F486170

General Info

Members Datasets Scaffolds Average Seq Length
935 346 1870 170

Family's Representative Sequence

Representative Sequence 3300046680|Ga0495646_0031437|Ga0495646_0031437_1297_1914
Length 205
Sequence MACPPRPTALAPHWRAPGERRPGREFLPDGASLKADTVSGEGRPAAETVDAAGLTLAIAVTRWHAEITDALTDRALAAAKACGVDDPLVVRVPGAVELPVVAAELARNHDAVACLGAVIRGGTPHFEYVCDAVTYGIARVALDAGKPVGNGVLTCDTLEQARDRSGQDGSREDKGWEAVVAALETALVLRSLRGNDPGAGDHQRH

Samples

Sample ID Description Type Environment
1 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
108 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
109 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
166 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
167 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
168 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
169 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
170 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
171 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
172 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
173 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
174 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
175 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
176 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
177 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
178 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
179 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
180 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
181 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
182 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
183 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
184 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
201 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
202 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
203 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
204 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
205 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
206 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
207 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
208 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
209 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
210 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
211 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
214 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
215 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
216 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
217 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
218 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
219 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
222 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
231 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
232 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
233 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
234 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
235 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
236 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
237 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
238 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
239 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
240 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
241 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
242 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
243 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
244 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
245 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
246 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
247 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
248 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
249 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
250 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
251 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
252 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
253 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
254 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
255 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
256 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
262 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
263 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
264 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
265 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
266 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
267 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
268 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
269 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
270 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
271 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
272 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
273 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
274 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
275 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
276 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
277 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
278 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
279 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
280 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
281 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
282 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
285 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
286 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
287 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
288 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
289 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
290 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
291 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
292 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
293 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
294 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
295 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
296 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
297 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
298 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
299 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
300 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
301 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
302 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
303 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
304 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
305 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
316 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
317 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
318 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
319 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
320 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
324 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
325 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
326 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
327 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
328 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
329 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
330 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
331 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
332 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
333 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
334 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
335 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
336 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
337 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
338 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
339 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
340 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
341 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
342 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
343 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
344 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
345 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
346 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.18
Metatranscriptomes 1.5
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 6.63
Rhizosphere 90.27
Stem 0
Stem Tuber 0
Unclassified 0.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495646_0031437 3300046680 Bacteria 3307
2 JGI25406J46586_10051874 3300003203 Bacteria 1370
3 JGI25405J52794_10074824 3300003911 Bacteria 741
4 Ga0070658_10096527 3300005327 Bacteria 2440
5 Ga0070658_10396814 3300005327 Bacteria 1185
6 Ga0070676_10062529 3300005328 Bacteria 2215
7 Ga0070683_100297030 3300005329 Bacteria 1536
8 Ga0070670_100079289 3300005331 Bacteria 2822
9 Ga0068869_100002052 3300005334 Bacteria 12100
10 Ga0070680_100022377 3300005336 Bacteria 5035
11 Ga0070680_100411330 3300005336 Bacteria 1154
12 Ga0070682_100006180 3300005337 Bacteria 6709
13 Ga0070682_100045233 3300005337 Bacteria 2728
14 Ga0070682_100252769 3300005337 Bacteria 1271
15 Ga0068868_100004627 3300005338 Bacteria 9651
16 Ga0068868_100439381 3300005338 Bacteria 1133
17 Ga0070660_100087424 3300005339 Bacteria 2453
18 Ga0070660_100201248 3300005339 Bacteria 1615
19 Ga0070660_100522657 3300005339 Bacteria 988
20 Ga0070691_10019655 3300005341 Bacteria 3118
21 Ga0070691_10509410 3300005341 Bacteria 697
22 Ga0070661_100552592 3300005344 Bacteria 926
23 Ga0070692_10001247 3300005345 Bacteria 9083
