300037312 | Ga0395899_0009612 | Ga0395899_0009612_178_1068 | 292 |
| 415 | 3300037418 | Ga0395900_0000402 | Ga0395900_0000402_3675_4565 | 292 |
| 416 | 3300037418 | Ga0395900_0002186 | Ga0395900_0002186_3712_4602 | 292 |
| 417 | 3300037418 | Ga0395900_0002328 | Ga0395900_0002328_11185_12075 | 292 |
| 418 | 3300037418 | Ga0395900_0023829 | Ga0395900_0023829_2183_3073 | 292 |
| 419 | 3300037418 | Ga0395900_0031677 | Ga0395900_0031677_1313_2203 | 292 |
| 420 | 3300037418 | Ga0395900_0075873 | Ga0395900_0075873_2509_3399 | 292 |
| 421 | 3300037418 | Ga0395900_0117216 | Ga0395900_0117216_596_1486 | 292 |
| 422 | 3300037466 | Ga0395898_0071146 | Ga0395898_0071146_1347_2237 | 292 |
| 423 | 3300037466 | Ga0395898_0164041 | Ga0395898_0164041_679_1569 | 292 |
| 424 | 3300037471 | Ga0395905_0032524 | Ga0395905_0032524_857_1747 | 292 |
| 425 | 3300037471 | Ga0395905_0291229 | Ga0395905_0291229_176_1066 | 292 |
| 426 | 3300038443 | Ga0395901_0000250 | Ga0395901_0000250_33109_33999 | 292 |
| 427 | 3300038443 | Ga0395901_0009268 | Ga0395901_0009268_3712_4602 | 292 |
| 428 | 3300038443 | Ga0395901_0064881 | Ga0395901_0064881_2201_3091 | 292 |
| 429 | 3300038443 | Ga0395901_0327421 | Ga0395901_0327421_450_1340 | 292 |
| 430 | 3300039447 | Ga0436361_0075458 | Ga0436361_0075458_3663_4562 | 292 |
| 431 | 3300039447 | Ga0436361_0086588 | Ga0436361_0086588_2636_3649 | 292 |
| 432 | 3300039447 | Ga0436361_0099372 | Ga0436361_0099372_4250_5128 | 292 |
| 433 | 3300039447 | Ga0436361_0379135 | Ga0436361_0379135_3620_4519 | 292 |
| 434 | 3300039447 | Ga0436361_0481825 | Ga0436361_0481825_743_1642 | 292 |
| 435 | 3300039447 | Ga0436361_0560696 | Ga0436361_0560696_23_916 | 292 |
| 436 | 3300039447 | Ga0436361_0577764 | Ga0436361_0577764_473_1372 | 292 |
| 437 | 3300039447 | Ga0436361_1153033 | Ga0436361_1153033_46_945 | 292 |
| 438 | 3300041408 | Ga0439453_0015626 | Ga0439453_0015626_130_1020 | 292 |
| 439 | 3300042005 | Ga0439448_0001130 | Ga0439448_0001130_1946_2836 | 292 |
| 440 | 3300042007 | Ga0439449_0063778 | Ga0439449_0063778_84_974 | 292 |
| 441 | 3300044656 | Ga0466969_0070575 | Ga0466969_0070575_630_1520 | 292 |
| 442 | 3300044658 | Ga0466972_0012350 | Ga0466972_0012350_989_1879 | 292 |
| 443 | 3300044683 | Ga0466965_0039961 | Ga0466965_0039961_492_1382 | 292 |
| 444 | 3300044683 | Ga0466965_0066902 | Ga0466965_0066902_708_1598 | 292 |
| 445 | 3300044684 | Ga0466966_0038405 | Ga0466966_0038405_574_1464 | 292 |
| 446 | 3300044694 | Ga0466963_0009383 | Ga0466963_0009383_211_1101 | 292 |
| 447 | 3300044706 | Ga0466964_0000992 | Ga0466964_0000992_837_1727 | 292 |
| 448 | 3300044706 | Ga0466964_0001256 | Ga0466964_0001256_3683_4573 | 292 |
| 449 | 3300044719 | Ga0466971_0019600 | Ga0466971_0019600_797_1687 | 292 |
| 450 | 3300044735 | Ga0466968_0001194 | Ga0466968_0001194_5777_6667 | 292 |
| 451 | 3300044842 | Ga0466957_0005465 | Ga0466957_0005465_2552_3442 | 292 |
| 452 | 3300044842 | Ga0466957_0019951 | Ga0466957_0019951_1440_2327 | 292 |
| 453 | 3300045051 | Ga0451576_0730377 | Ga0451576_0730377_79_957 | 292 |
| 454 | 3300045976 | Ga0466967_0318479 | Ga0466967_0318479_316_1206 | 292 |
| 455 | 3300046452 | Ga0495617_003012 | Ga0495617_003012_237_1115 | 292 |
| 456 | 3300046457 | Ga0495590_0000002 | Ga0495590_0000002_56844_57746 | 292 |
| 457 | 3300046460 | Ga0495638_0000367 | Ga0495638_0000367_18916_19818 | 292 |
| 458 | 3300046460 | Ga0495638_0102593 | Ga0495638_0102593_221_1120 | 292 |
| 459 | 3300046471 | Ga0495650_0000224 | Ga0495650_0000224_44807_45694 | 292 |
| 460 | 3300046471 | Ga0495650_0000521 | Ga0495650_0000521_50366_51265 | 292 |
| 461 | 3300046471 | Ga0495650_0000631 | Ga0495650_0000631_40356_41243 | 292 |
| 462 | 3300046471 | Ga0495650_0005201 | Ga0495650_0005201_758_1657 | 292 |
| 463 | 3300046471 | Ga0495650_0014288 | Ga0495650_0014288_1822_2715 | 292 |
| 464 | 3300046471 | Ga0495650_0045766 | Ga0495650_0045766_34_933 | 292 |
| 465 | 3300046474 | Ga0495605_0000028 | Ga0495605_0000028_8956_9855 | 292 |
| 466 | 3300046474 | Ga0495605_0000325 | Ga0495605_0000325_19698_20588 | 292 |
| 467 | 3300046491 | Ga0495584_0001517 | Ga0495584_0001517_3774_4664 | 292 |
| 468 | 3300046492 | Ga0495585_0004455 | Ga0495585_0004455_2675_3613 | 292 |
| 469 | 3300046500 | Ga0495596_0004429 | Ga0495596_0004429_2710_3597 | 292 |
| 470 | 3300046500 | Ga0495596_0019756 | Ga0495596_0019756_470_1354 | 292 |
| 471 | 3300046501 | Ga0495607_0004790 | Ga0495607_0004790_3909_4808 | 292 |
| 472 | 3300046501 | Ga0495607_0008801 | Ga0495607_0008801_3621_4511 | 292 |
| 473 | 3300046506 | Ga0495583_0000741 | Ga0495583_0000741_5481_6383 | 292 |
| 474 | 3300046506 | Ga0495583_0045206 | Ga0495583_0045206_998_1882 | 292 |
| 475 | 3300046507 | Ga0495606_0000001 | Ga0495606_0000001_570879_571778 | 292 |
| 476 | 3300046507 | Ga0495606_0000526 | Ga0495606_0000526_3672_4577 | 292 |
| 477 | 3300046507 | Ga0495606_0001009 | Ga0495606_0001009_28016_28915 | 292 |
| 478 | 3300046507 | Ga0495606_0008453 | Ga0495606_0008453_5216_6094 | 292 |
| 479 | 3300046507 | Ga0495606_0010586 | Ga0495606_0010586_3548_4447 | 292 |
