F486177

General Info

Members Datasets Scaffolds Average Seq Length
935 412 935 278

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0063357|Ga0501034_0063357_1268_2128
Length 286
Sequence MGAFPMTDRFGRLSLHMWTIDTTPLGTALDAARAAGYDAVELRRTDFKRLLDTGQSNAQILDLIRKSGIKVGILGVEYGWLFAKGDESKRLFGVLRESCQNAVALGCDMLMCAPGQISAPLSEAVENLKIGGDIVGEFPGLRLAIEFNSQHAVLNSVHALRDLLAGARRKNCGYLLDAYHLTRSGSPGRGFEDVPGEEIFVFQYSDVPPAPVETGVKRPTDRLPPGKGLVRWREMLGLLAEKGYTGYLSYEAPNPEQWARSPYDVAKEGVELTRKLLKEAVPSYAA

Samples

Sample ID Description Type Environment
1 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
6 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
57 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
65 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
95 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
96 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
97 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
98 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
99 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
100 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
101 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
104 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
105 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
106 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
107 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
108 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
109 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
110 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
111 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
144 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
146 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
220 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
221 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
222 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
223 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
224 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
225 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
226 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
227 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
228 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
229 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
230 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
231 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
232 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
233 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
234 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
235 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
236 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
237 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
238 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
239 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
240 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
241 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
242 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
243 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
245 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
246 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
247 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
248 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
249 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
250 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
251 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
252 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
253 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
254 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
255 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
256 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
257 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
258 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
259 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
260 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
261 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
262 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
263 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
264 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
265 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
266 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
267 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
268 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
269 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
270 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
271 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
272 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
273 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
274 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
275 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
276 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
277 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
278 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
279 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
280 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
281 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
282 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
283 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
284 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
285 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
286 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
287 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
288 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
289 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
290 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
291 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
292 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
293 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
294 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
295 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
296 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
297 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
298 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
299 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
300 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
301 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
302 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
303 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
304 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
305 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
306 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
307 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
308 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
309 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
310 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
311 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
312 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
313 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
314 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
315 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
316 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
317 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
318 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
319 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
320 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
321 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
322 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
323 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
324 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
325 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
326 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
327 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
328 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
329 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
330 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
331 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
332 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
333 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
334 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
335 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
336 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
337 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
338 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
339 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
340 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
341 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
342 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
343 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
344 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
345 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
346 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
347 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
348 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
349 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
350 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
351 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
352 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
353 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
354 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
355 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
356 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
357 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
358 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
359 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
360 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
361 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
373 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
374 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
375 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
376 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
377 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
378 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
379 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
380 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
381 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
382 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
385 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
386 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
387 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
388 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
389 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
390 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
391 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
392 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
393 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
394 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
395 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
396 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
397 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
398 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
399 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
400 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
401 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
402 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
403 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
404 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
405 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
406 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
407 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
408 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
409 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
410 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
411 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
412 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.71
Nodule 0
Rhizoplane 5.88
Rhizosphere 91.55
Stem 0
Stem Tuber 0
Unclassified 0.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARSoilYngRDRAFT_c00118 3300000042 Bacteria 13503
2 ARcpr5yngRDRAFT_c000035 3300000043 Bacteria 21396
3 ARCol0yngRDRAFT_1000516 3300000652 Bacteria 4478
4 JGI24752J21851_1007583 3300001976 Bacteria 1416
5 JGI24746J21847_1011725 3300001977 Bacteria 1287
6 JGI24747J21853_1002987 3300001978 Bacteria 1431
7 JGI24739J22299_10000158 3300001989 Bacteria 22012
8 JGI24737J22298_10001510 3300001990 Bacteria 8284
9 JGI24737J22298_10001948 3300001990 Bacteria 7386
10 JGI24750J21931_1000477 3300002070 Bacteria 6371
11 JGI24745J21846_1000120 3300002073 Bacteria 6024
12 JGI24738J21930_10001316 3300002075 Bacteria 6946
13 JGI24749J21850_1000215 3300002076 Bacteria 9013
14 JGI24749J21850_1004682 3300002076 Bacteria 1918
15 JGI24744J21845_10012002 3300002077 Bacteria 1763
16 JGI24035J26624_1000023 3300002126 Bacteria 11063
17 JGI24034J26672_10000641 3300002239 Plasmid 4487
18 JGI24742J22300_10002624 3300002244 Plasmid 2883
19 Ga0065717_1000203 3300005276 Bacteria 2019
20 Ga0065704_10090673 3300005289 Bacteria 2768
21 Ga0065712_10018330 3300005290 Bacteria 1732
22 Ga0065712_10093636 3300005290 Unclassified 2284
23 Ga0065715_10001166 3300005293 Bacteria 15369
24 Ga0065715_10021066 3300005293 Bacteria 1926
25 Ga0065715_10099722 3300005293 Plasmid 3378
26 Ga0070658_10006919 3300005327 Bacteria 9160
27 Ga0070658_10028299 3300005327 Bacteria 4498
28 Ga0070658_10055484 3300005327 Bacteria 3219
29 Ga0070676_10015064 3300005328 Bacteria 4260
30 Ga0070683_100012601 3300005329 Bacteria 7351
31 Ga0070683_100051385 3300005329 Plasmid 3817
32 Ga0070690_100000727 3300005330 Bacteria 16862
33 Ga0070690_100023181 3300005330 Plasmid 3805
34 Ga0070690_100038800 3300005330 Bacteria 3007
35 Ga0070690_100291883 3300005330 Unclassified 1166
36 Ga0070670_100040022 3300005331 Plasmid 4031
37 Ga0070670_100046230 3300005331 Plasmid 3743
38 Ga0070670_100566337 3300005331 Unclassified 1014
39 Ga0070677_10002396 3300005333 Bacteria 5981
40 Ga0068869_100002166 3300005334 Bacteria 11815
41 Ga0068869_100312538 3300005334 Unclassified 1272
42 Ga0070666_10022637 3300005335 Plasmid 4082
43 Ga0070666_10025033 3300005335 Plasmid 3890
44 Ga0070680_100006389 3300005336 Bacteria 8955
45 Ga0070680_100018615 3300005336 Bacteria 5491
46 Ga0070680_100057732 3300005336 Plasmid 3173
47 Ga0070680_100073630 3300005336 Bacteria 2809
48 Ga0070680_100189244 3300005336 Bacteria 1734