24 Ga0070675_100009094 3300005354 Bacteria 7716
25 Ga0070675_100013231 3300005354 Bacteria 6484
26 Ga0070671_100002713 3300005355 Bacteria 13735
27 Ga0070659_100218684 3300005366 Bacteria 1571
28 Ga0070659_100224938 3300005366 Bacteria 1550
29 Ga0070659_100485645 3300005366 Bacteria 1051
30 Ga0070659_100549615 3300005366 Bacteria 988
31 Ga0070709_10007442 3300005434 Bacteria 6001
32 Ga0070709_10039528 3300005434 Bacteria 2895
33 Ga0070714_100004329 3300005435 Bacteria 10706
34 Ga0070714_100009463 3300005435 Bacteria 7662
35 Ga0070714_100019622 3300005435 Bacteria 5512
36 Ga0070714_100043473 3300005435 Bacteria 3800
37 Ga0070714_100070722 3300005435 Bacteria 3016
38 Ga0070714_100079102 3300005435 Bacteria 2858
39 Ga0070714_100154976 3300005435 Bacteria 2067
40 Ga0070714_100159390 3300005435 Bacteria 2040
41 Ga0070714_100212077 3300005435 Bacteria 1775
42 Ga0070714_100219834 3300005435 Bacteria 1745
43 Ga0070714_100226579 3300005435 Bacteria 1720
44 Ga0070714_100321589 3300005435 Bacteria 1447
45 Ga0070714_100393909 3300005435 Bacteria 1308
46 Ga0070714_100548482 3300005435 Bacteria 1106
47 Ga0070714_100570442 3300005435 Bacteria 1085
48 Ga0070714_101520736 3300005435 Bacteria 654
49 Ga0070713_100036219 3300005436 Bacteria 3980
50 Ga0070713_100176176 3300005436 Bacteria 1919
51 Ga0070713_100338194 3300005436 Bacteria 1394
52 Ga0070713_100340993 3300005436 Bacteria 1388
53 Ga0070713_100346807 3300005436 Bacteria 1377
54 Ga0070713_100638343 3300005436 Bacteria 1013
55 Ga0070713_100647818 3300005436 Bacteria 1006
56 Ga0070713_100919625 3300005436 Bacteria 842
57 Ga0070713_101389811 3300005436 Bacteria 681
58 Ga0070710_10128257 3300005437 Bacteria 1543
59 Ga0070710_10323299 3300005437 Bacteria 1013
60 Ga0070710_10414397 3300005437 Bacteria 906
61 Ga0070711_100032680 3300005439 Bacteria 3461
62 Ga0070711_100104807 3300005439 Bacteria 2064
63 Ga0070711_100413458 3300005439 Bacteria 1097
64 Ga0070711_100632634 3300005439 Bacteria 895
65 Ga0070711_100990293 3300005439 Bacteria 721
66 Ga0070705_100077968 3300005440 Bacteria 2025
67 Ga0070694_100169495 3300005444 Bacteria 1607
68 Ga0070694_100757991 3300005444 Bacteria 793
69 Ga0070694_101109028 3300005444 Bacteria 660
70 Ga0070708_100002501 3300005445 Bacteria 14185
71 Ga0070708_100042043 3300005445 Bacteria 4009
72 Ga0070708_100066894 3300005445 Bacteria 3225
73 Ga0070708_100561009 3300005445 Bacteria 1077
74 Ga0070663_100004146 3300005455 Bacteria 8466
75 Ga0070663_100053936 3300005455 Bacteria 2872
76 Ga0070663_100108239 3300005455 Bacteria 2085
77 Ga0070663_100685738 3300005455 Bacteria 869
78 Ga0070678_100015458 3300005456 Bacteria 4854
79 Ga0070678_100704941 3300005456 Bacteria 910
80 Ga0070662_100243168 3300005457 Bacteria 1444
81 Ga0070681_10007378 3300005458 Bacteria 10746
82 Ga0070681_10055905 3300005458 Bacteria 3928
83 Ga0070681_11208352 3300005458 Unclassified 678
84 Ga0070685_10017716 3300005466 Bacteria 3817
85 Ga0070706_100002492 3300005467 Bacteria 18546
86 Ga0070706_100008070 3300005467 Bacteria 9822
87 Ga0070706_100017808 3300005467 Bacteria 6554
88 Ga0070706_100021912 3300005467 Bacteria 5883
89 Ga0070706_100054596 3300005467 Bacteria 3687
90 Ga0070706_100136298 3300005467 Bacteria 2291
91 Ga0070706_100214722 3300005467 Bacteria 1796
92 Ga0070706_100811748 3300005467 Bacteria 866
93 Ga0070707_100000199 3300005468 Bacteria 60047
94 Ga0070707_100001332 3300005468 Bacteria 24324
95 Ga0070707_100005322 3300005468 Bacteria 12043
96 Ga0070707_100012384 3300005468 Bacteria 7965
97 Ga0070707_100030494 3300005468 Bacteria 5134
98 Ga0070707_100036466 3300005468 Bacteria 4692
99 Ga0070707_100040620 3300005468 Bacteria 4451
100 Ga0070707_100061390 3300005468 Bacteria 3604
101 Ga0070707_100123121 3300005468 Bacteria 2518
102 Ga0070707_100832142 3300005468 Bacteria 887
103 Ga0070707_101103001 3300005468 Bacteria 760
104 Ga0070698_100000264 3300005471 Bacteria 52985
105 Ga0070698_100001732 3300005471 Bacteria 24325
106 Ga0070698_100035178 3300005471 Bacteria 5180
107 Ga0070698_100035250 3300005471 Bacteria 5175
108 Ga0070698_100048835 3300005471 Bacteria 4324
109 Ga0070698_100051145 3300005471 Bacteria 4209
110 Ga0070698_100071099 3300005471 Bacteria 3490
111 Ga0070698_100182506 3300005471 Bacteria 2037
112 Ga0070698_100463966 3300005471 Bacteria 1202
113 Ga0070698_100547426 3300005471 Bacteria 1096
114 Ga0070698_100743831 3300005471 Bacteria 923
115 Ga0070699_100006399 3300005518 Bacteria 10256
116 Ga0070679_100016152 3300005530 Bacteria 7193
117 Ga0070679_100074844 3300005530 Bacteria 3377
118 Ga0070679_100106016 3300005530 Bacteria 2796
119 Ga0070679_100118116 3300005530 Bacteria 2637
120 Ga0070679_100442230 3300005530 Bacteria 1245
121 Ga0070684_100086401 3300005535 Bacteria 2784
122 Ga0070684_100641351 3300005535 Bacteria 988
123 Ga0070684_101053753 3300005535 Bacteria 764
124 Ga0070697_100010436 3300005536 Bacteria 7249
125 Ga0070697_100033026 3300005536 Bacteria 4166
126 Ga0070697_100075666 3300005536 Bacteria 2768
127 Ga0070697_100712606 3300005536 Bacteria 886
128 Ga0068853_100054874 3300005539 Bacteria 3434
129 Ga0068853_100247590 3300005539 Bacteria 1635
130 Ga0070686_100565979 3300005544 Bacteria 891
131 Ga0070695_100700332 3300005545 Bacteria 804
132 Ga0070695_100901322 3300005545 Bacteria 714
133 Ga0070665_100045239 3300005548 Bacteria 4421
134 Ga0070665_100465985 3300005548 Bacteria 1274
135 Ga0070665_100639483 3300005548 Bacteria 1077
136 Ga0070704_100166515 3300005549 Bacteria 1748
137 Ga0070704_100339739 3300005549 Bacteria 1264
138 Ga0068855_100009694 3300005563 Bacteria 11625
139 Ga0068855_100742934 3300005563 Bacteria 1047
140 Ga0068857_100673572 3300005577 Bacteria 981
141 Ga0068857_100839866 3300005577 Bacteria 878
142 Ga0068856_100008925 3300005614 Bacteria 9751
143 Ga0068856_100042106 3300005614 Bacteria 4492
144 Ga0068856_100048682 3300005614 Bacteria 4178
145 Ga0068856_100302681 3300005614 Bacteria 1617
146 Ga0068856_100742570 3300005614 Bacteria 1001
147 Ga0068856_101030912 3300005614 Bacteria 841
148 Ga0068856_101797982 3300005614 Bacteria 624
149 Ga0070702_100001819 3300005615 Bacteria 8877
150 Ga0070702_100350434 3300005615 Bacteria 1040
151 Ga0068852_100006864 3300005616 Bacteria 8273
152 Ga0068852_100327019 3300005616 Bacteria 1490
153 Ga0068852_101699026 3300005616 Bacteria 654
154 Ga0068859_100077412 3300005617 Bacteria 3367
155 Ga0068864_100106943 3300005618 Bacteria 2488
156 Ga0068864_100428677 3300005618 Bacteria 1261
157 Ga0068866_10685973 3300005718 Bacteria 701
158 Ga0068861_100168780 3300005719 Bacteria 1812
159 Ga0068851_10010568 3300005834 Bacteria 4310
160 Ga0068870_10000071 3300005840 Bacteria 32257
161 Ga0068863_100032440 3300005841 Bacteria 4979
162 Ga0068863_100103755 3300005841 Bacteria 2705
163 Ga0068858_100003961 3300005842 Bacteria 14613
164 Ga0068860_100311861 3300005843 Bacteria 1543
165 Ga0081455_10001891 3300005937 Bacteria 25187
166 Ga0081539_10000806 3300005985 Bacteria 61012
167 Ga0070717_10002201 3300006028 Bacteria 13706
168 Ga0070717_10004329 3300006028 Bacteria 10243
169 Ga0070717_10048540 3300006028 Bacteria 3482
170 Ga0070717_10064433 3300006028 Bacteria 3044
171 Ga0070717_10094448 3300006028 Bacteria 2530
172 Ga0070717_10206429 3300006028 Bacteria 1723
173 Ga0070717_10208281 3300006028 Bacteria 1715
174 Ga0070717_10254711 3300006028 Bacteria 1551
175 Ga0070717_10296654 3300006028 Bacteria 1436
176 Ga0070717_10302209 3300006028 Bacteria 1423
177 Ga0070717_10318453 3300006028 Bacteria 1385
178 Ga0070717_10438333 3300006028 Bacteria 1176
179 Ga0070717_11409355 3300006028 Bacteria 633
180 Ga0075432_10003384 3300006058 Bacteria 5393
181 Ga0075432_10196075 3300006058 Bacteria 797
182 Ga0070715_10003898 3300006163 Bacteria 4826
183 Ga0070715_10008246 3300006163 Bacteria 3624
184 Ga0070715_10008492 3300006163 Bacteria 3583
185 Ga0070715_10054529 3300006163 Bacteria 1732
186 Ga0070716_100120063 3300006173 Bacteria 1644
187 Ga0070716_100178665 3300006173 Bacteria 1391
188 Ga0070716_100301902 3300006173 Bacteria 1114
189 Ga0070716_100324093 3300006173 Bacteria 1081
190 Ga0070716_100417201 3300006173 Bacteria 970
191 Ga0070716_100563211 3300006173 Bacteria 851
192 Ga0070712_100014246 3300006175 Bacteria 5103
193 Ga0070712_100126708 3300006175 Bacteria 1929
194 Ga0070712_100256995 3300006175 Bacteria 1398
195 Ga0070712_100744336 3300006175 Bacteria 838
196 Ga0097621_100044853 3300006237 Bacteria 3569
197 Ga0068871_100037805 3300006358 Bacteria 3852
198 Ga0075428_100243261 3300006844 Bacteria 1941
199 Ga0075428_100355691 3300006844 Bacteria 1571
200 Ga0075431_100407351 3300006847 Bacteria 1360
201 Ga0075433_10005340 3300006852 Bacteria 10084
202 Ga0075433_10046311 3300006852 Bacteria 3782
203 Ga0075433_10233585 3300006852 Bacteria 1633
204 Ga0075434_100001779 3300006871 Bacteria 18580
205 Ga0075434_100007096 3300006871 Bacteria 10347
206 Ga0075434_100489726 3300006871 Bacteria 1250
207 Ga0075434_100592208 3300006871 Bacteria 1128
208 Ga0075429_100231745 3300006880 Bacteria 1618
209 Ga0068865_101097625 3300006881 Bacteria 701
210 Ga0075436_100001620 3300006914 Bacteria 15407
211 Ga0075436_100029436 3300006914 Bacteria 3777
212 Ga0075436_100106996 3300006914 Bacteria 1951
213 Ga0075436_100458689 3300006914 Bacteria 929
214 Ga0075436_100690802 3300006914 Bacteria 755
215 Ga0097620_100077414 3300006931 Bacteria 3367
216 Ga0075435_100002488 3300007076 Bacteria 12249
217 Ga0075435_100005801 3300007076 Bacteria 8676
218 Ga0075435_100083568 3300007076 Bacteria 2625
219 Ga0075435_100320827 3300007076 Bacteria 1326
220 Ga0075435_100908889 3300007076 Bacteria 768
221 Ga0099794_10028392 3300007265 Bacteria 2603
222 Ga0105251_10065085 3300009011 Bacteria 1707
223 Ga0105240_10109913 3300009093 Bacteria 3337