| 480 | 3300046507 | Ga0495606_0027916 | Ga0495606_0027916_471_1355 | 292 |
| 481 | 3300046507 | Ga0495606_0029465 | Ga0495606_0029465_88_978 | 292 |
| 482 | 3300046507 | Ga0495606_0085182 | Ga0495606_0085182_274_1164 | 292 |
| 483 | 3300046512 | Ga0495610_0000106 | Ga0495610_0000106_29393_30292 | 292 |
| 484 | 3300046512 | Ga0495610_0003952 | Ga0495610_0003952_10190_11068 | 292 |
| 485 | 3300046512 | Ga0495610_0004909 | Ga0495610_0004909_3727_4623 | 292 |
| 486 | 3300046512 | Ga0495610_0013556 | Ga0495610_0013556_2848_3747 | 292 |
| 487 | 3300046513 | Ga0495616_0000316 | Ga0495616_0000316_16461_17360 | 292 |
| 488 | 3300046513 | Ga0495616_0074419 | Ga0495616_0074419_510_1400 | 292 |
| 489 | 3300046519 | Ga0495632_0000725 | Ga0495632_0000725_3772_4659 | 292 |
| 490 | 3300046519 | Ga0495632_0007105 | Ga0495632_0007105_2221_3111 | 292 |
| 491 | 3300046520 | Ga0495637_0008922 | Ga0495637_0008922_1003_1902 | 292 |
| 492 | 3300046522 | Ga0495643_0000444 | Ga0495643_0000444_5404_6300 | 292 |
| 493 | 3300046522 | Ga0495643_0000643 | Ga0495643_0000643_35337_36239 | 292 |
| 494 | 3300046522 | Ga0495643_0000777 | Ga0495643_0000777_7522_8412 | 292 |
| 495 | 3300046522 | Ga0495643_0001278 | Ga0495643_0001278_6831_7730 | 292 |
| 496 | 3300046522 | Ga0495643_0003064 | Ga0495643_0003064_8600_9490 | 292 |
| 497 | 3300046522 | Ga0495643_0049890 | Ga0495643_0049890_635_1522 | 292 |
| 498 | 3300046524 | Ga0495648_0000037 | Ga0495648_0000037_3624_4526 | 292 |
| 499 | 3300046524 | Ga0495648_0002410 | Ga0495648_0002410_5749_6636 | 292 |
| 500 | 3300046524 | Ga0495648_0007092 | Ga0495648_0007092_1218_2108 | 292 |
| 501 | 3300046524 | Ga0495648_0009168 | Ga0495648_0009168_5334_6230 | 292 |
| 502 | 3300046528 | Ga0495642_0000386 | Ga0495642_0000386_22367_23257 | 292 |
| 503 | 3300046528 | Ga0495642_0009306 | Ga0495642_0009306_67_960 | 292 |
| 504 | 3300046528 | Ga0495642_0027357 | Ga0495642_0027357_226_1116 | 292 |
| 505 | 3300046530 | Ga0495654_0012233 | Ga0495654_0012233_115_1053 | 292 |
| 506 | 3300046538 | Ga0495609_0000039 | Ga0495609_0000039_155660_156550 | 292 |
| 507 | 3300046538 | Ga0495609_0000730 | Ga0495609_0000730_17964_18851 | 292 |
| 508 | 3300046538 | Ga0495609_0001009 | Ga0495609_0001009_15537_16439 | 292 |
| 509 | 3300046538 | Ga0495609_0008314 | Ga0495609_0008314_411_1307 | 292 |
| 510 | 3300046542 | Ga0495597_0000327 | Ga0495597_0000327_35291_36187 | 292 |
| 511 | 3300046542 | Ga0495597_0000874 | Ga0495597_0000874_18920_19822 | 292 |
| 512 | 3300046542 | Ga0495597_0042045 | Ga0495597_0042045_988_1881 | 292 |
| 513 | 3300046542 | Ga0495597_0077321 | Ga0495597_0077321_351_1232 | 292 |
| 514 | 3300046557 | Ga0495622_0002083 | Ga0495622_0002083_3644_4546 | 292 |
| 515 | 3300046558 | Ga0495633_0000244 | Ga0495633_0000244_35470_36360 | 292 |
| 516 | 3300046558 | Ga0495633_0000433 | Ga0495633_0000433_19140_20042 | 292 |
| 517 | 3300046558 | Ga0495633_0007472 | Ga0495633_0007472_625_1518 | 292 |
| 518 | 3300046616 | Ga0495668_0000241 | Ga0495668_0000241_24350_25249 | 292 |
| 519 | 3300046616 | Ga0495668_0002017 | Ga0495668_0002017_5345_6247 | 292 |
| 520 | 3300046616 | Ga0495668_0003173 | Ga0495668_0003173_8023_8910 | 292 |
| 521 | 3300046616 | Ga0495668_0003228 | Ga0495668_0003228_7822_8760 | 292 |
| 522 | 3300046616 | Ga0495668_0005941 | Ga0495668_0005941_2300_3199 | 292 |
| 523 | 3300046616 | Ga0495668_0148792 | Ga0495668_0148792_164_1057 | 292 |
| 524 | 3300046660 | Ga0495625_0002538 | Ga0495625_0002538_6165_7052 | 292 |
| 525 | 3300046660 | Ga0495625_0006115 | Ga0495625_0006115_2980_3879 | 292 |
| 526 | 3300046660 | Ga0495625_0006849 | Ga0495625_0006849_5541_6443 | 292 |
| 527 | 3300046660 | Ga0495625_0010538 | Ga0495625_0010538_6415_7356 | 292 |
| 528 | 3300046660 | Ga0495625_0018274 | Ga0495625_0018274_4036_4932 | 292 |
| 529 | 3300046665 | Ga0495661_0000903 | Ga0495661_0000903_3588_4478 | 292 |
| 530 | 3300046665 | Ga0495661_0001155 | Ga0495661_0001155_13161_14054 | 292 |
| 531 | 3300046665 | Ga0495661_0003555 | Ga0495661_0003555_7518_8408 | 292 |
| 532 | 3300046665 | Ga0495661_0019219 | Ga0495661_0019219_975_1913 | 292 |
| 533 | 3300046665 | Ga0495661_0021310 | Ga0495661_0021310_945_1835 | 292 |
| 534 | 3300046674 | Ga0495588_0000110 | Ga0495588_0000110_90985_91875 | 292 |
| 535 | 3300046692 | Ga0495671_0000006 | Ga0495671_0000006_436476_437375 | 292 |
| 536 | 3300046692 | Ga0495671_0008804 | Ga0495671_0008804_187_1125 | 292 |
| 537 | 3300046694 | Ga0495649_0009011 | Ga0495649_0009011_3599_4495 | 292 |
| 538 | 3300046694 | Ga0495649_0024838 | Ga0495649_0024838_1429_2316 | 292 |
| 539 | 3300046794 | Ga0495589_0000019 | Ga0495589_0000019_157431_158321 | 292 |
| 540 | 3300046794 | Ga0495589_0000828 | Ga0495589_0000828_7590_8480 | 292 |
| 541 | 3300046794 | Ga0495589_0030098 | Ga0495589_0030098_1073_1960 | 292 |
| 542 | 3300046810 | Ga0495660_0000572 | Ga0495660_0000572_3662_4552 | 292 |
| 543 | 3300046810 | Ga0495660_0006376 | Ga0495660_0006376_5146_6084 | 292 |
| 544 | 3300047320 | Ga0495672_0000753 | Ga0495672_0000753_29378_30274 | 292 |