49 Ga0070680_100289243 3300005336 Unclassified 1389
50 Ga0070680_100448654 3300005336 Unclassified 1102
51 Ga0070682_100002724 3300005337 Bacteria 9789
52 Ga0070682_100038338 3300005337 Unclassified 2939
53 Ga0070682_100130177 3300005337 Bacteria 1702
54 Ga0068868_100002949 3300005338 Bacteria 11812
55 Ga0068868_100021585 3300005338 Plasmid 4850
56 Ga0070660_100000985 3300005339 Bacteria 19067
57 Ga0070660_100026353 3300005339 Bacteria 4327
58 Ga0070689_100000646 3300005340 Bacteria 21086
59 Ga0070689_100002989 3300005340 Bacteria 11115
60 Ga0070689_100014280 3300005340 Bacteria 5766
61 Ga0070691_10000060 3300005341 Bacteria 30257
62 Ga0070687_100000773 3300005343 Bacteria 10637
63 Ga0070661_100015592 3300005344 Bacteria 5363
64 Ga0070661_100206021 3300005344 Bacteria 1504
65 Ga0070692_10000273 3300005345 Bacteria 14477
66 Ga0070668_100007804 3300005347 Bacteria 7946
67 Ga0070669_100019129 3300005353 Bacteria 4895
68 Ga0070675_100003854 3300005354 Bacteria 11384
69 Ga0070675_100036283 3300005354 Plasmid 4011
70 Ga0070671_100000349 3300005355 Bacteria 31741
71 Ga0070671_100032167 3300005355 Bacteria 4338
72 Ga0070671_100111836 3300005355 Bacteria 2294
73 Ga0070674_100000152 3300005356 Bacteria 32268
74 Ga0070674_100026791 3300005356 Bacteria 3770
75 Ga0070674_100031793 3300005356 Plasmid 3500
76 Ga0070673_100007455 3300005364 Bacteria 7216
77 Ga0070688_100002079 3300005365 Bacteria 10108
78 Ga0070688_100002194 3300005365 Bacteria 9852
79 Ga0070688_100091062 3300005365 Bacteria 1992
80 Ga0070659_100000621 3300005366 Bacteria 25919
81 Ga0070659_100037533 3300005366 Bacteria 3777
82 Ga0070667_100000810 3300005367 Bacteria 29225
83 Ga0070703_10002626 3300005406 Bacteria 5171
84 Ga0070709_10024168 3300005434 Bacteria 3574
85 Ga0070714_100027007 3300005435 Bacteria 4750
86 Ga0070714_100049823 3300005435 Bacteria 3565
87 Ga0070714_100068290 3300005435 Bacteria 3066
88 Ga0070714_100102916 3300005435 Plasmid 2519
89 Ga0070714_100617703 3300005435 Bacteria 1042
90 Ga0070713_100015547 3300005436 Bacteria 5697
91 Ga0070713_100045893 3300005436 Plasmid 3583
92 Ga0070713_100081039 3300005436 Bacteria 2769
93 Ga0070713_100084255 3300005436 Bacteria 2720
94 Ga0070710_10029249 3300005437 Bacteria 2954
95 Ga0070701_10000042 3300005438 Bacteria 32304
96 Ga0070701_10008593 3300005438 Plasmid 4427
97 Ga0070711_100008373 3300005439 Bacteria 6335
98 Ga0070711_100132629 3300005439 Unclassified 1857
99 Ga0070705_100005564 3300005440 Bacteria 6146
100 Ga0070705_100096394 3300005440 Unclassified 1857
101 Ga0070705_100147919 3300005440 Bacteria 1555
102 Ga0070700_100000329 3300005441 Bacteria 24667
103 Ga0070700_100023379 3300005441 Plasmid 3613
104 Ga0070694_100002007 3300005444 Bacteria 12098
105 Ga0070694_100002748 3300005444 Bacteria 10437
106 Ga0070708_100045860 3300005445 Plasmid 3854
107 Ga0070663_100037014 3300005455 Plasmid 3394
108 Ga0070663_100090670 3300005455 Unclassified 2264
109 Ga0070678_100013734 3300005456 Bacteria 5089
110 Ga0070678_100062841 3300005456 Plasmid 2744
111 Ga0070662_100064811 3300005457 Plasmid 2676
112 Ga0070662_100182156 3300005457 Unclassified 1656
113 Ga0070662_100333215 3300005457 Unclassified 1240
114 Ga0070662_100548462 3300005457 Unclassified 968
115 Ga0070681_10004332 3300005458 Bacteria 13487
116 Ga0070681_10005076 3300005458 Bacteria 12700
117 Ga0070681_10016427 3300005458 Bacteria 7390
118 Ga0070681_10148826 3300005458 Unclassified 2269
119 Ga0068867_100007473 3300005459 Bacteria 7727
120 Ga0068867_100119720 3300005459 Unclassified 2033
121 Ga0070685_10006180 3300005466 Bacteria 6097
122 Ga0070685_10007245 3300005466 Bacteria 5670
123 Ga0070685_10129989 3300005466 Bacteria 1573
124 Ga0070706_100157073 3300005467 Bacteria 2123
125 Ga0070699_100270906 3300005518 Bacteria 1520
126 Ga0070679_100002742 3300005530 Bacteria 16042
127 Ga0070679_100157221 3300005530 Unclassified 2248
128 Ga0070679_100206314 3300005530 Bacteria 1930
129 Ga0070679_100222698 3300005530 Bacteria 1847
130 Ga0070679_100236175 3300005530 Bacteria 1787
131 Ga0070684_100000464 3300005535 Bacteria 27749
132 Ga0070684_100376832 3300005535 Bacteria 1307
133 Ga0070697_100013327 3300005536 Bacteria 6448
134 Ga0068853_100001029 3300005539 Bacteria 19655
135 Ga0070672_100020218 3300005543 Bacteria 4851
136 Ga0070672_100078130 3300005543 Bacteria 2648
137 Ga0070686_100001527 3300005544 Bacteria 13007
138 Ga0070695_100010249 3300005545 Bacteria 5593
139 Ga0070695_100047425 3300005545 Plasmid 2744
140 Ga0070695_100097437 3300005545 Bacteria 1975
141 Ga0070696_100015481 3300005546 Bacteria 5123
142 Ga0070696_100098522 3300005546 Unclassified 2091
143 Ga0070693_100000266 3300005547 Bacteria 24669
144 Ga0070693_100036753 3300005547 Bacteria 2725
145 Ga0070693_100060687 3300005547 Unclassified 2196
146 Ga0070665_100108939 3300005548 Plasmid 2772
147 Ga0070665_100168547 3300005548 Bacteria 2191
148 Ga0070704_100010668 3300005549 Bacteria 5596
149 Ga0070704_100104573 3300005549 Bacteria 2141
150 Ga0068855_100041697 3300005563 Bacteria 5439
151 Ga0068855_100061239 3300005563 Bacteria 4398
152 Ga0070664_100015424 3300005564 Bacteria 6249
153 Ga0070664_100023574 3300005564 Bacteria 5084
154 Ga0068857_100000888 3300005577 Bacteria 22595
155 Ga0068857_100239796 3300005577 Bacteria 1660
156 Ga0068857_100691623 3300005577 Unclassified 968
157 Ga0068854_100005378 3300005578 Bacteria 8082
158 Ga0068856_100003260 3300005614 Bacteria 16512
159 Ga0068856_100126633 3300005614 Bacteria 2557
160 Ga0068856_100160523 3300005614 Bacteria 2258
161 Ga0068856_100494033 3300005614 Unclassified 1244
162 Ga0070702_100053415 3300005615 Unclassified 2321
163 Ga0068852_100000579 3300005616 Bacteria 24117
164 Ga0068852_100580680 3300005616 Bacteria 1124
165 Ga0068859_100003690 3300005617 Bacteria 15603
166 Ga0068859_100146749 3300005617 Bacteria 2434
167 Ga0068859_100231653 3300005617 Bacteria 1935
168 Ga0068859_100233619 3300005617 Bacteria 1927
169 Ga0068864_100001260 3300005618 Bacteria 21062
170 Ga0068864_100106019 3300005618 Bacteria 2498
171 Ga0068864_100236411 3300005618 Bacteria 1691
172 Ga0068864_100710527 3300005618 Bacteria 982
173 Ga0068866_10001077 3300005718 Bacteria 12040
174 Ga0068866_10018692 3300005718 Unclassified 3140
175 Ga0068861_100001782 3300005719 Bacteria 13850
176 Ga0068861_100351967 3300005719 Unclassified 1292
177 Ga0068851_10046717 3300005834 Bacteria 2191
178 Ga0068870_10000108 3300005840 Bacteria 28313
179 Ga0068863_100001201 3300005841 Bacteria 25868
180 Ga0068863_100324236 3300005841 Unclassified 1496
181 Ga0068858_100000419 3300005842 Bacteria 44155
182 Ga0068858_100054459 3300005842 Plasmid 3699
183 Ga0068858_100181366 3300005842 Unclassified 1988
184 Ga0068860_100001359 3300005843 Bacteria 26585
185 Ga0068860_100475076 3300005843 Unclassified 1245
186 Ga0068860_100875780 3300005843 Bacteria 913
187 Ga0068860_100896963 3300005843 Unclassified 902
188 Ga0068862_100005815 3300005844 Bacteria 10279
189 Ga0068862_100056562 3300005844 Plasmid 3361
190 Ga0081455_10000009 3300005937 Bacteria 249885
191 Ga0081455_10004982 3300005937 Bacteria 14691
192 Ga0081455_10117653 3300005937 Bacteria 2100
193 Ga0070717_10021459 3300006028 Bacteria 5089
194 Ga0070717_10527144 3300006028 Unclassified 1069
195 Ga0075432_10021698 3300006058 Bacteria 2195
196 Ga0070715_10020498 3300006163 Unclassified 2551
197 Ga0070716_100001823 3300006173 Bacteria 9652
198 Ga0070716_100016982 3300006173 Unclassified 3766
199 Ga0070712_100014499 3300006175 Bacteria 5058
200 Ga0070712_100032441 3300006175 Unclassified 3527
201 Ga0070712_100050661 3300006175 Bacteria 2890
202 Ga0070712_100051125 3300006175 Plasmid 2878
203 Ga0070712_100499292 3300006175 Bacteria 1020
204 Ga0075367_10009088 3300006178 Bacteria 5176
205 Ga0075427_10001549 3300006194 Bacteria 2969
206 Ga0097621_100021768 3300006237 Bacteria 4967
207 Ga0097621_100031346 3300006237 Bacteria 4218
208 Ga0097621_100073441 3300006237 Unclassified 2831
209 Ga0075370_10131248 3300006353 Unclassified 1462
210 Ga0075370_10252665 3300006353 Unclassified 1045
211 Ga0068871_100000417 3300006358 Bacteria 29416
212 Ga0068871_100011895 3300006358 Bacteria 6403
213 Ga0068871_100357746 3300006358 Unclassified 1292
214 Ga0075428_100010422 3300006844 Bacteria 10321
215 Ga0075430_100001576 3300006846 Bacteria 18645
216 Ga0075430_100095225 3300006846 Bacteria 2489
217 Ga0075431_100002654 3300006847 Bacteria 17313
218 Ga0075433_10011770 3300006852 Bacteria 7046
219 Ga0075433_10017308 3300006852 Bacteria 5967
220 Ga0075433_10047158 3300006852 Bacteria 3748
221 Ga0075433_10221434 3300006852 Unclassified 1681
222 Ga0075434_100001354 3300006871 Bacteria 20567
223 Ga0075434_100002767 3300006871 Bacteria 15520
224 Ga0075434_100011160 3300006871 Bacteria 8453
225 Ga0075434_100188185 3300006871 Bacteria 2084
226 Ga0075429_100001895 3300006880 Bacteria 17336
227 Ga0075429_100309124 3300006880 Bacteria 1384
228 Ga0068865_100000450 3300006881 Bacteria 22865
229 Ga0068865_100149202 3300006881 Bacteria 1772
230 Ga0097620_100003690 3300006931 Bacteria 15603
231 Ga0097620_100146739 3300006931 Bacteria 2434
232 Ga0097620_100231649 3300006931 Bacteria 1935
233 Ga0097620_100233630 3300006931 Bacteria 1927
234 Ga0075435_100003745 3300007076 Bacteria 10359
235 Ga0075435_100014388 3300007076 Bacteria 5912
236 Ga0075435_100154700 3300007076 Bacteria 1929
237 Ga0075435_100228984 3300007076 Bacteria 1579
238 Ga0075435_100346988 3300007076 Unclassified 1272
239 Ga0105240_10059540 3300009093 Bacteria 4765
240 Ga0105240_10177548 3300009093 Plasmid 2517
241 Ga0111539_10000196 3300009094 Bacteria 70998
242 Ga0111539_10013383 3300009094 Bacteria 10255
243 Ga0111539_10027016 3300009094 Bacteria 7010
244 Ga0111539_10655615 3300009094 Bacteria 1222
245 Ga0111539_11067943 3300009094 Bacteria 938
246 Ga0105245_10026898 3300009098 Bacteria 5065
247 Ga0105245_10458835 3300009098 Unclassified 1284
248 Ga0105247_10013936 3300009101 Plasmid 4821
249 Ga0105247_10182088 3300009101 Unclassified 1403
250 Ga0105247_10212672 3300009101 Bacteria 1305
251 Ga0105247_10234103 3300009101 Bacteria 1248
252 Ga0114129_10013413 3300009147 Bacteria 11678
253 Ga0114129_10020551 3300009147 Bacteria 9391
254 Ga0105243_10002051 3300009148 Bacteria 17085
255 Ga0105243_10044187 3300009148 Unclassified 3494
256 Ga0105243_10702399 3300009148 Bacteria 986
257 Ga0105241_10001526 3300009174 Bacteria 17741
258 Ga0105241_10132786 3300009174 Bacteria 2018
259 Ga0105241_10383803 3300009174 Bacteria 1228
260 Ga0105242_10000399 3300009176 Bacteria 34466
261 Ga0105242_10066427 3300009176 Plasmid 2978
262 Ga0105242_10285747 3300009176 Unclassified 1500
263 Ga0105248_10004145 3300009177 Bacteria 16029
264 Ga0105248_10068292 3300009177 Unclassified 3991
265 Ga0105248_10085160 3300009177 Bacteria 3557
266 Ga0105237_10006666 3300009545 Bacteria 12762
267 Ga0105237_10038653 3300009545 Bacteria 4818
268 Ga0105237_10040533 3300009545 Bacteria 4696
269 Ga0105237_10458258 3300009545 Bacteria 1281
270 Ga0105238_10111550 3300009551 Plasmid 2715
271 Ga0105238_10432216 3300009551 Unclassified 1312
272 Ga0105249_10002756 3300009553 Bacteria 15191
273 Ga0105249_10013099 3300009553 Bacteria 7319
274 Ga0105249_10831782 3300009553 Unclassified 988
275 Ga0105239_10043528 3300010375 Plasmid 4922
276 Ga0105239_10105506 3300010375 Bacteria 3121
277 Ga0105239_10478136 3300010375 Unclassified 1415
278 Ga0105239_10493535 3300010375 Unclassified 1392
279 Ga0105246_10000033 3300011119 Bacteria 50575
280 Ga0105246_10203566 3300011119 Unclassified 1540
281 Ga0105246_10254007 3300011119 Bacteria 1397
282 Ga0157373_10006645 3300013100 Bacteria 8615
283 Ga0157371_10015424 3300013102 Bacteria 5731
284 Ga0157371_10052511 3300013102 Bacteria 2895
285 Ga0157370_10114232 3300013104 Bacteria 2523
286 Ga0157370_10144803 3300013104 Unclassified 2213
287 Ga0157369_10494186 3300013105 Unclassified 1266
288 Ga0157374_10002423 3300013296 Bacteria 15718
289 Ga0157374_10201748 3300013296 Bacteria 1948
290 Ga0157374_10209982 3300013296 Bacteria 1909
291 Ga0157374_10228712 3300013296 Bacteria 1827
292 Ga0157378_10011328 3300013297 Bacteria 7804
293 Ga0163162_10175648 3300013306 Unclassified 2267
294 Ga0163162_10429942 3300013306 Bacteria 1452
295 Ga0157372_10001162 3300013307 Bacteria 28497
296 Ga0157372_10531519 3300013307 Bacteria 1371
297 Ga0157372_10783681 3300013307 Unclassified 1108
298 Ga0157375_10000124 3300013308 Bacteria 76003
299 Ga0157375_10022011 3300013308 Bacteria 5861
300 Ga0157375_10193278 3300013308 Bacteria 2190
301 Ga0163163_10000745 3300014325 Bacteria 27709
302 Ga0163163_10173646 3300014325 Unclassified 2201
303 Ga0163163_10591800 3300014325 Bacteria 1172
304 Ga0157380_10000140 3300014326 Bacteria 40628
305 Ga0157380_10294780 3300014326 Bacteria 1491
306 Ga0157377_10000117 3300014745 Bacteria 53219
307 Ga0157377_10120726 3300014745 Unclassified 1588
308 Ga0157379_10000785 3300014968 Bacteria 25777
309 Ga0157379_10020035 3300014968 Bacteria 5912
310 Ga0157379_10055182 3300014968 Unclassified 3550
311 Ga0157379_10507186 3300014968 Unclassified 1119
312 Ga0157376_10000034 3300014969 Bacteria 161526
313 Ga0206354_10939082 3300020081 Unclassified 1036
314 Ga0213876_10037930 3300021384 Bacteria 2542
315 Ga0207666_1000017 3300025271 Bacteria 40049
316 Ga0207666_1000448 3300025271 Bacteria 5327
317 Ga0207673_1000258 3300025290 Bacteria 5406
318 Ga0207697_10000009 3300025315 Bacteria 67526
319 Ga0207697_10001569 3300025315 Bacteria 12343
320 Ga0207682_10000301 3300025893 Bacteria 22279
321 Ga0207692_10005897 3300025898 Bacteria 4940
322 Ga0207642_10001973 3300025899 Bacteria 6336
323 Ga0207710_10004684 3300025900 Bacteria 5936
324 Ga0207710_10094733 3300025900 Bacteria 1402
325 Ga0207688_10000012 3300025901 Bacteria 60353
326 Ga0207688_10287309 3300025901 Bacteria 1003
327 Ga0207647_10005111 3300025904 Bacteria 9660
328 Ga0207647_10017208 3300025904 Plasmid 4919
329 Ga0207685_10005072 3300025905 Plasmid 3431
330 Ga0207699_10001620 3300025906 Bacteria 10680
331 Ga0207699_10002309 3300025906 Bacteria 9013
332 Ga0207645_10000124 3300025907 Bacteria 58746
333 Ga0207645_10008610 3300025907 Bacteria 7104
334 Ga0207643_10000046 3300025908 Bacteria 80736
335 Ga0207705_10008788 3300025909 Bacteria 7363
336 Ga0207705_10027090 3300025909 Bacteria 4085
337 Ga0207705_10209221 3300025909 Bacteria 1479
338 Ga0207654_10003867 3300025911 Bacteria 7546
339 Ga0207654_10051066 3300025911 Bacteria 2378
340 Ga0207707_10021900 3300025912 Bacteria 5586
341 Ga0207707_10052526 3300025912 Bacteria 3548
342 Ga0207707_10065374 3300025912 Bacteria 3168
343 Ga0207707_10140111 3300025912 Bacteria 2115
344 Ga0207707_10414139 3300025912 Bacteria 1156
345 Ga0207707_10530181 3300025912 Unclassified 1002
346 Ga0207671_10253315 3300025914 Bacteria 1384