224 Ga0105240_10283149 3300009093 Bacteria 1903
225 Ga0111539_10019228 3300009094 Bacteria 8436
226 Ga0105245_10254953 3300009098 Bacteria 1706
227 Ga0105245_10536031 3300009098 Bacteria 1191
228 Ga0105245_11251747 3300009098 Bacteria 790
229 Ga0114129_10041618 3300009147 Bacteria 6472
230 Ga0114129_10771531 3300009147 Bacteria 1229
231 Ga0105243_10188743 3300009148 Bacteria 1798
232 Ga0105241_10007293 3300009174 Bacteria 8138
233 Ga0105248_10012380 3300009177 Bacteria 9412
234 Ga0105237_10160172 3300009545 Bacteria 2249
235 Ga0105238_10291735 3300009551 Bacteria 1613
236 Ga0105238_10631063 3300009551 Bacteria 1081
237 Ga0105239_10954888 3300010375 Bacteria 985
238 Ga0105239_10976350 3300010375 Bacteria 974
239 Ga0105246_10000478 3300011119 Bacteria 21566
240 Ga0157371_10009341 3300013102 Bacteria 7729
241 Ga0157371_10273155 3300013102 Bacteria 1220
242 Ga0157370_10064992 3300013104 Bacteria 3452
243 Ga0157370_10107846 3300013104 Bacteria 2604
244 Ga0157369_10009552 3300013105 Bacteria 11095
245 Ga0157369_10107064 3300013105 Bacteria 2975
246 Ga0157369_10433780 3300013105 Bacteria 1361
247 Ga0157374_10270734 3300013296 Bacteria 1675
248 Ga0163162_10534143 3300013306 Bacteria 1302
249 Ga0157372_10041227 3300013307 Bacteria 5103
250 Ga0157372_10433686 3300013307 Bacteria 1532
251 Ga0157375_12452708 3300013308 Bacteria 623
252 Ga0163163_10220663 3300014325 Bacteria 1944
253 Ga0163163_10962253 3300014325 Bacteria 917
254 Ga0163163_11245025 3300014325 Bacteria 806
255 Ga0157380_10264225 3300014326 Bacteria 1565
256 Ga0182008_10020152 3300014497 Bacteria 3436
257 Ga0157377_10116735 3300014745 Bacteria 1612
258 Ga0157377_10390674 3300014745 Bacteria 945
259 Ga0157379_10035359 3300014968 Bacteria 4454
260 Ga0157376_12010665 3300014969 Bacteria 616
261 Ga0197907_10181547 3300020069 Bacteria 2145
262 Ga0206356_10850638 3300020070 Bacteria 591
263 Ga0206352_10556522 3300020078 Bacteria 1081
264 Ga0206354_10159229 3300020081 Bacteria 1326
265 Ga0206354_10322134 3300020081 Bacteria 2185
266 Ga0206354_11210541 3300020081 Bacteria 1123
267 Ga0206354_11331006 3300020081 Bacteria 2817
268 Ga0206353_10363697 3300020082 Bacteria 2093
269 Ga0206353_10591091 3300020082 Bacteria 3421
270 Ga0206353_10881626 3300020082 Bacteria 1176
271 Ga0206353_10948632 3300020082 Bacteria 737
272 Ga0206353_11417859 3300020082 Bacteria 1097
273 Ga0206353_11420308 3300020082 Bacteria 911
274 Ga0213873_10087785 3300021358 Bacteria 879
275 Ga0213875_10000079 3300021388 Bacteria 114698
276 Ga0213875_10033595 3300021388 Bacteria 2423
277 Ga0213875_10084295 3300021388 Bacteria 1483
278 Ga0213875_10125370 3300021388 Bacteria 1200
279 Ga0224712_10008505 3300022467 Bacteria 3047
280 Ga0207656_10002399 3300025321 Bacteria 6304
281 Ga0207692_10002632 3300025898 Bacteria 6904
282 Ga0207692_10004539 3300025898 Bacteria 5509
283 Ga0207692_10029139 3300025898 Bacteria 2620
284 Ga0207692_10322136 3300025898 Bacteria 946
285 Ga0207692_10557709 3300025898 Bacteria 733
286 Ga0207688_10002679 3300025901 Bacteria 9637
287 Ga0207647_10063509 3300025904 Bacteria 2246
288 Ga0207685_10002255 3300025905 Bacteria 4369
289 Ga0207685_10038598 3300025905 Bacteria 1767
290 Ga0207685_10082791 3300025905 Bacteria 1332
291 Ga0207685_10279429 3300025905 Bacteria 819
292 Ga0207699_10008324 3300025906 Bacteria 5113
293 Ga0207699_10053957 3300025906 Bacteria 2386
294 Ga0207699_10074508 3300025906 Bacteria 2085
295 Ga0207699_10229767 3300025906 Bacteria 1270
296 Ga0207699_10373981 3300025906 Bacteria 1010
297 Ga0207699_10619030 3300025906 Bacteria 789
298 Ga0207645_10013762 3300025907 Bacteria 5429
299 Ga0207643_10000102 3300025908 Bacteria 57710
300 Ga0207705_10004990 3300025909 Bacteria 9954
301 Ga0207705_10008596 3300025909 Bacteria 7443
302 Ga0207705_10080992 3300025909 Bacteria 2366
303 Ga0207705_10131864 3300025909 Bacteria 1860
304 Ga0207705_10645593 3300025909 Bacteria 823
305 Ga0207705_10760245 3300025909 Bacteria 753
306 Ga0207684_10001761 3300025910 Bacteria 22878
307 Ga0207684_10007871 3300025910 Bacteria 9532
308 Ga0207684_10048106 3300025910 Bacteria 3617
309 Ga0207684_10088377 3300025910 Bacteria 2640
310 Ga0207684_10150743 3300025910 Bacteria 2000
311 Ga0207684_10269781 3300025910 Bacteria 1468
312 Ga0207684_10317304 3300025910 Bacteria 1343
313 Ga0207684_10601954 3300025910 Bacteria 939
314 Ga0207654_10004709 3300025911 Bacteria 6903
315 Ga0207707_10019633 3300025912 Bacteria 5898
316 Ga0207707_10019811 3300025912 Bacteria 5874
317 Ga0207707_10891251 3300025912 Bacteria 736
318 Ga0207695_10664480 3300025913 Bacteria 923
319 Ga0207695_10856908 3300025913 Bacteria 789
320 Ga0207695_11047964 3300025913 Bacteria 695
321 Ga0207693_10007692 3300025915 Bacteria 8848
322 Ga0207693_10029943 3300025915 Bacteria 4296
323 Ga0207693_10083256 3300025915 Bacteria 2506
324 Ga0207693_10703707 3300025915 Bacteria 782
325 Ga0207693_11023311 3300025915 Bacteria 630
326 Ga0207663_10002072 3300025916 Bacteria 9557
327 Ga0207663_10049524 3300025916 Bacteria 2606
328 Ga0207663_10066709 3300025916 Bacteria 2304
329 Ga0207663_10084074 3300025916 Bacteria 2092
330 Ga0207663_10333652 3300025916 Bacteria 1143
331 Ga0207663_10752584 3300025916 Bacteria 774
332 Ga0207660_10015994 3300025917 Bacteria 4959
333 Ga0207660_10048977 3300025917 Bacteria 2992
334 Ga0207660_10748071 3300025917 Bacteria 798
335 Ga0207657_10013713 3300025919 Bacteria 7935
336 Ga0207657_10014627 3300025919 Bacteria 7645
337 Ga0207657_10320312 3300025919 Bacteria 1226
338 Ga0207649_10017873 3300025920 Bacteria 4022
339 Ga0207649_10744977 3300025920 Bacteria 762
340 Ga0207652_10071714 3300025921 Bacteria 3010
341 Ga0207652_10131531 3300025921 Bacteria 2232
342 Ga0207652_10226658 3300025921 Bacteria 1684
343 Ga0207652_10237625 3300025921 Bacteria 1642
344 Ga0207652_10846870 3300025921 Bacteria 810
345 Ga0207646_10000278 3300025922 Bacteria 70066
346 Ga0207646_10005502 3300025922 Bacteria 13316
347 Ga0207646_10008219 3300025922 Bacteria 10486
348 Ga0207646_10023928 3300025922 Bacteria 5603
349 Ga0207646_10033313 3300025922 Bacteria 4662
350 Ga0207646_10046873 3300025922 Bacteria 3878
351 Ga0207646_10070964 3300025922 Bacteria 3111
352 Ga0207646_10431242 3300025922 Bacteria 1189
353 Ga0207694_10117979 3300025924 Bacteria 2116
354 Ga0207694_10265607 3300025924 Bacteria 1407
355 Ga0207650_10024219 3300025925 Bacteria 4312
356 Ga0207659_10030915 3300025926 Bacteria 3662
357 Ga0207687_10007022 3300025927 Bacteria 7424
358 Ga0207687_10382452 3300025927 Bacteria 1154
359 Ga0207687_10396601 3300025927 Bacteria 1134
360 Ga0207700_10004397 3300025928 Bacteria 8301
361 Ga0207700_10021649 3300025928 Bacteria 4394
362 Ga0207700_10026432 3300025928 Bacteria 4046
363 Ga0207700_10031586 3300025928 Bacteria 3764
364 Ga0207700_10078052 3300025928 Bacteria 2574
365 Ga0207700_10096332 3300025928 Bacteria 2349
366 Ga0207700_10176396 3300025928 Bacteria 1786
367 Ga0207700_10194413 3300025928 Bacteria 1706
368 Ga0207700_10223279 3300025928 Bacteria 1598
369 Ga0207700_10265710 3300025928 Bacteria 1471
370 Ga0207700_10333970 3300025928 Bacteria 1316
371 Ga0207700_10567648 3300025928 Bacteria 1008
372 Ga0207664_10001507 3300025929 Bacteria 15255
373 Ga0207664_10005990 3300025929 Bacteria 8324
374 Ga0207664_10014918 3300025929 Bacteria 5625
375 Ga0207664_10032034 3300025929 Bacteria 4027
376 Ga0207664_10037113 3300025929 Bacteria 3769
377 Ga0207664_10079232 3300025929 Bacteria 2666
378 Ga0207664_10099191 3300025929 Bacteria 2403
379 Ga0207664_10109776 3300025929 Bacteria 2292
380 Ga0207664_10195832 3300025929 Bacteria 1742
381 Ga0207664_10309562 3300025929 Bacteria 1391
382 Ga0207664_10312268 3300025929 Bacteria 1385
383 Ga0207664_10530583 3300025929 Bacteria 1055
384 Ga0207664_10691161 3300025929 Bacteria 917
385 Ga0207690_10226566 3300025932 Bacteria 1433
386 Ga0207706_10097994 3300025933 Bacteria 2579
387 Ga0207686_10406785 3300025934 Bacteria 1038
388 Ga0207670_10029745 3300025936 Bacteria 3483
389 Ga0207669_10490894 3300025937 Bacteria 981
390 Ga0207704_10099915 3300025938 Bacteria 1931
391 Ga0207665_10002825 3300025939 Bacteria 11643
392 Ga0207665_10011126 3300025939 Bacteria 5904
393 Ga0207665_10031849 3300025939 Bacteria 3490
394 Ga0207665_10049531 3300025939 Bacteria 2823
395 Ga0207665_10055461 3300025939 Bacteria 2674
396 Ga0207665_10149970 3300025939 Bacteria 1669
397 Ga0207665_10186428 3300025939 Bacteria 1505
398 Ga0207711_10026883 3300025941 Bacteria 4830
399 Ga0207689_10001185 3300025942 Bacteria 25056
400 Ga0207661_10016521 3300025944 Bacteria 5446
401 Ga0207661_10026259 3300025944 Bacteria 4435
402 Ga0207661_10664860 3300025944 Bacteria 957
403 Ga0207679_10004501 3300025945 Bacteria 8679
404 Ga0207679_10801592 3300025945 Bacteria 859
405 Ga0207667_10014963 3300025949 Bacteria 8824
406 Ga0207667_10513153 3300025949 Bacteria 1215
407 Ga0207651_10218130 3300025960 Bacteria 1540
408 Ga0207668_10786077 3300025972 Bacteria 842
409 Ga0207640_10023349 3300025981 Bacteria 3715
410 Ga0207677_10047916 3300026023 Bacteria 2873
411 Ga0207703_10068617 3300026035 Bacteria 2921
412 Ga0207639_10316886 3300026041 Bacteria 1383
413 Ga0207678_10000141 3300026067 Bacteria 59147
414 Ga0207678_10236425 3300026067 Bacteria 1565
415 Ga0207708_10242608 3300026075 Bacteria 1450
416 Ga0207702_10000567 3300026078 Bacteria 41121
417 Ga0207702_10012158 3300026078 Bacteria 7162
418 Ga0207702_10013663 3300026078 Bacteria 6743
419 Ga0207702_10033883 3300026078 Bacteria 4268
420 Ga0207702_11526843 3300026078 Bacteria 661
421 Ga0207641_10005052 3300026088 Bacteria 11305
422 Ga0207641_10082843 3300026088 Bacteria 2788
423 Ga0207641_10332812 3300026088 Bacteria 1443
424 Ga0207676_10000814 3300026095 Bacteria 24327