| 545 | 3300047320 | Ga0495672_0003317 | Ga0495672_0003317_8734_9621 | 292 |
| 546 | 3300047323 | Ga0495683_0014326 | Ga0495683_0014326_1309_2196 | 292 |
| 547 | 3300047323 | Ga0495683_0038841 | Ga0495683_0038841_1041_1925 | 292 |
| 548 | 3300047443 | Ga0495687_000059 | Ga0495687_000059_155660_156550 | 292 |
| 549 | 3300047443 | Ga0495687_005463 | Ga0495687_005463_7112_8002 | 292 |
| 550 | 3300047443 | Ga0495687_005550 | Ga0495687_005550_7028_7918 | 292 |
| 551 | 3300047445 | Ga0495677_0000006 | Ga0495677_0000006_42681_43571 | 292 |
| 552 | 3300047445 | Ga0495677_0000347 | Ga0495677_0000347_750_1637 | 292 |
| 553 | 3300047445 | Ga0495677_0003237 | Ga0495677_0003237_3584_4474 | 292 |
| 554 | 3300047469 | Ga0495673_0000003 | Ga0495673_0000003_710626_711525 | 292 |
| 555 | 3300047469 | Ga0495673_0000351 | Ga0495673_0000351_47965_48903 | 292 |
| 556 | 3300047470 | Ga0495681_0010860 | Ga0495681_0010860_928_1812 | 292 |
| 557 | 3300047472 | Ga0495686_0000318 | Ga0495686_0000318_43425_44312 | 292 |
| 558 | 3300047472 | Ga0495686_0001447 | Ga0495686_0001447_8271_9158 | 292 |
| 559 | 3300047472 | Ga0495686_0009673 | Ga0495686_0009673_5032_5931 | 292 |
| 560 | 3300047472 | Ga0495686_0080948 | Ga0495686_0080948_342_1280 | 292 |
| 561 | 3300048091 | Ga0495626_0000103 | Ga0495626_0000103_84908_85798 | 292 |
| 562 | 3300048091 | Ga0495626_0000902 | Ga0495626_0000902_3587_4477 | 292 |
| 563 | 3300048091 | Ga0495626_0015496 | Ga0495626_0015496_948_1835 | 292 |
| 564 | 3300048091 | Ga0495626_0042565 | Ga0495626_0042565_430_1329 | 292 |
| 565 | 3300048905 | Ga0496102_0000064 | Ga0496102_0000064_7494_8399 | 292 |
| 566 | 3300048906 | Ga0496103_0075367 | Ga0496103_0075367_858_1763 | 292 |
| 567 | 3300048907 | Ga0496104_0644534 | Ga0496104_0644534_54_944 | 292 |
| 568 | 3300048909 | Ga0496106_0008358 | Ga0496106_0008358_4538_5428 | 292 |
| 569 | 3300048910 | Ga0496107_0017885 | Ga0496107_0017885_1098_1988 | 292 |
| 570 | 3300048914 | Ga0496111_0012430 | Ga0496111_0012430_4090_4983 | 292 |
| 571 | 3300048916 | Ga0496113_0002265 | Ga0496113_0002265_6792_7682 | 292 |
| 572 | 3300048919 | Ga0496116_0023412 | Ga0496116_0023412_3451_4350 | 292 |
| 573 | 3300048919 | Ga0496116_0084815 | Ga0496116_0084815_501_1388 | 292 |
| 574 | 3300048920 | Ga0496117_0000094 | Ga0496117_0000094_135185_136078 | 292 |
| 575 | 3300048920 | Ga0496117_0246570 | Ga0496117_0246570_53_940 | 292 |
| 576 | 3300048921 | Ga0496118_0000071 | Ga0496118_0000071_135185_136078 | 292 |
| 577 | 3300048921 | Ga0496118_0095020 | Ga0496118_0095020_826_1713 | 292 |
| 578 | 3300048923 | Ga0496120_0020559 | Ga0496120_0020559_708_1607 | 292 |
| 579 | 3300048924 | Ga0496121_0013966 | Ga0496121_0013966_3602_4495 | 292 |
| 580 | 3300048924 | Ga0496121_0014140 | Ga0496121_0014140_3159_4103 | 292 |
| 581 | 3300048924 | Ga0496121_0022940 | Ga0496121_0022940_3649_4536 | 292 |
| 582 | 3300048924 | Ga0496121_0047108 | Ga0496121_0047108_1458_2357 | 292 |
| 583 | 3300048924 | Ga0496121_0050060 | Ga0496121_0050060_2244_3137 | 292 |
| 584 | 3300048924 | Ga0496121_0160111 | Ga0496121_0160111_679_1566 | 292 |
| 585 | 3300048925 | Ga0496122_0000134 | Ga0496122_0000134_134419_135360 | 292 |
| 586 | 3300048925 | Ga0496122_0003153 | Ga0496122_0003153_14230_15117 | 292 |
| 587 | 3300048925 | Ga0496122_0009932 | Ga0496122_0009932_2399_3292 | 292 |
| 588 | 3300048925 | Ga0496122_0011074 | Ga0496122_0011074_1242_2132 | 292 |
| 589 | 3300048925 | Ga0496122_0020099 | Ga0496122_0020099_1416_2306 | 292 |
| 590 | 3300048925 | Ga0496122_0092505 | Ga0496122_0092505_92_991 | 292 |
| 591 | 3300048925 | Ga0496122_0248064 | Ga0496122_0248064_36_935 | 292 |
| 592 | 3300048926 | Ga0496123_0000295 | Ga0496123_0000295_41100_41987 | 292 |
| 593 | 3300048926 | Ga0496123_0000307 | Ga0496123_0000307_60124_61065 | 292 |
| 594 | 3300048926 | Ga0496123_0001494 | Ga0496123_0001494_20652_21551 | 292 |
| 595 | 3300048926 | Ga0496123_0002403 | Ga0496123_0002403_4999_5892 | 292 |
| 596 | 3300048926 | Ga0496123_0012610 | Ga0496123_0012610_1064_1954 | 292 |
| 597 | 3300048926 | Ga0496123_0023302 | Ga0496123_0023302_513_1403 | 292 |
| 598 | 3300048927 | Ga0496124_0004010 | Ga0496124_0004010_9199_10089 | 292 |
| 599 | 3300048927 | Ga0496124_0055192 | Ga0496124_0055192_2260_3159 | 292 |
| 600 | 3300048928 | Ga0496125_0004153 | Ga0496125_0004153_14999_15940 | 292 |
| 601 | 3300048928 | Ga0496125_0009913 | Ga0496125_0009913_5542_6429 | 292 |
| 602 | 3300048928 | Ga0496125_0011136 | Ga0496125_0011136_3112_3999 | 292 |
| 603 | 3300048928 | Ga0496125_0069690 | Ga0496125_0069690_453_1394 | 292 |
| 604 | 3300048928 | Ga0496125_0188167 | Ga0496125_0188167_406_1299 | 292 |
| 605 | 3300048929 | Ga0496126_0008452 | Ga0496126_0008452_8644_9543 | 292 |
| 606 | 3300049459 | Ga0495678_000391 | Ga0495678_000391_29741_30625 | 292 |
| 607 | 3300049459 | Ga0495678_003514 | Ga0495678_003514_5146_6042 | 292 |
| 608 | 3300049459 | Ga0495678_003907 | Ga0495678_003907_5052_5954 | 292 |
| 609 | 3300049459 | Ga0495678_008263 | Ga0495678_008263_1850_2752 | 292 |
| 610 | 3300049459 | Ga0495678_011038 | Ga0495678_011038_1192_2079 | 292 |