347 Ga0207693_10005252 3300025915 Bacteria 10836
348 Ga0207693_10158542 3300025915 Unclassified 1780
349 Ga0207693_10185006 3300025915 Bacteria 1640
350 Ga0207663_10012608 3300025916 Bacteria 4577
351 Ga0207663_10066915 3300025916 Bacteria 2302
352 Ga0207663_10186245 3300025916 Bacteria 1486
353 Ga0207660_10001510 3300025917 Bacteria 15663
354 Ga0207660_10020034 3300025917 Bacteria 4482
355 Ga0207660_10139087 3300025917 Bacteria 1855
356 Ga0207660_10264613 3300025917 Bacteria 1361
357 Ga0207662_10000222 3300025918 Bacteria 26332
358 Ga0207657_10000162 3300025919 Bacteria 68121
359 Ga0207657_10008982 3300025919 Bacteria 10097
360 Ga0207657_10031279 3300025919 Bacteria 4824
361 Ga0207649_10000798 3300025920 Bacteria 20284
362 Ga0207649_10050147 3300025920 Bacteria 2581
363 Ga0207649_10074301 3300025920 Unclassified 2181
364 Ga0207652_10066691 3300025921 Bacteria 3120
365 Ga0207652_10126524 3300025921 Unclassified 2277
366 Ga0207652_10150391 3300025921 Bacteria 2084
367 Ga0207652_10157030 3300025921 Bacteria 2038
368 Ga0207652_10272769 3300025921 Unclassified 1526
369 Ga0207652_10343981 3300025921 Bacteria 1346
370 Ga0207646_10153575 3300025922 Unclassified 2076
371 Ga0207681_10003611 3300025923 Bacteria 9628
372 Ga0207694_10090129 3300025924 Unclassified 2419
373 Ga0207694_10326208 3300025924 Unclassified 1268
374 Ga0207650_10031847 3300025925 Plasmid 3811
375 Ga0207650_10059776 3300025925 Unclassified 2842
376 Ga0207650_10230395 3300025925 Bacteria 1494
377 Ga0207659_10016376 3300025926 Bacteria 4823
378 Ga0207687_10011784 3300025927 Bacteria 5721
379 Ga0207687_10236956 3300025927 Unclassified 1444
380 Ga0207700_10000290 3300025928 Bacteria 29736
381 Ga0207700_10022250 3300025928 Bacteria 4346
382 Ga0207664_10026121 3300025929 Unclassified 4409
383 Ga0207664_10097295 3300025929 Unclassified 2424
384 Ga0207664_10162640 3300025929 Unclassified 1905
385 Ga0207644_10018037 3300025931 Bacteria 4771
386 Ga0207644_10124978 3300025931 Unclassified 1962
387 Ga0207706_10000368 3300025933 Bacteria 48834
388 Ga0207706_10007484 3300025933 Bacteria 10098
389 Ga0207706_10058572 3300025933 Plasmid 3393
390 Ga0207686_10010832 3300025934 Bacteria 4971
391 Ga0207686_10034817 3300025934 Plasmid 3017
392 Ga0207709_10000256 3300025935 Bacteria 63853
393 Ga0207709_10147387 3300025935 Unclassified 1626
394 Ga0207670_10450041 3300025936 Bacteria 1038
395 Ga0207669_10001765 3300025937 Bacteria 9180
396 Ga0207669_10315477 3300025937 Bacteria 1194
397 Ga0207669_10585300 3300025937 Unclassified 905
398 Ga0207704_10002423 3300025938 Bacteria 8389
399 Ga0207665_10024323 3300025939 Plasmid 3993
400 Ga0207691_10000303 3300025940 Bacteria 48873
401 Ga0207711_10048233 3300025941 Bacteria 3644
402 Ga0207689_10000109 3300025942 Bacteria 67941
403 Ga0207661_10010457 3300025944 Bacteria 6680
404 Ga0207661_10106083 3300025944 Unclassified 2368
405 Ga0207661_10528559 3300025944 Bacteria 1079
406 Ga0207679_10000031 3300025945 Bacteria 165962
407 Ga0207679_10068452 3300025945 Bacteria 2667
408 Ga0207667_10002481 3300025949 Bacteria 22990
409 Ga0207667_10015271 3300025949 Bacteria 8732
410 Ga0207667_10078969 3300025949 Unclassified 3410
411 Ga0207651_10404483 3300025960 Bacteria 1162
412 Ga0207712_10001848 3300025961 Bacteria 13972
413 Ga0207712_10307709 3300025961 Unclassified 1303
414 Ga0207668_10001339 3300025972 Bacteria 14601
415 Ga0207640_10001185 3300025981 Bacteria 14246
416 Ga0207658_10016049 3300025986 Bacteria 5144
417 Ga0207658_10056945 3300025986 Unclassified 2903
418 Ga0207658_10102245 3300025986 Unclassified 2247
419 Ga0207677_10335012 3300026023 Unclassified 1262
420 Ga0207703_10008545 3300026035 Bacteria 8088
421 Ga0207639_10050194 3300026041 Plasmid 3167
422 Ga0207678_10000158 3300026067 Bacteria 56255
423 Ga0207678_10030340 3300026067 Bacteria 4720
424 Ga0207678_10073370 3300026067 Plasmid 2933
425 Ga0207678_10141821 3300026067 Unclassified 2051
426 Ga0207708_10000098 3300026075 Bacteria 67005
427 Ga0207708_10005985 3300026075 Bacteria 9009
428 Ga0207708_10122629 3300026075 Unclassified 2026
429 Ga0207702_10043424 3300026078 Bacteria 3774
430 Ga0207702_10319440 3300026078 Bacteria 1478
431 Ga0207702_10375330 3300026078 Unclassified 1366
432 Ga0207702_10739746 3300026078 Bacteria 970
433 Ga0207641_10025880 3300026088 Bacteria 4839
434 Ga0207641_10656842 3300026088 Unclassified 1030
435 Ga0207648_10000696 3300026089 Bacteria 37592
436 Ga0207648_10211259 3300026089 Unclassified 1723
437 Ga0207676_10005342 3300026095 Bacteria 9098
438 Ga0207676_10105319 3300026095 Bacteria 2348
439 Ga0207676_10269041 3300026095 Bacteria 1542
440 Ga0207674_10000420 3300026116 Bacteria 55287
441 Ga0207675_100001146 3300026118 Bacteria 26264
442 Ga0207675_100184391 3300026118 Unclassified 2000
443 Ga0207675_100383127 3300026118 Unclassified 1383
444 Ga0207683_10000004 3300026121 Bacteria 188086
445 Ga0207683_10001766 3300026121 Bacteria 19131
446 Ga0207683_10016095 3300026121 Bacteria 6365
447 Ga0207698_10015254 3300026142 Bacteria 5143
448 Ga0207698_10021138 3300026142 Bacteria 4495
449 Ga0209973_1013981 3300027252 Unclassified 996
450 Ga0209984_1007530 3300027424 Bacteria 1353
451 Ga0209970_1017406 3300027614 Unclassified 1203
452 Ga0210002_1002603 3300027617 Plasmid 2610
453 Ga0209971_1011172 3300027682 Bacteria 2126
454 Ga0209971_1014527 3300027682 Archaea 1867
455 Ga0209998_10003042 3300027717 Plasmid 3726
456 Ga0209998_10009889 3300027717 Unclassified 1977
457 Ga0209974_10000117 3300027876 Bacteria 23200
458 Ga0207428_10000250 3300027907 Bacteria 73217
459 Ga0207428_10001707 3300027907 Bacteria 22539
460 Ga0207428_10007251 3300027907 Bacteria 10137
461 Ga0268266_10009789 3300028379 Bacteria 8432
462 Ga0268265_10005880 3300028380 Bacteria 8360
463 Ga0268265_10054430 3300028380 Plasmid 3036
464 Ga0268264_10076905 3300028381 Bacteria 2841
465 Ga0268264_10108780 3300028381 Unclassified 2424
466 Ga0268264_10157143 3300028381 Unclassified 2044
467 Ga0265337_1005419 3300028556 Bacteria 5064
468 Ga0265318_10072287 3300028577 Bacteria 1278
469 Ga0265338_10009970 3300028800 Bacteria 11231
470 Ga0265338_10205712 3300028800 Unclassified 1481
471 Ga0265338_10261562 3300028800 Bacteria 1272
472 Ga0265325_10000039 3300031241 Bacteria 93014
473 Ga0265325_10000568 3300031241 Bacteria 26844
474 Ga0265325_10001242 3300031241 Bacteria 18188
475 Ga0265325_10007949 3300031241 Bacteria 6301
476 Ga0265325_10090448 3300031241 Unclassified 1510
477 Ga0265325_10118878 3300031241 Bacteria 1276
478 Ga0265329_10051651 3300031242 Bacteria 1309
479 Ga0265340_10011649 3300031247 Bacteria 4667
480 Ga0265340_10058550 3300031247 Bacteria 1850
481 Ga0265340_10068395 3300031247 Bacteria 1687
482 Ga0265339_10000060 3300031249 Bacteria 97276
483 Ga0265339_10004978 3300031249 Bacteria 8945
484 Ga0265339_10061175 3300031249 Bacteria 2027
485 Ga0265339_10108445 3300031249 Bacteria 1439
486 Ga0265316_10124161 3300031344 Bacteria 1948
487 Ga0265316_10154592 3300031344 Bacteria 1717
488 Ga0265313_10000072 3300031595 Bacteria 98635
489 Ga0265313_10000094 3300031595 Bacteria 89774
490 Ga0265313_10002026 3300031595 Bacteria 18179
491 Ga0265313_10013232 3300031595 Bacteria 4967
492 Ga0265313_10027718 3300031595 Bacteria 2961
493 Ga0265313_10094571 3300031595 Bacteria 1335
494 Ga0316579_10011195 3300031691 Bacteria 3808
495 Ga0265314_10011949 3300031711 Bacteria 7123
496 Ga0265314_10060949 3300031711 Bacteria 2572
497 Ga0265314_10087310 3300031711 Bacteria 2040
498 Ga0265342_10001132 3300031712 Bacteria 25514
499 Ga0265342_10017648 3300031712 Bacteria 4638
500 Ga0373948_0004653 3300034817 Unclassified 2184
501 Ga0373950_0000252 3300034818 Bacteria 6789
502 Ga0373950_0013749 3300034818 Bacteria 1354
503 Ga0373958_0000253 3300034819 Bacteria 6279
504 Ga0373958_0051445 3300034819 Bacteria 871
505 Ga0373959_0042536 3300034820 Unclassified 958
506 Ga0373926_0006367 3300035083 Bacteria 3921
507 Ga0373926_0009032 3300035083 Bacteria 3324
508 Ga0373928_0016950 3300035084 Bacteria 1495
509 Ga0373934_0178791 3300035086 Bacteria 872
510 Ga0373940_0001059 3300035088 Bacteria 4755
511 Ga0373944_0016839 3300035089 Bacteria 2067
512 Ga0373949_0007253 3300035090 Unclassified 2427
513 Ga0373951_0012875 3300035091 Bacteria 1881
514 Ga0373951_0025908 3300035091 Bacteria 1363
515 Ga0373952_0003163 3300035092 Plasmid 2963
516 Ga0373923_0020973 3300035111 Unclassified 2546
517 Ga0373923_0188808 3300035111 Bacteria 949
518 Ga0373932_0001805 3300035112 Bacteria 5763
519 Ga0373932_0015369 3300035112 Unclassified 1939
520 Ga0373936_0017326 3300035113 Unclassified 2773
521 Ga0373936_0023704 3300035113 Bacteria 2393
522 Ga0373936_0050063 3300035113 Unclassified 1689
523 Ga0373939_0002173 3300035114 Bacteria 4651
524 Ga0373939_0002190 3300035114 Plasmid 4629
525 Ga0373939_0063931 3300035114 Bacteria 1180
526 Ga0373941_0004921 3300035115 Bacteria 3112
527 Ga0373941_0005662 3300035115 Unclassified 2957
528 Ga0373941_0023592 3300035115 Bacteria 1758
529 Ga0373945_0000631 3300035116 Bacteria 10130
530 Ga0373945_0060108 3300035116 Bacteria 1416
531 Ga0373953_0112980 3300035117 Bacteria 1150
532 Ga0373953_0156098 3300035117 Bacteria 980
533 Ga0373954_0041392 3300035118 Unclassified 2148
534 Ga0373954_0059511 3300035118 Bacteria 1800
535 Ga0373954_0088350 3300035118 Bacteria 1486
536 Ga0373956_0011799 3300035119 Bacteria 3607
537 Ga0373956_0048683 3300035119 Bacteria 1899
538 Ga0373956_0085892 3300035119 Bacteria 1447
539 Ga0373957_0084793 3300035120 Bacteria 1253
540 Ga0373960_0028487 3300035121 Unclassified 1542
541 Ga0373943_0000576 3300035170 Bacteria 15908
542 Ga0373946_0020057 3300035171 Bacteria 2580
543 Ga0373955_0000486 3300035172 Bacteria 16843
544 Ga0373955_0008616 3300035172 Bacteria 4744
545 Ga0373955_0011699 3300035172 Bacteria 4193
546 Ga0373955_0266221 3300035172 Bacteria 1029
547 Ga0373942_0003463 3300035207 Plasmid 3705
548 Ga0373942_0046125 3300035207 Bacteria 1206
549 Ga0373961_0015754 3300035241 Bacteria 1937
550 Ga0373924_0011641 3300035410 Bacteria 3271
551 Ga0373931_0022894 3300035691 Unclassified 3148
552 Ga0373931_0050564 3300035691 Unclassified 2211
553 Ga0373935_0009157 3300035692 Bacteria 5924
554 Ga0373935_0010279 3300035692 Bacteria 5611
555 Ga0373935_0098587 3300035692 Unclassified 1923
556 Ga0373935_0104772 3300035692 Bacteria 1870
557 Ga0373935_0121379 3300035692 Unclassified 1746
558 Ga0373935_0290427 3300035692 Bacteria 1153
559 Ga0373927_0000994 3300035695 Bacteria 21579
560 Ga0373927_0125644 3300035695 Bacteria 1674
561 Ga0373927_0247215 3300035695 Bacteria 1172
562 Ga0373933_0001169 3300035724 Bacteria 15570
563 Ga0373933_0011184 3300035724 Unclassified 4938
564 Ga0373933_0048350 3300035724 Bacteria 2533
565 Ga0373933_0056238 3300035724 Bacteria 2361
566 Ga0373947_0000084 3300035725 Bacteria 46913
567 Ga0373947_0000874 3300035725 Bacteria 18211
568 Ga0373947_0179277 3300035725 Bacteria 1378
569 Ga0373947_0338826 3300035725 Bacteria 1007
570 Ga0373937_0003379 3300036401 Bacteria 13396
571 Ga0373937_0015326 3300036401 Bacteria 6778
572 Ga0373937_0027230 3300036401 Bacteria 5169
573 Ga0373937_0029009 3300036401 Bacteria 5011
574 Ga0373937_0029562 3300036401 Bacteria 4963
575 Ga0373937_0351105 3300036401 Bacteria 1397
576 Ga0373937_0457683 3300036401 Bacteria 1212
577 Ga0373925_0002271 3300037068 Bacteria 15571
578 Ga0373925_0009697 3300037068 Bacteria 7005
579 Ga0373925_0097726 3300037068 Bacteria 2252
580 Ga0373925_0105792 3300037068 Bacteria 2168
581 Ga0373925_0155420 3300037068 Unclassified 1798
582 Ga0373925_0499589 3300037068 Bacteria 998
583 Ga0395899_0018964 3300037312 Bacteria 5227
584 Ga0395899_0363665 3300037312 Unclassified 965
585 Ga0395900_0013490 3300037418 Bacteria 8349
586 Ga0395900_0033443 3300037418 Bacteria 5291
587 Ga0395900_0265905 3300037418 Bacteria 1711
588 Ga0395898_0002017 3300037466 Bacteria 25468
589 Ga0395898_0019431 3300037466 Bacteria 6914
590 Ga0395898_0070625 3300037466 Bacteria 3375
591 Ga0395901_0033083 3300038443 Bacteria 5335
592 Ga0395901_0040672 3300038443 Bacteria 4816
593 Ga0395901_0731074 3300038443 Unclassified 984
594 Ga0436365_1084775 3300039437 Bacteria 2258
595 Ga0436365_1446426 3300039437 Bacteria 6334
596 Ga0436365_1906059 3300039437 Bacteria 2235
597 Ga0439435_0051813 3300042436 Unclassified 1177
598 Ga0451577_0257160 3300042876 Bacteria 1581
599 Ga0466963_0011264 3300044694 Bacteria 5442
600 Ga0453684_0114945 3300044712 Plasmid 3262
601 Ga0466957_0444620 3300044842 Bacteria 892
602 Ga0451576_0047663 3300045051 Plasmid 4504
603 Ga0466958_0069110 3300045836 Unclassified 2160
604 Ga0466967_0001558 3300045976 Bacteria 13445
605 Ga0495617_008848 3300046452 Bacteria 3465
606 Ga0495592_0010591 3300046454 Bacteria 6955
607 Ga0495592_0012448 3300046454 Bacteria 6461
608 Ga0495592_0015983 3300046454 Bacteria 5693
609 Ga0495603_0001529 3300046455 Bacteria 13515
610 Ga0495603_0084857 3300046455 Bacteria 1854
611 Ga0495629_0001129 3300046459 Bacteria 21115
612 Ga0495629_0140647 3300046459 Bacteria 1679
613 Ga0495629_0181730 3300046459 Bacteria 1457
614 Ga0495641_0009864 3300046461 Bacteria 5622
615 Ga0495641_0121583 3300046461 Unclassified 1165
616 Ga0495651_0000565 3300046462 Bacteria 28643
617 Ga0495651_0005013 3300046462 Bacteria 10117
618 Ga0495651_0012172 3300046462 Bacteria 6623
619 Ga0495651_0248990 3300046462 Bacteria 1214
620 Ga0495653_0020000 3300046463 Bacteria 5425
621 Ga0495653_0080969 3300046463 Bacteria 2400
622 Ga0495653_0083117 3300046463 Bacteria 2362
623 Ga0495653_0106269 3300046463 Bacteria 2025
624 Ga0495580_0014617 3300046472 Bacteria 5950
625 Ga0495580_0081545 3300046472 Bacteria 2254
626 Ga0495582_0003684 3300046473 Bacteria 8636
627 Ga0495582_0106862 3300046473 Unclassified 1570
628 Ga0495639_0034974 3300046475 Bacteria 2247
629 Ga0495639_0061948 3300046475 Unclassified 1716
630 Ga0495662_0012418 3300046476 Bacteria 4156
631 Ga0495662_0017919 3300046476 Plasmid 3427
632 Ga0495664_0000810 3300046477 Bacteria 15995
633 Ga0495664_0005186 3300046477 Bacteria 7151
634 Ga0495664_0005968 3300046477 Bacteria 6711
635 Ga0495664_0016079 3300046477 Unclassified 4261
636 Ga0495584_0011215 3300046491 Bacteria 4591
637 Ga0495584_0052830 3300046491 Unclassified 2045
638 Ga0495585_0002467 3300046492 Bacteria 13224
639 Ga0495594_0031402 3300046499 Unclassified 2879
640 Ga0495594_0040820 3300046499 Bacteria 2540
641 Ga0495607_0004861 3300046501 Bacteria 9794
642 Ga0495583_0034275 3300046506 Bacteria 2434
643 Ga0495608_0003844 3300046511 Bacteria 10793
644 Ga0495608_0021633 3300046511 Bacteria 4414
645 Ga0495608_0052610 3300046511 Bacteria 2695
646 Ga0495608_0258057 3300046511 Bacteria 1086
647 Ga0495618_0000917 3300046514 Bacteria 20251
648 Ga0495618_0001056 3300046514 Bacteria 18774