425 Ga0207676_10247846 3300026095 Bacteria 1602
426 Ga0207674_10022354 3300026116 Bacteria 6791
427 Ga0207674_10981378 3300026116 Bacteria 814
428 Ga0207674_10983557 3300026116 Bacteria 813
429 Ga0207683_10002042 3300026121 Bacteria 17869
430 Ga0207683_10236616 3300026121 Bacteria 1666
431 Ga0207683_10369791 3300026121 Bacteria 1317
432 Ga0207683_10435210 3300026121 Bacteria 1209
433 Ga0207698_10002259 3300026142 Bacteria 11405
434 Ga0207698_11517674 3300026142 Bacteria 685
435 Ga0207428_10019640 3300027907 Bacteria 5759
436 Ga0268266_10090394 3300028379 Bacteria 2684
437 Ga0268266_10357664 3300028379 Bacteria 1373
438 Ga0268266_10520734 3300028379 Bacteria 1137
439 Ga0268264_11877075 3300028381 Bacteria 609
440 Ga0265337_1000705 3300028556 Bacteria 17624
441 Ga0265326_10010556 3300028558 Bacteria 2737
442 Ga0265319_1002204 3300028563 Bacteria 10846
443 Ga0265334_10001922 3300028573 Bacteria 9860
444 Ga0265318_10022213 3300028577 Bacteria 2539
445 Ga0265323_10010908 3300028653 Bacteria 3679
446 Ga0265322_10007986 3300028654 Bacteria 3087
447 Ga0265336_10001837 3300028666 Bacteria 9243
448 Ga0265338_10004045 3300028800 Bacteria 20114
449 Ga0265338_10011623 3300028800 Bacteria 10147
450 Ga0265338_10041393 3300028800 Bacteria 4308
451 Ga0265324_10001640 3300029957 Bacteria 12383
452 Ga0307511_10000625 3300030521 Bacteria 37858
453 Ga0307512_10024565 3300030522 Bacteria 5360
454 Ga0265332_10001213 3300031238 Bacteria 14920
455 Ga0265320_10023234 3300031240 Bacteria 3303
456 Ga0265325_10003537 3300031241 Bacteria 10158
457 Ga0265340_10002891 3300031247 Bacteria 9776
458 Ga0265339_10030831 3300031249 Bacteria 3034
459 Ga0265331_10334664 3300031250 Bacteria 678
460 Ga0265316_10012954 3300031344 Bacteria 7443
461 Ga0307513_10081826 3300031456 Bacteria 3326
462 Ga0307408_100257971 3300031548 Bacteria 1441
463 Ga0265313_10058125 3300031595 Bacteria 1823
464 Ga0265314_10025885 3300031711 Bacteria 4417
465 Ga0265342_10004344 3300031712 Bacteria 11215
466 Ga0307405_10101404 3300031731 Bacteria 1931
467 Ga0307405_10310595 3300031731 Bacteria 1200
468 Ga0307405_10787179 3300031731 Bacteria 796
469 Ga0307413_10002040 3300031824 Bacteria 8046
470 Ga0307413_10052584 3300031824 Bacteria 2461
471 Ga0307410_10053457 3300031852 Bacteria 2733
472 Ga0307410_10073759 3300031852 Bacteria 2374
473 Ga0307410_10360902 3300031852 Bacteria 1163
474 Ga0307410_10564405 3300031852 Bacteria 945
475 Ga0307410_11053372 3300031852 Bacteria 703
476 Ga0307406_10057466 3300031901 Bacteria 2495
477 Ga0307406_10073718 3300031901 Bacteria 2246
478 Ga0307406_10387480 3300031901 Bacteria 1104
479 Ga0307407_10011558 3300031903 Bacteria 4207
480 Ga0307412_10154730 3300031911 Bacteria 1696
481 Ga0307412_10729291 3300031911 Bacteria 853
482 Ga0307409_100026307 3300031995 Bacteria 4100
483 Ga0307409_100060029 3300031995 Bacteria 2963
484 Ga0307409_100160174 3300031995 Bacteria 1967
485 Ga0307409_100444741 3300031995 Bacteria 1249
486 Ga0307409_101299899 3300031995 Bacteria 752
487 Ga0307409_101393903 3300031995 Bacteria 727
488 Ga0307409_101659207 3300031995 Bacteria 668
489 Ga0307416_100161026 3300032002 Bacteria 2074
490 Ga0307416_100477121 3300032002 Bacteria 1306
491 Ga0307416_100493328 3300032002 Bacteria 1287
492 Ga0307416_101015640 3300032002 Bacteria 933
493 Ga0307416_101187703 3300032002 Bacteria 868
494 Ga0307414_11373397 3300032004 Bacteria 656
495 Ga0307411_10137300 3300032005 Bacteria 1797
496 Ga0307411_10415401 3300032005 Bacteria 1116
497 Ga0307411_10668249 3300032005 Bacteria 901
498 Ga0307411_10834111 3300032005 Bacteria 814
499 Ga0307415_100317996 3300032126 Bacteria 1297
500 Ga0307415_100630344 3300032126 Bacteria 958
501 Ga0307415_100659871 3300032126 Bacteria 939
502 Ga0307415_100917270 3300032126 Bacteria 808
503 Ga0316214_1031569 3300033545 Bacteria 752
504 Ga0373948_0011675 3300034817 Bacteria 1558
505 Ga0373926_0057756 3300035083 Bacteria 1410
506 Ga0373926_0077133 3300035083 Bacteria 1229
507 Ga0373926_0110451 3300035083 Bacteria 1032
508 Ga0373928_0003091 3300035084 Bacteria 3193
509 Ga0373929_0005169 3300035085 Bacteria 2346
510 Ga0373934_0062727 3300035086 Bacteria 1482
511 Ga0373940_0002286 3300035088 Bacteria 3694
512 Ga0373944_0000808 3300035089 Bacteria 7674
513 Ga0373944_0226245 3300035089 Bacteria 684
514 Ga0373949_0005475 3300035090 Bacteria 2831
515 Ga0373951_0015757 3300035091 Bacteria 1704
516 Ga0373952_0009434 3300035092 Bacteria 1868
517 Ga0373923_0001914 3300035111 Bacteria 6222
518 Ga0373923_0010514 3300035111 Bacteria 3369
519 Ga0373923_0110177 3300035111 Bacteria 1222
520 Ga0373936_0000341 3300035113 Bacteria 15795
521 Ga0373936_0004075 3300035113 Bacteria 5508
522 Ga0373936_0104220 3300035113 Bacteria 1199
523 Ga0373945_0001330 3300035116 Bacteria 7504
524 Ga0373945_0054315 3300035116 Bacteria 1481
525 Ga0373945_0106121 3300035116 Bacteria 1104
526 Ga0373953_0007549 3300035117 Bacteria 3649
527 Ga0373953_0017622 3300035117 Bacteria 2629
528 Ga0373954_0005348 3300035118 Bacteria 5547
529 Ga0373954_0032144 3300035118 Bacteria 2425
530 Ga0373954_0274685 3300035118 Bacteria 831
531 Ga0373956_0013973 3300035119 Bacteria 3347
532 Ga0373956_0030819 3300035119 Bacteria 2346
533 Ga0373957_0004353 3300035120 Bacteria 4300
534 Ga0373957_0040365 3300035120 Bacteria 1754
535 Ga0373957_0118748 3300035120 Bacteria 1069
536 Ga0373943_0000222 3300035170 Bacteria 23119
537 Ga0373943_0162665 3300035170 Bacteria 1216
538 Ga0373943_0358710 3300035170 Bacteria 836
539 Ga0373943_0375300 3300035170 Bacteria 818
540 Ga0373943_0624416 3300035170 Bacteria 636
541 Ga0373946_0000978 3300035171 Bacteria 9788
542 Ga0373946_0057447 3300035171 Bacteria 1646
543 Ga0373946_0062732 3300035171 Bacteria 1585
544 Ga0373946_0107118 3300035171 Bacteria 1260
545 Ga0373946_0189942 3300035171 Bacteria 979
546 Ga0373955_0005438 3300035172 Bacteria 5722
547 Ga0373955_0009735 3300035172 Bacteria 4514
548 Ga0373955_0013355 3300035172 Bacteria 3970
549 Ga0373955_0032799 3300035172 Bacteria 2730
550 Ga0373955_0086309 3300035172 Bacteria 1782
551 Ga0373961_0030354 3300035241 Bacteria 1503
552 Ga0373924_0000857 3300035410 Bacteria 9565
553 Ga0373924_0011457 3300035410 Bacteria 3293
554 Ga0373924_0027184 3300035410 Bacteria 2274
555 Ga0373931_0013864 3300035691 Bacteria 3932
556 Ga0373935_0000284 3300035692 Bacteria 24989
557 Ga0373935_0046359 3300035692 Bacteria 2745
558 Ga0373935_0075307 3300035692 Bacteria 2183
559 Ga0373935_0207251 3300035692 Bacteria 1357
560 Ga0373935_0844574 3300035692 Bacteria 677
561 Ga0373927_0002715 3300035695 Bacteria 12911
562 Ga0373927_0103410 3300035695 Bacteria 1853
563 Ga0373927_0490361 3300035695 Bacteria 812
564 Ga0373933_0001656 3300035724 Bacteria 12954
565 Ga0373933_0010912 3300035724 Bacteria 4989
566 Ga0373933_0011406 3300035724 Bacteria 4896
567 Ga0373933_0033245 3300035724 Bacteria 2999
568 Ga0373933_0133010 3300035724 Bacteria 1565
569 Ga0373947_0111726 3300035725 Bacteria 1727
570 Ga0373947_0161979 3300035725 Bacteria 1447
571 Ga0373947_0165173 3300035725 Bacteria 1433
572 Ga0373947_0246478 3300035725 Bacteria 1180
573 Ga0373937_0008933 3300036401 Bacteria 8700
574 Ga0373937_0020068 3300036401 Bacteria 5987
575 Ga0373937_0052935 3300036401 Bacteria 3723
576 Ga0373937_0067848 3300036401 Bacteria 3287
577 Ga0373937_0081086 3300036401 Bacteria 3001
578 Ga0373937_0186374 3300036401 Bacteria 1949
579 Ga0373937_0196611 3300036401 Bacteria 1895
580 Ga0373925_0000010 3300037068 Bacteria 229059
581 Ga0373925_0001242 3300037068 Bacteria 22486
582 Ga0373925_0008509 3300037068 Bacteria 7478
583 Ga0373925_0099508 3300037068 Bacteria 2233
584 Ga0373925_0148227 3300037068 Bacteria 1840
585 Ga0373925_0189265 3300037068 Bacteria 1632
586 Ga0373925_0681291 3300037068 Bacteria 847
587 Ga0395900_0357055 3300037418 Bacteria 1434
588 Ga0395900_1493460 3300037418 Bacteria 588
589 Ga0395898_0031434 3300037466 Bacteria 5304
590 Ga0395898_0157477 3300037466 Bacteria 2172
591 Ga0395905_0740604 3300037471 Bacteria 885
592 Ga0436364_0129100 3300037853 Bacteria 1740
593 Ga0436364_0526739 3300037853 Bacteria 629
594 Ga0436364_0568803 3300037853 Bacteria 42562
595 Ga0436364_0683724 3300037853 Bacteria 2916
596 Ga0436364_0805657 3300037853 Bacteria 63201
597 Ga0436364_0812095 3300037853 Bacteria 152428
598 Ga0436364_1046304 3300037853 Bacteria 1039
599 Ga0436364_1301853 3300037853 Bacteria 1395
600 Ga0436364_1470699 3300037853 Bacteria 1112
601 Ga0395901_0001374 3300038443 Bacteria 25464
602 Ga0395901_0330225 3300038443 Bacteria 1577
603 Ga0436365_0179761 3300039437 Bacteria 779
604 Ga0436365_0921579 3300039437 Bacteria 1010
605 Ga0436360_0567696 3300039438 Bacteria 1524
606 Ga0436363_1542421 3300039450 Bacteria 975
607 Ga0436362_0763195 3300039453 Bacteria 937
608 Ga0436362_0854794 3300039453 Bacteria 638
609 Ga0436362_1169821 3300039453 Bacteria 606
610 Ga0436362_1193726 3300039453 Bacteria 1299
611 Ga0451787_492751 3300041441 Bacteria 1016
612 Ga0451791_0567739 3300041451 Bacteria 9434
613 Ga0451793_0776550 3300041452 Bacteria 957
614 Ga0451797_1221977 3300041453 Bacteria 11215
615 Ga0451797_1302557 3300041453 Bacteria 906
616 Ga0451853_2506590 3300041512 Bacteria 6015
617 Ga0439449_0188888 3300042007 Bacteria 771
618 Ga0439459_0006708 3300042438 Bacteria 1927
619 Ga0466965_0025179 3300044683 Bacteria 2880
620 Ga0466966_0044949 3300044684 Bacteria 2825
621 Ga0466966_0243333 3300044684 Bacteria 1084
622 Ga0466966_0445544 3300044684 Bacteria 778
623 Ga0466961_0008686 3300044693 Bacteria 6476
624 Ga0466961_0156041 3300044693 Bacteria 1424
625 Ga0466963_0098947 3300044694 Bacteria 1994
626 Ga0466963_0105993 3300044694 Bacteria 1927
627 Ga0466971_0223478 3300044719 Bacteria 893
628 Ga0466968_0062288 3300044735 Bacteria 1611