| 611 | 3300049460 | Ga0495682_0000342 | Ga0495682_0000342_3728_4612 | 292 |
| 612 | 3300049460 | Ga0495682_0010160 | Ga0495682_0010160_2252_3145 | 292 |
| 613 | 3300049572 | Ga0501036_0028042 | Ga0501036_0028042_229_1119 | 292 |
| 614 | 3300049822 | Ga0501035_0001779 | Ga0501035_0001779_6433_7323 | 292 |
| 615 | 3300049823 | Ga0501044_0225798 | Ga0501044_0225798_526_1416 | 292 |
| 616 | 3300053125 | Ga0500618_000660 | Ga0500618_000660_15307_16341 | 292 |
| 617 | 3300053125 | Ga0500618_000824 | Ga0500618_000824_11281_12207 | 292 |
| 618 | 3300059641 | Ga0587068_005051 | Ga0587068_005051_317_1207 | 292 |
| 619 | 3300061719 | Ga0466962_0066246 | Ga0466962_0066246_335_1225 | 292 |
| 620 | iso_pu_bacteria | 2513020051 | 2513227688 | 292 |
| 621 | iso_pu_bacteria | 2599185214 | 2599625615 | 292 |
| 622 | iso_pu_bacteria | 2599185226 | 2599673628 | 292 |
| 623 | iso_pu_bacteria | 2599185227 | 2599683298 | 292 |
| 624 | iso_pu_bacteria | 2599185229 | 2599695214 | 292 |
| 625 | iso_pu_bacteria | 2643221628 | 2644162296 | 292 |
| 626 | iso_pu_bacteria | 2643221658 | 2644324457 | 292 |
| 627 | iso_pu_bacteria | 2643221672 | 2644396298 | 292 |
| 628 | iso_pu_bacteria | 2738541277 | 2738719201 | 292 |
| 629 | iso_pu_bacteria | 2738541307 | 2738880222 | 292 |
| 630 | iso_pu_bacteria | 2738543013 | 2739248079 | 292 |
| 631 | iso_pu_bacteria | 2738543019 | 2739281963 | 292 |
| 632 | iso_pu_bacteria | 2818991446 | 2819599702 | 292 |
| 633 | iso_pu_bacteria | 2831265667 | 2831271765 | 292 |
| 634 | iso_pu_bacteria | 2838054893 | 2838055614 | 292 |
| 635 | iso_pu_bacteria | 2842677519 | 2842682663 | 292 |
| 636 | iso_pu_bacteria | 2885192300 | 2885194778 | 292 |
| 637 | iso_pu_bacteria | 2885198086 | 2885200852 | 292 |
| 638 | iso_pu_bacteria | 2885211737 | 2885214365 | 292 |
| 639 | iso_pu_bacteria | 2899924645 | 2899927665 | 292 |
| 640 | iso_pu_bacteria | 2904449895 | 2904450633 | 292 |
| 641 | iso_pu_bacteria | 2904456579 | 2904459867 | 292 |
| 642 | iso_pu_bacteria | 2904541872 | 2904549834 | 292 |
| 643 | iso_pu_bacteria | 2919462493 | 2919462838 | 292 |
| 644 | iso_pu_bacteria | 2928037797 | 2928042058 | 292 |
| 645 | iso_pu_bacteria | 2928044640 | 2928049622 | 292 |
| 646 | iso_pu_bacteria | 2928051484 | 2928051704 | 292 |
| 647 | iso_pu_bacteria | 2928064002 | 2928065605 | 292 |
| 648 | iso_pu_bacteria | 2928070936 | 2928073072 | 292 |
| 649 | iso_pu_bacteria | 2928084124 | 2928086859 | 292 |
| 650 | iso_pu_bacteria | 2929160207 | 2929161804 | 292 |
| 651 | iso_pu_bacteria | 2929520902 | 2929521350 | 292 |
| 652 | iso_pu_bacteria | 2945972063 | 2945973408 | 292 |
| 653 | iso_pu_bacteria | 2945984333 | 2945990801 | 292 |
| 654 | iso_pu_bacteria | 2954767861 | 2954770990 | 292 |
| 655 | iso_pu_bacteria | 2643221683 | 2644464660 | 293 |
| 656 | 3300005353 | Ga0070669_100177227 | Ga0070669_1001772272 | 295 |
| 657 | 3300005548 | Ga0070665_100068370 | Ga0070665_1000683702 | 295 |
| 658 | 3300048919 | Ga0496116_0064515 | Ga0496116_0064515_802_1689 | 295 |
| 659 | 3300048925 | Ga0496122_0000063 | Ga0496122_0000063_67524_68411 | 295 |
| 660 | 3300048926 | Ga0496123_0000045 | Ga0496123_0000045_117949_118836 | 295 |
| 661 | 3300048926 | Ga0496123_0096810 | Ga0496123_0096810_437_1324 | 295 |
| 662 | 3300048927 | Ga0496124_0025846 | Ga0496124_0025846_4046_4933 | 295 |
| 663 | 3300049571 | Ga0501034_0266575 | Ga0501034_0266575_333_1220 | 295 |
| 664 | 3300053090 | Ga0500646_0023099 | Ga0500646_0023099_29_916 | 295 |
| 665 | 3300053093 | Ga0500651_0053665 | Ga0500651_0053665_286_1173 | 295 |
| 666 | 3300053136 | Ga0500559_0012473 | Ga0500559_0012473_363_1250 | 295 |
| 667 | 3300053156 | Ga0500622_0068864 | Ga0500622_0068864_413_1300 | 295 |
| 668 | 2162886007 | SwRhRL2b_contig_2752670 | SwRhRL2b_0788.00002700 | 296 |
| 669 | 3300002774 | JGI25150J39212_1002850 | JGI25150J39212_10028502 | 296 |
| 670 | 3300003374 | JGI25161J50226_1005205 | JGI25161J50226_10052053 | 296 |
| 671 | 3300003374 | JGI25161J50226_1005307 | JGI25161J50226_10053074 | 296 |
| 672 | 3300003578 | Ga0006562J51391_1018386 | Ga0006562J51391_10183862 | 296 |
| 673 | 3300003762 | Ga0055542_1000022 | Ga0055542_1000022167 | 296 |
| 674 | 3300003773 | Ga0055537_1000134 | Ga0055537_100013419 | 296 |
| 675 | 3300003781 | Ga0055536_1004046 | Ga0055536_10040468 | 296 |
| 676 | 3300003784 | Ga0055534_1000088 | Ga0055534_100008819 | 296 |
| 677 | 3300003790 | Ga0055528_1000630 | Ga0055528_100063018 | 296 |
| 678 | 3300003790 | Ga0055528_1011813 | Ga0055528_10118132 | 296 |
| 679 | 3300003791 | Ga0055530_10000962 | Ga0055530_100009622 | 296 |
| 680 | 3300003792 | Ga0055540_1003446 | Ga0055540_10034462 | 296 |
| 681 | 3300003792 | Ga0055540_1008455 | Ga0055540_10084552 | 296 |
| 682 | 3300003794 | Ga0055531_10002924 | Ga0055531_100029242 | 296 |
| 683 | 3300005289 | Ga0065704_10085515 | Ga0065704_100855152 | 296 |
| 684 | 3300005356 | Ga0070674_100052535 | Ga0070674_1000525353 | 296 |
| 685 | 3300005455 | Ga0070663_100154381 | Ga0070663_1001543813 | 296 |
| 686 | 3300005456 | Ga0070678_100038770 | Ga0070678_1000387702 | 296 |