649 Ga0495618_0139377 3300046514 Bacteria 1551
650 Ga0495618_0141972 3300046514 Bacteria 1536
651 Ga0495628_0004353 3300046516 Bacteria 12563
652 Ga0495628_0007281 3300046516 Bacteria 9588
653 Ga0495628_0024488 3300046516 Bacteria 4940
654 Ga0495628_0102206 3300046516 Bacteria 2212
655 Ga0495630_0002361 3300046517 Bacteria 13096
656 Ga0495630_0037747 3300046517 Bacteria 3612
657 Ga0495630_0104139 3300046517 Bacteria 2147
658 Ga0495631_0082807 3300046518 Bacteria 1383
659 Ga0495644_0000977 3300046523 Bacteria 11861
660 Ga0495663_0008995 3300046525 Bacteria 2768
661 Ga0495666_0010301 3300046526 Bacteria 4661
662 Ga0495652_0003321 3300046529 Bacteria 15975
663 Ga0495652_0011095 3300046529 Bacteria 8164
664 Ga0495652_0036189 3300046529 Bacteria 4293
665 Ga0495652_0042569 3300046529 Bacteria 3915
666 Ga0495652_0051988 3300046529 Unclassified 3496
667 Ga0495652_0107167 3300046529 Bacteria 2255
668 Ga0495652_0231048 3300046529 Bacteria 1383
669 Ga0495665_0010372 3300046531 Bacteria 5041
670 Ga0495665_0027263 3300046531 Plasmid 3067
671 Ga0495665_0033062 3300046531 Bacteria 2766
672 Ga0495665_0054425 3300046531 Unclassified 2114
673 Ga0495640_0015820 3300046533 Bacteria 5661
674 Ga0495640_0071285 3300046533 Bacteria 2332
675 Ga0495640_0186056 3300046533 Bacteria 1322
676 Ga0495587_0002666 3300046536 Bacteria 11915
677 Ga0495587_0086202 3300046536 Bacteria 1817
678 Ga0495645_0001019 3300046543 Bacteria 19074
679 Ga0495645_0001763 3300046543 Bacteria 14717
680 Ga0495622_0022047 3300046557 Bacteria 2967
681 Ga0495633_0021747 3300046558 Bacteria 3203
682 Ga0495667_0000256 3300046559 Bacteria 34418
683 Ga0495667_0003202 3300046559 Bacteria 10975
684 Ga0495667_0004500 3300046559 Bacteria 9408
685 Ga0495667_0051698 3300046559 Bacteria 2710
686 Ga0495667_0080082 3300046559 Bacteria 2123
687 Ga0495667_0111204 3300046559 Bacteria 1770
688 Ga0495656_0002804 3300046615 Bacteria 5828
689 Ga0495634_0002529 3300046642 Bacteria 15163
690 Ga0495634_0085794 3300046642 Unclassified 2051
691 Ga0495634_0099557 3300046642 Unclassified 1879
692 Ga0495634_0325765 3300046642 Bacteria 924
693 Ga0495611_0006278 3300046648 Bacteria 5071
694 Ga0495635_0001674 3300046663 Bacteria 14916
695 Ga0495635_0006462 3300046663 Bacteria 8173
696 Ga0495635_0055975 3300046663 Bacteria 2716
697 Ga0495635_0063562 3300046663 Bacteria 2535
698 Ga0495635_0175513 3300046663 Bacteria 1457
699 Ga0495659_0002865 3300046664 Bacteria 5540
700 Ga0495661_0046138 3300046665 Bacteria 2662
701 Ga0495588_0040840 3300046674 Bacteria 2367
702 Ga0495657_0002838 3300046675 Bacteria 14378
703 Ga0495657_0008836 3300046675 Bacteria 7671
704 Ga0495657_0041262 3300046675 Bacteria 3160
705 Ga0495599_0014560 3300046678 Plasmid 4870
706 Ga0495599_0015487 3300046678 Bacteria 4733
707 Ga0495599_0052311 3300046678 Bacteria 2558
708 Ga0495599_0093299 3300046678 Bacteria 1878
709 Ga0495623_0006304 3300046679 Bacteria 7713
710 Ga0495623_0102325 3300046679 Bacteria 1744
711 Ga0495623_0150627 3300046679 Bacteria 1375
712 Ga0495646_0001535 3300046680 Bacteria 13774
713 Ga0495646_0003056 3300046680 Bacteria 10373
714 Ga0495646_0144578 3300046680 Bacteria 1327
715 Ga0495647_0012134 3300046681 Plasmid 2963
716 Ga0495647_0027866 3300046681 Bacteria 2078
717 Ga0495658_0007273 3300046683 Bacteria 5472
718 Ga0495658_0027556 3300046683 Bacteria 3058
719 Ga0495658_0071135 3300046683 Unclassified 2020
720 Ga0495613_0012997 3300046689 Bacteria 6186
721 Ga0495613_0082469 3300046689 Unclassified 2335
722 Ga0495613_0116360 3300046689 Bacteria 1923
723 Ga0495624_0021752 3300046690 Bacteria 4249
724 Ga0495624_0048734 3300046690 Bacteria 2687
725 Ga0495670_0000385 3300046691 Bacteria 21067
726 Ga0495600_0008913 3300046809 Bacteria 6180
727 Ga0495600_0016927 3300046809 Bacteria 4633
728 Ga0495600_0035138 3300046809 Bacteria 3254
729 Ga0495581_0001980 3300047315 Bacteria 11493
730 Ga0495581_0038963 3300047315 Unclassified 2751
731 Ga0495581_0052331 3300047315 Bacteria 2358
732 Ga0495604_0035932 3300047317 Bacteria 3909
733 Ga0495604_0059042 3300047317 Bacteria 2943
734 Ga0495604_0061187 3300047317 Unclassified 2880
735 Ga0495604_0085385 3300047317 Bacteria 2355
736 Ga0495674_0001984 3300047319 Bacteria 20115
737 Ga0495674_0004803 3300047319 Bacteria 13003
738 Ga0495674_0097401 3300047319 Bacteria 2505
739 Ga0495674_0162477 3300047319 Bacteria 1868
740 Ga0495674_0238686 3300047319 Bacteria 1498
741 Ga0495674_0538587 3300047319 Bacteria 930
742 Ga0495676_0097796 3300047321 Unclassified 2179
743 Ga0495680_0005186 3300047322 Bacteria 12294
744 Ga0495680_0005564 3300047322 Bacteria 11827
745 Ga0495680_0013978 3300047322 Bacteria 6979
746 Ga0495680_0091074 3300047322 Bacteria 2286
747 Ga0495680_0096580 3300047322 Bacteria 2206
748 Ga0495675_0000532 3300047444 Bacteria 24684
749 Ga0495675_0155300 3300047444 Bacteria 1412
750 Ga0495677_0075446 3300047445 Bacteria 1260
751 Ga0495684_0003231 3300047471 Bacteria 12790
752 Ga0495684_0020948 3300047471 Bacteria 5036
753 Ga0495684_0025239 3300047471 Bacteria 4569
754 Ga0495684_0025619 3300047471 Bacteria 4531
755 Ga0495684_0083439 3300047471 Bacteria 2423
756 Ga0495684_0089038 3300047471 Bacteria 2339
757 Ga0495593_0016546 3300047673 Plasmid 4158
758 Ga0495593_0064928 3300047673 Unclassified 1904
759 Ga0495593_0154936 3300047673 Bacteria 1158
760 Ga0495593_0235278 3300047673 Bacteria 918
761 Ga0495602_0003582 3300048088 Bacteria 16079
762 Ga0495602_0005750 3300048088 Bacteria 13013
763 Ga0495614_0081315 3300048089 Bacteria 1403
764 Ga0496100_0009690 3300048903 Bacteria 5418
765 Ga0496100_0070886 3300048903 Unclassified 2325
766 Ga0496101_0002148 3300048904 Bacteria 12040
767 Ga0496101_0016521 3300048904 Bacteria 4988
768 Ga0496101_0474639 3300048904 Bacteria 987
769 Ga0496102_0038521 3300048905 Bacteria 4314
770 Ga0496102_0228210 3300048905 Unclassified 1755
771 Ga0496102_0567603 3300048905 Unclassified 1057
772 Ga0496102_0909528 3300048905 Bacteria 801
773 Ga0496103_0030585 3300048906 Bacteria 3277
774 Ga0496103_0106174 3300048906 Unclassified 1781
775 Ga0496104_0000575 3300048907 Bacteria 31363
776 Ga0496104_0095591 3300048907 Unclassified 2842
777 Ga0496104_0297870 3300048907 Bacteria 1525
778 Ga0496104_0375378 3300048907 Bacteria 1334
779 Ga0496105_0012737 3300048908 Bacteria 6662
780 Ga0496105_0048584 3300048908 Unclassified 3502
781 Ga0496105_0116922 3300048908 Bacteria 2199
782 Ga0496105_0408681 3300048908 Bacteria 1076
783 Ga0496106_0015507 3300048909 Bacteria 5638
784 Ga0496106_0025013 3300048909 Plasmid 4441
785 Ga0496106_0238314 3300048909 Unclassified 1453
786 Ga0496107_0004066 3300048910 Bacteria 9849
787 Ga0496107_0274991 3300048910 Unclassified 1253
788 Ga0496108_0017973 3300048911 Bacteria 5784
789 Ga0496108_0040534 3300048911 Bacteria 3882
790 Ga0496108_0054196 3300048911 Bacteria 3365
791 Ga0496108_0427739 3300048911 Bacteria 1156
792 Ga0496109_0004277 3300048912 Bacteria 11931
793 Ga0496109_0026022 3300048912 Bacteria 5215
794 Ga0496109_0043968 3300048912 Bacteria 4050
795 Ga0496109_0064398 3300048912 Bacteria 3354
796 Ga0496109_0178818 3300048912 Unclassified 1992
797 Ga0496110_0039711 3300048913 Bacteria 4098
798 Ga0496110_0042792 3300048913 Bacteria 3953
799 Ga0496110_0082037 3300048913 Plasmid 2875
800 Ga0496111_0067953 3300048914 Unclassified 2590
801 Ga0496111_0076128 3300048914 Bacteria 2446
802 Ga0496111_0137455 3300048914 Bacteria 1810
803 Ga0496112_0022849 3300048915 Bacteria 5966
804 Ga0496112_0027238 3300048915 Bacteria 5511
805 Ga0496112_0076436 3300048915 Unclassified 3311
806 Ga0496112_0373305 3300048915 Unclassified 1368
807 Ga0496112_0555739 3300048915 Bacteria 1081
808 Ga0496113_0024623 3300048916 Bacteria 4280
809 Ga0496113_0035969 3300048916 Unclassified 3626
810 Ga0496113_0108250 3300048916 Bacteria 2160
811 Ga0496113_0216578 3300048916 Bacteria 1525
812 Ga0496114_0005575 3300048917 Bacteria 9865
813 Ga0496114_0016691 3300048917 Bacteria 5920
814 Ga0496115_0027862 3300048918 Plasmid 4423
815 Ga0496115_0031167 3300048918 Bacteria 4199
816 Ga0496115_0069516 3300048918 Bacteria 2852
817 Ga0496115_0127538 3300048918 Unclassified 2096
818 Ga0496115_0156486 3300048918 Bacteria 1883
819 Ga0496119_0000906 3300048922 Bacteria 38547
820 Ga0496121_0245841 3300048924 Bacteria 1244
821 Ga0496122_0016749 3300048925 Bacteria 6907
822 Ga0496123_0001118 3300048926 Bacteria 40071
823 Ga0501033_0003913 3300049570 Bacteria 12090
824 Ga0501033_0091848 3300049570 Bacteria 2221
825 Ga0501033_0239233 3300049570 Bacteria 1288
826 Ga0501033_0429803 3300049570 Bacteria 919
827 Ga0501034_0000516 3300049571 Bacteria 62005
828 Ga0501034_0037478 3300049571 Bacteria 4910
829 Ga0501034_0063357 3300049571 Bacteria 3711
830 Ga0501036_0392257 3300049572 Bacteria 1158
831 Ga0501038_0063990 3300049574 Bacteria 3138
832 Ga0501038_0066609 3300049574 Bacteria 3066
833 Ga0501039_0006041 3300049575 Bacteria 9191
834 Ga0501039_0054336 3300049575 Bacteria 3100
835 Ga0501040_0014268 3300049576 Bacteria 5233
836 Ga0501041_0006521 3300049577 Bacteria 6833
837 Ga0501042_0048779 3300049578 Bacteria 3019
838 Ga0501043_0048654 3300049579 Bacteria 3333
839 Ga0501046_0063893 3300049580 Bacteria 2874
840 Ga0501046_0098596 3300049580 Bacteria 2244
841 Ga0501047_0004478 3300049581 Bacteria 13149
842 Ga0501047_0044782 3300049581 Bacteria 4276
843 Ga0501047_0078933 3300049581 Bacteria 3165
844 Ga0501047_0463921 3300049581 Bacteria 1095
845 Ga0501070_0018727 3300049586 Bacteria 5809
846 Ga0501070_0037859 3300049586 Bacteria 4025
847 Ga0501070_0260332 3300049586 Bacteria 1418
848 Ga0501070_0690068 3300049586 Unclassified 808
849 Ga0501071_0038665 3300049587 Bacteria 3410
850 Ga0501072_0139806 3300049588 Bacteria 1930
851 Ga0501072_0227857 3300049588 Bacteria 1485
852 Ga0501073_0009746 3300049589 Bacteria 7073
853 Ga0501075_0006847 3300049591 Bacteria 7869
854 Ga0501076_0002990 3300049592 Bacteria 11741
855 Ga0501076_0043052 3300049592 Bacteria 3557
856 Ga0501079_0000379 3300049741 Bacteria 28580
857 Ga0501079_0125498 3300049741 Bacteria 1997
858 Ga0501079_0243350 3300049741 Bacteria 1406
859 Ga0501080_0012910 3300049742 Bacteria 7667
860 Ga0501080_0032326 3300049742 Bacteria 4880
861 Ga0501080_0308225 3300049742 Bacteria 1435
862 Ga0501081_0000033 3300049743 Bacteria 51492
863 Ga0501083_0091167 3300049744 Bacteria 2012
864 Ga0501035_0004436 3300049822 Bacteria 13316
865 Ga0501044_0005860 3300049823 Bacteria 13610
866 Ga0501044_0094254 3300049823 Bacteria 3019
867 Ga0501044_0132508 3300049823 Bacteria 2486
868 Ga0501045_0036136 3300049824 Bacteria 3587
869 nmdc:mga07m45_327029_c1 3300050496 Unclassified 891
870 nmdc:mga05p37_3041_c1 3300050507 Bacteria 19469
871 nmdc:mga09592_324265_c1 3300050508 Bacteria 1334
872 nmdc:mga09592_5026_c1 3300050508 Bacteria 10727
873 nmdc:mga0qj67_1705_c1 3300050509 Bacteria 15492
874 nmdc:mga0qj67_231261_c1 3300050509 Bacteria 1500
875 nmdc:mga06r32_2163_c1 3300050510 Bacteria 17587
876 nmdc:mga06r32_226428_c1 3300050510 Bacteria 1858
877 nmdc:mga08y16_289_c1 3300050511 Bacteria 45654
878 nmdc:mga08y16_31530_c1 3300050511 Bacteria 5575
879 nmdc:mga0n895_112788_c1 3300050512 Bacteria 2736
880 nmdc:mga0n895_140865_c1 3300050512 Bacteria 2440
881 nmdc:mga0n895_361831_c1 3300050512 Bacteria 1469
882 nmdc:mga0n895_392128_c1 3300050512 Bacteria 1405
883 nmdc:mga0n895_4459_c1 3300050512 Bacteria 11502
884 nmdc:mga0rr50_11469_c1 3300050513 Bacteria 5677
885 nmdc:mga0rr50_141250_c1 3300050513 Bacteria 1937
886 nmdc:mga0rr50_168968_c1 3300050513 Bacteria 1780
887 nmdc:mga0rr50_308633_c1 3300050513 Bacteria 1325
888 nmdc:mga0rr50_576477_c1 3300050513 Bacteria 959
889 nmdc:mga08x19_198328_c1 3300050514 Bacteria 1375
890 nmdc:mga0a205_17258_c1 3300050515 Bacteria 6763
891 nmdc:mga0a205_249588_c1 3300050515 Unclassified 1654
892 nmdc:mga0a205_3619_c1 3300050515 Bacteria 13829
893 nmdc:mga0a205_733_c2 3300050515 Bacteria 10917
894 Ga0495601_0000418 3300053077 Bacteria 22241
895 Ga0495601_0002208 3300053077 Bacteria 10952
896 Ga0495601_0003992 3300053077 Bacteria 8492
897 Ga0495601_0017457 3300053077 Bacteria 4356
898 Ga0495601_0041803 3300053077 Bacteria 2874
899 Ga0495612_0000666 3300053078 Bacteria 13871
900 Ga0495612_0011282 3300053078 Bacteria 3602
901 Ga0495612_0011744 3300053078 Bacteria 3530
902 Ga0495612_0020362 3300053078 Bacteria 2658
903 Ga0495595_0003514 3300053084 Bacteria 6221
904 Ga0495595_0013087 3300053084 Bacteria 3499
905 Ga0495595_0025852 3300053084 Unclassified 2604
906 Ga0495595_0026794 3300053084 Bacteria 2563
907 Ga0495595_0047076 3300053084 Bacteria 1988
908 Ga0495619_0002359 3300053085 Bacteria 12422
909 Ga0495619_0002566 3300053085 Bacteria 11887
910 Ga0495619_0007346 3300053085 Bacteria 6982
911 Ga0495619_0007524 3300053085 Bacteria 6899
912 Ga0495619_0017182 3300053085 Bacteria 4582
913 Ga0495619_0021147 3300053085 Bacteria 4151
914 Ga0495619_0036672 3300053085 Unclassified 3193
915 Ga0495619_0061266 3300053085 Bacteria 2503
916 Ga0495619_0098848 3300053085 Bacteria 1984
917 Ga0500643_002005 3300053087 Bacteria 10963
918 Ga0500644_0013518 3300053088 Bacteria 2281
919 Ga0500566_0105691 3300053094 Bacteria 1537
920 Ga0500650_0097840 3300053098 Bacteria 1374
921 Ga0500593_035093 3300053117 Bacteria 2245
922 Ga0500594_0047025 3300053118 Bacteria 1202
923 Ga0500595_000002 3300053119 Bacteria 1074388
924 Ga0500652_003429 3300053131 Bacteria 4801
925 Ga0500652_154862 3300053131 Bacteria 949
926 Ga0500616_0000002 3300053153 Bacteria 1611257
927 Ga0500645_000086 3300053730 Bacteria 74512
928 Ga0500645_004764 3300053730 Bacteria 5135
929 Ga0501084_0074934 3300054114 Bacteria 2835
930 Ga0501082_0003399 3300060353 Bacteria 13894
931 Ga0501082_0203082 3300060353 Bacteria 1724
932 Ga0501082_0306932 3300060353 Unclassified 1382
933 Ga0501082_0439431 3300060353 Bacteria 1140
934 Ga0466962_0080838 3300061719 Bacteria 1554
935 Ga0530510_0167878 3300061734 Bacteria 1625

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300034819 Ga0373958_0051445 Ga0373958_0051445_167_859 230
2 3300046461 Ga0495641_0121583 Ga0495641_0121583_29_721 230
3 3300046473 Ga0495582_0106862 Ga0495582_0106862_29_721 230
4 3300046642 Ga0495634_0325765 Ga0495634_0325765_12_704 230
5 3300048905 Ga0496102_0909528 Ga0496102_0909528_29_721 230
6 3300035111 Ga0373923_0188808 Ga0373923_0188808_194_928 243
7 3300049580 Ga0501046_0098596 Ga0501046_0098596_207_944 245
8 3300049586 Ga0501070_0690068 Ga0501070_0690068_12_794 260
9 3300049571 Ga0501034_0000516 Ga0501034_0000516_40724_41512 261
10 3300049571 Ga0501034_0037478 Ga0501034_0037478_393_1181 261
11 3300036401 Ga0373937_0029009 Ga0373937_0029009_26_865 264
12 3300009093 Ga0105240_10177548 Ga0105240_101775482 268
13 3300009148 Ga0105243_10002051 Ga0105243_100020519 268
14 3300009174 Ga0105241_10001526 Ga0105241_100015269 268