629 Ga0466968_0177900 3300044735 Bacteria 988
630 Ga0466970_0087837 3300044765 Bacteria 1686
631 Ga0466970_0235493 3300044765 Bacteria 1024
632 Ga0466957_0019144 3300044842 Bacteria 4025
633 Ga0466957_0073273 3300044842 Bacteria 2122
634 Ga0466957_0177106 3300044842 Bacteria 1391
635 Ga0466957_0880381 3300044842 Bacteria 639
636 Ga0466960_0036253 3300044901 Bacteria 2309
637 Ga0466960_0141379 3300044901 Bacteria 1279
638 Ga0466960_0438201 3300044901 Bacteria 758
639 Ga0466960_0507242 3300044901 Bacteria 707
640 Ga0466959_0045597 3300045049 Bacteria 3228
641 Ga0466959_0087076 3300045049 Bacteria 2247
642 Ga0466959_0211433 3300045049 Bacteria 1348
643 Ga0466959_0211771 3300045049 Bacteria 1346
644 Ga0466959_0604258 3300045049 Bacteria 738
645 Ga0466958_0075278 3300045836 Bacteria 2070
646 Ga0466958_0084478 3300045836 Bacteria 1958
647 Ga0466958_0395292 3300045836 Bacteria 892
648 Ga0466958_0454670 3300045836 Bacteria 829
649 Ga0466967_0001208 3300045976 Bacteria 14538
650 Ga0466967_0020766 3300045976 Bacteria 5318
651 Ga0466967_0172562 3300045976 Bacteria 2035
652 Ga0466967_0384904 3300045976 Bacteria 1362
653 Ga0466967_0788294 3300045976 Bacteria 943
654 Ga0466967_1029986 3300045976 Bacteria 820
655 Ga0466967_1845226 3300045976 Bacteria 601
656 Ga0466967_1902848 3300045976 Bacteria 592
657 Ga0495592_0084123 3300046454 Bacteria 2296
658 Ga0495592_0112264 3300046454 Bacteria 1927
659 Ga0495592_0386519 3300046454 Bacteria 889
660 Ga0495603_0163238 3300046455 Bacteria 1292
661 Ga0495603_0516926 3300046455 Bacteria 684
662 Ga0495629_0001800 3300046459 Bacteria 16788
663 Ga0495629_0018033 3300046459 Bacteria 5059
664 Ga0495629_0025499 3300046459 Bacteria 4200
665 Ga0495629_0554499 3300046459 Bacteria 771
666 Ga0495641_0006605 3300046461 Bacteria 7471
667 Ga0495651_0011568 3300046462 Bacteria 6779
668 Ga0495651_0013357 3300046462 Bacteria 6352
669 Ga0495651_0109436 3300046462 Bacteria 2045
670 Ga0495651_0127548 3300046462 Bacteria 1861
671 Ga0495653_0023323 3300046463 Bacteria 5001
672 Ga0495653_0023846 3300046463 Bacteria 4939
673 Ga0495653_0049801 3300046463 Bacteria 3225
674 Ga0495653_0169805 3300046463 Bacteria 1506
675 Ga0495653_0190337 3300046463 Bacteria 1400
676 Ga0495653_0492051 3300046463 Bacteria 766
677 Ga0495580_0098032 3300046472 Bacteria 2039
678 Ga0495580_0361977 3300046472 Bacteria 982
679 Ga0495582_0003237 3300046473 Bacteria 9147
680 Ga0495582_0037837 3300046473 Bacteria 2654
681 Ga0495639_0019543 3300046475 Bacteria 2958
682 Ga0495639_0047349 3300046475 Bacteria 1947
683 Ga0495639_0235622 3300046475 Bacteria 902
684 Ga0495662_0021006 3300046476 Bacteria 3157
685 Ga0495662_0155558 3300046476 Bacteria 1126
686 Ga0495664_0002344 3300046477 Bacteria 10143
687 Ga0495664_0002466 3300046477 Bacteria 9960
688 Ga0495664_0039711 3300046477 Bacteria 2781
689 Ga0495664_0229075 3300046477 Bacteria 1124
690 Ga0495664_0518552 3300046477 Bacteria 711
691 Ga0495594_0050483 3300046499 Bacteria 2288
692 Ga0495596_0206697 3300046500 Bacteria 763
693 Ga0495608_0005053 3300046511 Bacteria 9437
694 Ga0495608_0013857 3300046511 Bacteria 5595
695 Ga0495608_0018341 3300046511 Bacteria 4829
696 Ga0495608_0037820 3300046511 Bacteria 3244
697 Ga0495608_0072696 3300046511 Bacteria 2243
698 Ga0495608_0098540 3300046511 Bacteria 1886
699 Ga0495608_0110927 3300046511 Bacteria 1764
700 Ga0495608_0120452 3300046511 Bacteria 1683
701 Ga0495618_0004006 3300046514 Bacteria 9083
702 Ga0495618_0010322 3300046514 Bacteria 5651
703 Ga0495618_0034393 3300046514 Bacteria 3177
704 Ga0495618_0215856 3300046514 Bacteria 1211
705 Ga0495628_0068140 3300046516 Bacteria 2777
706 Ga0495628_0187090 3300046516 Bacteria 1564
707 Ga0495628_0231681 3300046516 Bacteria 1384
708 Ga0495628_0247711 3300046516 Bacteria 1331
709 Ga0495628_0250617 3300046516 Bacteria 1322
710 Ga0495630_0002081 3300046517 Bacteria 13915
711 Ga0495630_0050184 3300046517 Bacteria 3122
712 Ga0495630_0190534 3300046517 Bacteria 1564
713 Ga0495652_0004790 3300046529 Bacteria 12879
714 Ga0495652_0009061 3300046529 Bacteria 9055
715 Ga0495652_0034845 3300046529 Bacteria 4385
716 Ga0495652_0060176 3300046529 Bacteria 3210
717 Ga0495652_0085070 3300046529 Bacteria 2600
718 Ga0495652_0497687 3300046529 Bacteria 845
719 Ga0495665_0003447 3300046531 Bacteria 8592
720 Ga0495665_0013796 3300046531 Bacteria 4365
721 Ga0495665_0070535 3300046531 Bacteria 1841
722 Ga0495640_0013788 3300046533 Bacteria 6141
723 Ga0495640_0079158 3300046533 Bacteria 2188
724 Ga0495640_0168453 3300046533 Bacteria 1400
725 Ga0495640_0272103 3300046533 Bacteria 1056
726 Ga0495640_0388146 3300046533 Bacteria 858
727 Ga0495586_0060770 3300046535 Bacteria 2055
728 Ga0495586_0075105 3300046535 Bacteria 1850
729 Ga0495587_0009568 3300046536 Bacteria 6204
730 Ga0495587_0039256 3300046536 Bacteria 2834
731 Ga0495587_0118087 3300046536 Bacteria 1520
732 Ga0495587_0244898 3300046536 Bacteria 1008
733 Ga0495587_0321227 3300046536 Bacteria 864
734 Ga0495645_0008403 3300046543 Bacteria 7212
735 Ga0495645_0041259 3300046543 Bacteria 3364
736 Ga0495645_0088303 3300046543 Bacteria 2218
737 Ga0495645_0101629 3300046543 Bacteria 2044
738 Ga0495645_0113723 3300046543 Bacteria 1913
739 Ga0495645_0353908 3300046543 Bacteria 945
740 Ga0495667_0009485 3300046559 Bacteria 6594
741 Ga0495667_0013328 3300046559 Bacteria 5564
742 Ga0495667_0017944 3300046559 Bacteria 4779
743 Ga0495667_0164534 3300046559 Bacteria 1426
744 Ga0495667_0173332 3300046559 Bacteria 1386
745 Ga0495667_0193224 3300046559 Bacteria 1304
746 Ga0495667_0513576 3300046559 Bacteria 750
747 Ga0495667_0585713 3300046559 Bacteria 695
748 Ga0495656_0069363 3300046615 Bacteria 1561
749 Ga0495634_0003736 3300046642 Bacteria 12125
750 Ga0495634_0022030 3300046642 Bacteria 4493
751 Ga0495634_0065008 3300046642 Bacteria 2418
752 Ga0495634_0134905 3300046642 Bacteria 1571
753 Ga0495635_0000373 3300046663 Bacteria 28369
754 Ga0495635_0010201 3300046663 Bacteria 6566
755 Ga0495635_0031552 3300046663 Bacteria 3677
756 Ga0495635_0048852 3300046663 Bacteria 2916
757 Ga0495635_0055815 3300046663 Bacteria 2721
758 Ga0495635_0067582 3300046663 Bacteria 2451
759 Ga0495635_0125396 3300046663 Bacteria 1751
760 Ga0495635_0157670 3300046663 Bacteria 1545
761 Ga0495588_0207115 3300046674 Bacteria 1036
762 Ga0495657_0005611 3300046675 Bacteria 9905
763 Ga0495657_0020617 3300046675 Bacteria 4738
764 Ga0495657_0032190 3300046675 Bacteria 3661
765 Ga0495657_0049639 3300046675 Bacteria 2825
766 Ga0495657_0063662 3300046675 Bacteria 2432
767 Ga0495657_0100230 3300046675 Bacteria 1846
768 Ga0495657_0359765 3300046675 Bacteria 860
769 Ga0495599_0006980 3300046678 Bacteria 6832
770 Ga0495599_0014769 3300046678 Bacteria 4834
771 Ga0495599_0057643 3300046678 Bacteria 2430
772 Ga0495599_0075853 3300046678 Bacteria 2099
773 Ga0495599_0127162 3300046678 Bacteria 1584
774 Ga0495599_0158130 3300046678 Bacteria 1401
775 Ga0495599_0193826 3300046678 Bacteria 1249
776 Ga0495599_0518277 3300046678 Bacteria 700
777 Ga0495623_0088595 3300046679 Bacteria 1904
778 Ga0495623_0123453 3300046679 Bacteria 1556
779 Ga0495623_0264055 3300046679 Bacteria 963
780 Ga0495646_0011973 3300046680 Bacteria 5518
781 Ga0495646_0098852 3300046680 Bacteria 1675
782 Ga0495646_0263585 3300046680 Bacteria 920
783 Ga0495646_0274623 3300046680 Bacteria 897
784 Ga0495658_0142253 3300046683 Bacteria 1468
785 Ga0495658_0149351 3300046683 Bacteria 1434
786 Ga0495613_0016767 3300046689 Bacteria 5454
787 Ga0495624_0005818 3300046690 Bacteria 8826
788 Ga0495671_0280469 3300046692 Bacteria 803
789 Ga0495600_0001122 3300046809 Bacteria 14592
790 Ga0495600_0017191 3300046809 Bacteria 4596
791 Ga0495600_0021301 3300046809 Bacteria 4149
792 Ga0495600_0416460 3300046809 Bacteria 834
793 Ga0495600_0542317 3300046809 Bacteria 711
794 Ga0495581_0098272 3300047315 Bacteria 1700
795 Ga0495581_0532588 3300047315 Bacteria 682
796 Ga0495604_0022717 3300047317 Bacteria 5008
797 Ga0495604_0033648 3300047317 Bacteria 4056
798 Ga0495674_0001403 3300047319 Bacteria 23570
799 Ga0495674_0008588 3300047319 Bacteria 9723
800 Ga0495674_0030881 3300047319 Bacteria 4868
801 Ga0495674_0033254 3300047319 Bacteria 4672
802 Ga0495674_0491523 3300047319 Bacteria 982
803 Ga0495674_0825849 3300047319 Bacteria 719
804 Ga0495676_0009960 3300047321 Bacteria 8637
805 Ga0495676_0257113 3300047321 Bacteria 1189
806 Ga0495680_0002970 3300047322 Bacteria 16962
807 Ga0495680_0003936 3300047322 Bacteria 14361
808 Ga0495680_0005201 3300047322 Bacteria 12275
809 Ga0495680_0025724 3300047322 Bacteria 4867
810 Ga0495680_0046222 3300047322 Bacteria 3433
811 Ga0495680_0064779 3300047322 Bacteria 2801
812 Ga0495680_0175742 3300047322 Bacteria 1548
813 Ga0495675_0004945 3300047444 Bacteria 8117
814 Ga0495675_0008242 3300047444 Bacteria 6447
815 Ga0495675_0010931 3300047444 Bacteria 5689
816 Ga0495675_0115439 3300047444 Bacteria 1674
817 Ga0495684_0017087 3300047471 Bacteria 5588
818 Ga0495684_0025759 3300047471 Bacteria 4519
819 Ga0495684_0026181 3300047471 Bacteria 4481
820 Ga0495684_0330890 3300047471 Bacteria 1086
821 Ga0495684_0416838 3300047471 Bacteria 939
822 Ga0495684_0550861 3300047471 Bacteria 785
823 Ga0495593_0080390 3300047673 Bacteria 1686
824 Ga0495593_0138062 3300047673 Bacteria 1235
825 Ga0495602_0053613 3300048088 Bacteria 3569
826 Ga0495602_0094490 3300048088 Bacteria 2470
827 Ga0495602_0156141 3300048088 Bacteria 1786
828 Ga0496100_0026734 3300048903 Bacteria 3541
829 Ga0496101_0004995 3300048904 Bacteria 8423
830 Ga0496101_0122283 3300048904 Bacteria 1969
831 Ga0496102_0013483 3300048905 Bacteria 7081
832 Ga0496102_0026750 3300048905 Bacteria 5149
833 Ga0496102_0383100 3300048905 Bacteria 1323
834 Ga0496102_0962699 3300048905 Bacteria 774