| 687 | 3300005457 | Ga0070662_100028288 | Ga0070662_1000282882 | 296 |
| 688 | 3300005459 | Ga0068867_100179652 | Ga0068867_1001796522 | 296 |
| 689 | 3300005548 | Ga0070665_100024888 | Ga0070665_1000248888 | 296 |
| 690 | 3300005548 | Ga0070665_100653291 | Ga0070665_1006532912 | 296 |
| 691 | 3300005563 | Ga0068855_100144470 | Ga0068855_1001444704 | 296 |
| 692 | 3300005577 | Ga0068857_100042395 | Ga0068857_1000423955 | 296 |
| 693 | 3300005834 | Ga0068851_10033206 | Ga0068851_100332062 | 296 |
| 694 | 3300006048 | Ga0075363_100024393 | Ga0075363_1000243934 | 296 |
| 695 | 3300006051 | Ga0075364_10096102 | Ga0075364_100961023 | 296 |
| 696 | 3300006177 | Ga0075362_10013049 | Ga0075362_100130494 | 296 |
| 697 | 3300006195 | Ga0075366_10024573 | Ga0075366_100245732 | 296 |
| 698 | 3300006195 | Ga0075366_10026719 | Ga0075366_100267192 | 296 |
| 699 | 3300006195 | Ga0075366_10051626 | Ga0075366_100516262 | 296 |
| 700 | 3300006353 | Ga0075370_10034392 | Ga0075370_100343923 | 296 |
| 701 | 3300006353 | Ga0075370_10126922 | Ga0075370_101269221 | 296 |
| 702 | 3300006353 | Ga0075370_10150195 | Ga0075370_101501951 | 296 |
| 703 | 3300006946 | Ga0079104_1029369 | Ga0079104_10293692 | 296 |
| 704 | 3300006948 | Ga0099826_10001370 | Ga0099826_1000137015 | 296 |
| 705 | 3300009036 | Ga0105244_10012570 | Ga0105244_100125702 | 296 |
| 706 | 3300009148 | Ga0105243_10006758 | Ga0105243_1000675810 | 296 |
| 707 | 3300009148 | Ga0105243_10009873 | Ga0105243_100098738 | 296 |
| 708 | 3300009174 | Ga0105241_10165016 | Ga0105241_101650162 | 296 |
| 709 | 3300009176 | Ga0105242_10102178 | Ga0105242_101021782 | 296 |
| 710 | 3300009176 | Ga0105242_10104410 | Ga0105242_101044102 | 296 |
| 711 | 3300009551 | Ga0105238_10064300 | Ga0105238_100643004 | 296 |
| 712 | 3300009551 | Ga0105238_10145333 | Ga0105238_101453332 | 296 |
| 713 | 3300010375 | Ga0105239_10252868 | Ga0105239_102528682 | 296 |
| 714 | 3300011119 | Ga0105246_10051565 | Ga0105246_100515652 | 296 |
| 715 | 3300013100 | Ga0157373_10068307 | Ga0157373_100683072 | 296 |
| 716 | 3300013100 | Ga0157373_10074161 | Ga0157373_100741612 | 296 |
| 717 | 3300013102 | Ga0157371_10134905 | Ga0157371_101349051 | 296 |
| 718 | 3300013104 | Ga0157370_10039005 | Ga0157370_100390054 | 296 |
| 719 | 3300013105 | Ga0157369_10007881 | Ga0157369_1000788110 | 296 |
| 720 | 3300013306 | Ga0163162_10027211 | Ga0163162_100272117 | 296 |
| 721 | 3300013307 | Ga0157372_10201211 | Ga0157372_102012112 | 296 |
| 722 | 3300014497 | Ga0182008_10002427 | Ga0182008_1000242713 | 296 |
| 723 | 3300014497 | Ga0182008_10006865 | Ga0182008_100068652 | 296 |
| 724 | 3300014497 | Ga0182008_10011104 | Ga0182008_100111042 | 296 |
| 725 | 3300014497 | Ga0182008_10016496 | Ga0182008_100164962 | 296 |
| 726 | 3300015261 | Ga0182006_1001570 | Ga0182006_10015702 | 296 |
| 727 | 3300015261 | Ga0182006_1012894 | Ga0182006_10128942 | 296 |
| 728 | 3300015262 | Ga0182007_10001908 | Ga0182007_1000190812 | 296 |
| 729 | 3300015262 | Ga0182007_10003300 | Ga0182007_100033002 | 296 |
| 730 | 3300015265 | Ga0182005_1016651 | Ga0182005_10166514 | 296 |
| 731 | 3300015683 | Ga0183362_10005 | Ga0183362_10005419 | 296 |
| 732 | 3300017792 | Ga0163161_10020171 | Ga0163161_100201712 | 296 |
| 733 | 3300017792 | Ga0163161_10065072 | Ga0163161_100650722 | 296 |
| 734 | 3300025228 | Ga0209672_101007 | Ga0209672_1010077 | 296 |
| 735 | 3300025229 | Ga0209147_103626 | Ga0209147_1036264 | 296 |
| 736 | 3300025242 | Ga0209258_100009 | Ga0209258_100009830 | 296 |
| 737 | 3300025254 | Ga0209148_1000007 | Ga0209148_1000007830 | 296 |
| 738 | 3300025258 | Ga0209129_1000024 | Ga0209129_1000024241 | 296 |
| 739 | 3300025258 | Ga0209129_1000085 | Ga0209129_100008521 | 296 |
| 740 | 3300025258 | Ga0209129_1005702 | Ga0209129_10057022 | 296 |
| 741 | 3300025263 | Ga0209565_1000046 | Ga0209565_1000046136 | 296 |
| 742 | 3300025273 | Ga0209673_1000058 | Ga0209673_100005842 | 296 |
| 743 | 3300025273 | Ga0209673_1010330 | Ga0209673_10103302 | 296 |
| 744 | 3300025273 | Ga0209673_1010835 | Ga0209673_10108352 | 296 |
| 745 | 3300025284 | Ga0209130_1002262 | Ga0209130_10022627 | 296 |
| 746 | 3300025291 | Ga0209675_1000010 | Ga0209675_1000010223 | 296 |
| 747 | 3300025291 | Ga0209675_1005766 | Ga0209675_10057662 | 296 |
| 748 | 3300025292 | Ga0209676_1000028 | Ga0209676_100002898 | 296 |
| 749 | 3300025292 | Ga0209676_1000098 | Ga0209676_1000098192 | 296 |
| 750 | 3300025292 | Ga0209676_1000173 | Ga0209676_1000173101 | 296 |
| 751 | 3300025292 | Ga0209676_1000194 | Ga0209676_100019435 | 296 |
| 752 | 3300025292 | Ga0209676_1041817 | Ga0209676_10418171 | 296 |
| 753 | 3300025292 | Ga0209676_1049270 | Ga0209676_10492701 | 296 |
| 754 | 3300025294 | Ga0209025_1000122 | Ga0209025_100012220 | 296 |
| 755 | 3300025294 | Ga0209025_1000404 | Ga0209025_100040412 | 296 |
| 756 | 3300025294 | Ga0209025_1002394 | Ga0209025_100239414 | 296 |
| 757 | 3300025294 | Ga0209025_1019136 | Ga0209025_10191364 | 296 |
| 758 | 3300025295 | Ga0209564_1000183 | Ga0209564_100018397 | 296 |
| 759 | 3300025295 | Ga0209564_1000198 | Ga0209564_100019887 | 296 |