15 3300009176 Ga0105242_10000399 Ga0105242_1000039920 268
16 3300009177 Ga0105248_10004145 Ga0105248_100041454 268
17 3300013100 Ga0157373_10006645 Ga0157373_100066453 268
18 3300013102 Ga0157371_10015424 Ga0157371_100154245 268
19 3300013104 Ga0157370_10144803 Ga0157370_101448033 268
20 3300013297 Ga0157378_10011328 Ga0157378_100113282 268
21 3300013307 Ga0157372_10001162 Ga0157372_1000116220 268
22 3300013307 Ga0157372_10531519 Ga0157372_105315191 268
23 3300014326 Ga0157380_10000140 Ga0157380_1000014012 268
24 3300014969 Ga0157376_10000034 Ga0157376_100000342 268
25 3300035083 Ga0373926_0006367 Ga0373926_0006367_2890_3696 268
26 3300035083 Ga0373926_0009032 Ga0373926_0009032_911_1717 268
27 3300035086 Ga0373934_0178791 Ga0373934_0178791_47_853 268
28 3300035088 Ga0373940_0001059 Ga0373940_0001059_15_821 268
29 3300035089 Ga0373944_0016839 Ga0373944_0016839_1094_1900 268
30 3300035113 Ga0373936_0023704 Ga0373936_0023704_1301_2107 268
31 3300035116 Ga0373945_0000631 Ga0373945_0000631_7906_8712 268
32 3300035118 Ga0373954_0088350 Ga0373954_0088350_472_1278 268
33 3300035170 Ga0373943_0000576 Ga0373943_0000576_13655_14461 268
34 3300035171 Ga0373946_0020057 Ga0373946_0020057_435_1241 268
35 3300035172 Ga0373955_0008616 Ga0373955_0008616_3319_4125 268
36 3300035172 Ga0373955_0266221 Ga0373955_0266221_198_1007 268
37 3300035692 Ga0373935_0010279 Ga0373935_0010279_1578_2384 268
38 3300035695 Ga0373927_0000994 Ga0373927_0000994_19159_19965 268
39 3300035695 Ga0373927_0125644 Ga0373927_0125644_166_972 268
40 3300035695 Ga0373927_0247215 Ga0373927_0247215_166_972 268
41 3300035725 Ga0373947_0000084 Ga0373947_0000084_20420_21226 268
42 3300035725 Ga0373947_0179277 Ga0373947_0179277_205_1011 268
43 3300036401 Ga0373937_0029562 Ga0373937_0029562_1961_2767 268
44 3300037068 Ga0373925_0002271 Ga0373925_0002271_1805_2611 268
45 3300037068 Ga0373925_0105792 Ga0373925_0105792_1230_2036 268
46 3300037312 Ga0395899_0018964 Ga0395899_0018964_3501_4307 268
47 3300037418 Ga0395900_0033443 Ga0395900_0033443_4169_4975 268
48 3300037466 Ga0395898_0002017 Ga0395898_0002017_9959_10765 268
49 3300037466 Ga0395898_0070625 Ga0395898_0070625_979_1785 268
50 3300038443 Ga0395901_0040672 Ga0395901_0040672_3498_4304 268
51 3300044694 Ga0466963_0011264 Ga0466963_0011264_48_857 268
52 3300044842 Ga0466957_0444620 Ga0466957_0444620_20_829 268
53 3300045836 Ga0466958_0069110 Ga0466958_0069110_423_1232 268
54 3300045976 Ga0466967_0001558 Ga0466967_0001558_4365_5174 268
55 3300046454 Ga0495592_0012448 Ga0495592_0012448_2893_3699 268
56 3300046459 Ga0495629_0181730 Ga0495629_0181730_311_1117 268
57 3300046462 Ga0495651_0248990 Ga0495651_0248990_296_1102 268
58 3300046463 Ga0495653_0080969 Ga0495653_0080969_473_1279 268
59 3300046463 Ga0495653_0083117 Ga0495653_0083117_260_1066 268
60 3300046472 Ga0495580_0014617 Ga0495580_0014617_4212_5018 268
61 3300046475 Ga0495639_0034974 Ga0495639_0034974_212_1018 268
62 3300046476 Ga0495662_0012418 Ga0495662_0012418_3244_4050 268
63 3300046477 Ga0495664_0000810 Ga0495664_0000810_4932_5738 268
64 3300046477 Ga0495664_0005968 Ga0495664_0005968_3715_4521 268
65 3300046511 Ga0495608_0258057 Ga0495608_0258057_247_1053 268
66 3300046514 Ga0495618_0001056 Ga0495618_0001056_989_1795 268
67 3300046514 Ga0495618_0139377 Ga0495618_0139377_176_982 268
68 3300046516 Ga0495628_0024488 Ga0495628_0024488_2458_3264 268
69 3300046517 Ga0495630_0002361 Ga0495630_0002361_1606_2412 268
70 3300046517 Ga0495630_0037747 Ga0495630_0037747_2441_3247 268
71 3300046517 Ga0495630_0104139 Ga0495630_0104139_386_1192 268
72 3300046526 Ga0495666_0010301 Ga0495666_0010301_2949_3755 268
73 3300046529 Ga0495652_0042569 Ga0495652_0042569_1968_2774 268
74 3300046531 Ga0495665_0010372 Ga0495665_0010372_628_1434 268
75 3300046531 Ga0495665_0033062 Ga0495665_0033062_260_1066 268
76 3300046531 Ga0495665_0054425 Ga0495665_0054425_401_1207 268
77 3300046533 Ga0495640_0071285 Ga0495640_0071285_421_1227 268
78 3300046536 Ga0495587_0086202 Ga0495587_0086202_310_1116 268
79 3300046543 Ga0495645_0001019 Ga0495645_0001019_6291_7097 268
80 3300046557 Ga0495622_0022047 Ga0495622_0022047_675_1481 268
81 3300046559 Ga0495667_0003202 Ga0495667_0003202_7115_7921 268
82 3300046642 Ga0495634_0002529 Ga0495634_0002529_1607_2413 268
83 3300046663 Ga0495635_0006462 Ga0495635_0006462_1805_2611 268
84 3300046663 Ga0495635_0055975 Ga0495635_0055975_152_958 268
85 3300046674 Ga0495588_0040840 Ga0495588_0040840_107_913 268
86 3300046675 Ga0495657_0041262 Ga0495657_0041262_161_967 268
87 3300046678 Ga0495599_0052311 Ga0495599_0052311_703_1509 268
88 3300046679 Ga0495623_0102325 Ga0495623_0102325_20_826 268
89 3300046683 Ga0495658_0027556 Ga0495658_0027556_1678_2484 268
90 3300046689 Ga0495613_0012997 Ga0495613_0012997_3452_4258 268
91 3300046689 Ga0495613_0082469 Ga0495613_0082469_566_1372 268
92 3300046690 Ga0495624_0021752 Ga0495624_0021752_1838_2644 268
93 3300046690 Ga0495624_0048734 Ga0495624_0048734_770_1576 268
94 3300046809 Ga0495600_0016927 Ga0495600_0016927_3798_4604 268
95 3300047315 Ga0495581_0001980 Ga0495581_0001980_7350_8156 268
96 3300047315 Ga0495581_0038963 Ga0495581_0038963_214_1020 268
97 3300047317 Ga0495604_0035932 Ga0495604_0035932_2631_3437 268
98 3300047319 Ga0495674_0162477 Ga0495674_0162477_885_1691 268
99 3300047319 Ga0495674_0238686 Ga0495674_0238686_261_1067 268
100 3300047319 Ga0495674_0538587 Ga0495674_0538587_12_818 268
101 3300047322 Ga0495680_0096580 Ga0495680_0096580_698_1504 268
102 3300047471 Ga0495684_0003231 Ga0495684_0003231_10324_11130 268
103 3300047471 Ga0495684_0025239 Ga0495684_0025239_1689_2495 268
104 3300047471 Ga0495684_0083439 Ga0495684_0083439_915_1721 268
105 3300047673 Ga0495593_0064928 Ga0495593_0064928_799_1605 268
106 3300048089 Ga0495614_0081315 Ga0495614_0081315_251_1057 268
107 3300048907 Ga0496104_0095591 Ga0496104_0095591_693_1499 268
108 3300048909 Ga0496106_0025013 Ga0496106_0025013_1921_2727 268
109 3300048912 Ga0496109_0004277 Ga0496109_0004277_11107_11913 268
110 3300048915 Ga0496112_0076436 Ga0496112_0076436_423_1229 268
111 3300049570 Ga0501033_0239233 Ga0501033_0239233_102_911 268
112 3300050496 nmdc:mga07m45_327029_c1 nmdc:mga07m45_327029_c1_73_879 268
113 3300053077 Ga0495601_0041803 Ga0495601_0041803_108_914 268
114 3300053078 Ga0495612_0000666 Ga0495612_0000666_5045_5851 268
115 3300053084 Ga0495595_0003514 Ga0495595_0003514_5176_5982 268
116 3300053085 Ga0495619_0007524 Ga0495619_0007524_4563_5369 268
117 3300053085 Ga0495619_0061266 Ga0495619_0061266_20_826 268
118 3300053153 Ga0500616_0000002 Ga0500616_0000002_544954_545760 268
119 3300053730 Ga0500645_000086 Ga0500645_000086_21912_22718 268
120 3300005336 Ga0070680_100189244 Ga0070680_1001892442 271
121 3300025917 Ga0207660_10139087 Ga0207660_101390872 271
122 3300005545 Ga0070695_100097437 Ga0070695_1000974372 272
123 3300014326 Ga0157380_10294780 Ga0157380_102947802 272
124 3300048925 Ga0496122_0016749 Ga0496122_0016749_2085_2948 272
125 3300048926 Ga0496123_0001118 Ga0496123_0001118_24109_24972 272
126 3300053131 Ga0500652_154862 Ga0500652_154862_56_919 272
127 3300049570 Ga0501033_0429803 Ga0501033_0429803_48_878 273
128 3300049575 Ga0501039_0006041 Ga0501039_0006041_4129_4959 273
129 3300049576 Ga0501040_0014268 Ga0501040_0014268_3901_4731 273
130 3300049577 Ga0501041_0006521 Ga0501041_0006521_416_1246 273
131 3300049578 Ga0501042_0048779 Ga0501042_0048779_1024_1854 273
132 3300049579 Ga0501043_0048654 Ga0501043_0048654_1405_2235 273
133 3300049580 Ga0501046_0063893 Ga0501046_0063893_42_872 273
134 3300049587 Ga0501071_0038665 Ga0501071_0038665_1300_2130 273
135 3300049588 Ga0501072_0139806 Ga0501072_0139806_807_1637 273
136 3300049591 Ga0501075_0006847 Ga0501075_0006847_3976_4806 273
137 3300049592 Ga0501076_0002990 Ga0501076_0002990_4545_5375 273
138 3300049741 Ga0501079_0000379 Ga0501079_0000379_4208_5038 273
139 3300049742 Ga0501080_0012910 Ga0501080_0012910_5088_5918 273
140 3300049743 Ga0501081_0000033 Ga0501081_0000033_10800_11630 273
141 3300049824 Ga0501045_0036136 Ga0501045_0036136_1421_2251 273
142 3300054114 Ga0501084_0074934 Ga0501084_0074934_1062_1892 273
143 3300060353 Ga0501082_0003399 Ga0501082_0003399_3162_3992 273
144 3300061734 Ga0530510_0167878 Ga0530510_0167878_699_1529 273
145 3300028577 Ga0265318_10072287 Ga0265318_100722871 274
146 3300031247 Ga0265340_10068395 Ga0265340_100683952 274
147 3300053117 Ga0500593_035093 Ga0500593_035093_1315_2139 274
148 3300006846 Ga0075430_100095225 Ga0075430_1000952252 275
149 3300049575 Ga0501039_0054336 Ga0501039_0054336_1089_1919 275
150 3300049588 Ga0501072_0227857 Ga0501072_0227857_41_871 275
151 3300049741 Ga0501079_0125498 Ga0501079_0125498_648_1478 275
152 3300050509 nmdc:mga0qj67_231261_c1 nmdc:mga0qj67_231261_c1_82_912 275
153 3300050510 nmdc:mga06r32_226428_c1 nmdc:mga06r32_226428_c1_374_1204 275
154 3300006353 Ga0075370_10252665 Ga0075370_102526652 277
155 3300005435 Ga0070714_100068290 Ga0070714_1000682901 278
156 3300021384 Ga0213876_10037930 Ga0213876_100379302 278
157 3300025929 Ga0207664_10162640 Ga0207664_101626402 278
158 3300028800 Ga0265338_10009970 Ga0265338_100099709 278
159 3300031241 Ga0265325_10007949 Ga0265325_100079493 278
160 3300031249 Ga0265339_10000060 Ga0265339_1000006069 278
161 3300031344 Ga0265316_10154592 Ga0265316_101545922 278
162 3300031595 Ga0265313_10000094 Ga0265313_1000009465 278
163 3300039437 Ga0436365_1446426 Ga0436365_1446426_4965_5801 278
164 3300048922 Ga0496119_0000906 Ga0496119_0000906_27083_27964 278
165 3300048924 Ga0496121_0245841 Ga0496121_0245841_305_1141 278
166 3300049581 Ga0501047_0463921 Ga0501047_0463921_80_919 278
167 3300053730 Ga0500645_004764 Ga0500645_004764_3012_3902 278
168 3300000042 ARSoilYngRDRAFT_c00118 ARSoilYngRDRAFT_0011818 279
169 3300000043 ARcpr5yngRDRAFT_c000035 ARcpr5yngRDRAFT_0000352 279
170 3300000652 ARCol0yngRDRAFT_1000516 ARCol0yngRDRAFT_10005162 279
171 3300001976 JGI24752J21851_1007583 JGI24752J21851_10075831 279
172 3300001977 JGI24746J21847_1011725 JGI24746J21847_10117252 279
173 3300001978 JGI24747J21853_1002987 JGI24747J21853_10029872 279
174 3300001989 JGI24739J22299_10000158 JGI24739J22299_1000015824 279
175 3300001990 JGI24737J22298_10001510 JGI24737J22298_100015102 279
176 3300001990 JGI24737J22298_10001948 JGI24737J22298_100019489 279
177 3300002070 JGI24750J21931_1000477 JGI24750J21931_10004776 279
178 3300002073 JGI24745J21846_1000120 JGI24745J21846_10001203 279
179 3300002075 JGI24738J21930_10001316 JGI24738J21930_100013162 279
180 3300002076 JGI24749J21850_1000215 JGI24749J21850_10002156 279
181 3300002076 JGI24749J21850_1004682 JGI24749J21850_10046822 279
182 3300002077 JGI24744J21845_10012002 JGI24744J21845_100120022 279
183 3300002126 JGI24035J26624_1000023 JGI24035J26624_10000232 279
184 3300002239 JGI24034J26672_10000641 JGI24034J26672_100006412 279
185 3300002244 JGI24742J22300_10002624 JGI24742J22300_100026242 279
186 3300005276 Ga0065717_1000203 Ga0065717_10002032 279
187 3300005289 Ga0065704_10090673 Ga0065704_100906733 279
188 3300005290 Ga0065712_10018330 Ga0065712_100183302 279
189 3300005290 Ga0065712_10093636 Ga0065712_100936362 279
190 3300005293 Ga0065715_10001166 Ga0065715_1000116612 279
191 3300005293 Ga0065715_10021066 Ga0065715_100210662 279
192 3300005293 Ga0065715_10099722 Ga0065715_100997221 279
193 3300005327 Ga0070658_10006919 Ga0070658_100069192 279
194 3300005327 Ga0070658_10028299 Ga0070658_100282996 279
195 3300005327 Ga0070658_10055484 Ga0070658_100554843 279
196 3300005328 Ga0070676_10015064 Ga0070676_100150642 279
197 3300005329 Ga0070683_100012601 Ga0070683_1000126016 279
198 3300005329 Ga0070683_100051385 Ga0070683_1000513855 279
199 3300005330 Ga0070690_100000727 Ga0070690_1000007272 279
200 3300005330 Ga0070690_100023181 Ga0070690_1000231812 279
201 3300005330 Ga0070690_100038800 Ga0070690_1000388002 279
202 3300005330 Ga0070690_100291883 Ga0070690_1002918832 279
203 3300005331 Ga0070670_100040022 Ga0070670_1000400225 279
204 3300005331 Ga0070670_100046230 Ga0070670_1000462302 279
205 3300005331 Ga0070670_100566337 Ga0070670_1005663371 279
206 3300005333 Ga0070677_10002396 Ga0070677_100023965 279
207 3300005334 Ga0068869_100002166 Ga0068869_1000021662 279
208 3300005334 Ga0068869_100312538 Ga0068869_1003125382 279
209 3300005335 Ga0070666_10022637 Ga0070666_100226372 279
210 3300005335 Ga0070666_10025033 Ga0070666_100250332 279
211 3300005336 Ga0070680_100006389 Ga0070680_10000638910 279
212 3300005336 Ga0070680_100018615 Ga0070680_1000186154 279
213 3300005336 Ga0070680_100057732 Ga0070680_1000577323 279
214 3300005336 Ga0070680_100073630 Ga0070680_1000736302 279
215 3300005336 Ga0070680_100289243 Ga0070680_1002892432 279
216 3300005336 Ga0070680_100448654 Ga0070680_1004486541 279
217 3300005337 Ga0070682_100002724 Ga0070682_1000027242 279
218 3300005337 Ga0070682_100038338 Ga0070682_1000383382 279
219 3300005337 Ga0070682_100130177 Ga0070682_1001301772 279
220 3300005338 Ga0068868_100002949 Ga0068868_10000294910 279
221 3300005338 Ga0068868_100021585 Ga0068868_1000215855 279
222 3300005339 Ga0070660_100000985 Ga0070660_1000009852 279
223 3300005339 Ga0070660_100026353 Ga0070660_1000263532 279
224 3300005340 Ga0070689_100000646 Ga0070689_10000064625 279
225 3300005340 Ga0070689_100002989 Ga0070689_1000029897 279
226 3300005340 Ga0070689_100014280 Ga0070689_1000142804 279
227 3300005341 Ga0070691_10000060 Ga0070691_1000006026 279
228 3300005343 Ga0070687_100000773 Ga0070687_10000077311 279
229 3300005344 Ga0070661_100015592 Ga0070661_1000155924 279
230 3300005344 Ga0070661_100206021 Ga0070661_1002060212 279
231 3300005345 Ga0070692_10000273 Ga0070692_100002736 279
232 3300005347 Ga0070668_100007804 Ga0070668_1000078042 279
233 3300005353 Ga0070669_100019129 Ga0070669_1000191292 279
234 3300005354 Ga0070675_100003854 Ga0070675_1000038542 279
235 3300005354 Ga0070675_100036283 Ga0070675_1000362834 279
236 3300005355 Ga0070671_100000349 Ga0070671_10000034916 279
237 3300005355 Ga0070671_100032167 Ga0070671_1000321674 279
238 3300005355 Ga0070671_100111836 Ga0070671_1001118361 279
239 3300005356 Ga0070674_100000152 Ga0070674_1000001525 279
240 3300005356 Ga0070674_100026791 Ga0070674_1000267912 279
241 3300005356 Ga0070674_100031793 Ga0070674_1000317933 279
242 3300005364 Ga0070673_100007455 Ga0070673_1000074556 279
243 3300005365 Ga0070688_100002079 Ga0070688_1000020797 279
244 3300005365 Ga0070688_100002194 Ga0070688_1000021942 279
245 3300005365 Ga0070688_100091062 Ga0070688_1000910622 279
246 3300005366 Ga0070659_100000621 Ga0070659_10000062129 279
247 3300005366 Ga0070659_100037533 Ga0070659_1000375332 279
248 3300005367 Ga0070667_100000810 Ga0070667_10000081012 279