835 Ga0496104_0000398 3300048907 Bacteria 38090
836 Ga0496104_0003572 3300048907 Bacteria 13421
837 Ga0496104_0004209 3300048907 Bacteria 12493
838 Ga0496104_0043126 3300048907 Bacteria 4237
839 Ga0496104_0095273 3300048907 Bacteria 2847
840 Ga0496105_0001408 3300048908 Bacteria 16892
841 Ga0496105_0002315 3300048908 Bacteria 13811
842 Ga0496105_0005313 3300048908 Bacteria 9764
843 Ga0496105_0024841 3300048908 Bacteria 4869
844 Ga0496105_0068794 3300048908 Bacteria 2925
845 Ga0496105_0372930 3300048908 Bacteria 1137
846 Ga0496106_0100833 3300048909 Bacteria 2239
847 Ga0496106_0104620 3300048909 Bacteria 2198
848 Ga0496107_0022993 3300048910 Bacteria 4407
849 Ga0496107_0246526 3300048910 Bacteria 1329
850 Ga0496107_0273234 3300048910 Bacteria 1258
851 Ga0496108_0003584 3300048911 Bacteria 12438
852 Ga0496108_0028241 3300048911 Bacteria 4641
853 Ga0496108_0088189 3300048911 Bacteria 2636
854 Ga0496108_0146694 3300048911 Bacteria 2035
855 Ga0496108_1079640 3300048911 Bacteria 683
856 Ga0496109_0005942 3300048912 Bacteria 10243
857 Ga0496109_0085204 3300048912 Bacteria 2916
858 Ga0496109_0209383 3300048912 Bacteria 1834
859 Ga0496109_0345131 3300048912 Bacteria 1406
860 Ga0496109_1158852 3300048912 Bacteria 710
861 Ga0496110_0002292 3300048913 Bacteria 14309
862 Ga0496110_0788106 3300048913 Bacteria 854
863 Ga0496111_0004922 3300048914 Bacteria 8480
864 Ga0496111_0022876 3300048914 Bacteria 4381
865 Ga0496112_0000555 3300048915 Bacteria 25563
866 Ga0496112_0142478 3300048915 Bacteria 2366
867 Ga0496112_0296872 3300048915 Bacteria 1561
868 Ga0496112_0688649 3300048915 Bacteria 950
869 Ga0496113_0031690 3300048916 Bacteria 3838
870 Ga0496113_0032801 3300048916 Bacteria 3775
871 Ga0496113_0035217 3300048916 Bacteria 3660
872 Ga0496113_0682354 3300048916 Bacteria 821
873 Ga0496114_0006141 3300048917 Bacteria 9452
874 Ga0496114_0061818 3300048917 Bacteria 3133
875 Ga0496114_0146772 3300048917 Bacteria 2045
876 Ga0496114_0288679 3300048917 Bacteria 1447
877 Ga0496114_0356933 3300048917 Bacteria 1293
878 Ga0496114_0768009 3300048917 Bacteria 842
879 Ga0496114_1327168 3300048917 Bacteria 606
880 Ga0496114_1335450 3300048917 Bacteria 604
881 Ga0496115_0029629 3300048918 Bacteria 4300
882 Ga0496115_0085445 3300048918 Bacteria 2573
883 Ga0496115_0379645 3300048918 Bacteria 1149
884 Ga0496115_0693695 3300048918 Bacteria 801
885 Ga0496119_0090394 3300048922 Bacteria 1741
886 Ga0496126_0028014 3300048929 Bacteria 5372
887 Ga0496126_0789095 3300048929 Bacteria 730
888 Ga0501031_0063792 3300049568 Bacteria 2400
889 Ga0501042_1061028 3300049578 Bacteria 591
890 Ga0501047_0623194 3300049581 Bacteria 899
891 Ga0501069_0120164 3300049585 Bacteria 1500
892 Ga0501070_0009955 3300049586 Bacteria 8039
893 Ga0501070_0558537 3300049586 Bacteria 916
894 Ga0501074_0527329 3300049590 Bacteria 836
895 Ga0501074_0577034 3300049590 Bacteria 796
896 Ga0501075_0584028 3300049591 Bacteria 852
897 Ga0501076_0377577 3300049592 Bacteria 1165
898 Ga0501080_0528278 3300049742 Bacteria 1052
899 nmdc:mga05p37_21572_c1 3300050507 Bacteria 7805
900 nmdc:mga05p37_338150_c1 3300050507 Bacteria 1776
901 nmdc:mga09592_49013_c1 3300050508 Bacteria 3561
902 nmdc:mga06r32_640586_c1 3300050510 Bacteria 1032
903 nmdc:mga0n895_243588_c1 3300050512 Bacteria 1825
904 nmdc:mga0n895_387107_c1 3300050512 Bacteria 1415
905 nmdc:mga0rr50_616257_c1 3300050513 Bacteria 926
906 nmdc:mga0rr50_7131_c1 3300050513 Bacteria 6865
907 nmdc:mga0rr50_73405_c1 3300050513 Bacteria 2616
908 nmdc:mga08x19_132610_c1 3300050514 Bacteria 1677
909 nmdc:mga08x19_193102_c1 3300050514 Bacteria 1393
910 nmdc:mga08x19_243092_c1 3300050514 Bacteria 1241
911 nmdc:mga08x19_249211_c1 3300050514 Bacteria 1226
912 nmdc:mga08x19_32832_c1 3300050514 Bacteria 3274
913 nmdc:mga0a205_5191_c1 3300050515 Bacteria 10230
914 Ga0495601_0003370 3300053077 Bacteria 9152
915 Ga0495601_0056233 3300053077 Bacteria 2491
916 Ga0495601_0084051 3300053077 Bacteria 2045
917 Ga0495601_0286462 3300053077 Bacteria 1074
918 Ga0495612_0013917 3300053078 Bacteria 3241
919 Ga0495612_0015530 3300053078 Bacteria 3053
920 Ga0495612_0035866 3300053078 Bacteria 2011
921 Ga0495595_0186368 3300053084 Bacteria 1030
922 Ga0495595_0447451 3300053084 Bacteria 656
923 Ga0495595_0555363 3300053084 Bacteria 586
924 Ga0495619_0010591 3300053085 Bacteria 5800
925 Ga0495619_0015371 3300053085 Bacteria 4843
926 Ga0495619_0268347 3300053085 Bacteria 1183
927 Ga0495619_0301857 3300053085 Bacteria 1109
928 Ga0500655_021105 3300053133 Bacteria 1220
929 Ga0500577_0113327 3300053142 Bacteria 1121
930 Ga0500630_182400 3300053159 Bacteria 844
931 Ga0466962_0106168 3300061719 Bacteria 1350
932 Ga0466962_0214620 3300061719 Bacteria 942
933 2623500177 2622736605 Bacteria 4992138
934 3003001834 3002998708 Bacteria 11715108
935 8056065082 8056060235 Bacteria 7259403
936 Ga0495646_0031437
937 JGI25406J46586_10051874
938 JGI25405J52794_10074824
939 Ga0070658_10096527
940 Ga0070658_10396814
941 Ga0070676_10062529
942 Ga0070683_100297030
943 Ga0070670_100079289
944 Ga0068869_100002052
945 Ga0070680_100022377
946 Ga0070680_100411330
947 Ga0070682_100006180
948 Ga0070682_100045233
949 Ga0070682_100252769
950 Ga0068868_100004627
951 Ga0068868_100439381
952 Ga0070660_100087424
953 Ga0070660_100201248
954 Ga0070660_100522657
955 Ga0070691_10019655
956 Ga0070691_10509410
957 Ga0070661_100552592
958 Ga0070692_10001247
959 Ga0070675_100009094
960 Ga0070675_100013231
961 Ga0070671_100002713
962 Ga0070659_100218684
963 Ga0070659_100224938
964 Ga0070659_100485645
965 Ga0070659_100549615
966 Ga0070709_10007442
967 Ga0070709_10039528
968 Ga0070714_100004329
969 Ga0070714_100009463
970 Ga0070714_100019622
971 Ga0070714_100043473
972 Ga0070714_100070722
973 Ga0070714_100079102
974 Ga0070714_100154976
975 Ga0070714_100159390
976 Ga0070714_100212077
977 Ga0070714_100219834
978 Ga0070714_100226579
979 Ga0070714_100321589
980 Ga0070714_100393909
981 Ga0070714_100548482
982 Ga0070714_100570442
983 Ga0070714_101520736
984 Ga0070713_100036219
985 Ga0070713_100176176
986 Ga0070713_100338194
987 Ga0070713_100340993
988 Ga0070713_100346807
989 Ga0070713_100638343
990 Ga0070713_100647818
991 Ga0070713_100919625
992 Ga0070713_101389811
993 Ga0070710_10128257
994 Ga0070710_10323299
995 Ga0070710_10414397
996 Ga0070711_100032680
997 Ga0070711_100104807
998 Ga0070711_100413458
999 Ga0070711_100632634
1000 Ga0070711_100990293
1001 Ga0070705_100077968
1002 Ga0070694_100169495
1003 Ga0070694_100757991
1004 Ga0070694_101109028
1005 Ga0070708_100002501
1006 Ga0070708_100042043
1007 Ga0070708_100066894
1008 Ga0070708_100561009
1009 Ga0070663_100004146
1010 Ga0070663_100053936
1011 Ga0070663_100108239
1012 Ga0070663_100685738
1013 Ga0070678_100015458
1014 Ga0070678_100704941
1015 Ga0070662_100243168
1016 Ga0070681_10007378
1017 Ga0070681_10055905
1018 Ga0070681_11208352
1019 Ga0070685_10017716
1020 Ga0070706_100002492
1021 Ga0070706_100008070
1022 Ga0070706_100017808
1023 Ga0070706_100021912
1024 Ga0070706_100054596
1025 Ga0070706_100136298
1026 Ga0070706_100214722
1027 Ga0070706_100811748
1028 Ga0070707_100000199
1029 Ga0070707_100001332
1030 Ga0070707_100005322
1031 Ga0070707_100012384
1032 Ga0070707_100030494
1033 Ga0070707_100036466
1034 Ga0070707_100040620
1035 Ga0070707_100061390
1036 Ga0070707_100123121
1037 Ga0070707_100832142
1038 Ga0070707_101103001
1039 Ga0070698_100000264
1040 Ga0070698_100001732
1041 Ga0070698_100035178
1042 Ga0070698_100035250
1043 Ga0070698_100048835
1044 Ga0070698_100051145
1045 Ga0070698_100071099
1046 Ga0070698_100182506
1047 Ga0070698_100463966
1048 Ga0070698_100547426
1049 Ga0070698_100743831
1050 Ga0070699_100006399
1051 Ga0070679_100016152
1052 Ga0070679_100074844
1053 Ga0070679_100106016
1054 Ga0070679_100118116
1055 Ga0070679_100442230
1056 Ga0070684_100086401
1057 Ga0070684_100641351
1058 Ga0070684_101053753
1059 Ga0070697_100010436
1060 Ga0070697_100033026
1061 Ga0070697_100075666
1062 Ga0070697_100712606
1063 Ga0068853_100054874
1064 Ga0068853_100247590
1065 Ga0070686_100565979
1066 Ga0070695_100700332
1067 Ga0070695_100901322
1068 Ga0070665_100045239
1069 Ga0070665_100465985
1070 Ga0070665_100639483
1071 Ga0070704_100166515
1072 Ga0070704_100339739
1073 Ga0068855_100009694
1074 Ga0068855_100742934
1075 Ga0068857_100673572
1076 Ga0068857_100839866
1077 Ga0068856_100008925
1078 Ga0068856_100042106
1079 Ga0068856_100048682
1080 Ga0068856_100302681
1081 Ga0068856_100742570
1082 Ga0068856_101030912
1083 Ga0068856_101797982
1084 Ga0070702_100001819
1085 Ga0070702_100350434
1086 Ga0068852_100006864
1087 Ga0068852_100327019
1088 Ga0068852_101699026
1089 Ga0068859_100077412
1090 Ga0068864_100106943
1091 Ga0068864_100428677
1092 Ga0068866_10685973
1093 Ga0068861_100168780
1094 Ga0068851_10010568
1095 Ga0068870_10000071
1096 Ga0068863_100032440
1097 Ga0068863_100103755
1098 Ga0068858_100003961
1099 Ga0068860_100311861
1100 Ga0081455_10001891
1101 Ga0081539_10000806
1102 Ga0070717_10002201
1103 Ga0070717_10004329
1104 Ga0070717_10048540
1105 Ga0070717_10064433
1106 Ga0070717_10094448
1107 Ga0070717_10206429
1108 Ga0070717_10208281
1109 Ga0070717_10254711
1110 Ga0070717_10296654
1111 Ga0070717_10302209
1112 Ga0070717_10318453
1113 Ga0070717_10438333
1114 Ga0070717_11409355
1115 Ga0075432_10003384
1116 Ga0075432_10196075
1117 Ga0070715_10003898
1118 Ga0070715_10008246
1119 Ga0070715_10008492
1120 Ga0070715_10054529
1121 Ga0070716_100120063
1122 Ga0070716_100178665
1123 Ga0070716_100301902
1124 Ga0070716_100324093
1125 Ga0070716_100417201
1126 Ga0070716_100563211
1127 Ga0070712_100014246
1128 Ga0070712_100126708
1129 Ga0070712_100256995
1130 Ga0070712_100744336
1131 Ga0097621_100044853
1132 Ga0068871_100037805