| 760 | 3300025297 | Ga0209758_1000049 | Ga0209758_1000049160 | 296 |
| 761 | 3300025298 | Ga0209050_1000002 | Ga0209050_1000002145 | 296 |
| 762 | 3300025298 | Ga0209050_1000122 | Ga0209050_1000122133 | 296 |
| 763 | 3300025298 | Ga0209050_1000554 | Ga0209050_100055454 | 296 |
| 764 | 3300025298 | Ga0209050_1005757 | Ga0209050_100575710 | 296 |
| 765 | 3300025299 | Ga0209256_1000098 | Ga0209256_1000098162 | 296 |
| 766 | 3300025299 | Ga0209256_1000140 | Ga0209256_100014097 | 296 |
| 767 | 3300025302 | Ga0207426_1000038 | Ga0207426_1000038162 | 296 |
| 768 | 3300025302 | Ga0207426_1000053 | Ga0207426_1000053196 | 296 |
| 769 | 3300025303 | Ga0209051_1000015 | Ga0209051_100001527 | 296 |
| 770 | 3300025303 | Ga0209051_1000159 | Ga0209051_100015920 | 296 |
| 771 | 3300025303 | Ga0209051_1000194 | Ga0209051_100019419 | 296 |
| 772 | 3300025303 | Ga0209051_1000282 | Ga0209051_100028247 | 296 |
| 773 | 3300025303 | Ga0209051_1000597 | Ga0209051_100059710 | 296 |
| 774 | 3300025303 | Ga0209051_1014777 | Ga0209051_10147774 | 296 |
| 775 | 3300025304 | Ga0209257_1000002 | Ga0209257_100000254 | 296 |
| 776 | 3300025304 | Ga0209257_1004288 | Ga0209257_100428811 | 296 |
| 777 | 3300025321 | Ga0207656_10010157 | Ga0207656_100101572 | 296 |
| 778 | 3300025728 | Ga0207655_1002288 | Ga0207655_100228813 | 296 |
| 779 | 3300025924 | Ga0207694_10075465 | Ga0207694_100754652 | 296 |
| 780 | 3300025924 | Ga0207694_10158047 | Ga0207694_101580473 | 296 |
| 781 | 3300025933 | Ga0207706_10025112 | Ga0207706_100251126 | 296 |
| 782 | 3300025934 | Ga0207686_10057268 | Ga0207686_100572682 | 296 |
| 783 | 3300025934 | Ga0207686_10126524 | Ga0207686_101265242 | 296 |
| 784 | 3300025935 | Ga0207709_10000285 | Ga0207709_1000028510 | 296 |
| 785 | 3300025935 | Ga0207709_10004960 | Ga0207709_100049602 | 296 |
| 786 | 3300025935 | Ga0207709_10058461 | Ga0207709_100584612 | 296 |
| 787 | 3300025949 | Ga0207667_10099953 | Ga0207667_100999532 | 296 |
| 788 | 3300025960 | Ga0207651_10457643 | Ga0207651_104576431 | 296 |
| 789 | 3300025986 | Ga0207658_10302372 | Ga0207658_103023723 | 296 |
| 790 | 3300026041 | Ga0207639_10010174 | Ga0207639_100101742 | 296 |
| 791 | 3300026041 | Ga0207639_10379058 | Ga0207639_103790581 | 296 |
| 792 | 3300026067 | Ga0207678_10287145 | Ga0207678_102871453 | 296 |
| 793 | 3300026089 | Ga0207648_10263216 | Ga0207648_102632162 | 296 |
| 794 | 3300026121 | Ga0207683_10166283 | Ga0207683_101662832 | 296 |
| 795 | 3300026121 | Ga0207683_10175634 | Ga0207683_101756342 | 296 |
| 796 | 3300027666 | Ga0209282_1001079 | Ga0209282_10010797 | 296 |
| 797 | 3300027907 | Ga0207428_10117068 | Ga0207428_101170682 | 296 |
| 798 | 3300028379 | Ga0268266_10324922 | Ga0268266_103249223 | 296 |
| 799 | 3300028380 | Ga0268265_10015308 | Ga0268265_100153083 | 296 |
| 800 | 3300028794 | Ga0307515_10012653 | Ga0307515_100126538 | 296 |
| 801 | 3300030731 | Ga0316177_1117067 | Ga0316177_11170672 | 296 |
| 802 | 3300030732 | Ga0316176_1072478 | Ga0316176_10724782 | 296 |
| 803 | 3300030733 | Ga0314311_1059701 | Ga0314311_10597011 | 296 |
| 804 | 3300030735 | Ga0316178_1142965 | Ga0316178_11429655 | 296 |
| 805 | 3300030736 | Ga0316180_1061916 | Ga0316180_10619161 | 296 |
| 806 | 3300030742 | Ga0316183_1076813 | Ga0316183_10768132 | 296 |
| 807 | 3300030744 | Ga0316181_1034408 | Ga0316181_10344082 | 296 |
| 808 | 3300030745 | Ga0316182_1050266 | Ga0316182_10502662 | 296 |
| 809 | 3300031251 | Ga0265327_10013542 | Ga0265327_100135428 | 296 |
| 810 | 3300031649 | Ga0307514_10024217 | Ga0307514_100242173 | 296 |
| 811 | 3300031731 | Ga0307405_10010853 | Ga0307405_100108532 | 296 |
| 812 | 3300031731 | Ga0307405_10066709 | Ga0307405_100667092 | 296 |
| 813 | 3300031901 | Ga0307406_10001422 | Ga0307406_1000142210 | 296 |
| 814 | 3300031911 | Ga0307412_10033751 | Ga0307412_100337514 | 296 |
| 815 | 3300031911 | Ga0307412_10049150 | Ga0307412_100491503 | 296 |
| 816 | 3300031911 | Ga0307412_10075260 | Ga0307412_100752602 | 296 |
| 817 | 3300032126 | Ga0307415_100418125 | Ga0307415_1004181251 | 296 |
| 818 | 3300041404 | Ga0439436_0000382 | Ga0439436_0000382_9253_10143 | 296 |
| 819 | 3300041404 | Ga0439436_0004185 | Ga0439436_0004185_1094_1984 | 296 |
| 820 | 3300041406 | Ga0439439_0003399 | Ga0439439_0003399_1190_2080 | 296 |
| 821 | 3300041411 | Ga0439466_0001231 | Ga0439466_0001231_7459_8349 | 296 |
| 822 | 3300041411 | Ga0439466_0021970 | Ga0439466_0021970_1089_1979 | 296 |
| 823 | 3300041413 | Ga0439465_0001246 | Ga0439465_0001246_1510_2400 | 296 |
| 824 | 3300041413 | Ga0439465_0015400 | Ga0439465_0015400_1134_2024 | 296 |
| 825 | 3300041997 | Ga0439431_0012337 | Ga0439431_0012337_717_1607 | 296 |
| 826 | 3300041999 | Ga0439433_0002040 | Ga0439433_0002040_950_1840 | 296 |
| 827 | 3300041999 | Ga0439433_0006272 | Ga0439433_0006272_647_1537 | 296 |
| 828 | 3300042002 | Ga0439442_002770 | Ga0439442_002770_988_1878 | 296 |
| 829 | 3300042002 | Ga0439442_013545 | Ga0439442_013545_274_1164 | 296 |
| 830 | 3300042004 | Ga0439445_0000223 | Ga0439445_0000223_826_1716 | 296 |