249 3300005406 Ga0070703_10002626 Ga0070703_100026264 279
250 3300005434 Ga0070709_10024168 Ga0070709_100241682 279
251 3300005435 Ga0070714_100027007 Ga0070714_1000270073 279
252 3300005435 Ga0070714_100049823 Ga0070714_1000498233 279
253 3300005435 Ga0070714_100102916 Ga0070714_1001029162 279
254 3300005435 Ga0070714_100617703 Ga0070714_1006177031 279
255 3300005436 Ga0070713_100015547 Ga0070713_1000155475 279
256 3300005436 Ga0070713_100045893 Ga0070713_1000458933 279
257 3300005436 Ga0070713_100081039 Ga0070713_1000810394 279
258 3300005436 Ga0070713_100084255 Ga0070713_1000842553 279
259 3300005437 Ga0070710_10029249 Ga0070710_100292493 279
260 3300005438 Ga0070701_10000042 Ga0070701_1000004233 279
261 3300005438 Ga0070701_10008593 Ga0070701_100085935 279
262 3300005439 Ga0070711_100008373 Ga0070711_1000083732 279
263 3300005439 Ga0070711_100132629 Ga0070711_1001326292 279
264 3300005440 Ga0070705_100005564 Ga0070705_1000055646 279
265 3300005440 Ga0070705_100096394 Ga0070705_1000963941 279
266 3300005440 Ga0070705_100147919 Ga0070705_1001479191 279
267 3300005441 Ga0070700_100000329 Ga0070700_10000032912 279
268 3300005441 Ga0070700_100023379 Ga0070700_1000233792 279
269 3300005444 Ga0070694_100002007 Ga0070694_1000020072 279
270 3300005444 Ga0070694_100002748 Ga0070694_1000027483 279
271 3300005445 Ga0070708_100045860 Ga0070708_1000458605 279
272 3300005455 Ga0070663_100037014 Ga0070663_1000370143 279
273 3300005455 Ga0070663_100090670 Ga0070663_1000906701 279
274 3300005456 Ga0070678_100013734 Ga0070678_1000137345 279
275 3300005456 Ga0070678_100062841 Ga0070678_1000628412 279
276 3300005457 Ga0070662_100064811 Ga0070662_1000648112 279
277 3300005457 Ga0070662_100182156 Ga0070662_1001821562 279
278 3300005457 Ga0070662_100333215 Ga0070662_1003332152 279
279 3300005457 Ga0070662_100548462 Ga0070662_1005484621 279
280 3300005458 Ga0070681_10004332 Ga0070681_100043323 279
281 3300005458 Ga0070681_10005076 Ga0070681_100050769 279
282 3300005458 Ga0070681_10016427 Ga0070681_100164275 279
283 3300005458 Ga0070681_10148826 Ga0070681_101488262 279
284 3300005459 Ga0068867_100007473 Ga0068867_10000747311 279
285 3300005459 Ga0068867_100119720 Ga0068867_1001197202 279
286 3300005466 Ga0070685_10006180 Ga0070685_100061804 279
287 3300005466 Ga0070685_10007245 Ga0070685_100072457 279
288 3300005466 Ga0070685_10129989 Ga0070685_101299892 279
289 3300005467 Ga0070706_100157073 Ga0070706_1001570732 279
290 3300005518 Ga0070699_100270906 Ga0070699_1002709062 279
291 3300005530 Ga0070679_100002742 Ga0070679_10000274212 279
292 3300005530 Ga0070679_100157221 Ga0070679_1001572213 279
293 3300005530 Ga0070679_100206314 Ga0070679_1002063141 279
294 3300005530 Ga0070679_100222698 Ga0070679_1002226982 279
295 3300005530 Ga0070679_100236175 Ga0070679_1002361752 279
296 3300005535 Ga0070684_100000464 Ga0070684_10000046424 279
297 3300005535 Ga0070684_100376832 Ga0070684_1003768322 279
298 3300005536 Ga0070697_100013327 Ga0070697_1000133276 279
299 3300005539 Ga0068853_100001029 Ga0068853_1000010297 279
300 3300005543 Ga0070672_100020218 Ga0070672_1000202184 279
301 3300005543 Ga0070672_100078130 Ga0070672_1000781302 279
302 3300005544 Ga0070686_100001527 Ga0070686_10000152710 279
303 3300005545 Ga0070695_100010249 Ga0070695_1000102492 279
304 3300005545 Ga0070695_100047425 Ga0070695_1000474252 279
305 3300005546 Ga0070696_100015481 Ga0070696_1000154813 279
306 3300005546 Ga0070696_100098522 Ga0070696_1000985222 279
307 3300005547 Ga0070693_100000266 Ga0070693_10000026618 279
308 3300005547 Ga0070693_100036753 Ga0070693_1000367533 279
309 3300005547 Ga0070693_100060687 Ga0070693_1000606872 279
310 3300005548 Ga0070665_100108939 Ga0070665_1001089392 279
311 3300005548 Ga0070665_100168547 Ga0070665_1001685471 279
312 3300005549 Ga0070704_100010668 Ga0070704_1000106684 279
313 3300005549 Ga0070704_100104573 Ga0070704_1001045732 279
314 3300005563 Ga0068855_100041697 Ga0068855_1000416975 279
315 3300005563 Ga0068855_100061239 Ga0068855_1000612393 279
316 3300005564 Ga0070664_100015424 Ga0070664_1000154244 279
317 3300005564 Ga0070664_100023574 Ga0070664_1000235744 279
318 3300005577 Ga0068857_100000888 Ga0068857_10000088817 279
319 3300005577 Ga0068857_100239796 Ga0068857_1002397962 279
320 3300005577 Ga0068857_100691623 Ga0068857_1006916231 279
321 3300005578 Ga0068854_100005378 Ga0068854_10000537811 279
322 3300005614 Ga0068856_100003260 Ga0068856_10000326011 279
323 3300005614 Ga0068856_100126633 Ga0068856_1001266332 279
324 3300005614 Ga0068856_100160523 Ga0068856_1001605232 279
325 3300005614 Ga0068856_100494033 Ga0068856_1004940332 279
326 3300005615 Ga0070702_100053415 Ga0070702_1000534152 279
327 3300005616 Ga0068852_100000579 Ga0068852_10000057924 279
328 3300005616 Ga0068852_100580680 Ga0068852_1005806801 279
329 3300005617 Ga0068859_100003690 Ga0068859_10000369020 279
330 3300005617 Ga0068859_100146749 Ga0068859_1001467491 279
331 3300005617 Ga0068859_100231653 Ga0068859_1002316532 279
332 3300005617 Ga0068859_100233619 Ga0068859_1002336192 279
333 3300005618 Ga0068864_100001260 Ga0068864_1000012608 279
334 3300005618 Ga0068864_100106019 Ga0068864_1001060192 279
335 3300005618 Ga0068864_100236411 Ga0068864_1002364112 279
336 3300005618 Ga0068864_100710527 Ga0068864_1007105271 279
337 3300005718 Ga0068866_10001077 Ga0068866_100010773 279
338 3300005718 Ga0068866_10018692 Ga0068866_100186923 279
339 3300005719 Ga0068861_100001782 Ga0068861_10000178212 279
340 3300005719 Ga0068861_100351967 Ga0068861_1003519672 279
341 3300005834 Ga0068851_10046717 Ga0068851_100467172 279
342 3300005840 Ga0068870_10000108 Ga0068870_100001089 279
343 3300005841 Ga0068863_100001201 Ga0068863_10000120112 279
344 3300005841 Ga0068863_100324236 Ga0068863_1003242362 279
345 3300005842 Ga0068858_100000419 Ga0068858_10000041942 279
346 3300005842 Ga0068858_100054459 Ga0068858_1000544592 279
347 3300005842 Ga0068858_100181366 Ga0068858_1001813662 279
348 3300005843 Ga0068860_100001359 Ga0068860_10000135914 279
349 3300005843 Ga0068860_100475076 Ga0068860_1004750761 279
350 3300005843 Ga0068860_100875780 Ga0068860_1008757801 279
351 3300005843 Ga0068860_100896963 Ga0068860_1008969631 279
352 3300005844 Ga0068862_100005815 Ga0068862_10000581511 279
353 3300005844 Ga0068862_100056562 Ga0068862_1000565622 279
354 3300005937 Ga0081455_10000009 Ga0081455_1000000930 279
355 3300005937 Ga0081455_10004982 Ga0081455_1000498215 279
356 3300005937 Ga0081455_10117653 Ga0081455_101176532 279
357 3300006028 Ga0070717_10021459 Ga0070717_100214595 279
358 3300006028 Ga0070717_10527144 Ga0070717_105271442 279
359 3300006058 Ga0075432_10021698 Ga0075432_100216982 279
360 3300006163 Ga0070715_10020498 Ga0070715_100204982 279
361 3300006173 Ga0070716_100001823 Ga0070716_1000018235 279
362 3300006173 Ga0070716_100016982 Ga0070716_1000169822 279
363 3300006175 Ga0070712_100014499 Ga0070712_1000144993 279
364 3300006175 Ga0070712_100032441 Ga0070712_1000324412 279
365 3300006175 Ga0070712_100050661 Ga0070712_1000506611 279
366 3300006175 Ga0070712_100051125 Ga0070712_1000511253 279
367 3300006175 Ga0070712_100499292 Ga0070712_1004992921 279
368 3300006178 Ga0075367_10009088 Ga0075367_100090883 279
369 3300006194 Ga0075427_10001549 Ga0075427_100015492 279
370 3300006237 Ga0097621_100021768 Ga0097621_1000217684 279
371 3300006237 Ga0097621_100031346 Ga0097621_1000313462 279
372 3300006237 Ga0097621_100073441 Ga0097621_1000734412 279
373 3300006353 Ga0075370_10131248 Ga0075370_101312482 279
374 3300006358 Ga0068871_100000417 Ga0068871_1000004179 279
375 3300006358 Ga0068871_100011895 Ga0068871_1000118952 279
376 3300006358 Ga0068871_100357746 Ga0068871_1003577462 279
377 3300006844 Ga0075428_100010422 Ga0075428_1000104227 279
378 3300006846 Ga0075430_100001576 Ga0075430_10000157610 279
379 3300006847 Ga0075431_100002654 Ga0075431_10000265416 279
380 3300006852 Ga0075433_10011770 Ga0075433_100117702 279
381 3300006852 Ga0075433_10017308 Ga0075433_100173083 279
382 3300006852 Ga0075433_10047158 Ga0075433_100471583 279
383 3300006852 Ga0075433_10221434 Ga0075433_102214342 279
384 3300006871 Ga0075434_100001354 Ga0075434_1000013547 279
385 3300006871 Ga0075434_100002767 Ga0075434_1000027679 279
386 3300006871 Ga0075434_100011160 Ga0075434_10001116010 279
387 3300006871 Ga0075434_100188185 Ga0075434_1001881852 279
388 3300006880 Ga0075429_100001895 Ga0075429_10000189516 279
389 3300006880 Ga0075429_100309124 Ga0075429_1003091242 279
390 3300006881 Ga0068865_100000450 Ga0068865_1000004502 279
391 3300006881 Ga0068865_100149202 Ga0068865_1001492021 279
392 3300006931 Ga0097620_100003690 Ga0097620_10000369020 279
393 3300006931 Ga0097620_100146739 Ga0097620_1001467391 279
394 3300006931 Ga0097620_100231649 Ga0097620_1002316492 279
395 3300006931 Ga0097620_100233630 Ga0097620_1002336302 279
396 3300007076 Ga0075435_100003745 Ga0075435_1000037458 279
397 3300007076 Ga0075435_100014388 Ga0075435_1000143883 279
398 3300007076 Ga0075435_100154700 Ga0075435_1001547002 279
399 3300007076 Ga0075435_100228984 Ga0075435_1002289842 279
400 3300007076 Ga0075435_100346988 Ga0075435_1003469881 279
401 3300009093 Ga0105240_10059540 Ga0105240_100595402 279
402 3300009094 Ga0111539_10000196 Ga0111539_1000019668 279
403 3300009094 Ga0111539_10013383 Ga0111539_100133832 279
404 3300009094 Ga0111539_10027016 Ga0111539_100270165 279
405 3300009094 Ga0111539_10655615 Ga0111539_106556151 279
406 3300009094 Ga0111539_11067943 Ga0111539_110679431 279
407 3300009098 Ga0105245_10026898 Ga0105245_100268985 279
408 3300009098 Ga0105245_10458835 Ga0105245_104588352 279
409 3300009101 Ga0105247_10013936 Ga0105247_100139364 279
410 3300009101 Ga0105247_10182088 Ga0105247_101820882 279
411 3300009101 Ga0105247_10212672 Ga0105247_102126721 279
412 3300009101 Ga0105247_10234103 Ga0105247_102341031 279
413 3300009147 Ga0114129_10013413 Ga0114129_100134131 279
414 3300009147 Ga0114129_10020551 Ga0114129_100205515 279
415 3300009148 Ga0105243_10044187 Ga0105243_100441872 279
416 3300009148 Ga0105243_10702399 Ga0105243_107023991 279
417 3300009174 Ga0105241_10132786 Ga0105241_101327862 279
418 3300009174 Ga0105241_10383803 Ga0105241_103838032 279
419 3300009176 Ga0105242_10066427 Ga0105242_100664273 279
420 3300009176 Ga0105242_10285747 Ga0105242_102857472 279
421 3300009177 Ga0105248_10068292 Ga0105248_100682923 279
422 3300009177 Ga0105248_10085160 Ga0105248_100851602 279
423 3300009545 Ga0105237_10006666 Ga0105237_1000666614 279
424 3300009545 Ga0105237_10038653 Ga0105237_100386532 279
425 3300009545 Ga0105237_10040533 Ga0105237_100405335 279
426 3300009545 Ga0105237_10458258 Ga0105237_104582582 279
427 3300009551 Ga0105238_10111550 Ga0105238_101115502 279
428 3300009551 Ga0105238_10432216 Ga0105238_104322162 279
429 3300009553 Ga0105249_10002756 Ga0105249_1000275616 279
430 3300009553 Ga0105249_10013099 Ga0105249_100130996 279
431 3300009553 Ga0105249_10831782 Ga0105249_108317822 279
432 3300010375 Ga0105239_10043528 Ga0105239_100435285 279
433 3300010375 Ga0105239_10105506 Ga0105239_101055063 279
434 3300010375 Ga0105239_10478136 Ga0105239_104781362 279
435 3300010375 Ga0105239_10493535 Ga0105239_104935352 279
436 3300011119 Ga0105246_10000033 Ga0105246_1000003342 279
437 3300011119 Ga0105246_10203566 Ga0105246_102035662 279
438 3300011119 Ga0105246_10254007 Ga0105246_102540071 279
439 3300013102 Ga0157371_10052511 Ga0157371_100525112 279
440 3300013104 Ga0157370_10114232 Ga0157370_101142322 279
441 3300013105 Ga0157369_10494186 Ga0157369_104941862 279
442 3300013296 Ga0157374_10002423 Ga0157374_1000242311 279
443 3300013296 Ga0157374_10201748 Ga0157374_102017482 279
444 3300013296 Ga0157374_10209982 Ga0157374_102099822 279
445 3300013296 Ga0157374_10228712 Ga0157374_102287122 279
446 3300013306 Ga0163162_10175648 Ga0163162_101756482 279
447 3300013306 Ga0163162_10429942 Ga0163162_104299421 279
448 3300013307 Ga0157372_10783681 Ga0157372_107836812 279
449 3300013308 Ga0157375_10000124 Ga0157375_1000012474 279
450 3300013308 Ga0157375_10022011 Ga0157375_100220113 279
451 3300013308 Ga0157375_10193278 Ga0157375_101932782 279
452 3300014325 Ga0163163_10000745 Ga0163163_100007452 279
453 3300014325 Ga0163163_10173646 Ga0163163_101736462 279
454 3300014325 Ga0163163_10591800 Ga0163163_105918001 279
455 3300014745 Ga0157377_10000117 Ga0157377_1000011758 279
456 3300014745 Ga0157377_10120726 Ga0157377_101207262 279
457 3300014968 Ga0157379_10000785 Ga0157379_1000078524 279
458 3300014968 Ga0157379_10020035 Ga0157379_100200352 279
459 3300014968 Ga0157379_10055182 Ga0157379_100551822 279
460 3300014968 Ga0157379_10507186 Ga0157379_105071861 279
461 3300020081 Ga0206354_10939082 Ga0206354_109390821 279
462 3300025271 Ga0207666_1000017 Ga0207666_10000173 279
463 3300025271 Ga0207666_1000448 Ga0207666_10004485 279
464 3300025290 Ga0207673_1000258 Ga0207673_10002587 279
465 3300025315 Ga0207697_10000009 Ga0207697_1000000920 279
466 3300025315 Ga0207697_10001569 Ga0207697_1000156915 279
467 3300025893 Ga0207682_10000301 Ga0207682_1000030111 279
468 3300025898 Ga0207692_10005897 Ga0207692_100058975 279
469 3300025899 Ga0207642_10001973 Ga0207642_100019733 279
470 3300025900 Ga0207710_10004684 Ga0207710_100046844 279
471 3300025900 Ga0207710_10094733 Ga0207710_100947332 279
472 3300025901 Ga0207688_10000012 Ga0207688_1000001213 279
473 3300025901 Ga0207688_10287309 Ga0207688_102873091 279
474 3300025904 Ga0207647_10005111 Ga0207647_1000511111 279
475 3300025904 Ga0207647_10017208 Ga0207647_100172083 279
476 3300025905 Ga0207685_10005072 Ga0207685_100050722 279
477 3300025906 Ga0207699_10001620 Ga0207699_100016209 279
478 3300025906 Ga0207699_10002309 Ga0207699_100023098 279
479 3300025907 Ga0207645_10000124 Ga0207645_1000012421 279
480 3300025907 Ga0207645_10008610 Ga0207645_100086106 279
481 3300025908 Ga0207643_10000046 Ga0207643_1000004613 279
482 3300025909 Ga0207705_10008788 Ga0207705_100087887 279
483 3300025909 Ga0207705_10027090 Ga0207705_100270904 279
484 3300025909 Ga0207705_10209221 Ga0207705_102092211 279
485 3300025911 Ga0207654_10003867 Ga0207654_1000386710 279
486 3300025911 Ga0207654_10051066 Ga0207654_100510662 279
487 3300025912 Ga0207707_10021900 Ga0207707_100219004 279
488 3300025912 Ga0207707_10052526 Ga0207707_100525265 279
489 3300025912 Ga0207707_10065374 Ga0207707_100653743 279
490 3300025912 Ga0207707_10140111 Ga0207707_101401112 279
491 3300025912 Ga0207707_10414139 Ga0207707_104141392 279
492 3300025912 Ga0207707_10530181 Ga0207707_105301811 279
493 3300025914 Ga0207671_10253315 Ga0207671_102533152 279
494 3300025915 Ga0207693_10005252 Ga0207693_100052525 279
495 3300025915 Ga0207693_10158542 Ga0207693_101585422 279
496 3300025915 Ga0207693_10185006 Ga0207693_101850062 279
497 3300025916 Ga0207663_10012608 Ga0207663_100126084 279
498 3300025916 Ga0207663_10066915 Ga0207663_100669152 279
499 3300025916 Ga0207663_10186245 Ga0207663_101862452 279
500 3300025917 Ga0207660_10001510 Ga0207660_100015105 279
501 3300025917 Ga0207660_10020034 Ga0207660_100200342 279
502 3300025917 Ga0207660_10264613 Ga0207660_102646132 279
503 3300025918 Ga0207662_10000222 Ga0207662_1000022220 279
504 3300025919 Ga0207657_10000162 Ga0207657_1000016252 279
505 3300025919 Ga0207657_10008982 Ga0207657_1000898212 279
506 3300025919 Ga0207657_10031279 Ga0207657_100312796 279
507 3300025920 Ga0207649_10000798 Ga0207649_1000079813 279
508 3300025920 Ga0207649_10050147 Ga0207649_100501472 279
509 3300025920 Ga0207649_10074301 Ga0207649_100743012 279
510 3300025921 Ga0207652_10066691 Ga0207652_100666912 279
511 3300025921 Ga0207652_10126524 Ga0207652_101265243 279
512 3300025921 Ga0207652_10150391 Ga0207652_101503912 279
513 3300025921 Ga0207652_10157030 Ga0207652_101570302 279
514 3300025921 Ga0207652_10272769 Ga0207652_102727692 279
515 3300025921 Ga0207652_10343981 Ga0207652_103439811 279
516 3300025922 Ga0207646_10153575 Ga0207646_101535752 279
517 3300025923 Ga0207681_10003611 Ga0207681_100036118 279
518 3300025924 Ga0207694_10090129 Ga0207694_100901292 279
519 3300025924 Ga0207694_10326208 Ga0207694_103262082 279
520 3300025925 Ga0207650_10031847 Ga0207650_100318475 279
521 3300025925 Ga0207650_10059776 Ga0207650_100597762 279
522 3300025925 Ga0207650_10230395 Ga0207650_102303952 279
523 3300025926 Ga0207659_10016376 Ga0207659_100163762 279
524 3300025927 Ga0207687_10011784 Ga0207687_100117846 279
525 3300025927 Ga0207687_10236956 Ga0207687_102369562 279
526 3300025928 Ga0207700_10000290 Ga0207700_1000029024 279
527 3300025928 Ga0207700_10022250 Ga0207700_100222505 279
528 3300025929 Ga0207664_10026121 Ga0207664_100261212 279
529 3300025929 Ga0207664_10097295 Ga0207664_100972952 279
530 3300025931 Ga0207644_10018037 Ga0207644_100180372 279
531 3300025931 Ga0207644_10124978 Ga0207644_101249782 279
532 3300025933 Ga0207706_10000368 Ga0207706_100003683 279
533 3300025933 Ga0207706_10007484 Ga0207706_1000748410 279
534 3300025933 Ga0207706_10058572 Ga0207706_100585722 279
535 3300025934 Ga0207686_10010832 Ga0207686_100108322 279
536 3300025934 Ga0207686_10034817 Ga0207686_100348173 279
537 3300025935 Ga0207709_10000256 Ga0207709_1000025613 279
538 3300025935 Ga0207709_10147387 Ga0207709_101473871 279
539 3300025936 Ga0207670_10450041 Ga0207670_104500411 279
540 3300025937 Ga0207669_10001765 Ga0207669_1000176511 279
541 3300025937 Ga0207669_10315477 Ga0207669_103154772 279
542 3300025937 Ga0207669_10585300 Ga0207669_105853001 279
543 3300025938 Ga0207704_10002423 Ga0207704_1000242311 279
544 3300025939 Ga0207665_10024323 Ga0207665_100243235 279
545 3300025940 Ga0207691_10000303 Ga0207691_100003034 279
546 3300025941 Ga0207711_10048233 Ga0207711_100482334 279
547 3300025942 Ga0207689_10000109 Ga0207689_1000010921 279
548 3300025944 Ga0207661_10010457 Ga0207661_1001045710 279
549 3300025944 Ga0207661_10106083 Ga0207661_101060832 279
550 3300025944 Ga0207661_10528559 Ga0207661_105285592 279
551 3300025945 Ga0207679_10000031 Ga0207679_10000031177 279
552 3300025945 Ga0207679_10068452 Ga0207679_100684523 279
553 3300025949 Ga0207667_10002481 Ga0207667_1000248124 279
554 3300025949 Ga0207667_10015271 Ga0207667_100152716 279
555 3300025949 Ga0207667_10078969 Ga0207667_100789694 279
556 3300025960 Ga0207651_10404483 Ga0207651_104044832 279
557 3300025961 Ga0207712_10001848 Ga0207712_1000184817 279
558 3300025961 Ga0207712_10307709 Ga0207712_103077092 279
559 3300025972 Ga0207668_10001339 Ga0207668_1000133911 279
560 3300025981 Ga0207640_10001185 Ga0207640_100011857 279
561 3300025986 Ga0207658_10016049 Ga0207658_100160492 279
562 3300025986 Ga0207658_10056945 Ga0207658_100569452 279
563 3300025986 Ga0207658_10102245 Ga0207658_101022451 279
564 3300026023 Ga0207677_10335012 Ga0207677_103350122 279
565 3300026035 Ga0207703_10008545 Ga0207703_100085452 279
566 3300026041 Ga0207639_10050194 Ga0207639_100501942 279
567 3300026067 Ga0207678_10000158 Ga0207678_1000015852 279
568 3300026067 Ga0207678_10030340 Ga0207678_100303402 279
569 3300026067 Ga0207678_10073370 Ga0207678_100733702 279
570 3300026067 Ga0207678_10141821 Ga0207678_101418212 279
571 3300026075 Ga0207708_10000098 Ga0207708_1000009820 279
572 3300026075 Ga0207708_10005985 Ga0207708_100059851 279
573 3300026075 Ga0207708_10122629 Ga0207708_101226292 279
574 3300026078 Ga0207702_10043424 Ga0207702_100434244 279
575 3300026078 Ga0207702_10319440 Ga0207702_103194402 279
576 3300026078 Ga0207702_10375330 Ga0207702_103753302 279
577 3300026078 Ga0207702_10739746 Ga0207702_107397462 279
578 3300026088 Ga0207641_10025880 Ga0207641_100258805 279
579 3300026088 Ga0207641_10656842 Ga0207641_106568422 279
580 3300026089 Ga0207648_10000696 Ga0207648_1000069644 279
581 3300026089 Ga0207648_10211259 Ga0207648_102112592 279
582 3300026095 Ga0207676_10005342 Ga0207676_100053422 279
583 3300026095 Ga0207676_10105319 Ga0207676_101053192 279
584 3300026095 Ga0207676_10269041 Ga0207676_102690412 279
585 3300026116 Ga0207674_10000420 Ga0207674_1000042020 279
586 3300026118 Ga0207675_100001146 Ga0207675_10000114629 279
587 3300026118 Ga0207675_100184391 Ga0207675_1001843911 279
588 3300026118 Ga0207675_100383127 Ga0207675_1003831272 279
589 3300026121 Ga0207683_10000004 Ga0207683_1000000429 279
590 3300026121 Ga0207683_10001766 Ga0207683_1000176621 279
591 3300026121 Ga0207683_10016095 Ga0207683_100160955 279
592 3300026142 Ga0207698_10015254 Ga0207698_100152545 279
593 3300026142 Ga0207698_10021138 Ga0207698_100211385 279
594 3300027252 Ga0209973_1013981 Ga0209973_10139811 279
595 3300027424 Ga0209984_1007530 Ga0209984_10075302 279
596 3300027614 Ga0209970_1017406 Ga0209970_10174062 279
597 3300027617 Ga0210002_1002603 Ga0210002_10026032 279
598 3300027682 Ga0209971_1011172 Ga0209971_10111722 279
599 3300027682 Ga0209971_1014527 Ga0209971_10145272 279
600 3300027717 Ga0209998_10003042 Ga0209998_100030422 279
601 3300027717 Ga0209998_10009889 Ga0209998_100098892 279
602 3300027876 Ga0209974_10000117 Ga0209974_100001173 279
603 3300027907 Ga0207428_10000250 Ga0207428_1000025070 279
604 3300027907 Ga0207428_10001707 Ga0207428_100017072 279
605 3300027907 Ga0207428_10007251 Ga0207428_1000725111 279
606 3300028379 Ga0268266_10009789 Ga0268266_100097895 279
607 3300028380 Ga0268265_10005880 Ga0268265_1000588011 279
608 3300028380 Ga0268265_10054430 Ga0268265_100544302 279
609 3300028381 Ga0268264_10076905 Ga0268264_100769052 279
610 3300028381 Ga0268264_10108780 Ga0268264_101087803 279
611 3300028381 Ga0268264_10157143 Ga0268264_101571432 279
612 3300028556 Ga0265337_1005419 Ga0265337_10054192 279
613 3300028800 Ga0265338_10205712 Ga0265338_102057122 279
614 3300028800 Ga0265338_10261562 Ga0265338_102615622 279
615 3300031241 Ga0265325_10000039 Ga0265325_1000003910 279
616 3300031241 Ga0265325_10000568 Ga0265325_100005688 279
617 3300031241 Ga0265325_10001242 Ga0265325_1000124213 279
618 3300031241 Ga0265325_10090448 Ga0265325_100904482 279
619 3300031241 Ga0265325_10118878 Ga0265325_101188781 279
620 3300031242 Ga0265329_10051651 Ga0265329_100516512 279
621 3300031247 Ga0265340_10011649 Ga0265340_100116493 279
622 3300031247 Ga0265340_10058550 Ga0265340_100585502 279
623 3300031249 Ga0265339_10004978 Ga0265339_100049788 279
624 3300031249 Ga0265339_10061175 Ga0265339_100611752 279
625 3300031249 Ga0265339_10108445 Ga0265339_101084452 279
626 3300031344 Ga0265316_10124161 Ga0265316_101241612 279
627 3300031595 Ga0265313_10000072 Ga0265313_1000007276 279
628 3300031595 Ga0265313_10002026 Ga0265313_100020267 279
629 3300031595 Ga0265313_10013232 Ga0265313_100132325 279
630 3300031595 Ga0265313_10027718 Ga0265313_100277182 279
631 3300031595 Ga0265313_10094571 Ga0265313_100945712 279
632 3300031691 Ga0316579_10011195 Ga0316579_100111953 279
633 3300031711 Ga0265314_10011949 Ga0265314_100119499 279
634 3300031711 Ga0265314_10060949 Ga0265314_100609492 279
635 3300031711 Ga0265314_10087310 Ga0265314_100873102 279
636 3300031712 Ga0265342_10001132 Ga0265342_1000113220 279
637 3300031712 Ga0265342_10017648 Ga0265342_100176484 279
638 3300034817 Ga0373948_0004653 Ga0373948_0004653_480_1319 279
639 3300034818 Ga0373950_0000252 Ga0373950_0000252_4811_5650 279
640 3300034818 Ga0373950_0013749 Ga0373950_0013749_10_849 279
641 3300034819 Ga0373958_0000253 Ga0373958_0000253_496_1335 279
642 3300034820 Ga0373959_0042536 Ga0373959_0042536_36_875 279
643 3300035084 Ga0373928_0016950 Ga0373928_0016950_284_1123 279
644 3300035090 Ga0373949_0007253 Ga0373949_0007253_1195_2034 279
645 3300035091 Ga0373951_0012875 Ga0373951_0012875_80_919 279
646 3300035091 Ga0373951_0025908 Ga0373951_0025908_52_891 279
647 3300035092 Ga0373952_0003163 Ga0373952_0003163_1773_2612 279
648 3300035111 Ga0373923_0020973 Ga0373923_0020973_589_1428 279
649 3300035112 Ga0373932_0001805 Ga0373932_0001805_2917_3756 279
650 3300035112 Ga0373932_0015369 Ga0373932_0015369_180_1019 279
651 3300035113 Ga0373936_0017326 Ga0373936_0017326_1255_2094 279
652 3300035113 Ga0373936_0050063 Ga0373936_0050063_93_932 279
653 3300035114 Ga0373939_0002173 Ga0373939_0002173_760_1599 279
654 3300035114 Ga0373939_0002190 Ga0373939_0002190_3100_3939 279
655 3300035114 Ga0373939_0063931 Ga0373939_0063931_298_1137 279
656 3300035115 Ga0373941_0004921 Ga0373941_0004921_350_1189 279
657 3300035115 Ga0373941_0005662 Ga0373941_0005662_801_1640 279
658 3300035115 Ga0373941_0023592 Ga0373941_0023592_413_1252 279
659 3300035116 Ga0373945_0060108 Ga0373945_0060108_421_1278 279
660 3300035117 Ga0373953_0112980 Ga0373953_0112980_96_953 279
661 3300035117 Ga0373953_0156098 Ga0373953_0156098_83_925 279
662 3300035118 Ga0373954_0041392 Ga0373954_0041392_841_1680 279
663 3300035118 Ga0373954_0059511 Ga0373954_0059511_120_959 279
664 3300035119 Ga0373956_0011799 Ga0373956_0011799_1590_2429 279
665 3300035119 Ga0373956_0048683 Ga0373956_0048683_713_1552 279
666 3300035119 Ga0373956_0085892 Ga0373956_0085892_251_1108 279
667 3300035120 Ga0373957_0084793 Ga0373957_0084793_324_1163 279
668 3300035121 Ga0373960_0028487 Ga0373960_0028487_446_1285 279
669 3300035172 Ga0373955_0000486 Ga0373955_0000486_7295_8134 279
670 3300035172 Ga0373955_0011699 Ga0373955_0011699_2037_2876 279
671 3300035207 Ga0373942_0003463 Ga0373942_0003463_1468_2307 279
672 3300035207 Ga0373942_0046125 Ga0373942_0046125_116_955 279
673 3300035241 Ga0373961_0015754 Ga0373961_0015754_278_1117 279
674 3300035410 Ga0373924_0011641 Ga0373924_0011641_952_1809 279
675 3300035691 Ga0373931_0022894 Ga0373931_0022894_2220_3059 279
676 3300035691 Ga0373931_0050564 Ga0373931_0050564_507_1346 279
677 3300035692 Ga0373935_0009157 Ga0373935_0009157_1008_1847 279
678 3300035692 Ga0373935_0098587 Ga0373935_0098587_227_1066 279
679 3300035692 Ga0373935_0104772 Ga0373935_0104772_696_1535 279
680 3300035692 Ga0373935_0121379 Ga0373935_0121379_309_1148 279
681 3300035692 Ga0373935_0290427 Ga0373935_0290427_128_967 279
682 3300035724 Ga0373933_0001169 Ga0373933_0001169_11409_12248 279
683 3300035724 Ga0373933_0011184 Ga0373933_0011184_3005_3844 279
684 3300035724 Ga0373933_0048350 Ga0373933_0048350_311_1150 279
685 3300035724 Ga0373933_0056238 Ga0373933_0056238_324_1181 279
686 3300035725 Ga0373947_0000874 Ga0373947_0000874_12993_13832 279
687 3300035725 Ga0373947_0338826 Ga0373947_0338826_12_851 279
688 3300036401 Ga0373937_0003379 Ga0373937_0003379_3712_4551 279
689 3300036401 Ga0373937_0015326 Ga0373937_0015326_4518_5360 279
690 3300036401 Ga0373937_0027230 Ga0373937_0027230_3555_4394 279
691 3300036401 Ga0373937_0351105 Ga0373937_0351105_209_1048 279
692 3300036401 Ga0373937_0457683 Ga0373937_0457683_14_853 279
693 3300037068 Ga0373925_0009697 Ga0373925_0009697_4435_5274 279
694 3300037068 Ga0373925_0097726 Ga0373925_0097726_779_1621 279
695 3300037068 Ga0373925_0155420 Ga0373925_0155420_102_941 279
696 3300037068 Ga0373925_0499589 Ga0373925_0499589_58_897 279
697 3300037312 Ga0395899_0363665 Ga0395899_0363665_72_911 279
698 3300037418 Ga0395900_0013490 Ga0395900_0013490_1901_2740 279
699 3300037418 Ga0395900_0265905 Ga0395900_0265905_616_1455 279
700 3300037466 Ga0395898_0019431 Ga0395898_0019431_35_874 279
701 3300038443 Ga0395901_0033083 Ga0395901_0033083_396_1235 279
702 3300038443 Ga0395901_0731074 Ga0395901_0731074_63_902 279
703 3300039437 Ga0436365_1084775 Ga0436365_1084775_255_1094 279
704 3300039437 Ga0436365_1906059 Ga0436365_1906059_293_1135 279
705 3300042436 Ga0439435_0051813 Ga0439435_0051813_191_1030 279
706 3300042876 Ga0451577_0257160 Ga0451577_0257160_216_1055 279
707 3300044712 Ga0453684_0114945 Ga0453684_0114945_1110_1949 279
708 3300045051 Ga0451576_0047663 Ga0451576_0047663_1698_2537 279
709 3300046452 Ga0495617_008848 Ga0495617_008848_1405_2262 279
710 3300046454 Ga0495592_0010591 Ga0495592_0010591_364_1206 279
711 3300046454 Ga0495592_0015983 Ga0495592_0015983_1643_2482 279
712 3300046455 Ga0495603_0001529 Ga0495603_0001529_3216_4055 279
713 3300046455 Ga0495603_0084857 Ga0495603_0084857_190_1029 279
714 3300046459 Ga0495629_0001129 Ga0495629_0001129_4522_5361 279
715 3300046459 Ga0495629_0140647 Ga0495629_0140647_250_1089 279
716 3300046461 Ga0495641_0009864 Ga0495641_0009864_3512_4369 279
717 3300046462 Ga0495651_0000565 Ga0495651_0000565_2435_3274 279
718 3300046462 Ga0495651_0005013 Ga0495651_0005013_4765_5607 279
719 3300046462 Ga0495651_0012172 Ga0495651_0012172_4510_5349 279
720 3300046463 Ga0495653_0020000 Ga0495653_0020000_3922_4761 279
721 3300046463 Ga0495653_0106269 Ga0495653_0106269_657_1499 279
722 3300046472 Ga0495580_0081545 Ga0495580_0081545_163_1020 279
723 3300046473 Ga0495582_0003684 Ga0495582_0003684_4773_5612 279
724 3300046475 Ga0495639_0061948 Ga0495639_0061948_385_1224 279
725 3300046476 Ga0495662_0017919 Ga0495662_0017919_2125_2964 279
726 3300046477 Ga0495664_0005186 Ga0495664_0005186_3222_4061 279
727 3300046477 Ga0495664_0016079 Ga0495664_0016079_3001_3840 279
728 3300046491 Ga0495584_0011215 Ga0495584_0011215_3450_4307 279
729 3300046491 Ga0495584_0052830 Ga0495584_0052830_549_1388 279
730 3300046492 Ga0495585_0002467 Ga0495585_0002467_10946_11803 279
731 3300046499 Ga0495594_0031402 Ga0495594_0031402_1460_2299 279
732 3300046499 Ga0495594_0040820 Ga0495594_0040820_581_1438 279
733 3300046501 Ga0495607_0004861 Ga0495607_0004861_2912_3769 279
734 3300046506 Ga0495583_0034275 Ga0495583_0034275_783_1640 279
735 3300046511 Ga0495608_0003844 Ga0495608_0003844_2133_2972 279
736 3300046511 Ga0495608_0021633 Ga0495608_0021633_3154_4011 279
737 3300046511 Ga0495608_0052610 Ga0495608_0052610_973_1812 279