1133 Ga0075428_100243261
1134 Ga0075428_100355691
1135 Ga0075431_100407351
1136 Ga0075433_10005340
1137 Ga0075433_10046311
1138 Ga0075433_10233585
1139 Ga0075434_100001779
1140 Ga0075434_100007096
1141 Ga0075434_100489726
1142 Ga0075434_100592208
1143 Ga0075429_100231745
1144 Ga0068865_101097625
1145 Ga0075436_100001620
1146 Ga0075436_100029436
1147 Ga0075436_100106996
1148 Ga0075436_100458689
1149 Ga0075436_100690802
1150 Ga0097620_100077414
1151 Ga0075435_100002488
1152 Ga0075435_100005801
1153 Ga0075435_100083568
1154 Ga0075435_100320827
1155 Ga0075435_100908889
1156 Ga0099794_10028392
1157 Ga0105251_10065085
1158 Ga0105240_10109913
1159 Ga0105240_10283149
1160 Ga0111539_10019228
1161 Ga0105245_10254953
1162 Ga0105245_10536031
1163 Ga0105245_11251747
1164 Ga0114129_10041618
1165 Ga0114129_10771531
1166 Ga0105243_10188743
1167 Ga0105241_10007293
1168 Ga0105248_10012380
1169 Ga0105237_10160172
1170 Ga0105238_10291735
1171 Ga0105238_10631063
1172 Ga0105239_10954888
1173 Ga0105239_10976350
1174 Ga0105246_10000478
1175 Ga0157371_10009341
1176 Ga0157371_10273155
1177 Ga0157370_10064992
1178 Ga0157370_10107846
1179 Ga0157369_10009552
1180 Ga0157369_10107064
1181 Ga0157369_10433780
1182 Ga0157374_10270734
1183 Ga0163162_10534143
1184 Ga0157372_10041227
1185 Ga0157372_10433686
1186 Ga0157375_12452708
1187 Ga0163163_10220663
1188 Ga0163163_10962253
1189 Ga0163163_11245025
1190 Ga0157380_10264225
1191 Ga0182008_10020152
1192 Ga0157377_10116735
1193 Ga0157377_10390674
1194 Ga0157379_10035359
1195 Ga0157376_12010665
1196 Ga0197907_10181547
1197 Ga0206356_10850638
1198 Ga0206352_10556522
1199 Ga0206354_10159229
1200 Ga0206354_10322134
1201 Ga0206354_11210541
1202 Ga0206354_11331006
1203 Ga0206353_10363697
1204 Ga0206353_10591091
1205 Ga0206353_10881626
1206 Ga0206353_10948632
1207 Ga0206353_11417859
1208 Ga0206353_11420308
1209 Ga0213873_10087785
1210 Ga0213875_10000079
1211 Ga0213875_10033595
1212 Ga0213875_10084295
1213 Ga0213875_10125370
1214 Ga0224712_10008505
1215 Ga0207656_10002399
1216 Ga0207692_10002632
1217 Ga0207692_10004539
1218 Ga0207692_10029139
1219 Ga0207692_10322136
1220 Ga0207692_10557709
1221 Ga0207688_10002679
1222 Ga0207647_10063509
1223 Ga0207685_10002255
1224 Ga0207685_10038598
1225 Ga0207685_10082791
1226 Ga0207685_10279429
1227 Ga0207699_10008324
1228 Ga0207699_10053957
1229 Ga0207699_10074508
1230 Ga0207699_10229767
1231 Ga0207699_10373981
1232 Ga0207699_10619030
1233 Ga0207645_10013762
1234 Ga0207643_10000102
1235 Ga0207705_10004990
1236 Ga0207705_10008596
1237 Ga0207705_10080992
1238 Ga0207705_10131864
1239 Ga0207705_10645593
1240 Ga0207705_10760245
1241 Ga0207684_10001761
1242 Ga0207684_10007871
1243 Ga0207684_10048106
1244 Ga0207684_10088377
1245 Ga0207684_10150743
1246 Ga0207684_10269781
1247 Ga0207684_10317304
1248 Ga0207684_10601954
1249 Ga0207654_10004709
1250 Ga0207707_10019633
1251 Ga0207707_10019811
1252 Ga0207707_10891251
1253 Ga0207695_10664480
1254 Ga0207695_10856908
1255 Ga0207695_11047964
1256 Ga0207693_10007692
1257 Ga0207693_10029943
1258 Ga0207693_10083256
1259 Ga0207693_10703707
1260 Ga0207693_11023311
1261 Ga0207663_10002072
1262 Ga0207663_10049524
1263 Ga0207663_10066709
1264 Ga0207663_10084074
1265 Ga0207663_10333652
1266 Ga0207663_10752584
1267 Ga0207660_10015994
1268 Ga0207660_10048977
1269 Ga0207660_10748071
1270 Ga0207657_10013713
1271 Ga0207657_10014627
1272 Ga0207657_10320312
1273 Ga0207649_10017873
1274 Ga0207649_10744977
1275 Ga0207652_10071714
1276 Ga0207652_10131531
1277 Ga0207652_10226658
1278 Ga0207652_10237625
1279 Ga0207652_10846870
1280 Ga0207646_10000278
1281 Ga0207646_10005502
1282 Ga0207646_10008219
1283 Ga0207646_10023928
1284 Ga0207646_10033313
1285 Ga0207646_10046873
1286 Ga0207646_10070964
1287 Ga0207646_10431242
1288 Ga0207694_10117979
1289 Ga0207694_10265607
1290 Ga0207650_10024219
1291 Ga0207659_10030915
1292 Ga0207687_10007022
1293 Ga0207687_10382452
1294 Ga0207687_10396601
1295 Ga0207700_10004397
1296 Ga0207700_10021649
1297 Ga0207700_10026432
1298 Ga0207700_10031586
1299 Ga0207700_10078052
1300 Ga0207700_10096332
1301 Ga0207700_10176396
1302 Ga0207700_10194413
1303 Ga0207700_10223279
1304 Ga0207700_10265710
1305 Ga0207700_10333970
1306 Ga0207700_10567648
1307 Ga0207664_10001507
1308 Ga0207664_10005990
1309 Ga0207664_10014918
1310 Ga0207664_10032034
1311 Ga0207664_10037113
1312 Ga0207664_10079232
1313 Ga0207664_10099191
1314 Ga0207664_10109776
1315 Ga0207664_10195832
1316 Ga0207664_10309562
1317 Ga0207664_10312268
1318 Ga0207664_10530583
1319 Ga0207664_10691161
1320 Ga0207690_10226566
1321 Ga0207706_10097994
1322 Ga0207686_10406785
1323 Ga0207670_10029745
1324 Ga0207669_10490894
1325 Ga0207704_10099915
1326 Ga0207665_10002825
1327 Ga0207665_10011126
1328 Ga0207665_10031849
1329 Ga0207665_10049531
1330 Ga0207665_10055461
1331 Ga0207665_10149970
1332 Ga0207665_10186428
1333 Ga0207711_10026883
1334 Ga0207689_10001185
1335 Ga0207661_10016521
1336 Ga0207661_10026259
1337 Ga0207661_10664860
1338 Ga0207679_10004501
1339 Ga0207679_10801592
1340 Ga0207667_10014963
1341 Ga0207667_10513153
1342 Ga0207651_10218130
1343 Ga0207668_10786077
1344 Ga0207640_10023349
1345 Ga0207677_10047916
1346 Ga0207703_10068617
1347 Ga0207639_10316886
1348 Ga0207678_10000141
1349 Ga0207678_10236425
1350 Ga0207708_10242608
1351 Ga0207702_10000567
1352 Ga0207702_10012158
1353 Ga0207702_10013663
1354 Ga0207702_10033883
1355 Ga0207702_11526843
1356 Ga0207641_10005052
1357 Ga0207641_10082843
1358 Ga0207641_10332812
1359 Ga0207676_10000814
1360 Ga0207676_10247846
1361 Ga0207674_10022354
1362 Ga0207674_10981378
1363 Ga0207674_10983557
1364 Ga0207683_10002042
1365 Ga0207683_10236616
1366 Ga0207683_10369791
1367 Ga0207683_10435210
1368 Ga0207698_10002259
1369 Ga0207698_11517674
1370 Ga0207428_10019640
1371 Ga0268266_10090394
1372 Ga0268266_10357664
1373 Ga0268266_10520734
1374 Ga0268264_11877075
1375 Ga0265337_1000705
1376 Ga0265326_10010556
1377 Ga0265319_1002204
1378 Ga0265334_10001922
1379 Ga0265318_10022213
1380 Ga0265323_10010908
1381 Ga0265322_10007986
1382 Ga0265336_10001837
1383 Ga0265338_10004045
1384 Ga0265338_10011623
1385 Ga0265338_10041393
1386 Ga0265324_10001640
1387 Ga0307511_10000625
1388 Ga0307512_10024565
1389 Ga0265332_10001213
1390 Ga0265320_10023234
1391 Ga0265325_10003537
1392 Ga0265340_10002891
1393 Ga0265339_10030831
1394 Ga0265331_10334664
1395 Ga0265316_10012954
1396 Ga0307513_10081826
1397 Ga0307408_100257971
1398 Ga0265313_10058125
1399 Ga0265314_10025885
1400 Ga0265342_10004344
1401 Ga0307405_10101404
1402 Ga0307405_10310595
1403 Ga0307405_10787179
1404 Ga0307413_10002040
1405 Ga0307413_10052584
1406 Ga0307410_10053457
1407 Ga0307410_10073759
1408 Ga0307410_10360902
1409 Ga0307410_10564405
1410 Ga0307410_11053372
1411 Ga0307406_10057466
1412 Ga0307406_10073718
1413 Ga0307406_10387480
1414 Ga0307407_10011558
1415 Ga0307412_10154730
1416 Ga0307412_10729291
1417 Ga0307409_100026307
1418 Ga0307409_100060029
1419 Ga0307409_100160174
1420 Ga0307409_100444741
1421 Ga0307409_101299899
1422 Ga0307409_101393903
1423 Ga0307409_101659207
1424 Ga0307416_100161026
1425 Ga0307416_100477121
1426 Ga0307416_100493328
1427 Ga0307416_101015640
1428 Ga0307416_101187703
1429 Ga0307414_11373397
1430 Ga0307411_10137300
1431 Ga0307411_10415401
1432 Ga0307411_10668249
1433 Ga0307411_10834111
1434 Ga0307415_100317996
1435 Ga0307415_100630344
1436 Ga0307415_100659871
1437 Ga0307415_100917270
1438 Ga0316214_1031569
1439 Ga0373948_0011675
1440 Ga0373926_0057756
1441 Ga0373926_0077133
1442 Ga0373926_0110451
1443 Ga0373928_0003091
1444 Ga0373929_0005169
1445 Ga0373934_0062727
1446 Ga0373940_0002286
1447 Ga0373944_0000808
1448 Ga0373944_0226245
1449 Ga0373949_0005475
1450 Ga0373951_0015757
1451 Ga0373952_0009434
1452 Ga0373923_0001914
1453 Ga0373923_0010514
1454 Ga0373923_0110177
1455 Ga0373936_0000341
1456 Ga0373936_0004075
1457 Ga0373936_0104220
1458 Ga0373945_0001330
1459 Ga0373945_0054315
1460 Ga0373945_0106121
1461 Ga0373953_0007549
1462 Ga0373953_0017622
1463 Ga0373954_0005348
1464 Ga0373954_0032144
1465 Ga0373954_0274685
1466 Ga0373956_0013973
1467 Ga0373956_0030819
1468 Ga0373957_0004353
1469 Ga0373957_0040365
1470 Ga0373957_0118748
1471 Ga0373943_0000222
1472 Ga0373943_0162665
1473 Ga0373943_0358710
1474 Ga0373943_0375300
1475 Ga0373943_0624416
1476 Ga0373946_0000978
1477 Ga0373946_0057447
1478 Ga0373946_0062732
1479 Ga0373946_0107118
1480 Ga0373946_0189942
1481 Ga0373955_0005438
1482 Ga0373955_0009735
1483 Ga0373955_0013355
1484 Ga0373955_0032799
1485 Ga0373955_0086309
1486 Ga0373961_0030354
1487 Ga0373924_0000857
1488 Ga0373924_0011457
1489 Ga0373924_0027184
1490 Ga0373931_0013864
1491 Ga0373935_0000284
1492 Ga0373935_0046359
1493 Ga0373935_0075307
1494 Ga0373935_0207251
1495 Ga0373935_0844574
1496 Ga0373927_0002715
1497 Ga0373927_0103410
1498 Ga0373927_0490361
1499 Ga0373933_0001656
1500 Ga0373933_0010912
1501 Ga0373933_0011406
1502 Ga0373933_0033245
1503 Ga0373933_0133010
1504 Ga0373947_0111726
1505 Ga0373947_0161979
1506 Ga0373947_0165173
1507 Ga0373947_0246478
1508 Ga0373937_0008933
1509 Ga0373937_0020068
1510 Ga0373937_0052935
1511 Ga0373937_0067848
1512 Ga0373937_0081086
1513 Ga0373937_0186374
1514 Ga0373937_0196611
1515 Ga0373925_0000010
1516 Ga0373925_0001242
1517 Ga0373925_0008509
1518 Ga0373925_0099508
1519 Ga0373925_0148227
1520 Ga0373925_0189265
1521 Ga0373925_0681291
1522 Ga0395900_0357055
1523 Ga0395900_1493460
1524 Ga0395898_0031434
1525 Ga0395898_0157477
1526 Ga0395905_0740604
1527 Ga0436364_0129100
1528 Ga0436364_0526739
1529 Ga0436364_0568803
1530 Ga0436364_0683724
1531 Ga0436364_0805657
1532 Ga0436364_0812095
1533 Ga0436364_1046304
1534 Ga0436364_1301853
1535 Ga0436364_1470699
1536 Ga0395901_0001374
1537 Ga0395901_0330225
1538 Ga0436365_0179761
1539 Ga0436365_0921579
1540 Ga0436360_0567696
1541 Ga0436363_1542421
1542 Ga0436362_0763195
1543 Ga0436362_0854794
1544 Ga0436362_1169821
1545 Ga0436362_1193726
1546 Ga0451787_492751
1547 Ga0451791_0567739
1548 Ga0451793_0776550
1549 Ga0451797_1221977
1550 Ga0451797_1302557
1551 Ga0451853_2506590
1552 Ga0439449_0188888
1553 Ga0439459_0006708
1554 Ga0466965_0025179
1555 Ga0466966_0044949
1556 Ga0466966_0243333
1557 Ga0466966_0445544
1558 Ga0466961_0008686
1559 Ga0466961_0156041
1560 Ga0466963_0098947
1561 Ga0466963_0105993
1562 Ga0466971_0223478
1563 Ga0466968_0062288
1564 Ga0466968_0177900
1565 Ga0466970_0087837
1566 Ga0466970_0235493
1567 Ga0466957_0019144
1568 Ga0466957_0073273
1569 Ga0466957_0177106
1570 Ga0466957_0880381
1571 Ga0466960_0036253
1572 Ga0466960_0141379
1573 Ga0466960_0438201
1574 Ga0466960_0507242
1575 Ga0466959_0045597
1576 Ga0466959_0087076
1577 Ga0466959_0211433
1578 Ga0466959_0211771
1579 Ga0466959_0604258
1580 Ga0466958_0075278
1581 Ga0466958_0084478
1582 Ga0466958_0395292
1583 Ga0466958_0454670
1584 Ga0466967_0001208
1585 Ga0466967_0020766
1586 Ga0466967_0172562
1587 Ga0466967_0384904
1588 Ga0466967_0788294
1589 Ga0466967_1029986
1590 Ga0466967_1845226
1591 Ga0466967_1902848
1592 Ga0495592_0084123
1593 Ga0495592_0112264
1594 Ga0495592_0386519
1595 Ga0495603_0163238
1596 Ga0495603_0516926
1597 Ga0495629_0001800
1598 Ga0495629_0018033
1599 Ga0495629_0025499
1600 Ga0495629_0554499
1601 Ga0495641_0006605
1602 Ga0495651_0011568
1603 Ga0495651_0013357
1604 Ga0495651_0109436
1605 Ga0495651_0127548
1606 Ga0495653_0023323
1607 Ga0495653_0023846
1608 Ga0495653_0049801
1609 Ga0495653_0169805
1610 Ga0495653_0190337
1611 Ga0495653_0492051
1612 Ga0495580_0098032
1613 Ga0495580_0361977
1614 Ga0495582_0003237
1615 Ga0495582_0037837
1616 Ga0495639_0019543
1617 Ga0495639_0047349
1618 Ga0495639_0235622
1619 Ga0495662_0021006
1620 Ga0495662_0155558
1621 Ga0495664_0002344
1622 Ga0495664_0002466
1623 Ga0495664_0039711
1624 Ga0495664_0229075
1625 Ga0495664_0518552
1626 Ga0495594_0050483
1627 Ga0495596_0206697
1628 Ga0495608_0005053
1629 Ga0495608_0013857
1630 Ga0495608_0018341
1631 Ga0495608_0037820
1632 Ga0495608_0072696
1633 Ga0495608_0098540
1634 Ga0495608_0110927
1635 Ga0495608_0120452
1636 Ga0495618_0004006
1637 Ga0495618_0010322
1638 Ga0495618_0034393
1639 Ga0495618_0215856
1640 Ga0495628_0068140
1641 Ga0495628_0187090
1642 Ga0495628_0231681
1643 Ga0495628_0247711
1644 Ga0495628_0250617
1645 Ga0495630_0002081
1646 Ga0495630_0050184
1647 Ga0495630_0190534
1648 Ga0495652_0004790
1649 Ga0495652_0009061
1650 Ga0495652_0034845
1651 Ga0495652_0060176
1652 Ga0495652_0085070
1653 Ga0495652_0497687
1654 Ga0495665_0003447
1655 Ga0495665_0013796
1656 Ga0495665_0070535
1657 Ga0495640_0013788
1658 Ga0495640_0079158
1659 Ga0495640_0168453
1660 Ga0495640_0272103
1661 Ga0495640_0388146
1662 Ga0495586_0060770
1663 Ga0495586_0075105
1664 Ga0495587_0009568
1665 Ga0495587_0039256
1666 Ga0495587_0118087
1667 Ga0495587_0244898
1668 Ga0495587_0321227
1669 Ga0495645_0008403
1670 Ga0495645_0041259
1671 Ga0495645_0088303
1672 Ga0495645_0101629
1673 Ga0495645_0113723
1674 Ga0495645_0353908
1675 Ga0495667_0009485
1676 Ga0495667_0013328
1677 Ga0495667_0017944
1678 Ga0495667_0164534
1679 Ga0495667_0173332
1680 Ga0495667_0193224
1681 Ga0495667_0513576
1682 Ga0495667_0585713
1683 Ga0495656_0069363
1684 Ga0495634_0003736
1685 Ga0495634_0022030
1686 Ga0495634_0065008
1687 Ga0495634_0134905
1688 Ga0495635_0000373
1689 Ga0495635_0010201
1690 Ga0495635_0031552
1691 Ga0495635_0048852
1692 Ga0495635_0055815
1693 Ga0495635_0067582
1694 Ga0495635_0125396
1695 Ga0495635_0157670
1696 Ga0495588_0207115
1697 Ga0495657_0005611
1698 Ga0495657_0020617
1699 Ga0495657_0032190
1700 Ga0495657_0049639
1701 Ga0495657_0063662
1702 Ga0495657_0100230
1703 Ga0495657_0359765
1704 Ga0495599_0006980
1705 Ga0495599_0014769
1706 Ga0495599_0057643
1707 Ga0495599_0075853
1708 Ga0495599_0127162
1709 Ga0495599_0158130
1710 Ga0495599_0193826
1711 Ga0495599_0518277
1712 Ga0495623_0088595
1713 Ga0495623_0123453
1714 Ga0495623_0264055
1715 Ga0495646_0011973
1716 Ga0495646_0098852
1717 Ga0495646_0263585
1718 Ga0495646_0274623
1719 Ga0495658_0142253
1720 Ga0495658_0149351
1721 Ga0495613_0016767
1722 Ga0495624_0005818
1723 Ga0495671_0280469
1724 Ga0495600_0001122
1725 Ga0495600_0017191
1726 Ga0495600_0021301
1727 Ga0495600_0416460
1728 Ga0495600_0542317
1729 Ga0495581_0098272
1730 Ga0495581_0532588
1731 Ga0495604_0022717
1732 Ga0495604_0033648
1733 Ga0495674_0001403
1734 Ga0495674_0008588
1735 Ga0495674_0030881
1736 Ga0495674_0033254
1737 Ga0495674_0491523
1738 Ga0495674_0825849
1739 Ga0495676_0009960
1740 Ga0495676_0257113
1741 Ga0495680_0002970
1742 Ga0495680_0003936
1743 Ga0495680_0005201
1744 Ga0495680_0025724
1745 Ga0495680_0046222
1746 Ga0495680_0064779
1747 Ga0495680_0175742
1748 Ga0495675_0004945
1749 Ga0495675_0008242
1750 Ga0495675_0010931
1751 Ga0495675_0115439
1752 Ga0495684_0017087
1753 Ga0495684_0025759
1754 Ga0495684_0026181
1755 Ga0495684_0330890
1756 Ga0495684_0416838
1757 Ga0495684_0550861
1758 Ga0495593_0080390
1759 Ga0495593_0138062
1760 Ga0495602_0053613
1761 Ga0495602_0094490
1762 Ga0495602_0156141
1763 Ga0496100_0026734
1764 Ga0496101_0004995
1765 Ga0496101_0122283
1766 Ga0496102_0013483
1767 Ga0496102_0026750
1768 Ga0496102_0383100
1769 Ga0496102_0962699
1770 Ga0496104_0000398
1771 Ga0496104_0003572
1772 Ga0496104_0004209
1773 Ga0496104_0043126
1774 Ga0496104_0095273
1775 Ga0496105_0001408
1776 Ga0496105_0002315
1777 Ga0496105_0005313
1778 Ga0496105_0024841
1779 Ga0496105_0068794
1780 Ga0496105_0372930
1781 Ga0496106_0100833
1782 Ga0496106_0104620
1783 Ga0496107_0022993
1784 Ga0496107_0246526
1785 Ga0496107_0273234
1786 Ga0496108_0003584
1787 Ga0496108_0028241
1788 Ga0496108_0088189
1789 Ga0496108_0146694
1790 Ga0496108_1079640
1791 Ga0496109_0005942
1792 Ga0496109_0085204
1793 Ga0496109_0209383
1794 Ga0496109_0345131
1795 Ga0496109_1158852
1796 Ga0496110_0002292
1797 Ga0496110_0788106
1798 Ga0496111_0004922
1799 Ga0496111_0022876
1800 Ga0496112_0000555
1801 Ga0496112_0142478
1802 Ga0496112_0296872
1803 Ga0496112_0688649
1804 Ga0496113_0031690
1805 Ga0496113_0032801
1806 Ga0496113_0035217
1807 Ga0496113_0682354
1808 Ga0496114_0006141
1809 Ga0496114_0061818
1810 Ga0496114_0146772
1811 Ga0496114_0288679
1812 Ga0496114_0356933
1813 Ga0496114_0768009
1814 Ga0496114_1327168
1815 Ga0496114_1335450
1816 Ga0496115_0029629
1817 Ga0496115_0085445
1818 Ga0496115_0379645
1819 Ga0496115_0693695
1820 Ga0496119_0090394
1821 Ga0496126_0028014
1822 Ga0496126_0789095
1823 Ga0501031_0063792
1824 Ga0501042_1061028
1825 Ga0501047_0623194
1826 Ga0501069_0120164
1827 Ga0501070_0009955
1828 Ga0501070_0558537
1829 Ga0501074_0527329
1830 Ga0501074_0577034
1831 Ga0501075_0584028
1832 Ga0501076_0377577
1833 Ga0501080_0528278
1834 nmdc:mga05p37_21572_c1
1835 nmdc:mga05p37_338150_c1
1836 nmdc:mga09592_49013_c1
1837 nmdc:mga06r32_640586_c1
1838 nmdc:mga0n895_243588_c1
1839 nmdc:mga0n895_387107_c1
1840 nmdc:mga0rr50_616257_c1
1841 nmdc:mga0rr50_7131_c1
1842 nmdc:mga0rr50_73405_c1
1843 nmdc:mga08x19_132610_c1
1844 nmdc:mga08x19_193102_c1
1845 nmdc:mga08x19_243092_c1
1846 nmdc:mga08x19_249211_c1
1847 nmdc:mga08x19_32832_c1
1848 nmdc:mga0a205_5191_c1
1849 Ga0495601_0003370
1850 Ga0495601_0056233
1851 Ga0495601_0084051
1852 Ga0495601_0286462
1853 Ga0495612_0013917
1854 Ga0495612_0015530
1855 Ga0495612_0035866
1856 Ga0495595_0186368
1857 Ga0495595_0447451
1858 Ga0495595_0555363
1859 Ga0495619_0010591
1860 Ga0495619_0015371
1861 Ga0495619_0268347
1862 Ga0495619_0301857
1863 Ga0500655_021105
1864 Ga0500577_0113327
1865 Ga0500630_182400
1866 Ga0466962_0106168
1867 Ga0466962_0214620
1868 2623500177
1869 3003001834
1870 8056065082

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00885

DMRL_synthase

6,7-dimethyl-8-ribityllumazine synthase

53

190

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j07-assembly1.cif.gz_B crystal structure of a probable riboflavin synthase, beta chain ribh (6,7-dimethyl-8-ribityllumazine synthase, dmrl synthase, lumazine synthase) from mycobacterium leprae 0.9826 12 158
2c9b-assembly2.cif.gz_G lumazine synthase from mycobacterium tuberculosus bound to 3-(1,3,7- trihydro-9-d-ribityl-2,6,8-purinetrione-7-yl) 0.9699 13 158
4j07-assembly1.cif.gz_B crystal structure of a probable riboflavin synthase, beta chain ribh (6,7-dimethyl-8-ribityllumazine synthase, dmrl synthase, lumazine synthase) from mycobacterium leprae 0.9695 12 158
2c9b-assembly2.cif.gz_G lumazine synthase from mycobacterium tuberculosus bound to 3-(1,3,7- trihydro-9-d-ribityl-2,6,8-purinetrione-7-yl) 0.957 13 158
7a4h-assembly1.cif.gz_BK aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-2 (180-mer) 0.9525 13 77
ID Description Score Start End Superfamily
2vi5I00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9756 13 158 3.40.50.960
2vi5I00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9437 13 158 3.40.50.960
3mk3100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9241 9 149 3.40.50.960
4kq6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9196 10 149 3.40.50.960
af_B4FBV7_62_217_3.40.50.960 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9146 9 153 3.40.50.960
ID Description Score Start End GO Terms
AF-A0A7W5T3Z0-F1-model_v4 deleted 0.9813 12 158
AF-A0A0K2RD09-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9793 32 155 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A399J9J1-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9776 20 151 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A2S8MPP9-F1-model_v4 deleted 0.9751 10 142
AF-A0A7W5T3Z0-F1-model_v4 deleted 0.9747 12 158

Map