| 831 | 3300042006 | Ga0439432_001997 | Ga0439432_001997_2413_3303 | 296 |
| 832 | 3300042006 | Ga0439432_002220 | Ga0439432_002220_3083_3973 | 296 |
| 833 | 3300042007 | Ga0439449_0000209 | Ga0439449_0000209_15120_16010 | 296 |
| 834 | 3300042007 | Ga0439449_0000215 | Ga0439449_0000215_6911_7801 | 296 |
| 835 | 3300042007 | Ga0439449_0005047 | Ga0439449_0005047_3807_4697 | 296 |
| 836 | 3300042007 | Ga0439449_0021863 | Ga0439449_0021863_1041_1931 | 296 |
| 837 | 3300042010 | Ga0439452_024773 | Ga0439452_024773_176_1066 | 296 |
| 838 | 3300042014 | Ga0439457_003046 | Ga0439457_003046_1115_2005 | 296 |
| 839 | 3300042015 | Ga0439462_0013469 | Ga0439462_0013469_711_1601 | 296 |
| 840 | 3300042125 | Ga0450923_005020 | Ga0450923_005020_95_985 | 296 |
| 841 | 3300042125 | Ga0450923_016250 | Ga0450923_016250_55_945 | 296 |
| 842 | 3300042135 | Ga0450899_006515 | Ga0450899_006515_322_1212 | 296 |
| 843 | 3300042146 | Ga0450907_005113 | Ga0450907_005113_1253_2143 | 296 |
| 844 | 3300042156 | Ga0439446_0003872 | Ga0439446_0003872_1175_2065 | 296 |
| 845 | 3300042184 | Ga0450908_000697 | Ga0450908_000697_49_939 | 296 |
| 846 | 3300042185 | Ga0450909_003723 | Ga0450909_003723_886_1776 | 296 |
| 847 | 3300042185 | Ga0450909_005523 | Ga0450909_005523_192_1082 | 296 |
| 848 | 3300042435 | Ga0439434_0001906 | Ga0439434_0001906_2715_3605 | 296 |
| 849 | 3300042435 | Ga0439434_0014465 | Ga0439434_0014465_788_1678 | 296 |
| 850 | 3300042531 | Ga0450918_000817 | Ga0450918_000817_580_1470 | 296 |
| 851 | 3300044683 | Ga0466965_0061551 | Ga0466965_0061551_49_939 | 296 |
| 852 | 3300044735 | Ga0466968_0055523 | Ga0466968_0055523_267_1187 | 296 |
| 853 | 3300046453 | Ga0495627_014963 | Ga0495627_014963_1528_2418 | 296 |
| 854 | 3300046460 | Ga0495638_0071080 | Ga0495638_0071080_186_1076 | 296 |
| 855 | 3300046462 | Ga0495651_0224859 | Ga0495651_0224859_346_1236 | 296 |
| 856 | 3300046513 | Ga0495616_0003860 | Ga0495616_0003860_1029_1919 | 296 |
| 857 | 3300046515 | Ga0495620_0004751 | Ga0495620_0004751_2261_3151 | 296 |
| 858 | 3300046517 | Ga0495630_0125540 | Ga0495630_0125540_280_1170 | 296 |
| 859 | 3300046518 | Ga0495631_0011741 | Ga0495631_0011741_1449_2339 | 296 |
| 860 | 3300046520 | Ga0495637_0001872 | Ga0495637_0001872_8790_9680 | 296 |
| 861 | 3300046522 | Ga0495643_0101656 | Ga0495643_0101656_14_904 | 296 |
| 862 | 3300046526 | Ga0495666_0174189 | Ga0495666_0174189_64_954 | 296 |
| 863 | 3300046539 | Ga0495621_0031994 | Ga0495621_0031994_98_988 | 296 |
| 864 | 3300046615 | Ga0495656_0000087 | Ga0495656_0000087_1411_2301 | 296 |
| 865 | 3300046616 | Ga0495668_0056002 | Ga0495668_0056002_928_1818 | 296 |
| 866 | 3300046660 | Ga0495625_0000245 | Ga0495625_0000245_72709_73599 | 296 |
| 867 | 3300046660 | Ga0495625_0062113 | Ga0495625_0062113_810_1700 | 296 |
| 868 | 3300046660 | Ga0495625_0162630 | Ga0495625_0162630_264_1154 | 296 |
| 869 | 3300046663 | Ga0495635_0243158 | Ga0495635_0243158_252_1142 | 296 |
| 870 | 3300046674 | Ga0495588_0007799 | Ga0495588_0007799_2612_3502 | 296 |
| 871 | 3300046680 | Ga0495646_0165249 | Ga0495646_0165249_308_1198 | 296 |
| 872 | 3300046683 | Ga0495658_0020233 | Ga0495658_0020233_129_1019 | 296 |
| 873 | 3300046691 | Ga0495670_0023650 | Ga0495670_0023650_1934_2824 | 296 |
| 874 | 3300046691 | Ga0495670_0103366 | Ga0495670_0103366_560_1450 | 296 |
| 875 | 3300046692 | Ga0495671_0037913 | Ga0495671_0037913_397_1287 | 296 |
| 876 | 3300047321 | Ga0495676_0228246 | Ga0495676_0228246_292_1182 | 296 |
| 877 | 3300048090 | Ga0495615_0008507 | Ga0495615_0008507_354_1244 | 296 |
| 878 | 3300048903 | Ga0496100_0092549 | Ga0496100_0092549_598_1488 | 296 |
| 879 | 3300048904 | Ga0496101_0034301 | Ga0496101_0034301_649_1539 | 296 |
| 880 | 3300048904 | Ga0496101_0036961 | Ga0496101_0036961_617_1507 | 296 |
| 881 | 3300048905 | Ga0496102_0116930 | Ga0496102_0116930_990_1880 | 296 |
| 882 | 3300048906 | Ga0496103_0014373 | Ga0496103_0014373_471_1361 | 296 |
| 883 | 3300048906 | Ga0496103_0094268 | Ga0496103_0094268_124_1014 | 296 |
| 884 | 3300048907 | Ga0496104_0005753 | Ga0496104_0005753_9028_9918 | 296 |
| 885 | 3300048908 | Ga0496105_0035394 | Ga0496105_0035394_741_1631 | 296 |
| 886 | 3300048909 | Ga0496106_0087580 | Ga0496106_0087580_890_1780 | 296 |
| 887 | 3300048910 | Ga0496107_0040214 | Ga0496107_0040214_716_1606 | 296 |
| 888 | 3300048911 | Ga0496108_0293163 | Ga0496108_0293163_66_956 | 296 |
| 889 | 3300048915 | Ga0496112_0267585 | Ga0496112_0267585_363_1253 | 296 |
| 890 | 3300048919 | Ga0496116_0031289 | Ga0496116_0031289_1965_2855 | 296 |
| 891 | 3300048919 | Ga0496116_0087056 | Ga0496116_0087056_342_1232 | 296 |
| 892 | 3300048920 | Ga0496117_0063595 | Ga0496117_0063595_40_930 | 296 |
| 893 | 3300048920 | Ga0496117_0081812 | Ga0496117_0081812_1052_1942 | 296 |
| 894 | 3300048922 | Ga0496119_0050596 | Ga0496119_0050596_728_1618 | 296 |
| 895 | 3300048924 | Ga0496121_0075961 | Ga0496121_0075961_1356_2246 | 296 |
| 896 | 3300048924 | Ga0496121_0080283 | Ga0496121_0080283_784_1674 | 296 |
| 897 | 3300048924 | Ga0496121_0095100 | Ga0496121_0095100_67_957 | 296 |