738 3300046514 Ga0495618_0000917 Ga0495618_0000917_11737_12576 279
739 3300046514 Ga0495618_0141972 Ga0495618_0141972_499_1338 279
740 3300046516 Ga0495628_0004353 Ga0495628_0004353_7296_8138 279
741 3300046516 Ga0495628_0007281 Ga0495628_0007281_5538_6377 279
742 3300046516 Ga0495628_0102206 Ga0495628_0102206_1280_2119 279
743 3300046518 Ga0495631_0082807 Ga0495631_0082807_82_939 279
744 3300046523 Ga0495644_0000977 Ga0495644_0000977_3390_4247 279
745 3300046525 Ga0495663_0008995 Ga0495663_0008995_1461_2318 279
746 3300046529 Ga0495652_0003321 Ga0495652_0003321_14482_15324 279
747 3300046529 Ga0495652_0011095 Ga0495652_0011095_6094_6933 279
748 3300046529 Ga0495652_0036189 Ga0495652_0036189_2092_2949 279
749 3300046529 Ga0495652_0051988 Ga0495652_0051988_233_1072 279
750 3300046529 Ga0495652_0107167 Ga0495652_0107167_465_1304 279
751 3300046529 Ga0495652_0231048 Ga0495652_0231048_384_1223 279
752 3300046531 Ga0495665_0027263 Ga0495665_0027263_168_1007 279
753 3300046533 Ga0495640_0015820 Ga0495640_0015820_1484_2323 279
754 3300046533 Ga0495640_0186056 Ga0495640_0186056_456_1298 279
755 3300046536 Ga0495587_0002666 Ga0495587_0002666_8108_8947 279
756 3300046543 Ga0495645_0001763 Ga0495645_0001763_5771_6610 279
757 3300046558 Ga0495633_0021747 Ga0495633_0021747_1169_2026 279
758 3300046559 Ga0495667_0000256 Ga0495667_0000256_17717_18556 279
759 3300046559 Ga0495667_0004500 Ga0495667_0004500_2365_3204 279
760 3300046559 Ga0495667_0051698 Ga0495667_0051698_219_1061 279
761 3300046559 Ga0495667_0080082 Ga0495667_0080082_249_1088 279
762 3300046559 Ga0495667_0111204 Ga0495667_0111204_71_910 279
763 3300046615 Ga0495656_0002804 Ga0495656_0002804_1198_2055 279
764 3300046642 Ga0495634_0085794 Ga0495634_0085794_708_1547 279
765 3300046642 Ga0495634_0099557 Ga0495634_0099557_842_1681 279
766 3300046648 Ga0495611_0006278 Ga0495611_0006278_3155_4012 279
767 3300046663 Ga0495635_0001674 Ga0495635_0001674_2967_3806 279
768 3300046663 Ga0495635_0063562 Ga0495635_0063562_1231_2073 279
769 3300046663 Ga0495635_0175513 Ga0495635_0175513_100_939 279
770 3300046664 Ga0495659_0002865 Ga0495659_0002865_2030_2887 279
771 3300046665 Ga0495661_0046138 Ga0495661_0046138_1040_1897 279
772 3300046675 Ga0495657_0002838 Ga0495657_0002838_7447_8286 279
773 3300046675 Ga0495657_0008836 Ga0495657_0008836_2672_3511 279
774 3300046678 Ga0495599_0014560 Ga0495599_0014560_2133_2972 279
775 3300046678 Ga0495599_0015487 Ga0495599_0015487_650_1492 279
776 3300046678 Ga0495599_0093299 Ga0495599_0093299_828_1667 279
777 3300046679 Ga0495623_0006304 Ga0495623_0006304_4743_5582 279
778 3300046679 Ga0495623_0150627 Ga0495623_0150627_322_1164 279
779 3300046680 Ga0495646_0001535 Ga0495646_0001535_3971_4810 279
780 3300046680 Ga0495646_0003056 Ga0495646_0003056_4303_5160 279
781 3300046680 Ga0495646_0144578 Ga0495646_0144578_215_1057 279
782 3300046681 Ga0495647_0012134 Ga0495647_0012134_855_1694 279
783 3300046681 Ga0495647_0027866 Ga0495647_0027866_647_1504 279
784 3300046683 Ga0495658_0007273 Ga0495658_0007273_1061_1900 279
785 3300046683 Ga0495658_0071135 Ga0495658_0071135_1113_1952 279
786 3300046689 Ga0495613_0116360 Ga0495613_0116360_660_1499 279
787 3300046691 Ga0495670_0000385 Ga0495670_0000385_11915_12772 279
788 3300046809 Ga0495600_0008913 Ga0495600_0008913_4828_5667 279
789 3300046809 Ga0495600_0035138 Ga0495600_0035138_783_1625 279
790 3300047315 Ga0495581_0052331 Ga0495581_0052331_118_957 279
791 3300047317 Ga0495604_0059042 Ga0495604_0059042_681_1520 279
792 3300047317 Ga0495604_0061187 Ga0495604_0061187_970_1809 279
793 3300047317 Ga0495604_0085385 Ga0495604_0085385_430_1272 279
794 3300047319 Ga0495674_0001984 Ga0495674_0001984_15946_16785 279
795 3300047319 Ga0495674_0004803 Ga0495674_0004803_3813_4652 279
796 3300047319 Ga0495674_0097401 Ga0495674_0097401_137_979 279
797 3300047321 Ga0495676_0097796 Ga0495676_0097796_654_1493 279
798 3300047322 Ga0495680_0005186 Ga0495680_0005186_9602_10441 279
799 3300047322 Ga0495680_0005564 Ga0495680_0005564_4698_5537 279
800 3300047322 Ga0495680_0013978 Ga0495680_0013978_1420_2259 279
801 3300047322 Ga0495680_0091074 Ga0495680_0091074_651_1493 279
802 3300047444 Ga0495675_0000532 Ga0495675_0000532_15555_16394 279
803 3300047444 Ga0495675_0155300 Ga0495675_0155300_64_903 279
804 3300047445 Ga0495677_0075446 Ga0495677_0075446_400_1239 279
805 3300047471 Ga0495684_0020948 Ga0495684_0020948_419_1258 279
806 3300047471 Ga0495684_0025619 Ga0495684_0025619_2683_3522 279
807 3300047471 Ga0495684_0089038 Ga0495684_0089038_1132_1971 279
808 3300047673 Ga0495593_0016546 Ga0495593_0016546_1633_2472 279
809 3300047673 Ga0495593_0154936 Ga0495593_0154936_201_1040 279
810 3300047673 Ga0495593_0235278 Ga0495593_0235278_37_876 279
811 3300048088 Ga0495602_0003582 Ga0495602_0003582_13299_14141 279
812 3300048088 Ga0495602_0005750 Ga0495602_0005750_9194_10033 279
813 3300048903 Ga0496100_0009690 Ga0496100_0009690_1716_2555 279
814 3300048903 Ga0496100_0070886 Ga0496100_0070886_804_1643 279
815 3300048904 Ga0496101_0002148 Ga0496101_0002148_3336_4175 279
816 3300048904 Ga0496101_0016521 Ga0496101_0016521_1209_2048 279
817 3300048904 Ga0496101_0474639 Ga0496101_0474639_11_850 279
818 3300048905 Ga0496102_0038521 Ga0496102_0038521_45_944 279
819 3300048905 Ga0496102_0228210 Ga0496102_0228210_896_1735 279
820 3300048905 Ga0496102_0567603 Ga0496102_0567603_74_913 279
821 3300048906 Ga0496103_0030585 Ga0496103_0030585_389_1228 279
822 3300048906 Ga0496103_0106174 Ga0496103_0106174_252_1091 279
823 3300048907 Ga0496104_0000575 Ga0496104_0000575_4954_5793 279
824 3300048907 Ga0496104_0297870 Ga0496104_0297870_82_921 279
825 3300048907 Ga0496104_0375378 Ga0496104_0375378_30_869 279
826 3300048908 Ga0496105_0012737 Ga0496105_0012737_5671_6510 279
827 3300048908 Ga0496105_0048584 Ga0496105_0048584_1288_2127 279
828 3300048908 Ga0496105_0116922 Ga0496105_0116922_89_928 279
829 3300048908 Ga0496105_0408681 Ga0496105_0408681_21_860 279
830 3300048909 Ga0496106_0015507 Ga0496106_0015507_3338_4177 279
831 3300048909 Ga0496106_0238314 Ga0496106_0238314_204_1043 279
832 3300048910 Ga0496107_0004066 Ga0496107_0004066_1795_2634 279
833 3300048910 Ga0496107_0274991 Ga0496107_0274991_235_1074 279
834 3300048911 Ga0496108_0017973 Ga0496108_0017973_2812_3651 279
835 3300048911 Ga0496108_0040534 Ga0496108_0040534_2524_3363 279
836 3300048911 Ga0496108_0054196 Ga0496108_0054196_81_920 279
837 3300048911 Ga0496108_0427739 Ga0496108_0427739_21_860 279
838 3300048912 Ga0496109_0026022 Ga0496109_0026022_2925_3764 279
839 3300048912 Ga0496109_0043968 Ga0496109_0043968_2524_3363 279
840 3300048912 Ga0496109_0064398 Ga0496109_0064398_2446_3285 279
841 3300048912 Ga0496109_0178818 Ga0496109_0178818_901_1740 279
842 3300048913 Ga0496110_0039711 Ga0496110_0039711_2813_3652 279
843 3300048913 Ga0496110_0042792 Ga0496110_0042792_2408_3247 279
844 3300048913 Ga0496110_0082037 Ga0496110_0082037_1506_2345 279
845 3300048914 Ga0496111_0067953 Ga0496111_0067953_1045_1884 279
846 3300048914 Ga0496111_0076128 Ga0496111_0076128_635_1474 279
847 3300048914 Ga0496111_0137455 Ga0496111_0137455_669_1508 279
848 3300048915 Ga0496112_0022849 Ga0496112_0022849_2411_3250 279
849 3300048915 Ga0496112_0027238 Ga0496112_0027238_2440_3279 279
850 3300048915 Ga0496112_0373305 Ga0496112_0373305_14_853 279
851 3300048915 Ga0496112_0555739 Ga0496112_0555739_21_860 279
852 3300048916 Ga0496113_0024623 Ga0496113_0024623_918_1757 279
853 3300048916 Ga0496113_0035969 Ga0496113_0035969_35_874 279
854 3300048916 Ga0496113_0108250 Ga0496113_0108250_49_888 279
855 3300048916 Ga0496113_0216578 Ga0496113_0216578_676_1515 279
856 3300048917 Ga0496114_0005575 Ga0496114_0005575_1889_2728 279
857 3300048917 Ga0496114_0016691 Ga0496114_0016691_105_944 279
858 3300048918 Ga0496115_0027862 Ga0496115_0027862_2723_3562 279
859 3300048918 Ga0496115_0031167 Ga0496115_0031167_19_858 279
860 3300048918 Ga0496115_0069516 Ga0496115_0069516_1494_2333 279
861 3300048918 Ga0496115_0127538 Ga0496115_0127538_473_1312 279
862 3300048918 Ga0496115_0156486 Ga0496115_0156486_1014_1853 279
863 3300049570 Ga0501033_0003913 Ga0501033_0003913_5680_6519 279
864 3300049570 Ga0501033_0091848 Ga0501033_0091848_905_1744 279
865 3300049571 Ga0501034_0063357 Ga0501034_0063357_1268_2128 279
866 3300049572 Ga0501036_0392257 Ga0501036_0392257_73_912 279
867 3300049574 Ga0501038_0063990 Ga0501038_0063990_136_975 279
868 3300049574 Ga0501038_0066609 Ga0501038_0066609_1358_2197 279
869 3300049581 Ga0501047_0004478 Ga0501047_0004478_705_1544 279
870 3300049581 Ga0501047_0044782 Ga0501047_0044782_3310_4176 279
871 3300049581 Ga0501047_0078933 Ga0501047_0078933_1001_1840 279
872 3300049586 Ga0501070_0018727 Ga0501070_0018727_1329_2168 279
873 3300049586 Ga0501070_0037859 Ga0501070_0037859_2098_2940 279
874 3300049586 Ga0501070_0260332 Ga0501070_0260332_107_946 279
875 3300049589 Ga0501073_0009746 Ga0501073_0009746_648_1487 279
876 3300049592 Ga0501076_0043052 Ga0501076_0043052_2102_2941 279
877 3300049741 Ga0501079_0243350 Ga0501079_0243350_141_980 279
878 3300049742 Ga0501080_0032326 Ga0501080_0032326_4010_4849 279
879 3300049742 Ga0501080_0308225 Ga0501080_0308225_200_1045 279
880 3300049744 Ga0501083_0091167 Ga0501083_0091167_75_935 279
881 3300049822 Ga0501035_0004436 Ga0501035_0004436_8412_9254 279
882 3300049823 Ga0501044_0005860 Ga0501044_0005860_7440_8279 279
883 3300049823 Ga0501044_0094254 Ga0501044_0094254_1256_2095 279
884 3300049823 Ga0501044_0132508 Ga0501044_0132508_1366_2205 279
885 3300050507 nmdc:mga05p37_3041_c1 nmdc:mga05p37_3041_c1_3874_4713 279
886 3300050508 nmdc:mga09592_324265_c1 nmdc:mga09592_324265_c1_144_983 279
887 3300050508 nmdc:mga09592_5026_c1 nmdc:mga09592_5026_c1_7688_8527 279
888 3300050509 nmdc:mga0qj67_1705_c1 nmdc:mga0qj67_1705_c1_13486_14325 279
889 3300050510 nmdc:mga06r32_2163_c1 nmdc:mga06r32_2163_c1_10827_11666 279
890 3300050511 nmdc:mga08y16_289_c1 nmdc:mga08y16_289_c1_6275_7114 279
891 3300050511 nmdc:mga08y16_31530_c1 nmdc:mga08y16_31530_c1_519_1358 279
892 3300050512 nmdc:mga0n895_112788_c1 nmdc:mga0n895_112788_c1_1655_2494 279
893 3300050512 nmdc:mga0n895_140865_c1 nmdc:mga0n895_140865_c1_1549_2388 279
894 3300050512 nmdc:mga0n895_361831_c1 nmdc:mga0n895_361831_c1_174_1013 279
895 3300050512 nmdc:mga0n895_392128_c1 nmdc:mga0n895_392128_c1_228_1067 279
896 3300050512 nmdc:mga0n895_4459_c1 nmdc:mga0n895_4459_c1_10415_11254 279
897 3300050513 nmdc:mga0rr50_11469_c1 nmdc:mga0rr50_11469_c1_416_1255 279
898 3300050513 nmdc:mga0rr50_141250_c1 nmdc:mga0rr50_141250_c1_195_1034 279
899 3300050513 nmdc:mga0rr50_168968_c1 nmdc:mga0rr50_168968_c1_568_1407 279
900 3300050513 nmdc:mga0rr50_308633_c1 nmdc:mga0rr50_308633_c1_286_1125 279
901 3300050513 nmdc:mga0rr50_576477_c1 nmdc:mga0rr50_576477_c1_40_879 279
902 3300050514 nmdc:mga08x19_198328_c1 nmdc:mga08x19_198328_c1_254_1093 279
903 3300050515 nmdc:mga0a205_17258_c1 nmdc:mga0a205_17258_c1_228_1067 279
904 3300050515 nmdc:mga0a205_249588_c1 nmdc:mga0a205_249588_c1_684_1523 279
905 3300050515 nmdc:mga0a205_3619_c1 nmdc:mga0a205_3619_c1_4880_5719 279
906 3300050515 nmdc:mga0a205_733_c2 nmdc:mga0a205_733_c2_9600_10439 279
907 3300053077 Ga0495601_0000418 Ga0495601_0000418_9674_10513 279
908 3300053077 Ga0495601_0002208 Ga0495601_0002208_788_1627 279
909 3300053077 Ga0495601_0003992 Ga0495601_0003992_4426_5268 279
910 3300053077 Ga0495601_0017457 Ga0495601_0017457_629_1468 279
911 3300053078 Ga0495612_0011282 Ga0495612_0011282_970_1809 279
912 3300053078 Ga0495612_0011744 Ga0495612_0011744_1792_2631 279
913 3300053078 Ga0495612_0020362 Ga0495612_0020362_893_1750 279
914 3300053084 Ga0495595_0013087 Ga0495595_0013087_642_1481 279
915 3300053084 Ga0495595_0025852 Ga0495595_0025852_418_1257 279
916 3300053084 Ga0495595_0026794 Ga0495595_0026794_280_1119 279
917 3300053084 Ga0495595_0047076 Ga0495595_0047076_836_1675 279
918 3300053085 Ga0495619_0002359 Ga0495619_0002359_9405_10244 279
919 3300053085 Ga0495619_0002566 Ga0495619_0002566_10383_11222 279
920 3300053085 Ga0495619_0007346 Ga0495619_0007346_1254_2093 279
921 3300053085 Ga0495619_0017182 Ga0495619_0017182_2771_3613 279
922 3300053085 Ga0495619_0021147 Ga0495619_0021147_1969_2808 279
923 3300053085 Ga0495619_0036672 Ga0495619_0036672_581_1420 279
924 3300053085 Ga0495619_0098848 Ga0495619_0098848_357_1196 279
925 3300053087 Ga0500643_002005 Ga0500643_002005_3093_3932 279
926 3300053088 Ga0500644_0013518 Ga0500644_0013518_1215_2054 279
927 3300053094 Ga0500566_0105691 Ga0500566_0105691_466_1305 279
928 3300053098 Ga0500650_0097840 Ga0500650_0097840_270_1109 279
929 3300053118 Ga0500594_0047025 Ga0500594_0047025_147_986 279
930 3300053119 Ga0500595_000002 Ga0500595_000002_480861_481700 279
931 3300053131 Ga0500652_003429 Ga0500652_003429_366_1205 279
932 3300060353 Ga0501082_0203082 Ga0501082_0203082_672_1532 279
933 3300060353 Ga0501082_0306932 Ga0501082_0306932_312_1199 279
934 3300060353 Ga0501082_0439431 Ga0501082_0439431_237_1076 279
935 3300061719 Ga0466962_0080838 Ga0466962_0080838_645_1493 279

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

29

276

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g0w-assembly1.cif.gz_A crystal structure of a putative sugar isomerase (lmo2234) from listeria monocytogenes at 1.70 a resolution 0.8866 8 275
5hmq-assembly3.cif.gz_E xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein 0.879 7 273
5hmq-assembly1.cif.gz_C xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein 0.877 7 273
5hmq-assembly3.cif.gz_D xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein 0.8655 7 273
5hmq-assembly2.cif.gz_B xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein 0.8653 7 273
ID Description Score Start End Superfamily
2g0wB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8783 8 275 3.20.20.150
af_P45541_1_270_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.837 6 268 3.20.20.150
3qc0A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8308 7 269 3.20.20.150
2g0wB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8254 8 275 3.20.20.150
1i60A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8219 8 279 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A5J5GCL0-F1-model_v4 Sugar phosphate isomerase/epimerase 0.99 2 279 GO:0016853
AF-A0A7C3JPR9-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9853 7 273 GO:0016853
AF-A0A5J5GCL0-F1-model_v4 Sugar phosphate isomerase/epimerase 0.983 2 279 GO:0016853
AF-A0A537N724-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9792 3 241 GO:0016853
AF-A0A2E9I2B3-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.9776 3 273

Feature Viewer

pLDDT pTM Quality
95.85 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map