| 898 | 3300048925 | Ga0496122_0036508 | Ga0496122_0036508_1035_1925 | 296 |
| 899 | 3300048925 | Ga0496122_0111682 | Ga0496122_0111682_317_1207 | 296 |
| 900 | 3300048927 | Ga0496124_0052717 | Ga0496124_0052717_1154_2044 | 296 |
| 901 | 3300048927 | Ga0496124_0083739 | Ga0496124_0083739_705_1595 | 296 |
| 902 | 3300048928 | Ga0496125_0015804 | Ga0496125_0015804_5402_6292 | 296 |
| 903 | 3300048928 | Ga0496125_0045967 | Ga0496125_0045967_877_1767 | 296 |
| 904 | 3300048928 | Ga0496125_0119869 | Ga0496125_0119869_233_1123 | 296 |
| 905 | 3300049705 | Ga0501225_0027047 | Ga0501225_0027047_401_1291 | 296 |
| 906 | 3300049759 | Ga0501262_000532 | Ga0501262_000532_2631_3521 | 296 |
| 907 | 3300050489 | nmdc:mga03683_14532_c1 | nmdc:mga03683_14532_c1_1524_2414 | 296 |
| 908 | 3300050489 | nmdc:mga03683_44068_c1 | nmdc:mga03683_44068_c1_855_1745 | 296 |
| 909 | 3300050489 | nmdc:mga03683_48174_c1 | nmdc:mga03683_48174_c1_53_943 | 296 |
| 910 | 3300050490 | nmdc:mga03n38_22845_c1 | nmdc:mga03n38_22845_c1_1175_2065 | 296 |
| 911 | 3300050491 | nmdc:mga00v17_35099_c1 | nmdc:mga00v17_35099_c1_528_1418 | 296 |
| 912 | 3300050493 | nmdc:mga0k408_11179_c1 | nmdc:mga0k408_11179_c1_2057_2947 | 296 |
| 913 | 3300050493 | nmdc:mga0k408_19690_c1 | nmdc:mga0k408_19690_c1_2215_3105 | 296 |
| 914 | 3300050493 | nmdc:mga0k408_34097_c1 | nmdc:mga0k408_34097_c1_738_1628 | 296 |
| 915 | 3300050494 | nmdc:mga06z11_129231_c1 | nmdc:mga06z11_129231_c1_324_1214 | 296 |
| 916 | 3300050496 | nmdc:mga07m45_2078_c1 | nmdc:mga07m45_2078_c1_1506_2396 | 296 |
| 917 | 3300050496 | nmdc:mga07m45_23737_c1 | nmdc:mga07m45_23737_c1_222_1112 | 296 |
| 918 | 3300050496 | nmdc:mga07m45_9105_c1 | nmdc:mga07m45_9105_c1_3238_4128 | 296 |
| 919 | 3300053079 | Ga0500610_0004823 | Ga0500610_0004823_815_1705 | 296 |
| 920 | 3300053093 | Ga0500651_0000125 | Ga0500651_0000125_38325_39215 | 296 |
| 921 | 3300053096 | Ga0500641_0152769 | Ga0500641_0152769_39_929 | 296 |
| 922 | 3300053110 | Ga0500571_000811 | Ga0500571_000811_5626_6516 | 296 |
| 923 | 3300053111 | Ga0500572_033169 | Ga0500572_033169_43_933 | 296 |
| 924 | 3300053117 | Ga0500593_004926 | Ga0500593_004926_1276_2166 | 296 |
| 925 | 3300053118 | Ga0500594_0013942 | Ga0500594_0013942_840_1730 | 296 |
| 926 | 3300053121 | Ga0500607_007247 | Ga0500607_007247_2616_3506 | 296 |
| 927 | 3300053122 | Ga0500608_010325 | Ga0500608_010325_1649_2539 | 296 |
| 928 | 3300053128 | Ga0500626_015711 | Ga0500626_015711_1375_2265 | 296 |
| 929 | 3300053133 | Ga0500655_002019 | Ga0500655_002019_1499_2389 | 296 |
| 930 | 3300053134 | Ga0500658_0001125 | Ga0500658_0001125_1389_2279 | 296 |
| 931 | 3300053134 | Ga0500658_0002341 | Ga0500658_0002341_3733_4623 | 296 |
| 932 | 3300053139 | Ga0500568_0002512 | Ga0500568_0002512_7260_8150 | 296 |
| 933 | 3300053141 | Ga0500574_002077 | Ga0500574_002077_144_1034 | 296 |
| 934 | 3300053158 | Ga0500627_0001087 | Ga0500627_0001087_846_1736 | 296 |
| 935 | 3300053161 | Ga0500634_0013841 | Ga0500634_0013841_2690_3580 | 296 |
| 936 | 3300053161 | Ga0500634_0015330 | Ga0500634_0015330_1412_2302 | 296 |
| 937 | 3300053162 | Ga0500638_040324 | Ga0500638_040324_991_1881 | 296 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ve7-assembly1.cif.gz_A | crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp | 0.8983 | 7 | 294 |
| 5j49-assembly1.cif.gz_A | crystal structure of udp-glucose pyrophosporylase / utp-glucose-1-phosphate uridylyltransferase from burkholderia xenovorans | 0.8959 | 7 | 292 |
| 5i1f-assembly1.cif.gz_A-2 | crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate-glucose | 0.8943 | 7 | 293 |
| 5ve7-assembly1.cif.gz_A | crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp | 0.8922 | 7 | 294 |
| 3juk-assembly1.cif.gz_D | the crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose | 0.8843 | 8 | 273 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3jukA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8855 | 8 | 273 | 3.90.550.10 |
| af_Q2G1T6_1_286_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8716 | 7 | 294 | 3.90.550.10 |
| af_Q58730_1_282_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8634 | 8 | 292 | 3.90.550.10 |
| af_Q2G1T6_1_286_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8632 | 7 | 294 | 3.90.550.10 |
| 2ux8B00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8559 | 8 | 293 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A658J916-F1-model_v4 | deleted | 0.9808 | 148 | 244 |
|
| AF-X1NAW7-F1-model_v4 | UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) | 0.978 | 106 | 237 |
GO:0003983
GO:0006011 GO:0009058 |
| AF-A0A4Q2L7R5-F1-model_v4 | deleted | 0.9737 | 133 | 249 |
|
| AF-X0Y2Y7-F1-model_v4 | UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) | 0.9712 | 114 | 259 |
GO:0003983
GO:0006011 GO:0009058 |
| AF-A0A3D5DBI4-F1-model_v4 | UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (UDP-glucose pyrophosphorylase) (Uridine diphosphoglucose pyrophosphorylase) | 0.9656 | 113 | 293 |
GO:0003983
GO:0006011 GO:0009058 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar