F486170
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 935 | 346 | 1870 | 170 |
Family's Representative Sequence
| Representative Sequence | 3300046680|Ga0495646_0031437|Ga0495646_0031437_1297_1914 |
| Length | 205 |
| Sequence | MACPPRPTALAPHWRAPGERRPGREFLPDGASLKADTVSGEGRPAAETVDAAGLTLAIAVTRWHAEITDALTDRALAAAKACGVDDPLVVRVPGAVELPVVAAELARNHDAVACLGAVIRGGTPHFEYVCDAVTYGIARVALDAGKPVGNGVLTCDTLEQARDRSGQDGSREDKGWEAVVAALETALVLRSLRGNDPGAGDHQRH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 62 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 77 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 108 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 109 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 166 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 167 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 168 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 170 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 171 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 172 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 175 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 176 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 177 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 180 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 181 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 183 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 184 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 185 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 186 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 187 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 189 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 191 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 192 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 193 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 194 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 200 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 201 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 203 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 204 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 205 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 209 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 211 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 218 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 223 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 226 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 227 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 228 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 231 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 232 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 233 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 234 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 235 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 236 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 237 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 238 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 239 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 244 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 245 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 246 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 247 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 248 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 249 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 250 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 251 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 252 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 253 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 254 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 255 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 256 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 257 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 258 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 306 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 307 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 308 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 309 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 310 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 313 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 314 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 315 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 316 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 317 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 318 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 319 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 320 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 341 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 342 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 343 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 344 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 345 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 346 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.18 |
| Metatranscriptomes | 1.5 |
| Isolates | 0.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.32 |
| Nodule | 0 |
| Rhizoplane | 6.63 |
| Rhizosphere | 90.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495646_0031437 | 3300046680 | Bacteria | 3307 |
| 2 | JGI25406J46586_10051874 | 3300003203 | Bacteria | 1370 |
| 3 | JGI25405J52794_10074824 | 3300003911 | Bacteria | 741 |
| 4 | Ga0070658_10096527 | 3300005327 | Bacteria | 2440 |
| 5 | Ga0070658_10396814 | 3300005327 | Bacteria | 1185 |
| 6 | Ga0070676_10062529 | 3300005328 | Bacteria | 2215 |
| 7 | Ga0070683_100297030 | 3300005329 | Bacteria | 1536 |
| 8 | Ga0070670_100079289 | 3300005331 | Bacteria | 2822 |
| 9 | Ga0068869_100002052 | 3300005334 | Bacteria | 12100 |
| 10 | Ga0070680_100022377 | 3300005336 | Bacteria | 5035 |
| 11 | Ga0070680_100411330 | 3300005336 | Bacteria | 1154 |
| 12 | Ga0070682_100006180 | 3300005337 | Bacteria | 6709 |
| 13 | Ga0070682_100045233 | 3300005337 | Bacteria | 2728 |
| 14 | Ga0070682_100252769 | 3300005337 | Bacteria | 1271 |
| 15 | Ga0068868_100004627 | 3300005338 | Bacteria | 9651 |
| 16 | Ga0068868_100439381 | 3300005338 | Bacteria | 1133 |
| 17 | Ga0070660_100087424 | 3300005339 | Bacteria | 2453 |
| 18 | Ga0070660_100201248 | 3300005339 | Bacteria | 1615 |
| 19 | Ga0070660_100522657 | 3300005339 | Bacteria | 988 |
| 20 | Ga0070691_10019655 | 3300005341 | Bacteria | 3118 |
| 21 | Ga0070691_10509410 | 3300005341 | Bacteria | 697 |
| 22 | Ga0070661_100552592 | 3300005344 | Bacteria | 926 |
| 23 | Ga0070692_10001247 | 3300005345 | Bacteria | 9083 |
| 24 | Ga0070675_100009094 | 3300005354 | Bacteria | 7716 |
| 25 | Ga0070675_100013231 | 3300005354 | Bacteria | 6484 |
| 26 | Ga0070671_100002713 | 3300005355 | Bacteria | 13735 |
| 27 | Ga0070659_100218684 | 3300005366 | Bacteria | 1571 |
| 28 | Ga0070659_100224938 | 3300005366 | Bacteria | 1550 |
| 29 | Ga0070659_100485645 | 3300005366 | Bacteria | 1051 |
| 30 | Ga0070659_100549615 | 3300005366 | Bacteria | 988 |
| 31 | Ga0070709_10007442 | 3300005434 | Bacteria | 6001 |
| 32 | Ga0070709_10039528 | 3300005434 | Bacteria | 2895 |
| 33 | Ga0070714_100004329 | 3300005435 | Bacteria | 10706 |
| 34 | Ga0070714_100009463 | 3300005435 | Bacteria | 7662 |
| 35 | Ga0070714_100019622 | 3300005435 | Bacteria | 5512 |
| 36 | Ga0070714_100043473 | 3300005435 | Bacteria | 3800 |
| 37 | Ga0070714_100070722 | 3300005435 | Bacteria | 3016 |
| 38 | Ga0070714_100079102 | 3300005435 | Bacteria | 2858 |
| 39 | Ga0070714_100154976 | 3300005435 | Bacteria | 2067 |
| 40 | Ga0070714_100159390 | 3300005435 | Bacteria | 2040 |
| 41 | Ga0070714_100212077 | 3300005435 | Bacteria | 1775 |
| 42 | Ga0070714_100219834 | 3300005435 | Bacteria | 1745 |
| 43 | Ga0070714_100226579 | 3300005435 | Bacteria | 1720 |
| 44 | Ga0070714_100321589 | 3300005435 | Bacteria | 1447 |
| 45 | Ga0070714_100393909 | 3300005435 | Bacteria | 1308 |
| 46 | Ga0070714_100548482 | 3300005435 | Bacteria | 1106 |
| 47 | Ga0070714_100570442 | 3300005435 | Bacteria | 1085 |
| 48 | Ga0070714_101520736 | 3300005435 | Bacteria | 654 |
| 49 | Ga0070713_100036219 | 3300005436 | Bacteria | 3980 |
| 50 | Ga0070713_100176176 | 3300005436 | Bacteria | 1919 |
| 51 | Ga0070713_100338194 | 3300005436 | Bacteria | 1394 |
| 52 | Ga0070713_100340993 | 3300005436 | Bacteria | 1388 |
| 53 | Ga0070713_100346807 | 3300005436 | Bacteria | 1377 |
| 54 | Ga0070713_100638343 | 3300005436 | Bacteria | 1013 |
| 55 | Ga0070713_100647818 | 3300005436 | Bacteria | 1006 |
| 56 | Ga0070713_100919625 | 3300005436 | Bacteria | 842 |
| 57 | Ga0070713_101389811 | 3300005436 | Bacteria | 681 |
| 58 | Ga0070710_10128257 | 3300005437 | Bacteria | 1543 |
| 59 | Ga0070710_10323299 | 3300005437 | Bacteria | 1013 |
| 60 | Ga0070710_10414397 | 3300005437 | Bacteria | 906 |
| 61 | Ga0070711_100032680 | 3300005439 | Bacteria | 3461 |
| 62 | Ga0070711_100104807 | 3300005439 | Bacteria | 2064 |
| 63 | Ga0070711_100413458 | 3300005439 | Bacteria | 1097 |
| 64 | Ga0070711_100632634 | 3300005439 | Bacteria | 895 |
| 65 | Ga0070711_100990293 | 3300005439 | Bacteria | 721 |
| 66 | Ga0070705_100077968 | 3300005440 | Bacteria | 2025 |
| 67 | Ga0070694_100169495 | 3300005444 | Bacteria | 1607 |
| 68 | Ga0070694_100757991 | 3300005444 | Bacteria | 793 |
| 69 | Ga0070694_101109028 | 3300005444 | Bacteria | 660 |
| 70 | Ga0070708_100002501 | 3300005445 | Bacteria | 14185 |
| 71 | Ga0070708_100042043 | 3300005445 | Bacteria | 4009 |
| 72 | Ga0070708_100066894 | 3300005445 | Bacteria | 3225 |
| 73 | Ga0070708_100561009 | 3300005445 | Bacteria | 1077 |
| 74 | Ga0070663_100004146 | 3300005455 | Bacteria | 8466 |
| 75 | Ga0070663_100053936 | 3300005455 | Bacteria | 2872 |
| 76 | Ga0070663_100108239 | 3300005455 | Bacteria | 2085 |
| 77 | Ga0070663_100685738 | 3300005455 | Bacteria | 869 |
| 78 | Ga0070678_100015458 | 3300005456 | Bacteria | 4854 |
| 79 | Ga0070678_100704941 | 3300005456 | Bacteria | 910 |
| 80 | Ga0070662_100243168 | 3300005457 | Bacteria | 1444 |
| 81 | Ga0070681_10007378 | 3300005458 | Bacteria | 10746 |
| 82 | Ga0070681_10055905 | 3300005458 | Bacteria | 3928 |
| 83 | Ga0070681_11208352 | 3300005458 | Unclassified | 678 |
| 84 | Ga0070685_10017716 | 3300005466 | Bacteria | 3817 |
| 85 | Ga0070706_100002492 | 3300005467 | Bacteria | 18546 |
| 86 | Ga0070706_100008070 | 3300005467 | Bacteria | 9822 |
| 87 | Ga0070706_100017808 | 3300005467 | Bacteria | 6554 |
| 88 | Ga0070706_100021912 | 3300005467 | Bacteria | 5883 |
| 89 | Ga0070706_100054596 | 3300005467 | Bacteria | 3687 |
| 90 | Ga0070706_100136298 | 3300005467 | Bacteria | 2291 |
| 91 | Ga0070706_100214722 | 3300005467 | Bacteria | 1796 |
| 92 | Ga0070706_100811748 | 3300005467 | Bacteria | 866 |
| 93 | Ga0070707_100000199 | 3300005468 | Bacteria | 60047 |
| 94 | Ga0070707_100001332 | 3300005468 | Bacteria | 24324 |
| 95 | Ga0070707_100005322 | 3300005468 | Bacteria | 12043 |
| 96 | Ga0070707_100012384 | 3300005468 | Bacteria | 7965 |
| 97 | Ga0070707_100030494 | 3300005468 | Bacteria | 5134 |
| 98 | Ga0070707_100036466 | 3300005468 | Bacteria | 4692 |
| 99 | Ga0070707_100040620 | 3300005468 | Bacteria | 4451 |
| 100 | Ga0070707_100061390 | 3300005468 | Bacteria | 3604 |
| 101 | Ga0070707_100123121 | 3300005468 | Bacteria | 2518 |
| 102 | Ga0070707_100832142 | 3300005468 | Bacteria | 887 |
| 103 | Ga0070707_101103001 | 3300005468 | Bacteria | 760 |
| 104 | Ga0070698_100000264 | 3300005471 | Bacteria | 52985 |
| 105 | Ga0070698_100001732 | 3300005471 | Bacteria | 24325 |
| 106 | Ga0070698_100035178 | 3300005471 | Bacteria | 5180 |
| 107 | Ga0070698_100035250 | 3300005471 | Bacteria | 5175 |
| 108 | Ga0070698_100048835 | 3300005471 | Bacteria | 4324 |
| 109 | Ga0070698_100051145 | 3300005471 | Bacteria | 4209 |
| 110 | Ga0070698_100071099 | 3300005471 | Bacteria | 3490 |
| 111 | Ga0070698_100182506 | 3300005471 | Bacteria | 2037 |
| 112 | Ga0070698_100463966 | 3300005471 | Bacteria | 1202 |
| 113 | Ga0070698_100547426 | 3300005471 | Bacteria | 1096 |
| 114 | Ga0070698_100743831 | 3300005471 | Bacteria | 923 |
| 115 | Ga0070699_100006399 | 3300005518 | Bacteria | 10256 |
| 116 | Ga0070679_100016152 | 3300005530 | Bacteria | 7193 |
| 117 | Ga0070679_100074844 | 3300005530 | Bacteria | 3377 |
| 118 | Ga0070679_100106016 | 3300005530 | Bacteria | 2796 |
| 119 | Ga0070679_100118116 | 3300005530 | Bacteria | 2637 |
| 120 | Ga0070679_100442230 | 3300005530 | Bacteria | 1245 |
| 121 | Ga0070684_100086401 | 3300005535 | Bacteria | 2784 |
| 122 | Ga0070684_100641351 | 3300005535 | Bacteria | 988 |
| 123 | Ga0070684_101053753 | 3300005535 | Bacteria | 764 |
| 124 | Ga0070697_100010436 | 3300005536 | Bacteria | 7249 |
| 125 | Ga0070697_100033026 | 3300005536 | Bacteria | 4166 |
| 126 | Ga0070697_100075666 | 3300005536 | Bacteria | 2768 |
| 127 | Ga0070697_100712606 | 3300005536 | Bacteria | 886 |
| 128 | Ga0068853_100054874 | 3300005539 | Bacteria | 3434 |
| 129 | Ga0068853_100247590 | 3300005539 | Bacteria | 1635 |
| 130 | Ga0070686_100565979 | 3300005544 | Bacteria | 891 |
| 131 | Ga0070695_100700332 | 3300005545 | Bacteria | 804 |
| 132 | Ga0070695_100901322 | 3300005545 | Bacteria | 714 |
| 133 | Ga0070665_100045239 | 3300005548 | Bacteria | 4421 |
| 134 | Ga0070665_100465985 | 3300005548 | Bacteria | 1274 |
| 135 | Ga0070665_100639483 | 3300005548 | Bacteria | 1077 |
| 136 | Ga0070704_100166515 | 3300005549 | Bacteria | 1748 |
| 137 | Ga0070704_100339739 | 3300005549 | Bacteria | 1264 |
| 138 | Ga0068855_100009694 | 3300005563 | Bacteria | 11625 |
| 139 | Ga0068855_100742934 | 3300005563 | Bacteria | 1047 |
| 140 | Ga0068857_100673572 | 3300005577 | Bacteria | 981 |
| 141 | Ga0068857_100839866 | 3300005577 | Bacteria | 878 |
| 142 | Ga0068856_100008925 | 3300005614 | Bacteria | 9751 |
| 143 | Ga0068856_100042106 | 3300005614 | Bacteria | 4492 |
| 144 | Ga0068856_100048682 | 3300005614 | Bacteria | 4178 |
| 145 | Ga0068856_100302681 | 3300005614 | Bacteria | 1617 |
| 146 | Ga0068856_100742570 | 3300005614 | Bacteria | 1001 |
| 147 | Ga0068856_101030912 | 3300005614 | Bacteria | 841 |
| 148 | Ga0068856_101797982 | 3300005614 | Bacteria | 624 |
| 149 | Ga0070702_100001819 | 3300005615 | Bacteria | 8877 |
| 150 | Ga0070702_100350434 | 3300005615 | Bacteria | 1040 |
| 151 | Ga0068852_100006864 | 3300005616 | Bacteria | 8273 |
| 152 | Ga0068852_100327019 | 3300005616 | Bacteria | 1490 |
| 153 | Ga0068852_101699026 | 3300005616 | Bacteria | 654 |
| 154 | Ga0068859_100077412 | 3300005617 | Bacteria | 3367 |
| 155 | Ga0068864_100106943 | 3300005618 | Bacteria | 2488 |
| 156 | Ga0068864_100428677 | 3300005618 | Bacteria | 1261 |
| 157 | Ga0068866_10685973 | 3300005718 | Bacteria | 701 |
| 158 | Ga0068861_100168780 | 3300005719 | Bacteria | 1812 |
| 159 | Ga0068851_10010568 | 3300005834 | Bacteria | 4310 |
| 160 | Ga0068870_10000071 | 3300005840 | Bacteria | 32257 |
| 161 | Ga0068863_100032440 | 3300005841 | Bacteria | 4979 |
| 162 | Ga0068863_100103755 | 3300005841 | Bacteria | 2705 |
| 163 | Ga0068858_100003961 | 3300005842 | Bacteria | 14613 |
| 164 | Ga0068860_100311861 | 3300005843 | Bacteria | 1543 |
| 165 | Ga0081455_10001891 | 3300005937 | Bacteria | 25187 |
| 166 | Ga0081539_10000806 | 3300005985 | Bacteria | 61012 |
| 167 | Ga0070717_10002201 | 3300006028 | Bacteria | 13706 |
| 168 | Ga0070717_10004329 | 3300006028 | Bacteria | 10243 |
| 169 | Ga0070717_10048540 | 3300006028 | Bacteria | 3482 |
| 170 | Ga0070717_10064433 | 3300006028 | Bacteria | 3044 |
| 171 | Ga0070717_10094448 | 3300006028 | Bacteria | 2530 |
| 172 | Ga0070717_10206429 | 3300006028 | Bacteria | 1723 |
| 173 | Ga0070717_10208281 | 3300006028 | Bacteria | 1715 |
| 174 | Ga0070717_10254711 | 3300006028 | Bacteria | 1551 |
| 175 | Ga0070717_10296654 | 3300006028 | Bacteria | 1436 |
| 176 | Ga0070717_10302209 | 3300006028 | Bacteria | 1423 |
| 177 | Ga0070717_10318453 | 3300006028 | Bacteria | 1385 |
| 178 | Ga0070717_10438333 | 3300006028 | Bacteria | 1176 |
| 179 | Ga0070717_11409355 | 3300006028 | Bacteria | 633 |
| 180 | Ga0075432_10003384 | 3300006058 | Bacteria | 5393 |
| 181 | Ga0075432_10196075 | 3300006058 | Bacteria | 797 |
| 182 | Ga0070715_10003898 | 3300006163 | Bacteria | 4826 |
| 183 | Ga0070715_10008246 | 3300006163 | Bacteria | 3624 |
| 184 | Ga0070715_10008492 | 3300006163 | Bacteria | 3583 |
| 185 | Ga0070715_10054529 | 3300006163 | Bacteria | 1732 |
| 186 | Ga0070716_100120063 | 3300006173 | Bacteria | 1644 |
| 187 | Ga0070716_100178665 | 3300006173 | Bacteria | 1391 |
| 188 | Ga0070716_100301902 | 3300006173 | Bacteria | 1114 |
| 189 | Ga0070716_100324093 | 3300006173 | Bacteria | 1081 |
| 190 | Ga0070716_100417201 | 3300006173 | Bacteria | 970 |
| 191 | Ga0070716_100563211 | 3300006173 | Bacteria | 851 |
| 192 | Ga0070712_100014246 | 3300006175 | Bacteria | 5103 |
| 193 | Ga0070712_100126708 | 3300006175 | Bacteria | 1929 |
| 194 | Ga0070712_100256995 | 3300006175 | Bacteria | 1398 |
| 195 | Ga0070712_100744336 | 3300006175 | Bacteria | 838 |
| 196 | Ga0097621_100044853 | 3300006237 | Bacteria | 3569 |
| 197 | Ga0068871_100037805 | 3300006358 | Bacteria | 3852 |
| 198 | Ga0075428_100243261 | 3300006844 | Bacteria | 1941 |
| 199 | Ga0075428_100355691 | 3300006844 | Bacteria | 1571 |
| 200 | Ga0075431_100407351 | 3300006847 | Bacteria | 1360 |
| 201 | Ga0075433_10005340 | 3300006852 | Bacteria | 10084 |
| 202 | Ga0075433_10046311 | 3300006852 | Bacteria | 3782 |
| 203 | Ga0075433_10233585 | 3300006852 | Bacteria | 1633 |
| 204 | Ga0075434_100001779 | 3300006871 | Bacteria | 18580 |
| 205 | Ga0075434_100007096 | 3300006871 | Bacteria | 10347 |
| 206 | Ga0075434_100489726 | 3300006871 | Bacteria | 1250 |
| 207 | Ga0075434_100592208 | 3300006871 | Bacteria | 1128 |
| 208 | Ga0075429_100231745 | 3300006880 | Bacteria | 1618 |
| 209 | Ga0068865_101097625 | 3300006881 | Bacteria | 701 |
| 210 | Ga0075436_100001620 | 3300006914 | Bacteria | 15407 |
| 211 | Ga0075436_100029436 | 3300006914 | Bacteria | 3777 |
| 212 | Ga0075436_100106996 | 3300006914 | Bacteria | 1951 |
| 213 | Ga0075436_100458689 | 3300006914 | Bacteria | 929 |
| 214 | Ga0075436_100690802 | 3300006914 | Bacteria | 755 |
| 215 | Ga0097620_100077414 | 3300006931 | Bacteria | 3367 |
| 216 | Ga0075435_100002488 | 3300007076 | Bacteria | 12249 |
| 217 | Ga0075435_100005801 | 3300007076 | Bacteria | 8676 |
| 218 | Ga0075435_100083568 | 3300007076 | Bacteria | 2625 |
| 219 | Ga0075435_100320827 | 3300007076 | Bacteria | 1326 |
| 220 | Ga0075435_100908889 | 3300007076 | Bacteria | 768 |
| 221 | Ga0099794_10028392 | 3300007265 | Bacteria | 2603 |
| 222 | Ga0105251_10065085 | 3300009011 | Bacteria | 1707 |
| 223 | Ga0105240_10109913 | 3300009093 | Bacteria | 3337 |
| 224 | Ga0105240_10283149 | 3300009093 | Bacteria | 1903 |
| 225 | Ga0111539_10019228 | 3300009094 | Bacteria | 8436 |
| 226 | Ga0105245_10254953 | 3300009098 | Bacteria | 1706 |
| 227 | Ga0105245_10536031 | 3300009098 | Bacteria | 1191 |
| 228 | Ga0105245_11251747 | 3300009098 | Bacteria | 790 |
| 229 | Ga0114129_10041618 | 3300009147 | Bacteria | 6472 |
| 230 | Ga0114129_10771531 | 3300009147 | Bacteria | 1229 |
| 231 | Ga0105243_10188743 | 3300009148 | Bacteria | 1798 |
| 232 | Ga0105241_10007293 | 3300009174 | Bacteria | 8138 |
| 233 | Ga0105248_10012380 | 3300009177 | Bacteria | 9412 |
| 234 | Ga0105237_10160172 | 3300009545 | Bacteria | 2249 |
| 235 | Ga0105238_10291735 | 3300009551 | Bacteria | 1613 |
| 236 | Ga0105238_10631063 | 3300009551 | Bacteria | 1081 |
| 237 | Ga0105239_10954888 | 3300010375 | Bacteria | 985 |
| 238 | Ga0105239_10976350 | 3300010375 | Bacteria | 974 |
| 239 | Ga0105246_10000478 | 3300011119 | Bacteria | 21566 |
| 240 | Ga0157371_10009341 | 3300013102 | Bacteria | 7729 |
| 241 | Ga0157371_10273155 | 3300013102 | Bacteria | 1220 |
| 242 | Ga0157370_10064992 | 3300013104 | Bacteria | 3452 |
| 243 | Ga0157370_10107846 | 3300013104 | Bacteria | 2604 |
| 244 | Ga0157369_10009552 | 3300013105 | Bacteria | 11095 |
| 245 | Ga0157369_10107064 | 3300013105 | Bacteria | 2975 |
| 246 | Ga0157369_10433780 | 3300013105 | Bacteria | 1361 |
| 247 | Ga0157374_10270734 | 3300013296 | Bacteria | 1675 |
| 248 | Ga0163162_10534143 | 3300013306 | Bacteria | 1302 |
| 249 | Ga0157372_10041227 | 3300013307 | Bacteria | 5103 |
| 250 | Ga0157372_10433686 | 3300013307 | Bacteria | 1532 |
| 251 | Ga0157375_12452708 | 3300013308 | Bacteria | 623 |
| 252 | Ga0163163_10220663 | 3300014325 | Bacteria | 1944 |
| 253 | Ga0163163_10962253 | 3300014325 | Bacteria | 917 |
| 254 | Ga0163163_11245025 | 3300014325 | Bacteria | 806 |
| 255 | Ga0157380_10264225 | 3300014326 | Bacteria | 1565 |
| 256 | Ga0182008_10020152 | 3300014497 | Bacteria | 3436 |
| 257 | Ga0157377_10116735 | 3300014745 | Bacteria | 1612 |
| 258 | Ga0157377_10390674 | 3300014745 | Bacteria | 945 |
| 259 | Ga0157379_10035359 | 3300014968 | Bacteria | 4454 |
| 260 | Ga0157376_12010665 | 3300014969 | Bacteria | 616 |
| 261 | Ga0197907_10181547 | 3300020069 | Bacteria | 2145 |
| 262 | Ga0206356_10850638 | 3300020070 | Bacteria | 591 |
| 263 | Ga0206352_10556522 | 3300020078 | Bacteria | 1081 |
| 264 | Ga0206354_10159229 | 3300020081 | Bacteria | 1326 |
| 265 | Ga0206354_10322134 | 3300020081 | Bacteria | 2185 |
| 266 | Ga0206354_11210541 | 3300020081 | Bacteria | 1123 |
| 267 | Ga0206354_11331006 | 3300020081 | Bacteria | 2817 |
| 268 | Ga0206353_10363697 | 3300020082 | Bacteria | 2093 |
| 269 | Ga0206353_10591091 | 3300020082 | Bacteria | 3421 |
| 270 | Ga0206353_10881626 | 3300020082 | Bacteria | 1176 |
| 271 | Ga0206353_10948632 | 3300020082 | Bacteria | 737 |
| 272 | Ga0206353_11417859 | 3300020082 | Bacteria | 1097 |
| 273 | Ga0206353_11420308 | 3300020082 | Bacteria | 911 |
| 274 | Ga0213873_10087785 | 3300021358 | Bacteria | 879 |
| 275 | Ga0213875_10000079 | 3300021388 | Bacteria | 114698 |
| 276 | Ga0213875_10033595 | 3300021388 | Bacteria | 2423 |
| 277 | Ga0213875_10084295 | 3300021388 | Bacteria | 1483 |
| 278 | Ga0213875_10125370 | 3300021388 | Bacteria | 1200 |
| 279 | Ga0224712_10008505 | 3300022467 | Bacteria | 3047 |
| 280 | Ga0207656_10002399 | 3300025321 | Bacteria | 6304 |
| 281 | Ga0207692_10002632 | 3300025898 | Bacteria | 6904 |
| 282 | Ga0207692_10004539 | 3300025898 | Bacteria | 5509 |
| 283 | Ga0207692_10029139 | 3300025898 | Bacteria | 2620 |
| 284 | Ga0207692_10322136 | 3300025898 | Bacteria | 946 |
| 285 | Ga0207692_10557709 | 3300025898 | Bacteria | 733 |
| 286 | Ga0207688_10002679 | 3300025901 | Bacteria | 9637 |
| 287 | Ga0207647_10063509 | 3300025904 | Bacteria | 2246 |
| 288 | Ga0207685_10002255 | 3300025905 | Bacteria | 4369 |
| 289 | Ga0207685_10038598 | 3300025905 | Bacteria | 1767 |
| 290 | Ga0207685_10082791 | 3300025905 | Bacteria | 1332 |
| 291 | Ga0207685_10279429 | 3300025905 | Bacteria | 819 |
| 292 | Ga0207699_10008324 | 3300025906 | Bacteria | 5113 |
| 293 | Ga0207699_10053957 | 3300025906 | Bacteria | 2386 |
| 294 | Ga0207699_10074508 | 3300025906 | Bacteria | 2085 |
| 295 | Ga0207699_10229767 | 3300025906 | Bacteria | 1270 |
| 296 | Ga0207699_10373981 | 3300025906 | Bacteria | 1010 |
| 297 | Ga0207699_10619030 | 3300025906 | Bacteria | 789 |
| 298 | Ga0207645_10013762 | 3300025907 | Bacteria | 5429 |
| 299 | Ga0207643_10000102 | 3300025908 | Bacteria | 57710 |
| 300 | Ga0207705_10004990 | 3300025909 | Bacteria | 9954 |
| 301 | Ga0207705_10008596 | 3300025909 | Bacteria | 7443 |
| 302 | Ga0207705_10080992 | 3300025909 | Bacteria | 2366 |
| 303 | Ga0207705_10131864 | 3300025909 | Bacteria | 1860 |
| 304 | Ga0207705_10645593 | 3300025909 | Bacteria | 823 |
| 305 | Ga0207705_10760245 | 3300025909 | Bacteria | 753 |
| 306 | Ga0207684_10001761 | 3300025910 | Bacteria | 22878 |
| 307 | Ga0207684_10007871 | 3300025910 | Bacteria | 9532 |
| 308 | Ga0207684_10048106 | 3300025910 | Bacteria | 3617 |
| 309 | Ga0207684_10088377 | 3300025910 | Bacteria | 2640 |
| 310 | Ga0207684_10150743 | 3300025910 | Bacteria | 2000 |
| 311 | Ga0207684_10269781 | 3300025910 | Bacteria | 1468 |
| 312 | Ga0207684_10317304 | 3300025910 | Bacteria | 1343 |
| 313 | Ga0207684_10601954 | 3300025910 | Bacteria | 939 |
| 314 | Ga0207654_10004709 | 3300025911 | Bacteria | 6903 |
| 315 | Ga0207707_10019633 | 3300025912 | Bacteria | 5898 |
| 316 | Ga0207707_10019811 | 3300025912 | Bacteria | 5874 |
| 317 | Ga0207707_10891251 | 3300025912 | Bacteria | 736 |
| 318 | Ga0207695_10664480 | 3300025913 | Bacteria | 923 |
| 319 | Ga0207695_10856908 | 3300025913 | Bacteria | 789 |
| 320 | Ga0207695_11047964 | 3300025913 | Bacteria | 695 |
| 321 | Ga0207693_10007692 | 3300025915 | Bacteria | 8848 |
| 322 | Ga0207693_10029943 | 3300025915 | Bacteria | 4296 |
| 323 | Ga0207693_10083256 | 3300025915 | Bacteria | 2506 |
| 324 | Ga0207693_10703707 | 3300025915 | Bacteria | 782 |
| 325 | Ga0207693_11023311 | 3300025915 | Bacteria | 630 |
| 326 | Ga0207663_10002072 | 3300025916 | Bacteria | 9557 |
| 327 | Ga0207663_10049524 | 3300025916 | Bacteria | 2606 |
| 328 | Ga0207663_10066709 | 3300025916 | Bacteria | 2304 |
| 329 | Ga0207663_10084074 | 3300025916 | Bacteria | 2092 |
| 330 | Ga0207663_10333652 | 3300025916 | Bacteria | 1143 |
| 331 | Ga0207663_10752584 | 3300025916 | Bacteria | 774 |
| 332 | Ga0207660_10015994 | 3300025917 | Bacteria | 4959 |
| 333 | Ga0207660_10048977 | 3300025917 | Bacteria | 2992 |
| 334 | Ga0207660_10748071 | 3300025917 | Bacteria | 798 |
| 335 | Ga0207657_10013713 | 3300025919 | Bacteria | 7935 |
| 336 | Ga0207657_10014627 | 3300025919 | Bacteria | 7645 |
| 337 | Ga0207657_10320312 | 3300025919 | Bacteria | 1226 |
| 338 | Ga0207649_10017873 | 3300025920 | Bacteria | 4022 |
| 339 | Ga0207649_10744977 | 3300025920 | Bacteria | 762 |
| 340 | Ga0207652_10071714 | 3300025921 | Bacteria | 3010 |
| 341 | Ga0207652_10131531 | 3300025921 | Bacteria | 2232 |
| 342 | Ga0207652_10226658 | 3300025921 | Bacteria | 1684 |
| 343 | Ga0207652_10237625 | 3300025921 | Bacteria | 1642 |
| 344 | Ga0207652_10846870 | 3300025921 | Bacteria | 810 |
| 345 | Ga0207646_10000278 | 3300025922 | Bacteria | 70066 |
| 346 | Ga0207646_10005502 | 3300025922 | Bacteria | 13316 |
| 347 | Ga0207646_10008219 | 3300025922 | Bacteria | 10486 |
| 348 | Ga0207646_10023928 | 3300025922 | Bacteria | 5603 |
| 349 | Ga0207646_10033313 | 3300025922 | Bacteria | 4662 |
| 350 | Ga0207646_10046873 | 3300025922 | Bacteria | 3878 |
| 351 | Ga0207646_10070964 | 3300025922 | Bacteria | 3111 |
| 352 | Ga0207646_10431242 | 3300025922 | Bacteria | 1189 |
| 353 | Ga0207694_10117979 | 3300025924 | Bacteria | 2116 |
| 354 | Ga0207694_10265607 | 3300025924 | Bacteria | 1407 |
| 355 | Ga0207650_10024219 | 3300025925 | Bacteria | 4312 |
| 356 | Ga0207659_10030915 | 3300025926 | Bacteria | 3662 |
| 357 | Ga0207687_10007022 | 3300025927 | Bacteria | 7424 |
| 358 | Ga0207687_10382452 | 3300025927 | Bacteria | 1154 |
| 359 | Ga0207687_10396601 | 3300025927 | Bacteria | 1134 |
| 360 | Ga0207700_10004397 | 3300025928 | Bacteria | 8301 |
| 361 | Ga0207700_10021649 | 3300025928 | Bacteria | 4394 |
| 362 | Ga0207700_10026432 | 3300025928 | Bacteria | 4046 |
| 363 | Ga0207700_10031586 | 3300025928 | Bacteria | 3764 |
| 364 | Ga0207700_10078052 | 3300025928 | Bacteria | 2574 |
| 365 | Ga0207700_10096332 | 3300025928 | Bacteria | 2349 |
| 366 | Ga0207700_10176396 | 3300025928 | Bacteria | 1786 |
| 367 | Ga0207700_10194413 | 3300025928 | Bacteria | 1706 |
| 368 | Ga0207700_10223279 | 3300025928 | Bacteria | 1598 |
| 369 | Ga0207700_10265710 | 3300025928 | Bacteria | 1471 |
| 370 | Ga0207700_10333970 | 3300025928 | Bacteria | 1316 |
| 371 | Ga0207700_10567648 | 3300025928 | Bacteria | 1008 |
| 372 | Ga0207664_10001507 | 3300025929 | Bacteria | 15255 |
| 373 | Ga0207664_10005990 | 3300025929 | Bacteria | 8324 |
| 374 | Ga0207664_10014918 | 3300025929 | Bacteria | 5625 |
| 375 | Ga0207664_10032034 | 3300025929 | Bacteria | 4027 |
| 376 | Ga0207664_10037113 | 3300025929 | Bacteria | 3769 |
| 377 | Ga0207664_10079232 | 3300025929 | Bacteria | 2666 |
| 378 | Ga0207664_10099191 | 3300025929 | Bacteria | 2403 |
| 379 | Ga0207664_10109776 | 3300025929 | Bacteria | 2292 |
| 380 | Ga0207664_10195832 | 3300025929 | Bacteria | 1742 |
| 381 | Ga0207664_10309562 | 3300025929 | Bacteria | 1391 |
| 382 | Ga0207664_10312268 | 3300025929 | Bacteria | 1385 |
| 383 | Ga0207664_10530583 | 3300025929 | Bacteria | 1055 |
| 384 | Ga0207664_10691161 | 3300025929 | Bacteria | 917 |
| 385 | Ga0207690_10226566 | 3300025932 | Bacteria | 1433 |
| 386 | Ga0207706_10097994 | 3300025933 | Bacteria | 2579 |
| 387 | Ga0207686_10406785 | 3300025934 | Bacteria | 1038 |
| 388 | Ga0207670_10029745 | 3300025936 | Bacteria | 3483 |
| 389 | Ga0207669_10490894 | 3300025937 | Bacteria | 981 |
| 390 | Ga0207704_10099915 | 3300025938 | Bacteria | 1931 |
| 391 | Ga0207665_10002825 | 3300025939 | Bacteria | 11643 |
| 392 | Ga0207665_10011126 | 3300025939 | Bacteria | 5904 |
| 393 | Ga0207665_10031849 | 3300025939 | Bacteria | 3490 |
| 394 | Ga0207665_10049531 | 3300025939 | Bacteria | 2823 |
| 395 | Ga0207665_10055461 | 3300025939 | Bacteria | 2674 |
| 396 | Ga0207665_10149970 | 3300025939 | Bacteria | 1669 |
| 397 | Ga0207665_10186428 | 3300025939 | Bacteria | 1505 |
| 398 | Ga0207711_10026883 | 3300025941 | Bacteria | 4830 |
| 399 | Ga0207689_10001185 | 3300025942 | Bacteria | 25056 |
| 400 | Ga0207661_10016521 | 3300025944 | Bacteria | 5446 |
| 401 | Ga0207661_10026259 | 3300025944 | Bacteria | 4435 |
| 402 | Ga0207661_10664860 | 3300025944 | Bacteria | 957 |
| 403 | Ga0207679_10004501 | 3300025945 | Bacteria | 8679 |
| 404 | Ga0207679_10801592 | 3300025945 | Bacteria | 859 |
| 405 | Ga0207667_10014963 | 3300025949 | Bacteria | 8824 |
| 406 | Ga0207667_10513153 | 3300025949 | Bacteria | 1215 |
| 407 | Ga0207651_10218130 | 3300025960 | Bacteria | 1540 |
| 408 | Ga0207668_10786077 | 3300025972 | Bacteria | 842 |
| 409 | Ga0207640_10023349 | 3300025981 | Bacteria | 3715 |
| 410 | Ga0207677_10047916 | 3300026023 | Bacteria | 2873 |
| 411 | Ga0207703_10068617 | 3300026035 | Bacteria | 2921 |
| 412 | Ga0207639_10316886 | 3300026041 | Bacteria | 1383 |
| 413 | Ga0207678_10000141 | 3300026067 | Bacteria | 59147 |
| 414 | Ga0207678_10236425 | 3300026067 | Bacteria | 1565 |
| 415 | Ga0207708_10242608 | 3300026075 | Bacteria | 1450 |
| 416 | Ga0207702_10000567 | 3300026078 | Bacteria | 41121 |
| 417 | Ga0207702_10012158 | 3300026078 | Bacteria | 7162 |
| 418 | Ga0207702_10013663 | 3300026078 | Bacteria | 6743 |
| 419 | Ga0207702_10033883 | 3300026078 | Bacteria | 4268 |
| 420 | Ga0207702_11526843 | 3300026078 | Bacteria | 661 |
| 421 | Ga0207641_10005052 | 3300026088 | Bacteria | 11305 |
| 422 | Ga0207641_10082843 | 3300026088 | Bacteria | 2788 |
| 423 | Ga0207641_10332812 | 3300026088 | Bacteria | 1443 |
| 424 | Ga0207676_10000814 | 3300026095 | Bacteria | 24327 |
| 425 | Ga0207676_10247846 | 3300026095 | Bacteria | 1602 |
| 426 | Ga0207674_10022354 | 3300026116 | Bacteria | 6791 |
| 427 | Ga0207674_10981378 | 3300026116 | Bacteria | 814 |
| 428 | Ga0207674_10983557 | 3300026116 | Bacteria | 813 |
| 429 | Ga0207683_10002042 | 3300026121 | Bacteria | 17869 |
| 430 | Ga0207683_10236616 | 3300026121 | Bacteria | 1666 |
| 431 | Ga0207683_10369791 | 3300026121 | Bacteria | 1317 |
| 432 | Ga0207683_10435210 | 3300026121 | Bacteria | 1209 |
| 433 | Ga0207698_10002259 | 3300026142 | Bacteria | 11405 |
| 434 | Ga0207698_11517674 | 3300026142 | Bacteria | 685 |
| 435 | Ga0207428_10019640 | 3300027907 | Bacteria | 5759 |
| 436 | Ga0268266_10090394 | 3300028379 | Bacteria | 2684 |
| 437 | Ga0268266_10357664 | 3300028379 | Bacteria | 1373 |
| 438 | Ga0268266_10520734 | 3300028379 | Bacteria | 1137 |
| 439 | Ga0268264_11877075 | 3300028381 | Bacteria | 609 |
| 440 | Ga0265337_1000705 | 3300028556 | Bacteria | 17624 |
| 441 | Ga0265326_10010556 | 3300028558 | Bacteria | 2737 |
| 442 | Ga0265319_1002204 | 3300028563 | Bacteria | 10846 |
| 443 | Ga0265334_10001922 | 3300028573 | Bacteria | 9860 |
| 444 | Ga0265318_10022213 | 3300028577 | Bacteria | 2539 |
| 445 | Ga0265323_10010908 | 3300028653 | Bacteria | 3679 |
| 446 | Ga0265322_10007986 | 3300028654 | Bacteria | 3087 |
| 447 | Ga0265336_10001837 | 3300028666 | Bacteria | 9243 |
| 448 | Ga0265338_10004045 | 3300028800 | Bacteria | 20114 |
| 449 | Ga0265338_10011623 | 3300028800 | Bacteria | 10147 |
| 450 | Ga0265338_10041393 | 3300028800 | Bacteria | 4308 |
| 451 | Ga0265324_10001640 | 3300029957 | Bacteria | 12383 |
| 452 | Ga0307511_10000625 | 3300030521 | Bacteria | 37858 |
| 453 | Ga0307512_10024565 | 3300030522 | Bacteria | 5360 |
| 454 | Ga0265332_10001213 | 3300031238 | Bacteria | 14920 |
| 455 | Ga0265320_10023234 | 3300031240 | Bacteria | 3303 |
| 456 | Ga0265325_10003537 | 3300031241 | Bacteria | 10158 |
| 457 | Ga0265340_10002891 | 3300031247 | Bacteria | 9776 |
| 458 | Ga0265339_10030831 | 3300031249 | Bacteria | 3034 |
| 459 | Ga0265331_10334664 | 3300031250 | Bacteria | 678 |
| 460 | Ga0265316_10012954 | 3300031344 | Bacteria | 7443 |
| 461 | Ga0307513_10081826 | 3300031456 | Bacteria | 3326 |
| 462 | Ga0307408_100257971 | 3300031548 | Bacteria | 1441 |
| 463 | Ga0265313_10058125 | 3300031595 | Bacteria | 1823 |
| 464 | Ga0265314_10025885 | 3300031711 | Bacteria | 4417 |
| 465 | Ga0265342_10004344 | 3300031712 | Bacteria | 11215 |
| 466 | Ga0307405_10101404 | 3300031731 | Bacteria | 1931 |
| 467 | Ga0307405_10310595 | 3300031731 | Bacteria | 1200 |
| 468 | Ga0307405_10787179 | 3300031731 | Bacteria | 796 |
| 469 | Ga0307413_10002040 | 3300031824 | Bacteria | 8046 |
| 470 | Ga0307413_10052584 | 3300031824 | Bacteria | 2461 |
| 471 | Ga0307410_10053457 | 3300031852 | Bacteria | 2733 |
| 472 | Ga0307410_10073759 | 3300031852 | Bacteria | 2374 |
| 473 | Ga0307410_10360902 | 3300031852 | Bacteria | 1163 |
| 474 | Ga0307410_10564405 | 3300031852 | Bacteria | 945 |
| 475 | Ga0307410_11053372 | 3300031852 | Bacteria | 703 |
| 476 | Ga0307406_10057466 | 3300031901 | Bacteria | 2495 |
| 477 | Ga0307406_10073718 | 3300031901 | Bacteria | 2246 |
| 478 | Ga0307406_10387480 | 3300031901 | Bacteria | 1104 |
| 479 | Ga0307407_10011558 | 3300031903 | Bacteria | 4207 |
| 480 | Ga0307412_10154730 | 3300031911 | Bacteria | 1696 |
| 481 | Ga0307412_10729291 | 3300031911 | Bacteria | 853 |
| 482 | Ga0307409_100026307 | 3300031995 | Bacteria | 4100 |
| 483 | Ga0307409_100060029 | 3300031995 | Bacteria | 2963 |
| 484 | Ga0307409_100160174 | 3300031995 | Bacteria | 1967 |
| 485 | Ga0307409_100444741 | 3300031995 | Bacteria | 1249 |
| 486 | Ga0307409_101299899 | 3300031995 | Bacteria | 752 |
| 487 | Ga0307409_101393903 | 3300031995 | Bacteria | 727 |
| 488 | Ga0307409_101659207 | 3300031995 | Bacteria | 668 |
| 489 | Ga0307416_100161026 | 3300032002 | Bacteria | 2074 |
| 490 | Ga0307416_100477121 | 3300032002 | Bacteria | 1306 |
| 491 | Ga0307416_100493328 | 3300032002 | Bacteria | 1287 |
| 492 | Ga0307416_101015640 | 3300032002 | Bacteria | 933 |
| 493 | Ga0307416_101187703 | 3300032002 | Bacteria | 868 |
| 494 | Ga0307414_11373397 | 3300032004 | Bacteria | 656 |
| 495 | Ga0307411_10137300 | 3300032005 | Bacteria | 1797 |
| 496 | Ga0307411_10415401 | 3300032005 | Bacteria | 1116 |
| 497 | Ga0307411_10668249 | 3300032005 | Bacteria | 901 |
| 498 | Ga0307411_10834111 | 3300032005 | Bacteria | 814 |
| 499 | Ga0307415_100317996 | 3300032126 | Bacteria | 1297 |
| 500 | Ga0307415_100630344 | 3300032126 | Bacteria | 958 |
| 501 | Ga0307415_100659871 | 3300032126 | Bacteria | 939 |
| 502 | Ga0307415_100917270 | 3300032126 | Bacteria | 808 |
| 503 | Ga0316214_1031569 | 3300033545 | Bacteria | 752 |
| 504 | Ga0373948_0011675 | 3300034817 | Bacteria | 1558 |
| 505 | Ga0373926_0057756 | 3300035083 | Bacteria | 1410 |
| 506 | Ga0373926_0077133 | 3300035083 | Bacteria | 1229 |
| 507 | Ga0373926_0110451 | 3300035083 | Bacteria | 1032 |
| 508 | Ga0373928_0003091 | 3300035084 | Bacteria | 3193 |
| 509 | Ga0373929_0005169 | 3300035085 | Bacteria | 2346 |
| 510 | Ga0373934_0062727 | 3300035086 | Bacteria | 1482 |
| 511 | Ga0373940_0002286 | 3300035088 | Bacteria | 3694 |
| 512 | Ga0373944_0000808 | 3300035089 | Bacteria | 7674 |
| 513 | Ga0373944_0226245 | 3300035089 | Bacteria | 684 |
| 514 | Ga0373949_0005475 | 3300035090 | Bacteria | 2831 |
| 515 | Ga0373951_0015757 | 3300035091 | Bacteria | 1704 |
| 516 | Ga0373952_0009434 | 3300035092 | Bacteria | 1868 |
| 517 | Ga0373923_0001914 | 3300035111 | Bacteria | 6222 |
| 518 | Ga0373923_0010514 | 3300035111 | Bacteria | 3369 |
| 519 | Ga0373923_0110177 | 3300035111 | Bacteria | 1222 |
| 520 | Ga0373936_0000341 | 3300035113 | Bacteria | 15795 |
| 521 | Ga0373936_0004075 | 3300035113 | Bacteria | 5508 |
| 522 | Ga0373936_0104220 | 3300035113 | Bacteria | 1199 |
| 523 | Ga0373945_0001330 | 3300035116 | Bacteria | 7504 |
| 524 | Ga0373945_0054315 | 3300035116 | Bacteria | 1481 |
| 525 | Ga0373945_0106121 | 3300035116 | Bacteria | 1104 |
| 526 | Ga0373953_0007549 | 3300035117 | Bacteria | 3649 |
| 527 | Ga0373953_0017622 | 3300035117 | Bacteria | 2629 |
| 528 | Ga0373954_0005348 | 3300035118 | Bacteria | 5547 |
| 529 | Ga0373954_0032144 | 3300035118 | Bacteria | 2425 |
| 530 | Ga0373954_0274685 | 3300035118 | Bacteria | 831 |
| 531 | Ga0373956_0013973 | 3300035119 | Bacteria | 3347 |
| 532 | Ga0373956_0030819 | 3300035119 | Bacteria | 2346 |
| 533 | Ga0373957_0004353 | 3300035120 | Bacteria | 4300 |
| 534 | Ga0373957_0040365 | 3300035120 | Bacteria | 1754 |
| 535 | Ga0373957_0118748 | 3300035120 | Bacteria | 1069 |
| 536 | Ga0373943_0000222 | 3300035170 | Bacteria | 23119 |
| 537 | Ga0373943_0162665 | 3300035170 | Bacteria | 1216 |
| 538 | Ga0373943_0358710 | 3300035170 | Bacteria | 836 |
| 539 | Ga0373943_0375300 | 3300035170 | Bacteria | 818 |
| 540 | Ga0373943_0624416 | 3300035170 | Bacteria | 636 |
| 541 | Ga0373946_0000978 | 3300035171 | Bacteria | 9788 |
| 542 | Ga0373946_0057447 | 3300035171 | Bacteria | 1646 |
| 543 | Ga0373946_0062732 | 3300035171 | Bacteria | 1585 |
| 544 | Ga0373946_0107118 | 3300035171 | Bacteria | 1260 |
| 545 | Ga0373946_0189942 | 3300035171 | Bacteria | 979 |
| 546 | Ga0373955_0005438 | 3300035172 | Bacteria | 5722 |
| 547 | Ga0373955_0009735 | 3300035172 | Bacteria | 4514 |
| 548 | Ga0373955_0013355 | 3300035172 | Bacteria | 3970 |
| 549 | Ga0373955_0032799 | 3300035172 | Bacteria | 2730 |
| 550 | Ga0373955_0086309 | 3300035172 | Bacteria | 1782 |
| 551 | Ga0373961_0030354 | 3300035241 | Bacteria | 1503 |
| 552 | Ga0373924_0000857 | 3300035410 | Bacteria | 9565 |
| 553 | Ga0373924_0011457 | 3300035410 | Bacteria | 3293 |
| 554 | Ga0373924_0027184 | 3300035410 | Bacteria | 2274 |
| 555 | Ga0373931_0013864 | 3300035691 | Bacteria | 3932 |
| 556 | Ga0373935_0000284 | 3300035692 | Bacteria | 24989 |
| 557 | Ga0373935_0046359 | 3300035692 | Bacteria | 2745 |
| 558 | Ga0373935_0075307 | 3300035692 | Bacteria | 2183 |
| 559 | Ga0373935_0207251 | 3300035692 | Bacteria | 1357 |
| 560 | Ga0373935_0844574 | 3300035692 | Bacteria | 677 |
| 561 | Ga0373927_0002715 | 3300035695 | Bacteria | 12911 |
| 562 | Ga0373927_0103410 | 3300035695 | Bacteria | 1853 |
| 563 | Ga0373927_0490361 | 3300035695 | Bacteria | 812 |
| 564 | Ga0373933_0001656 | 3300035724 | Bacteria | 12954 |
| 565 | Ga0373933_0010912 | 3300035724 | Bacteria | 4989 |
| 566 | Ga0373933_0011406 | 3300035724 | Bacteria | 4896 |
| 567 | Ga0373933_0033245 | 3300035724 | Bacteria | 2999 |
| 568 | Ga0373933_0133010 | 3300035724 | Bacteria | 1565 |
| 569 | Ga0373947_0111726 | 3300035725 | Bacteria | 1727 |
| 570 | Ga0373947_0161979 | 3300035725 | Bacteria | 1447 |
| 571 | Ga0373947_0165173 | 3300035725 | Bacteria | 1433 |
| 572 | Ga0373947_0246478 | 3300035725 | Bacteria | 1180 |
| 573 | Ga0373937_0008933 | 3300036401 | Bacteria | 8700 |
| 574 | Ga0373937_0020068 | 3300036401 | Bacteria | 5987 |
| 575 | Ga0373937_0052935 | 3300036401 | Bacteria | 3723 |
| 576 | Ga0373937_0067848 | 3300036401 | Bacteria | 3287 |
| 577 | Ga0373937_0081086 | 3300036401 | Bacteria | 3001 |
| 578 | Ga0373937_0186374 | 3300036401 | Bacteria | 1949 |
| 579 | Ga0373937_0196611 | 3300036401 | Bacteria | 1895 |
| 580 | Ga0373925_0000010 | 3300037068 | Bacteria | 229059 |
| 581 | Ga0373925_0001242 | 3300037068 | Bacteria | 22486 |
| 582 | Ga0373925_0008509 | 3300037068 | Bacteria | 7478 |
| 583 | Ga0373925_0099508 | 3300037068 | Bacteria | 2233 |
| 584 | Ga0373925_0148227 | 3300037068 | Bacteria | 1840 |
| 585 | Ga0373925_0189265 | 3300037068 | Bacteria | 1632 |
| 586 | Ga0373925_0681291 | 3300037068 | Bacteria | 847 |
| 587 | Ga0395900_0357055 | 3300037418 | Bacteria | 1434 |
| 588 | Ga0395900_1493460 | 3300037418 | Bacteria | 588 |
| 589 | Ga0395898_0031434 | 3300037466 | Bacteria | 5304 |
| 590 | Ga0395898_0157477 | 3300037466 | Bacteria | 2172 |
| 591 | Ga0395905_0740604 | 3300037471 | Bacteria | 885 |
| 592 | Ga0436364_0129100 | 3300037853 | Bacteria | 1740 |
| 593 | Ga0436364_0526739 | 3300037853 | Bacteria | 629 |
| 594 | Ga0436364_0568803 | 3300037853 | Bacteria | 42562 |
| 595 | Ga0436364_0683724 | 3300037853 | Bacteria | 2916 |
| 596 | Ga0436364_0805657 | 3300037853 | Bacteria | 63201 |
| 597 | Ga0436364_0812095 | 3300037853 | Bacteria | 152428 |
| 598 | Ga0436364_1046304 | 3300037853 | Bacteria | 1039 |
| 599 | Ga0436364_1301853 | 3300037853 | Bacteria | 1395 |
| 600 | Ga0436364_1470699 | 3300037853 | Bacteria | 1112 |
| 601 | Ga0395901_0001374 | 3300038443 | Bacteria | 25464 |
| 602 | Ga0395901_0330225 | 3300038443 | Bacteria | 1577 |
| 603 | Ga0436365_0179761 | 3300039437 | Bacteria | 779 |
| 604 | Ga0436365_0921579 | 3300039437 | Bacteria | 1010 |
| 605 | Ga0436360_0567696 | 3300039438 | Bacteria | 1524 |
| 606 | Ga0436363_1542421 | 3300039450 | Bacteria | 975 |
| 607 | Ga0436362_0763195 | 3300039453 | Bacteria | 937 |
| 608 | Ga0436362_0854794 | 3300039453 | Bacteria | 638 |
| 609 | Ga0436362_1169821 | 3300039453 | Bacteria | 606 |
| 610 | Ga0436362_1193726 | 3300039453 | Bacteria | 1299 |
| 611 | Ga0451787_492751 | 3300041441 | Bacteria | 1016 |
| 612 | Ga0451791_0567739 | 3300041451 | Bacteria | 9434 |
| 613 | Ga0451793_0776550 | 3300041452 | Bacteria | 957 |
| 614 | Ga0451797_1221977 | 3300041453 | Bacteria | 11215 |
| 615 | Ga0451797_1302557 | 3300041453 | Bacteria | 906 |
| 616 | Ga0451853_2506590 | 3300041512 | Bacteria | 6015 |
| 617 | Ga0439449_0188888 | 3300042007 | Bacteria | 771 |
| 618 | Ga0439459_0006708 | 3300042438 | Bacteria | 1927 |
| 619 | Ga0466965_0025179 | 3300044683 | Bacteria | 2880 |
| 620 | Ga0466966_0044949 | 3300044684 | Bacteria | 2825 |
| 621 | Ga0466966_0243333 | 3300044684 | Bacteria | 1084 |
| 622 | Ga0466966_0445544 | 3300044684 | Bacteria | 778 |
| 623 | Ga0466961_0008686 | 3300044693 | Bacteria | 6476 |
| 624 | Ga0466961_0156041 | 3300044693 | Bacteria | 1424 |
| 625 | Ga0466963_0098947 | 3300044694 | Bacteria | 1994 |
| 626 | Ga0466963_0105993 | 3300044694 | Bacteria | 1927 |
| 627 | Ga0466971_0223478 | 3300044719 | Bacteria | 893 |
| 628 | Ga0466968_0062288 | 3300044735 | Bacteria | 1611 |
| 629 | Ga0466968_0177900 | 3300044735 | Bacteria | 988 |
| 630 | Ga0466970_0087837 | 3300044765 | Bacteria | 1686 |
| 631 | Ga0466970_0235493 | 3300044765 | Bacteria | 1024 |
| 632 | Ga0466957_0019144 | 3300044842 | Bacteria | 4025 |
| 633 | Ga0466957_0073273 | 3300044842 | Bacteria | 2122 |
| 634 | Ga0466957_0177106 | 3300044842 | Bacteria | 1391 |
| 635 | Ga0466957_0880381 | 3300044842 | Bacteria | 639 |
| 636 | Ga0466960_0036253 | 3300044901 | Bacteria | 2309 |
| 637 | Ga0466960_0141379 | 3300044901 | Bacteria | 1279 |
| 638 | Ga0466960_0438201 | 3300044901 | Bacteria | 758 |
| 639 | Ga0466960_0507242 | 3300044901 | Bacteria | 707 |
| 640 | Ga0466959_0045597 | 3300045049 | Bacteria | 3228 |
| 641 | Ga0466959_0087076 | 3300045049 | Bacteria | 2247 |
| 642 | Ga0466959_0211433 | 3300045049 | Bacteria | 1348 |
| 643 | Ga0466959_0211771 | 3300045049 | Bacteria | 1346 |
| 644 | Ga0466959_0604258 | 3300045049 | Bacteria | 738 |
| 645 | Ga0466958_0075278 | 3300045836 | Bacteria | 2070 |
| 646 | Ga0466958_0084478 | 3300045836 | Bacteria | 1958 |
| 647 | Ga0466958_0395292 | 3300045836 | Bacteria | 892 |
| 648 | Ga0466958_0454670 | 3300045836 | Bacteria | 829 |
| 649 | Ga0466967_0001208 | 3300045976 | Bacteria | 14538 |
| 650 | Ga0466967_0020766 | 3300045976 | Bacteria | 5318 |
| 651 | Ga0466967_0172562 | 3300045976 | Bacteria | 2035 |
| 652 | Ga0466967_0384904 | 3300045976 | Bacteria | 1362 |
| 653 | Ga0466967_0788294 | 3300045976 | Bacteria | 943 |
| 654 | Ga0466967_1029986 | 3300045976 | Bacteria | 820 |
| 655 | Ga0466967_1845226 | 3300045976 | Bacteria | 601 |
| 656 | Ga0466967_1902848 | 3300045976 | Bacteria | 592 |
| 657 | Ga0495592_0084123 | 3300046454 | Bacteria | 2296 |
| 658 | Ga0495592_0112264 | 3300046454 | Bacteria | 1927 |
| 659 | Ga0495592_0386519 | 3300046454 | Bacteria | 889 |
| 660 | Ga0495603_0163238 | 3300046455 | Bacteria | 1292 |
| 661 | Ga0495603_0516926 | 3300046455 | Bacteria | 684 |
| 662 | Ga0495629_0001800 | 3300046459 | Bacteria | 16788 |
| 663 | Ga0495629_0018033 | 3300046459 | Bacteria | 5059 |
| 664 | Ga0495629_0025499 | 3300046459 | Bacteria | 4200 |
| 665 | Ga0495629_0554499 | 3300046459 | Bacteria | 771 |
| 666 | Ga0495641_0006605 | 3300046461 | Bacteria | 7471 |
| 667 | Ga0495651_0011568 | 3300046462 | Bacteria | 6779 |
| 668 | Ga0495651_0013357 | 3300046462 | Bacteria | 6352 |
| 669 | Ga0495651_0109436 | 3300046462 | Bacteria | 2045 |
| 670 | Ga0495651_0127548 | 3300046462 | Bacteria | 1861 |
| 671 | Ga0495653_0023323 | 3300046463 | Bacteria | 5001 |
| 672 | Ga0495653_0023846 | 3300046463 | Bacteria | 4939 |
| 673 | Ga0495653_0049801 | 3300046463 | Bacteria | 3225 |
| 674 | Ga0495653_0169805 | 3300046463 | Bacteria | 1506 |
| 675 | Ga0495653_0190337 | 3300046463 | Bacteria | 1400 |
| 676 | Ga0495653_0492051 | 3300046463 | Bacteria | 766 |
| 677 | Ga0495580_0098032 | 3300046472 | Bacteria | 2039 |
| 678 | Ga0495580_0361977 | 3300046472 | Bacteria | 982 |
| 679 | Ga0495582_0003237 | 3300046473 | Bacteria | 9147 |
| 680 | Ga0495582_0037837 | 3300046473 | Bacteria | 2654 |
| 681 | Ga0495639_0019543 | 3300046475 | Bacteria | 2958 |
| 682 | Ga0495639_0047349 | 3300046475 | Bacteria | 1947 |
| 683 | Ga0495639_0235622 | 3300046475 | Bacteria | 902 |
| 684 | Ga0495662_0021006 | 3300046476 | Bacteria | 3157 |
| 685 | Ga0495662_0155558 | 3300046476 | Bacteria | 1126 |
| 686 | Ga0495664_0002344 | 3300046477 | Bacteria | 10143 |
| 687 | Ga0495664_0002466 | 3300046477 | Bacteria | 9960 |
| 688 | Ga0495664_0039711 | 3300046477 | Bacteria | 2781 |
| 689 | Ga0495664_0229075 | 3300046477 | Bacteria | 1124 |
| 690 | Ga0495664_0518552 | 3300046477 | Bacteria | 711 |
| 691 | Ga0495594_0050483 | 3300046499 | Bacteria | 2288 |
| 692 | Ga0495596_0206697 | 3300046500 | Bacteria | 763 |
| 693 | Ga0495608_0005053 | 3300046511 | Bacteria | 9437 |
| 694 | Ga0495608_0013857 | 3300046511 | Bacteria | 5595 |
| 695 | Ga0495608_0018341 | 3300046511 | Bacteria | 4829 |
| 696 | Ga0495608_0037820 | 3300046511 | Bacteria | 3244 |
| 697 | Ga0495608_0072696 | 3300046511 | Bacteria | 2243 |
| 698 | Ga0495608_0098540 | 3300046511 | Bacteria | 1886 |
| 699 | Ga0495608_0110927 | 3300046511 | Bacteria | 1764 |
| 700 | Ga0495608_0120452 | 3300046511 | Bacteria | 1683 |
| 701 | Ga0495618_0004006 | 3300046514 | Bacteria | 9083 |
| 702 | Ga0495618_0010322 | 3300046514 | Bacteria | 5651 |
| 703 | Ga0495618_0034393 | 3300046514 | Bacteria | 3177 |
| 704 | Ga0495618_0215856 | 3300046514 | Bacteria | 1211 |
| 705 | Ga0495628_0068140 | 3300046516 | Bacteria | 2777 |
| 706 | Ga0495628_0187090 | 3300046516 | Bacteria | 1564 |
| 707 | Ga0495628_0231681 | 3300046516 | Bacteria | 1384 |
| 708 | Ga0495628_0247711 | 3300046516 | Bacteria | 1331 |
| 709 | Ga0495628_0250617 | 3300046516 | Bacteria | 1322 |
| 710 | Ga0495630_0002081 | 3300046517 | Bacteria | 13915 |
| 711 | Ga0495630_0050184 | 3300046517 | Bacteria | 3122 |
| 712 | Ga0495630_0190534 | 3300046517 | Bacteria | 1564 |
| 713 | Ga0495652_0004790 | 3300046529 | Bacteria | 12879 |
| 714 | Ga0495652_0009061 | 3300046529 | Bacteria | 9055 |
| 715 | Ga0495652_0034845 | 3300046529 | Bacteria | 4385 |
| 716 | Ga0495652_0060176 | 3300046529 | Bacteria | 3210 |
| 717 | Ga0495652_0085070 | 3300046529 | Bacteria | 2600 |
| 718 | Ga0495652_0497687 | 3300046529 | Bacteria | 845 |
| 719 | Ga0495665_0003447 | 3300046531 | Bacteria | 8592 |
| 720 | Ga0495665_0013796 | 3300046531 | Bacteria | 4365 |
| 721 | Ga0495665_0070535 | 3300046531 | Bacteria | 1841 |
| 722 | Ga0495640_0013788 | 3300046533 | Bacteria | 6141 |
| 723 | Ga0495640_0079158 | 3300046533 | Bacteria | 2188 |
| 724 | Ga0495640_0168453 | 3300046533 | Bacteria | 1400 |
| 725 | Ga0495640_0272103 | 3300046533 | Bacteria | 1056 |
| 726 | Ga0495640_0388146 | 3300046533 | Bacteria | 858 |
| 727 | Ga0495586_0060770 | 3300046535 | Bacteria | 2055 |
| 728 | Ga0495586_0075105 | 3300046535 | Bacteria | 1850 |
| 729 | Ga0495587_0009568 | 3300046536 | Bacteria | 6204 |
| 730 | Ga0495587_0039256 | 3300046536 | Bacteria | 2834 |
| 731 | Ga0495587_0118087 | 3300046536 | Bacteria | 1520 |
| 732 | Ga0495587_0244898 | 3300046536 | Bacteria | 1008 |
| 733 | Ga0495587_0321227 | 3300046536 | Bacteria | 864 |
| 734 | Ga0495645_0008403 | 3300046543 | Bacteria | 7212 |
| 735 | Ga0495645_0041259 | 3300046543 | Bacteria | 3364 |
| 736 | Ga0495645_0088303 | 3300046543 | Bacteria | 2218 |
| 737 | Ga0495645_0101629 | 3300046543 | Bacteria | 2044 |
| 738 | Ga0495645_0113723 | 3300046543 | Bacteria | 1913 |
| 739 | Ga0495645_0353908 | 3300046543 | Bacteria | 945 |
| 740 | Ga0495667_0009485 | 3300046559 | Bacteria | 6594 |
| 741 | Ga0495667_0013328 | 3300046559 | Bacteria | 5564 |
| 742 | Ga0495667_0017944 | 3300046559 | Bacteria | 4779 |
| 743 | Ga0495667_0164534 | 3300046559 | Bacteria | 1426 |
| 744 | Ga0495667_0173332 | 3300046559 | Bacteria | 1386 |
| 745 | Ga0495667_0193224 | 3300046559 | Bacteria | 1304 |
| 746 | Ga0495667_0513576 | 3300046559 | Bacteria | 750 |
| 747 | Ga0495667_0585713 | 3300046559 | Bacteria | 695 |
| 748 | Ga0495656_0069363 | 3300046615 | Bacteria | 1561 |
| 749 | Ga0495634_0003736 | 3300046642 | Bacteria | 12125 |
| 750 | Ga0495634_0022030 | 3300046642 | Bacteria | 4493 |
| 751 | Ga0495634_0065008 | 3300046642 | Bacteria | 2418 |
| 752 | Ga0495634_0134905 | 3300046642 | Bacteria | 1571 |
| 753 | Ga0495635_0000373 | 3300046663 | Bacteria | 28369 |
| 754 | Ga0495635_0010201 | 3300046663 | Bacteria | 6566 |
| 755 | Ga0495635_0031552 | 3300046663 | Bacteria | 3677 |
| 756 | Ga0495635_0048852 | 3300046663 | Bacteria | 2916 |
| 757 | Ga0495635_0055815 | 3300046663 | Bacteria | 2721 |
| 758 | Ga0495635_0067582 | 3300046663 | Bacteria | 2451 |
| 759 | Ga0495635_0125396 | 3300046663 | Bacteria | 1751 |
| 760 | Ga0495635_0157670 | 3300046663 | Bacteria | 1545 |
| 761 | Ga0495588_0207115 | 3300046674 | Bacteria | 1036 |
| 762 | Ga0495657_0005611 | 3300046675 | Bacteria | 9905 |
| 763 | Ga0495657_0020617 | 3300046675 | Bacteria | 4738 |
| 764 | Ga0495657_0032190 | 3300046675 | Bacteria | 3661 |
| 765 | Ga0495657_0049639 | 3300046675 | Bacteria | 2825 |
| 766 | Ga0495657_0063662 | 3300046675 | Bacteria | 2432 |
| 767 | Ga0495657_0100230 | 3300046675 | Bacteria | 1846 |
| 768 | Ga0495657_0359765 | 3300046675 | Bacteria | 860 |
| 769 | Ga0495599_0006980 | 3300046678 | Bacteria | 6832 |
| 770 | Ga0495599_0014769 | 3300046678 | Bacteria | 4834 |
| 771 | Ga0495599_0057643 | 3300046678 | Bacteria | 2430 |
| 772 | Ga0495599_0075853 | 3300046678 | Bacteria | 2099 |
| 773 | Ga0495599_0127162 | 3300046678 | Bacteria | 1584 |
| 774 | Ga0495599_0158130 | 3300046678 | Bacteria | 1401 |
| 775 | Ga0495599_0193826 | 3300046678 | Bacteria | 1249 |
| 776 | Ga0495599_0518277 | 3300046678 | Bacteria | 700 |
| 777 | Ga0495623_0088595 | 3300046679 | Bacteria | 1904 |
| 778 | Ga0495623_0123453 | 3300046679 | Bacteria | 1556 |
| 779 | Ga0495623_0264055 | 3300046679 | Bacteria | 963 |
| 780 | Ga0495646_0011973 | 3300046680 | Bacteria | 5518 |
| 781 | Ga0495646_0098852 | 3300046680 | Bacteria | 1675 |
| 782 | Ga0495646_0263585 | 3300046680 | Bacteria | 920 |
| 783 | Ga0495646_0274623 | 3300046680 | Bacteria | 897 |
| 784 | Ga0495658_0142253 | 3300046683 | Bacteria | 1468 |
| 785 | Ga0495658_0149351 | 3300046683 | Bacteria | 1434 |
| 786 | Ga0495613_0016767 | 3300046689 | Bacteria | 5454 |
| 787 | Ga0495624_0005818 | 3300046690 | Bacteria | 8826 |
| 788 | Ga0495671_0280469 | 3300046692 | Bacteria | 803 |
| 789 | Ga0495600_0001122 | 3300046809 | Bacteria | 14592 |
| 790 | Ga0495600_0017191 | 3300046809 | Bacteria | 4596 |
| 791 | Ga0495600_0021301 | 3300046809 | Bacteria | 4149 |
| 792 | Ga0495600_0416460 | 3300046809 | Bacteria | 834 |
| 793 | Ga0495600_0542317 | 3300046809 | Bacteria | 711 |
| 794 | Ga0495581_0098272 | 3300047315 | Bacteria | 1700 |
| 795 | Ga0495581_0532588 | 3300047315 | Bacteria | 682 |
| 796 | Ga0495604_0022717 | 3300047317 | Bacteria | 5008 |
| 797 | Ga0495604_0033648 | 3300047317 | Bacteria | 4056 |
| 798 | Ga0495674_0001403 | 3300047319 | Bacteria | 23570 |
| 799 | Ga0495674_0008588 | 3300047319 | Bacteria | 9723 |
| 800 | Ga0495674_0030881 | 3300047319 | Bacteria | 4868 |
| 801 | Ga0495674_0033254 | 3300047319 | Bacteria | 4672 |
| 802 | Ga0495674_0491523 | 3300047319 | Bacteria | 982 |
| 803 | Ga0495674_0825849 | 3300047319 | Bacteria | 719 |
| 804 | Ga0495676_0009960 | 3300047321 | Bacteria | 8637 |
| 805 | Ga0495676_0257113 | 3300047321 | Bacteria | 1189 |
| 806 | Ga0495680_0002970 | 3300047322 | Bacteria | 16962 |
| 807 | Ga0495680_0003936 | 3300047322 | Bacteria | 14361 |
| 808 | Ga0495680_0005201 | 3300047322 | Bacteria | 12275 |
| 809 | Ga0495680_0025724 | 3300047322 | Bacteria | 4867 |
| 810 | Ga0495680_0046222 | 3300047322 | Bacteria | 3433 |
| 811 | Ga0495680_0064779 | 3300047322 | Bacteria | 2801 |
| 812 | Ga0495680_0175742 | 3300047322 | Bacteria | 1548 |
| 813 | Ga0495675_0004945 | 3300047444 | Bacteria | 8117 |
| 814 | Ga0495675_0008242 | 3300047444 | Bacteria | 6447 |
| 815 | Ga0495675_0010931 | 3300047444 | Bacteria | 5689 |
| 816 | Ga0495675_0115439 | 3300047444 | Bacteria | 1674 |
| 817 | Ga0495684_0017087 | 3300047471 | Bacteria | 5588 |
| 818 | Ga0495684_0025759 | 3300047471 | Bacteria | 4519 |
| 819 | Ga0495684_0026181 | 3300047471 | Bacteria | 4481 |
| 820 | Ga0495684_0330890 | 3300047471 | Bacteria | 1086 |
| 821 | Ga0495684_0416838 | 3300047471 | Bacteria | 939 |
| 822 | Ga0495684_0550861 | 3300047471 | Bacteria | 785 |
| 823 | Ga0495593_0080390 | 3300047673 | Bacteria | 1686 |
| 824 | Ga0495593_0138062 | 3300047673 | Bacteria | 1235 |
| 825 | Ga0495602_0053613 | 3300048088 | Bacteria | 3569 |
| 826 | Ga0495602_0094490 | 3300048088 | Bacteria | 2470 |
| 827 | Ga0495602_0156141 | 3300048088 | Bacteria | 1786 |
| 828 | Ga0496100_0026734 | 3300048903 | Bacteria | 3541 |
| 829 | Ga0496101_0004995 | 3300048904 | Bacteria | 8423 |
| 830 | Ga0496101_0122283 | 3300048904 | Bacteria | 1969 |
| 831 | Ga0496102_0013483 | 3300048905 | Bacteria | 7081 |
| 832 | Ga0496102_0026750 | 3300048905 | Bacteria | 5149 |
| 833 | Ga0496102_0383100 | 3300048905 | Bacteria | 1323 |
| 834 | Ga0496102_0962699 | 3300048905 | Bacteria | 774 |
| 835 | Ga0496104_0000398 | 3300048907 | Bacteria | 38090 |
| 836 | Ga0496104_0003572 | 3300048907 | Bacteria | 13421 |
| 837 | Ga0496104_0004209 | 3300048907 | Bacteria | 12493 |
| 838 | Ga0496104_0043126 | 3300048907 | Bacteria | 4237 |
| 839 | Ga0496104_0095273 | 3300048907 | Bacteria | 2847 |
| 840 | Ga0496105_0001408 | 3300048908 | Bacteria | 16892 |
| 841 | Ga0496105_0002315 | 3300048908 | Bacteria | 13811 |
| 842 | Ga0496105_0005313 | 3300048908 | Bacteria | 9764 |
| 843 | Ga0496105_0024841 | 3300048908 | Bacteria | 4869 |
| 844 | Ga0496105_0068794 | 3300048908 | Bacteria | 2925 |
| 845 | Ga0496105_0372930 | 3300048908 | Bacteria | 1137 |
| 846 | Ga0496106_0100833 | 3300048909 | Bacteria | 2239 |
| 847 | Ga0496106_0104620 | 3300048909 | Bacteria | 2198 |
| 848 | Ga0496107_0022993 | 3300048910 | Bacteria | 4407 |
| 849 | Ga0496107_0246526 | 3300048910 | Bacteria | 1329 |
| 850 | Ga0496107_0273234 | 3300048910 | Bacteria | 1258 |
| 851 | Ga0496108_0003584 | 3300048911 | Bacteria | 12438 |
| 852 | Ga0496108_0028241 | 3300048911 | Bacteria | 4641 |
| 853 | Ga0496108_0088189 | 3300048911 | Bacteria | 2636 |
| 854 | Ga0496108_0146694 | 3300048911 | Bacteria | 2035 |
| 855 | Ga0496108_1079640 | 3300048911 | Bacteria | 683 |
| 856 | Ga0496109_0005942 | 3300048912 | Bacteria | 10243 |
| 857 | Ga0496109_0085204 | 3300048912 | Bacteria | 2916 |
| 858 | Ga0496109_0209383 | 3300048912 | Bacteria | 1834 |
| 859 | Ga0496109_0345131 | 3300048912 | Bacteria | 1406 |
| 860 | Ga0496109_1158852 | 3300048912 | Bacteria | 710 |
| 861 | Ga0496110_0002292 | 3300048913 | Bacteria | 14309 |
| 862 | Ga0496110_0788106 | 3300048913 | Bacteria | 854 |
| 863 | Ga0496111_0004922 | 3300048914 | Bacteria | 8480 |
| 864 | Ga0496111_0022876 | 3300048914 | Bacteria | 4381 |
| 865 | Ga0496112_0000555 | 3300048915 | Bacteria | 25563 |
| 866 | Ga0496112_0142478 | 3300048915 | Bacteria | 2366 |
| 867 | Ga0496112_0296872 | 3300048915 | Bacteria | 1561 |
| 868 | Ga0496112_0688649 | 3300048915 | Bacteria | 950 |
| 869 | Ga0496113_0031690 | 3300048916 | Bacteria | 3838 |
| 870 | Ga0496113_0032801 | 3300048916 | Bacteria | 3775 |
| 871 | Ga0496113_0035217 | 3300048916 | Bacteria | 3660 |
| 872 | Ga0496113_0682354 | 3300048916 | Bacteria | 821 |
| 873 | Ga0496114_0006141 | 3300048917 | Bacteria | 9452 |
| 874 | Ga0496114_0061818 | 3300048917 | Bacteria | 3133 |
| 875 | Ga0496114_0146772 | 3300048917 | Bacteria | 2045 |
| 876 | Ga0496114_0288679 | 3300048917 | Bacteria | 1447 |
| 877 | Ga0496114_0356933 | 3300048917 | Bacteria | 1293 |
| 878 | Ga0496114_0768009 | 3300048917 | Bacteria | 842 |
| 879 | Ga0496114_1327168 | 3300048917 | Bacteria | 606 |
| 880 | Ga0496114_1335450 | 3300048917 | Bacteria | 604 |
| 881 | Ga0496115_0029629 | 3300048918 | Bacteria | 4300 |
| 882 | Ga0496115_0085445 | 3300048918 | Bacteria | 2573 |
| 883 | Ga0496115_0379645 | 3300048918 | Bacteria | 1149 |
| 884 | Ga0496115_0693695 | 3300048918 | Bacteria | 801 |
| 885 | Ga0496119_0090394 | 3300048922 | Bacteria | 1741 |
| 886 | Ga0496126_0028014 | 3300048929 | Bacteria | 5372 |
| 887 | Ga0496126_0789095 | 3300048929 | Bacteria | 730 |
| 888 | Ga0501031_0063792 | 3300049568 | Bacteria | 2400 |
| 889 | Ga0501042_1061028 | 3300049578 | Bacteria | 591 |
| 890 | Ga0501047_0623194 | 3300049581 | Bacteria | 899 |
| 891 | Ga0501069_0120164 | 3300049585 | Bacteria | 1500 |
| 892 | Ga0501070_0009955 | 3300049586 | Bacteria | 8039 |
| 893 | Ga0501070_0558537 | 3300049586 | Bacteria | 916 |
| 894 | Ga0501074_0527329 | 3300049590 | Bacteria | 836 |
| 895 | Ga0501074_0577034 | 3300049590 | Bacteria | 796 |
| 896 | Ga0501075_0584028 | 3300049591 | Bacteria | 852 |
| 897 | Ga0501076_0377577 | 3300049592 | Bacteria | 1165 |
| 898 | Ga0501080_0528278 | 3300049742 | Bacteria | 1052 |
| 899 | nmdc:mga05p37_21572_c1 | 3300050507 | Bacteria | 7805 |
| 900 | nmdc:mga05p37_338150_c1 | 3300050507 | Bacteria | 1776 |
| 901 | nmdc:mga09592_49013_c1 | 3300050508 | Bacteria | 3561 |
| 902 | nmdc:mga06r32_640586_c1 | 3300050510 | Bacteria | 1032 |
| 903 | nmdc:mga0n895_243588_c1 | 3300050512 | Bacteria | 1825 |
| 904 | nmdc:mga0n895_387107_c1 | 3300050512 | Bacteria | 1415 |
| 905 | nmdc:mga0rr50_616257_c1 | 3300050513 | Bacteria | 926 |
| 906 | nmdc:mga0rr50_7131_c1 | 3300050513 | Bacteria | 6865 |
| 907 | nmdc:mga0rr50_73405_c1 | 3300050513 | Bacteria | 2616 |
| 908 | nmdc:mga08x19_132610_c1 | 3300050514 | Bacteria | 1677 |
| 909 | nmdc:mga08x19_193102_c1 | 3300050514 | Bacteria | 1393 |
| 910 | nmdc:mga08x19_243092_c1 | 3300050514 | Bacteria | 1241 |
| 911 | nmdc:mga08x19_249211_c1 | 3300050514 | Bacteria | 1226 |
| 912 | nmdc:mga08x19_32832_c1 | 3300050514 | Bacteria | 3274 |
| 913 | nmdc:mga0a205_5191_c1 | 3300050515 | Bacteria | 10230 |
| 914 | Ga0495601_0003370 | 3300053077 | Bacteria | 9152 |
| 915 | Ga0495601_0056233 | 3300053077 | Bacteria | 2491 |
| 916 | Ga0495601_0084051 | 3300053077 | Bacteria | 2045 |
| 917 | Ga0495601_0286462 | 3300053077 | Bacteria | 1074 |
| 918 | Ga0495612_0013917 | 3300053078 | Bacteria | 3241 |
| 919 | Ga0495612_0015530 | 3300053078 | Bacteria | 3053 |
| 920 | Ga0495612_0035866 | 3300053078 | Bacteria | 2011 |
| 921 | Ga0495595_0186368 | 3300053084 | Bacteria | 1030 |
| 922 | Ga0495595_0447451 | 3300053084 | Bacteria | 656 |
| 923 | Ga0495595_0555363 | 3300053084 | Bacteria | 586 |
| 924 | Ga0495619_0010591 | 3300053085 | Bacteria | 5800 |
| 925 | Ga0495619_0015371 | 3300053085 | Bacteria | 4843 |
| 926 | Ga0495619_0268347 | 3300053085 | Bacteria | 1183 |
| 927 | Ga0495619_0301857 | 3300053085 | Bacteria | 1109 |
| 928 | Ga0500655_021105 | 3300053133 | Bacteria | 1220 |
| 929 | Ga0500577_0113327 | 3300053142 | Bacteria | 1121 |
| 930 | Ga0500630_182400 | 3300053159 | Bacteria | 844 |
| 931 | Ga0466962_0106168 | 3300061719 | Bacteria | 1350 |
| 932 | Ga0466962_0214620 | 3300061719 | Bacteria | 942 |
| 933 | 2623500177 | 2622736605 | Bacteria | 4992138 |
| 934 | 3003001834 | 3002998708 | Bacteria | 11715108 |
| 935 | 8056065082 | 8056060235 | Bacteria | 7259403 |
| 936 | Ga0495646_0031437 | |||
| 937 | JGI25406J46586_10051874 | |||
| 938 | JGI25405J52794_10074824 | |||
| 939 | Ga0070658_10096527 | |||
| 940 | Ga0070658_10396814 | |||
| 941 | Ga0070676_10062529 | |||
| 942 | Ga0070683_100297030 | |||
| 943 | Ga0070670_100079289 | |||
| 944 | Ga0068869_100002052 | |||
| 945 | Ga0070680_100022377 | |||
| 946 | Ga0070680_100411330 | |||
| 947 | Ga0070682_100006180 | |||
| 948 | Ga0070682_100045233 | |||
| 949 | Ga0070682_100252769 | |||
| 950 | Ga0068868_100004627 | |||
| 951 | Ga0068868_100439381 | |||
| 952 | Ga0070660_100087424 | |||
| 953 | Ga0070660_100201248 | |||
| 954 | Ga0070660_100522657 | |||
| 955 | Ga0070691_10019655 | |||
| 956 | Ga0070691_10509410 | |||
| 957 | Ga0070661_100552592 | |||
| 958 | Ga0070692_10001247 | |||
| 959 | Ga0070675_100009094 | |||
| 960 | Ga0070675_100013231 | |||
| 961 | Ga0070671_100002713 | |||
| 962 | Ga0070659_100218684 | |||
| 963 | Ga0070659_100224938 | |||
| 964 | Ga0070659_100485645 | |||
| 965 | Ga0070659_100549615 | |||
| 966 | Ga0070709_10007442 | |||
| 967 | Ga0070709_10039528 | |||
| 968 | Ga0070714_100004329 | |||
| 969 | Ga0070714_100009463 | |||
| 970 | Ga0070714_100019622 | |||
| 971 | Ga0070714_100043473 | |||
| 972 | Ga0070714_100070722 | |||
| 973 | Ga0070714_100079102 | |||
| 974 | Ga0070714_100154976 | |||
| 975 | Ga0070714_100159390 | |||
| 976 | Ga0070714_100212077 | |||
| 977 | Ga0070714_100219834 | |||
| 978 | Ga0070714_100226579 | |||
| 979 | Ga0070714_100321589 | |||
| 980 | Ga0070714_100393909 | |||
| 981 | Ga0070714_100548482 | |||
| 982 | Ga0070714_100570442 | |||
| 983 | Ga0070714_101520736 | |||
| 984 | Ga0070713_100036219 | |||
| 985 | Ga0070713_100176176 | |||
| 986 | Ga0070713_100338194 | |||
| 987 | Ga0070713_100340993 | |||
| 988 | Ga0070713_100346807 | |||
| 989 | Ga0070713_100638343 | |||
| 990 | Ga0070713_100647818 | |||
| 991 | Ga0070713_100919625 | |||
| 992 | Ga0070713_101389811 | |||
| 993 | Ga0070710_10128257 | |||
| 994 | Ga0070710_10323299 | |||
| 995 | Ga0070710_10414397 | |||
| 996 | Ga0070711_100032680 | |||
| 997 | Ga0070711_100104807 | |||
| 998 | Ga0070711_100413458 | |||
| 999 | Ga0070711_100632634 | |||
| 1000 | Ga0070711_100990293 | |||
| 1001 | Ga0070705_100077968 | |||
| 1002 | Ga0070694_100169495 | |||
| 1003 | Ga0070694_100757991 | |||
| 1004 | Ga0070694_101109028 | |||
| 1005 | Ga0070708_100002501 | |||
| 1006 | Ga0070708_100042043 | |||
| 1007 | Ga0070708_100066894 | |||
| 1008 | Ga0070708_100561009 | |||
| 1009 | Ga0070663_100004146 | |||
| 1010 | Ga0070663_100053936 | |||
| 1011 | Ga0070663_100108239 | |||
| 1012 | Ga0070663_100685738 | |||
| 1013 | Ga0070678_100015458 | |||
| 1014 | Ga0070678_100704941 | |||
| 1015 | Ga0070662_100243168 | |||
| 1016 | Ga0070681_10007378 | |||
| 1017 | Ga0070681_10055905 | |||
| 1018 | Ga0070681_11208352 | |||
| 1019 | Ga0070685_10017716 | |||
| 1020 | Ga0070706_100002492 | |||
| 1021 | Ga0070706_100008070 | |||
| 1022 | Ga0070706_100017808 | |||
| 1023 | Ga0070706_100021912 | |||
| 1024 | Ga0070706_100054596 | |||
| 1025 | Ga0070706_100136298 | |||
| 1026 | Ga0070706_100214722 | |||
| 1027 | Ga0070706_100811748 | |||
| 1028 | Ga0070707_100000199 | |||
| 1029 | Ga0070707_100001332 | |||
| 1030 | Ga0070707_100005322 | |||
| 1031 | Ga0070707_100012384 | |||
| 1032 | Ga0070707_100030494 | |||
| 1033 | Ga0070707_100036466 | |||
| 1034 | Ga0070707_100040620 | |||
| 1035 | Ga0070707_100061390 | |||
| 1036 | Ga0070707_100123121 | |||
| 1037 | Ga0070707_100832142 | |||
| 1038 | Ga0070707_101103001 | |||
| 1039 | Ga0070698_100000264 | |||
| 1040 | Ga0070698_100001732 | |||
| 1041 | Ga0070698_100035178 | |||
| 1042 | Ga0070698_100035250 | |||
| 1043 | Ga0070698_100048835 | |||
| 1044 | Ga0070698_100051145 | |||
| 1045 | Ga0070698_100071099 | |||
| 1046 | Ga0070698_100182506 | |||
| 1047 | Ga0070698_100463966 | |||
| 1048 | Ga0070698_100547426 | |||
| 1049 | Ga0070698_100743831 | |||
| 1050 | Ga0070699_100006399 | |||
| 1051 | Ga0070679_100016152 | |||
| 1052 | Ga0070679_100074844 | |||
| 1053 | Ga0070679_100106016 | |||
| 1054 | Ga0070679_100118116 | |||
| 1055 | Ga0070679_100442230 | |||
| 1056 | Ga0070684_100086401 | |||
| 1057 | Ga0070684_100641351 | |||
| 1058 | Ga0070684_101053753 | |||
| 1059 | Ga0070697_100010436 | |||
| 1060 | Ga0070697_100033026 | |||
| 1061 | Ga0070697_100075666 | |||
| 1062 | Ga0070697_100712606 | |||
| 1063 | Ga0068853_100054874 | |||
| 1064 | Ga0068853_100247590 | |||
| 1065 | Ga0070686_100565979 | |||
| 1066 | Ga0070695_100700332 | |||
| 1067 | Ga0070695_100901322 | |||
| 1068 | Ga0070665_100045239 | |||
| 1069 | Ga0070665_100465985 | |||
| 1070 | Ga0070665_100639483 | |||
| 1071 | Ga0070704_100166515 | |||
| 1072 | Ga0070704_100339739 | |||
| 1073 | Ga0068855_100009694 | |||
| 1074 | Ga0068855_100742934 | |||
| 1075 | Ga0068857_100673572 | |||
| 1076 | Ga0068857_100839866 | |||
| 1077 | Ga0068856_100008925 | |||
| 1078 | Ga0068856_100042106 | |||
| 1079 | Ga0068856_100048682 | |||
| 1080 | Ga0068856_100302681 | |||
| 1081 | Ga0068856_100742570 | |||
| 1082 | Ga0068856_101030912 | |||
| 1083 | Ga0068856_101797982 | |||
| 1084 | Ga0070702_100001819 | |||
| 1085 | Ga0070702_100350434 | |||
| 1086 | Ga0068852_100006864 | |||
| 1087 | Ga0068852_100327019 | |||
| 1088 | Ga0068852_101699026 | |||
| 1089 | Ga0068859_100077412 | |||
| 1090 | Ga0068864_100106943 | |||
| 1091 | Ga0068864_100428677 | |||
| 1092 | Ga0068866_10685973 | |||
| 1093 | Ga0068861_100168780 | |||
| 1094 | Ga0068851_10010568 | |||
| 1095 | Ga0068870_10000071 | |||
| 1096 | Ga0068863_100032440 | |||
| 1097 | Ga0068863_100103755 | |||
| 1098 | Ga0068858_100003961 | |||
| 1099 | Ga0068860_100311861 | |||
| 1100 | Ga0081455_10001891 | |||
| 1101 | Ga0081539_10000806 | |||
| 1102 | Ga0070717_10002201 | |||
| 1103 | Ga0070717_10004329 | |||
| 1104 | Ga0070717_10048540 | |||
| 1105 | Ga0070717_10064433 | |||
| 1106 | Ga0070717_10094448 | |||
| 1107 | Ga0070717_10206429 | |||
| 1108 | Ga0070717_10208281 | |||
| 1109 | Ga0070717_10254711 | |||
| 1110 | Ga0070717_10296654 | |||
| 1111 | Ga0070717_10302209 | |||
| 1112 | Ga0070717_10318453 | |||
| 1113 | Ga0070717_10438333 | |||
| 1114 | Ga0070717_11409355 | |||
| 1115 | Ga0075432_10003384 | |||
| 1116 | Ga0075432_10196075 | |||
| 1117 | Ga0070715_10003898 | |||
| 1118 | Ga0070715_10008246 | |||
| 1119 | Ga0070715_10008492 | |||
| 1120 | Ga0070715_10054529 | |||
| 1121 | Ga0070716_100120063 | |||
| 1122 | Ga0070716_100178665 | |||
| 1123 | Ga0070716_100301902 | |||
| 1124 | Ga0070716_100324093 | |||
| 1125 | Ga0070716_100417201 | |||
| 1126 | Ga0070716_100563211 | |||
| 1127 | Ga0070712_100014246 | |||
| 1128 | Ga0070712_100126708 | |||
| 1129 | Ga0070712_100256995 | |||
| 1130 | Ga0070712_100744336 | |||
| 1131 | Ga0097621_100044853 | |||
| 1132 | Ga0068871_100037805 | |||
| 1133 | Ga0075428_100243261 | |||
| 1134 | Ga0075428_100355691 | |||
| 1135 | Ga0075431_100407351 | |||
| 1136 | Ga0075433_10005340 | |||
| 1137 | Ga0075433_10046311 | |||
| 1138 | Ga0075433_10233585 | |||
| 1139 | Ga0075434_100001779 | |||
| 1140 | Ga0075434_100007096 | |||
| 1141 | Ga0075434_100489726 | |||
| 1142 | Ga0075434_100592208 | |||
| 1143 | Ga0075429_100231745 | |||
| 1144 | Ga0068865_101097625 | |||
| 1145 | Ga0075436_100001620 | |||
| 1146 | Ga0075436_100029436 | |||
| 1147 | Ga0075436_100106996 | |||
| 1148 | Ga0075436_100458689 | |||
| 1149 | Ga0075436_100690802 | |||
| 1150 | Ga0097620_100077414 | |||
| 1151 | Ga0075435_100002488 | |||
| 1152 | Ga0075435_100005801 | |||
| 1153 | Ga0075435_100083568 | |||
| 1154 | Ga0075435_100320827 | |||
| 1155 | Ga0075435_100908889 | |||
| 1156 | Ga0099794_10028392 | |||
| 1157 | Ga0105251_10065085 | |||
| 1158 | Ga0105240_10109913 | |||
| 1159 | Ga0105240_10283149 | |||
| 1160 | Ga0111539_10019228 | |||
| 1161 | Ga0105245_10254953 | |||
| 1162 | Ga0105245_10536031 | |||
| 1163 | Ga0105245_11251747 | |||
| 1164 | Ga0114129_10041618 | |||
| 1165 | Ga0114129_10771531 | |||
| 1166 | Ga0105243_10188743 | |||
| 1167 | Ga0105241_10007293 | |||
| 1168 | Ga0105248_10012380 | |||
| 1169 | Ga0105237_10160172 | |||
| 1170 | Ga0105238_10291735 | |||
| 1171 | Ga0105238_10631063 | |||
| 1172 | Ga0105239_10954888 | |||
| 1173 | Ga0105239_10976350 | |||
| 1174 | Ga0105246_10000478 | |||
| 1175 | Ga0157371_10009341 | |||
| 1176 | Ga0157371_10273155 | |||
| 1177 | Ga0157370_10064992 | |||
| 1178 | Ga0157370_10107846 | |||
| 1179 | Ga0157369_10009552 | |||
| 1180 | Ga0157369_10107064 | |||
| 1181 | Ga0157369_10433780 | |||
| 1182 | Ga0157374_10270734 | |||
| 1183 | Ga0163162_10534143 | |||
| 1184 | Ga0157372_10041227 | |||
| 1185 | Ga0157372_10433686 | |||
| 1186 | Ga0157375_12452708 | |||
| 1187 | Ga0163163_10220663 | |||
| 1188 | Ga0163163_10962253 | |||
| 1189 | Ga0163163_11245025 | |||
| 1190 | Ga0157380_10264225 | |||
| 1191 | Ga0182008_10020152 | |||
| 1192 | Ga0157377_10116735 | |||
| 1193 | Ga0157377_10390674 | |||
| 1194 | Ga0157379_10035359 | |||
| 1195 | Ga0157376_12010665 | |||
| 1196 | Ga0197907_10181547 | |||
| 1197 | Ga0206356_10850638 | |||
| 1198 | Ga0206352_10556522 | |||
| 1199 | Ga0206354_10159229 | |||
| 1200 | Ga0206354_10322134 | |||
| 1201 | Ga0206354_11210541 | |||
| 1202 | Ga0206354_11331006 | |||
| 1203 | Ga0206353_10363697 | |||
| 1204 | Ga0206353_10591091 | |||
| 1205 | Ga0206353_10881626 | |||
| 1206 | Ga0206353_10948632 | |||
| 1207 | Ga0206353_11417859 | |||
| 1208 | Ga0206353_11420308 | |||
| 1209 | Ga0213873_10087785 | |||
| 1210 | Ga0213875_10000079 | |||
| 1211 | Ga0213875_10033595 | |||
| 1212 | Ga0213875_10084295 | |||
| 1213 | Ga0213875_10125370 | |||
| 1214 | Ga0224712_10008505 | |||
| 1215 | Ga0207656_10002399 | |||
| 1216 | Ga0207692_10002632 | |||
| 1217 | Ga0207692_10004539 | |||
| 1218 | Ga0207692_10029139 | |||
| 1219 | Ga0207692_10322136 | |||
| 1220 | Ga0207692_10557709 | |||
| 1221 | Ga0207688_10002679 | |||
| 1222 | Ga0207647_10063509 | |||
| 1223 | Ga0207685_10002255 | |||
| 1224 | Ga0207685_10038598 | |||
| 1225 | Ga0207685_10082791 | |||
| 1226 | Ga0207685_10279429 | |||
| 1227 | Ga0207699_10008324 | |||
| 1228 | Ga0207699_10053957 | |||
| 1229 | Ga0207699_10074508 | |||
| 1230 | Ga0207699_10229767 | |||
| 1231 | Ga0207699_10373981 | |||
| 1232 | Ga0207699_10619030 | |||
| 1233 | Ga0207645_10013762 | |||
| 1234 | Ga0207643_10000102 | |||
| 1235 | Ga0207705_10004990 | |||
| 1236 | Ga0207705_10008596 | |||
| 1237 | Ga0207705_10080992 | |||
| 1238 | Ga0207705_10131864 | |||
| 1239 | Ga0207705_10645593 | |||
| 1240 | Ga0207705_10760245 | |||
| 1241 | Ga0207684_10001761 | |||
| 1242 | Ga0207684_10007871 | |||
| 1243 | Ga0207684_10048106 | |||
| 1244 | Ga0207684_10088377 | |||
| 1245 | Ga0207684_10150743 | |||
| 1246 | Ga0207684_10269781 | |||
| 1247 | Ga0207684_10317304 | |||
| 1248 | Ga0207684_10601954 | |||
| 1249 | Ga0207654_10004709 | |||
| 1250 | Ga0207707_10019633 | |||
| 1251 | Ga0207707_10019811 | |||
| 1252 | Ga0207707_10891251 | |||
| 1253 | Ga0207695_10664480 | |||
| 1254 | Ga0207695_10856908 | |||
| 1255 | Ga0207695_11047964 | |||
| 1256 | Ga0207693_10007692 | |||
| 1257 | Ga0207693_10029943 | |||
| 1258 | Ga0207693_10083256 | |||
| 1259 | Ga0207693_10703707 | |||
| 1260 | Ga0207693_11023311 | |||
| 1261 | Ga0207663_10002072 | |||
| 1262 | Ga0207663_10049524 | |||
| 1263 | Ga0207663_10066709 | |||
| 1264 | Ga0207663_10084074 | |||
| 1265 | Ga0207663_10333652 | |||
| 1266 | Ga0207663_10752584 | |||
| 1267 | Ga0207660_10015994 | |||
| 1268 | Ga0207660_10048977 | |||
| 1269 | Ga0207660_10748071 | |||
| 1270 | Ga0207657_10013713 | |||
| 1271 | Ga0207657_10014627 | |||
| 1272 | Ga0207657_10320312 | |||
| 1273 | Ga0207649_10017873 | |||
| 1274 | Ga0207649_10744977 | |||
| 1275 | Ga0207652_10071714 | |||
| 1276 | Ga0207652_10131531 | |||
| 1277 | Ga0207652_10226658 | |||
| 1278 | Ga0207652_10237625 | |||
| 1279 | Ga0207652_10846870 | |||
| 1280 | Ga0207646_10000278 | |||
| 1281 | Ga0207646_10005502 | |||
| 1282 | Ga0207646_10008219 | |||
| 1283 | Ga0207646_10023928 | |||
| 1284 | Ga0207646_10033313 | |||
| 1285 | Ga0207646_10046873 | |||
| 1286 | Ga0207646_10070964 | |||
| 1287 | Ga0207646_10431242 | |||
| 1288 | Ga0207694_10117979 | |||
| 1289 | Ga0207694_10265607 | |||
| 1290 | Ga0207650_10024219 | |||
| 1291 | Ga0207659_10030915 | |||
| 1292 | Ga0207687_10007022 | |||
| 1293 | Ga0207687_10382452 | |||
| 1294 | Ga0207687_10396601 | |||
| 1295 | Ga0207700_10004397 | |||
| 1296 | Ga0207700_10021649 | |||
| 1297 | Ga0207700_10026432 | |||
| 1298 | Ga0207700_10031586 | |||
| 1299 | Ga0207700_10078052 | |||
| 1300 | Ga0207700_10096332 | |||
| 1301 | Ga0207700_10176396 | |||
| 1302 | Ga0207700_10194413 | |||
| 1303 | Ga0207700_10223279 | |||
| 1304 | Ga0207700_10265710 | |||
| 1305 | Ga0207700_10333970 | |||
| 1306 | Ga0207700_10567648 | |||
| 1307 | Ga0207664_10001507 | |||
| 1308 | Ga0207664_10005990 | |||
| 1309 | Ga0207664_10014918 | |||
| 1310 | Ga0207664_10032034 | |||
| 1311 | Ga0207664_10037113 | |||
| 1312 | Ga0207664_10079232 | |||
| 1313 | Ga0207664_10099191 | |||
| 1314 | Ga0207664_10109776 | |||
| 1315 | Ga0207664_10195832 | |||
| 1316 | Ga0207664_10309562 | |||
| 1317 | Ga0207664_10312268 | |||
| 1318 | Ga0207664_10530583 | |||
| 1319 | Ga0207664_10691161 | |||
| 1320 | Ga0207690_10226566 | |||
| 1321 | Ga0207706_10097994 | |||
| 1322 | Ga0207686_10406785 | |||
| 1323 | Ga0207670_10029745 | |||
| 1324 | Ga0207669_10490894 | |||
| 1325 | Ga0207704_10099915 | |||
| 1326 | Ga0207665_10002825 | |||
| 1327 | Ga0207665_10011126 | |||
| 1328 | Ga0207665_10031849 | |||
| 1329 | Ga0207665_10049531 | |||
| 1330 | Ga0207665_10055461 | |||
| 1331 | Ga0207665_10149970 | |||
| 1332 | Ga0207665_10186428 | |||
| 1333 | Ga0207711_10026883 | |||
| 1334 | Ga0207689_10001185 | |||
| 1335 | Ga0207661_10016521 | |||
| 1336 | Ga0207661_10026259 | |||
| 1337 | Ga0207661_10664860 | |||
| 1338 | Ga0207679_10004501 | |||
| 1339 | Ga0207679_10801592 | |||
| 1340 | Ga0207667_10014963 | |||
| 1341 | Ga0207667_10513153 | |||
| 1342 | Ga0207651_10218130 | |||
| 1343 | Ga0207668_10786077 | |||
| 1344 | Ga0207640_10023349 | |||
| 1345 | Ga0207677_10047916 | |||
| 1346 | Ga0207703_10068617 | |||
| 1347 | Ga0207639_10316886 | |||
| 1348 | Ga0207678_10000141 | |||
| 1349 | Ga0207678_10236425 | |||
| 1350 | Ga0207708_10242608 | |||
| 1351 | Ga0207702_10000567 | |||
| 1352 | Ga0207702_10012158 | |||
| 1353 | Ga0207702_10013663 | |||
| 1354 | Ga0207702_10033883 | |||
| 1355 | Ga0207702_11526843 | |||
| 1356 | Ga0207641_10005052 | |||
| 1357 | Ga0207641_10082843 | |||
| 1358 | Ga0207641_10332812 | |||
| 1359 | Ga0207676_10000814 | |||
| 1360 | Ga0207676_10247846 | |||
| 1361 | Ga0207674_10022354 | |||
| 1362 | Ga0207674_10981378 | |||
| 1363 | Ga0207674_10983557 | |||
| 1364 | Ga0207683_10002042 | |||
| 1365 | Ga0207683_10236616 | |||
| 1366 | Ga0207683_10369791 | |||
| 1367 | Ga0207683_10435210 | |||
| 1368 | Ga0207698_10002259 | |||
| 1369 | Ga0207698_11517674 | |||
| 1370 | Ga0207428_10019640 | |||
| 1371 | Ga0268266_10090394 | |||
| 1372 | Ga0268266_10357664 | |||
| 1373 | Ga0268266_10520734 | |||
| 1374 | Ga0268264_11877075 | |||
| 1375 | Ga0265337_1000705 | |||
| 1376 | Ga0265326_10010556 | |||
| 1377 | Ga0265319_1002204 | |||
| 1378 | Ga0265334_10001922 | |||
| 1379 | Ga0265318_10022213 | |||
| 1380 | Ga0265323_10010908 | |||
| 1381 | Ga0265322_10007986 | |||
| 1382 | Ga0265336_10001837 | |||
| 1383 | Ga0265338_10004045 | |||
| 1384 | Ga0265338_10011623 | |||
| 1385 | Ga0265338_10041393 | |||
| 1386 | Ga0265324_10001640 | |||
| 1387 | Ga0307511_10000625 | |||
| 1388 | Ga0307512_10024565 | |||
| 1389 | Ga0265332_10001213 | |||
| 1390 | Ga0265320_10023234 | |||
| 1391 | Ga0265325_10003537 | |||
| 1392 | Ga0265340_10002891 | |||
| 1393 | Ga0265339_10030831 | |||
| 1394 | Ga0265331_10334664 | |||
| 1395 | Ga0265316_10012954 | |||
| 1396 | Ga0307513_10081826 | |||
| 1397 | Ga0307408_100257971 | |||
| 1398 | Ga0265313_10058125 | |||
| 1399 | Ga0265314_10025885 | |||
| 1400 | Ga0265342_10004344 | |||
| 1401 | Ga0307405_10101404 | |||
| 1402 | Ga0307405_10310595 | |||
| 1403 | Ga0307405_10787179 | |||
| 1404 | Ga0307413_10002040 | |||
| 1405 | Ga0307413_10052584 | |||
| 1406 | Ga0307410_10053457 | |||
| 1407 | Ga0307410_10073759 | |||
| 1408 | Ga0307410_10360902 | |||
| 1409 | Ga0307410_10564405 | |||
| 1410 | Ga0307410_11053372 | |||
| 1411 | Ga0307406_10057466 | |||
| 1412 | Ga0307406_10073718 | |||
| 1413 | Ga0307406_10387480 | |||
| 1414 | Ga0307407_10011558 | |||
| 1415 | Ga0307412_10154730 | |||
| 1416 | Ga0307412_10729291 | |||
| 1417 | Ga0307409_100026307 | |||
| 1418 | Ga0307409_100060029 | |||
| 1419 | Ga0307409_100160174 | |||
| 1420 | Ga0307409_100444741 | |||
| 1421 | Ga0307409_101299899 | |||
| 1422 | Ga0307409_101393903 | |||
| 1423 | Ga0307409_101659207 | |||
| 1424 | Ga0307416_100161026 | |||
| 1425 | Ga0307416_100477121 | |||
| 1426 | Ga0307416_100493328 | |||
| 1427 | Ga0307416_101015640 | |||
| 1428 | Ga0307416_101187703 | |||
| 1429 | Ga0307414_11373397 | |||
| 1430 | Ga0307411_10137300 | |||
| 1431 | Ga0307411_10415401 | |||
| 1432 | Ga0307411_10668249 | |||
| 1433 | Ga0307411_10834111 | |||
| 1434 | Ga0307415_100317996 | |||
| 1435 | Ga0307415_100630344 | |||
| 1436 | Ga0307415_100659871 | |||
| 1437 | Ga0307415_100917270 | |||
| 1438 | Ga0316214_1031569 | |||
| 1439 | Ga0373948_0011675 | |||
| 1440 | Ga0373926_0057756 | |||
| 1441 | Ga0373926_0077133 | |||
| 1442 | Ga0373926_0110451 | |||
| 1443 | Ga0373928_0003091 | |||
| 1444 | Ga0373929_0005169 | |||
| 1445 | Ga0373934_0062727 | |||
| 1446 | Ga0373940_0002286 | |||
| 1447 | Ga0373944_0000808 | |||
| 1448 | Ga0373944_0226245 | |||
| 1449 | Ga0373949_0005475 | |||
| 1450 | Ga0373951_0015757 | |||
| 1451 | Ga0373952_0009434 | |||
| 1452 | Ga0373923_0001914 | |||
| 1453 | Ga0373923_0010514 | |||
| 1454 | Ga0373923_0110177 | |||
| 1455 | Ga0373936_0000341 | |||
| 1456 | Ga0373936_0004075 | |||
| 1457 | Ga0373936_0104220 | |||
| 1458 | Ga0373945_0001330 | |||
| 1459 | Ga0373945_0054315 | |||
| 1460 | Ga0373945_0106121 | |||
| 1461 | Ga0373953_0007549 | |||
| 1462 | Ga0373953_0017622 | |||
| 1463 | Ga0373954_0005348 | |||
| 1464 | Ga0373954_0032144 | |||
| 1465 | Ga0373954_0274685 | |||
| 1466 | Ga0373956_0013973 | |||
| 1467 | Ga0373956_0030819 | |||
| 1468 | Ga0373957_0004353 | |||
| 1469 | Ga0373957_0040365 | |||
| 1470 | Ga0373957_0118748 | |||
| 1471 | Ga0373943_0000222 | |||
| 1472 | Ga0373943_0162665 | |||
| 1473 | Ga0373943_0358710 | |||
| 1474 | Ga0373943_0375300 | |||
| 1475 | Ga0373943_0624416 | |||
| 1476 | Ga0373946_0000978 | |||
| 1477 | Ga0373946_0057447 | |||
| 1478 | Ga0373946_0062732 | |||
| 1479 | Ga0373946_0107118 | |||
| 1480 | Ga0373946_0189942 | |||
| 1481 | Ga0373955_0005438 | |||
| 1482 | Ga0373955_0009735 | |||
| 1483 | Ga0373955_0013355 | |||
| 1484 | Ga0373955_0032799 | |||
| 1485 | Ga0373955_0086309 | |||
| 1486 | Ga0373961_0030354 | |||
| 1487 | Ga0373924_0000857 | |||
| 1488 | Ga0373924_0011457 | |||
| 1489 | Ga0373924_0027184 | |||
| 1490 | Ga0373931_0013864 | |||
| 1491 | Ga0373935_0000284 | |||
| 1492 | Ga0373935_0046359 | |||
| 1493 | Ga0373935_0075307 | |||
| 1494 | Ga0373935_0207251 | |||
| 1495 | Ga0373935_0844574 | |||
| 1496 | Ga0373927_0002715 | |||
| 1497 | Ga0373927_0103410 | |||
| 1498 | Ga0373927_0490361 | |||
| 1499 | Ga0373933_0001656 | |||
| 1500 | Ga0373933_0010912 | |||
| 1501 | Ga0373933_0011406 | |||
| 1502 | Ga0373933_0033245 | |||
| 1503 | Ga0373933_0133010 | |||
| 1504 | Ga0373947_0111726 | |||
| 1505 | Ga0373947_0161979 | |||
| 1506 | Ga0373947_0165173 | |||
| 1507 | Ga0373947_0246478 | |||
| 1508 | Ga0373937_0008933 | |||
| 1509 | Ga0373937_0020068 | |||
| 1510 | Ga0373937_0052935 | |||
| 1511 | Ga0373937_0067848 | |||
| 1512 | Ga0373937_0081086 | |||
| 1513 | Ga0373937_0186374 | |||
| 1514 | Ga0373937_0196611 | |||
| 1515 | Ga0373925_0000010 | |||
| 1516 | Ga0373925_0001242 | |||
| 1517 | Ga0373925_0008509 | |||
| 1518 | Ga0373925_0099508 | |||
| 1519 | Ga0373925_0148227 | |||
| 1520 | Ga0373925_0189265 | |||
| 1521 | Ga0373925_0681291 | |||
| 1522 | Ga0395900_0357055 | |||
| 1523 | Ga0395900_1493460 | |||
| 1524 | Ga0395898_0031434 | |||
| 1525 | Ga0395898_0157477 | |||
| 1526 | Ga0395905_0740604 | |||
| 1527 | Ga0436364_0129100 | |||
| 1528 | Ga0436364_0526739 | |||
| 1529 | Ga0436364_0568803 | |||
| 1530 | Ga0436364_0683724 | |||
| 1531 | Ga0436364_0805657 | |||
| 1532 | Ga0436364_0812095 | |||
| 1533 | Ga0436364_1046304 | |||
| 1534 | Ga0436364_1301853 | |||
| 1535 | Ga0436364_1470699 | |||
| 1536 | Ga0395901_0001374 | |||
| 1537 | Ga0395901_0330225 | |||
| 1538 | Ga0436365_0179761 | |||
| 1539 | Ga0436365_0921579 | |||
| 1540 | Ga0436360_0567696 | |||
| 1541 | Ga0436363_1542421 | |||
| 1542 | Ga0436362_0763195 | |||
| 1543 | Ga0436362_0854794 | |||
| 1544 | Ga0436362_1169821 | |||
| 1545 | Ga0436362_1193726 | |||
| 1546 | Ga0451787_492751 | |||
| 1547 | Ga0451791_0567739 | |||
| 1548 | Ga0451793_0776550 | |||
| 1549 | Ga0451797_1221977 | |||
| 1550 | Ga0451797_1302557 | |||
| 1551 | Ga0451853_2506590 | |||
| 1552 | Ga0439449_0188888 | |||
| 1553 | Ga0439459_0006708 | |||
| 1554 | Ga0466965_0025179 | |||
| 1555 | Ga0466966_0044949 | |||
| 1556 | Ga0466966_0243333 | |||
| 1557 | Ga0466966_0445544 | |||
| 1558 | Ga0466961_0008686 | |||
| 1559 | Ga0466961_0156041 | |||
| 1560 | Ga0466963_0098947 | |||
| 1561 | Ga0466963_0105993 | |||
| 1562 | Ga0466971_0223478 | |||
| 1563 | Ga0466968_0062288 | |||
| 1564 | Ga0466968_0177900 | |||
| 1565 | Ga0466970_0087837 | |||
| 1566 | Ga0466970_0235493 | |||
| 1567 | Ga0466957_0019144 | |||
| 1568 | Ga0466957_0073273 | |||
| 1569 | Ga0466957_0177106 | |||
| 1570 | Ga0466957_0880381 | |||
| 1571 | Ga0466960_0036253 | |||
| 1572 | Ga0466960_0141379 | |||
| 1573 | Ga0466960_0438201 | |||
| 1574 | Ga0466960_0507242 | |||
| 1575 | Ga0466959_0045597 | |||
| 1576 | Ga0466959_0087076 | |||
| 1577 | Ga0466959_0211433 | |||
| 1578 | Ga0466959_0211771 | |||
| 1579 | Ga0466959_0604258 | |||
| 1580 | Ga0466958_0075278 | |||
| 1581 | Ga0466958_0084478 | |||
| 1582 | Ga0466958_0395292 | |||
| 1583 | Ga0466958_0454670 | |||
| 1584 | Ga0466967_0001208 | |||
| 1585 | Ga0466967_0020766 | |||
| 1586 | Ga0466967_0172562 | |||
| 1587 | Ga0466967_0384904 | |||
| 1588 | Ga0466967_0788294 | |||
| 1589 | Ga0466967_1029986 | |||
| 1590 | Ga0466967_1845226 | |||
| 1591 | Ga0466967_1902848 | |||
| 1592 | Ga0495592_0084123 | |||
| 1593 | Ga0495592_0112264 | |||
| 1594 | Ga0495592_0386519 | |||
| 1595 | Ga0495603_0163238 | |||
| 1596 | Ga0495603_0516926 | |||
| 1597 | Ga0495629_0001800 | |||
| 1598 | Ga0495629_0018033 | |||
| 1599 | Ga0495629_0025499 | |||
| 1600 | Ga0495629_0554499 | |||
| 1601 | Ga0495641_0006605 | |||
| 1602 | Ga0495651_0011568 | |||
| 1603 | Ga0495651_0013357 | |||
| 1604 | Ga0495651_0109436 | |||
| 1605 | Ga0495651_0127548 | |||
| 1606 | Ga0495653_0023323 | |||
| 1607 | Ga0495653_0023846 | |||
| 1608 | Ga0495653_0049801 | |||
| 1609 | Ga0495653_0169805 | |||
| 1610 | Ga0495653_0190337 | |||
| 1611 | Ga0495653_0492051 | |||
| 1612 | Ga0495580_0098032 | |||
| 1613 | Ga0495580_0361977 | |||
| 1614 | Ga0495582_0003237 | |||
| 1615 | Ga0495582_0037837 | |||
| 1616 | Ga0495639_0019543 | |||
| 1617 | Ga0495639_0047349 | |||
| 1618 | Ga0495639_0235622 | |||
| 1619 | Ga0495662_0021006 | |||
| 1620 | Ga0495662_0155558 | |||
| 1621 | Ga0495664_0002344 | |||
| 1622 | Ga0495664_0002466 | |||
| 1623 | Ga0495664_0039711 | |||
| 1624 | Ga0495664_0229075 | |||
| 1625 | Ga0495664_0518552 | |||
| 1626 | Ga0495594_0050483 | |||
| 1627 | Ga0495596_0206697 | |||
| 1628 | Ga0495608_0005053 | |||
| 1629 | Ga0495608_0013857 | |||
| 1630 | Ga0495608_0018341 | |||
| 1631 | Ga0495608_0037820 | |||
| 1632 | Ga0495608_0072696 | |||
| 1633 | Ga0495608_0098540 | |||
| 1634 | Ga0495608_0110927 | |||
| 1635 | Ga0495608_0120452 | |||
| 1636 | Ga0495618_0004006 | |||
| 1637 | Ga0495618_0010322 | |||
| 1638 | Ga0495618_0034393 | |||
| 1639 | Ga0495618_0215856 | |||
| 1640 | Ga0495628_0068140 | |||
| 1641 | Ga0495628_0187090 | |||
| 1642 | Ga0495628_0231681 | |||
| 1643 | Ga0495628_0247711 | |||
| 1644 | Ga0495628_0250617 | |||
| 1645 | Ga0495630_0002081 | |||
| 1646 | Ga0495630_0050184 | |||
| 1647 | Ga0495630_0190534 | |||
| 1648 | Ga0495652_0004790 | |||
| 1649 | Ga0495652_0009061 | |||
| 1650 | Ga0495652_0034845 | |||
| 1651 | Ga0495652_0060176 | |||
| 1652 | Ga0495652_0085070 | |||
| 1653 | Ga0495652_0497687 | |||
| 1654 | Ga0495665_0003447 | |||
| 1655 | Ga0495665_0013796 | |||
| 1656 | Ga0495665_0070535 | |||
| 1657 | Ga0495640_0013788 | |||
| 1658 | Ga0495640_0079158 | |||
| 1659 | Ga0495640_0168453 | |||
| 1660 | Ga0495640_0272103 | |||
| 1661 | Ga0495640_0388146 | |||
| 1662 | Ga0495586_0060770 | |||
| 1663 | Ga0495586_0075105 | |||
| 1664 | Ga0495587_0009568 | |||
| 1665 | Ga0495587_0039256 | |||
| 1666 | Ga0495587_0118087 | |||
| 1667 | Ga0495587_0244898 | |||
| 1668 | Ga0495587_0321227 | |||
| 1669 | Ga0495645_0008403 | |||
| 1670 | Ga0495645_0041259 | |||
| 1671 | Ga0495645_0088303 | |||
| 1672 | Ga0495645_0101629 | |||
| 1673 | Ga0495645_0113723 | |||
| 1674 | Ga0495645_0353908 | |||
| 1675 | Ga0495667_0009485 | |||
| 1676 | Ga0495667_0013328 | |||
| 1677 | Ga0495667_0017944 | |||
| 1678 | Ga0495667_0164534 | |||
| 1679 | Ga0495667_0173332 | |||
| 1680 | Ga0495667_0193224 | |||
| 1681 | Ga0495667_0513576 | |||
| 1682 | Ga0495667_0585713 | |||
| 1683 | Ga0495656_0069363 | |||
| 1684 | Ga0495634_0003736 | |||
| 1685 | Ga0495634_0022030 | |||
| 1686 | Ga0495634_0065008 | |||
| 1687 | Ga0495634_0134905 | |||
| 1688 | Ga0495635_0000373 | |||
| 1689 | Ga0495635_0010201 | |||
| 1690 | Ga0495635_0031552 | |||
| 1691 | Ga0495635_0048852 | |||
| 1692 | Ga0495635_0055815 | |||
| 1693 | Ga0495635_0067582 | |||
| 1694 | Ga0495635_0125396 | |||
| 1695 | Ga0495635_0157670 | |||
| 1696 | Ga0495588_0207115 | |||
| 1697 | Ga0495657_0005611 | |||
| 1698 | Ga0495657_0020617 | |||
| 1699 | Ga0495657_0032190 | |||
| 1700 | Ga0495657_0049639 | |||
| 1701 | Ga0495657_0063662 | |||
| 1702 | Ga0495657_0100230 | |||
| 1703 | Ga0495657_0359765 | |||
| 1704 | Ga0495599_0006980 | |||
| 1705 | Ga0495599_0014769 | |||
| 1706 | Ga0495599_0057643 | |||
| 1707 | Ga0495599_0075853 | |||
| 1708 | Ga0495599_0127162 | |||
| 1709 | Ga0495599_0158130 | |||
| 1710 | Ga0495599_0193826 | |||
| 1711 | Ga0495599_0518277 | |||
| 1712 | Ga0495623_0088595 | |||
| 1713 | Ga0495623_0123453 | |||
| 1714 | Ga0495623_0264055 | |||
| 1715 | Ga0495646_0011973 | |||
| 1716 | Ga0495646_0098852 | |||
| 1717 | Ga0495646_0263585 | |||
| 1718 | Ga0495646_0274623 | |||
| 1719 | Ga0495658_0142253 | |||
| 1720 | Ga0495658_0149351 | |||
| 1721 | Ga0495613_0016767 | |||
| 1722 | Ga0495624_0005818 | |||
| 1723 | Ga0495671_0280469 | |||
| 1724 | Ga0495600_0001122 | |||
| 1725 | Ga0495600_0017191 | |||
| 1726 | Ga0495600_0021301 | |||
| 1727 | Ga0495600_0416460 | |||
| 1728 | Ga0495600_0542317 | |||
| 1729 | Ga0495581_0098272 | |||
| 1730 | Ga0495581_0532588 | |||
| 1731 | Ga0495604_0022717 | |||
| 1732 | Ga0495604_0033648 | |||
| 1733 | Ga0495674_0001403 | |||
| 1734 | Ga0495674_0008588 | |||
| 1735 | Ga0495674_0030881 | |||
| 1736 | Ga0495674_0033254 | |||
| 1737 | Ga0495674_0491523 | |||
| 1738 | Ga0495674_0825849 | |||
| 1739 | Ga0495676_0009960 | |||
| 1740 | Ga0495676_0257113 | |||
| 1741 | Ga0495680_0002970 | |||
| 1742 | Ga0495680_0003936 | |||
| 1743 | Ga0495680_0005201 | |||
| 1744 | Ga0495680_0025724 | |||
| 1745 | Ga0495680_0046222 | |||
| 1746 | Ga0495680_0064779 | |||
| 1747 | Ga0495680_0175742 | |||
| 1748 | Ga0495675_0004945 | |||
| 1749 | Ga0495675_0008242 | |||
| 1750 | Ga0495675_0010931 | |||
| 1751 | Ga0495675_0115439 | |||
| 1752 | Ga0495684_0017087 | |||
| 1753 | Ga0495684_0025759 | |||
| 1754 | Ga0495684_0026181 | |||
| 1755 | Ga0495684_0330890 | |||
| 1756 | Ga0495684_0416838 | |||
| 1757 | Ga0495684_0550861 | |||
| 1758 | Ga0495593_0080390 | |||
| 1759 | Ga0495593_0138062 | |||
| 1760 | Ga0495602_0053613 | |||
| 1761 | Ga0495602_0094490 | |||
| 1762 | Ga0495602_0156141 | |||
| 1763 | Ga0496100_0026734 | |||
| 1764 | Ga0496101_0004995 | |||
| 1765 | Ga0496101_0122283 | |||
| 1766 | Ga0496102_0013483 | |||
| 1767 | Ga0496102_0026750 | |||
| 1768 | Ga0496102_0383100 | |||
| 1769 | Ga0496102_0962699 | |||
| 1770 | Ga0496104_0000398 | |||
| 1771 | Ga0496104_0003572 | |||
| 1772 | Ga0496104_0004209 | |||
| 1773 | Ga0496104_0043126 | |||
| 1774 | Ga0496104_0095273 | |||
| 1775 | Ga0496105_0001408 | |||
| 1776 | Ga0496105_0002315 | |||
| 1777 | Ga0496105_0005313 | |||
| 1778 | Ga0496105_0024841 | |||
| 1779 | Ga0496105_0068794 | |||
| 1780 | Ga0496105_0372930 | |||
| 1781 | Ga0496106_0100833 | |||
| 1782 | Ga0496106_0104620 | |||
| 1783 | Ga0496107_0022993 | |||
| 1784 | Ga0496107_0246526 | |||
| 1785 | Ga0496107_0273234 | |||
| 1786 | Ga0496108_0003584 | |||
| 1787 | Ga0496108_0028241 | |||
| 1788 | Ga0496108_0088189 | |||
| 1789 | Ga0496108_0146694 | |||
| 1790 | Ga0496108_1079640 | |||
| 1791 | Ga0496109_0005942 | |||
| 1792 | Ga0496109_0085204 | |||
| 1793 | Ga0496109_0209383 | |||
| 1794 | Ga0496109_0345131 | |||
| 1795 | Ga0496109_1158852 | |||
| 1796 | Ga0496110_0002292 | |||
| 1797 | Ga0496110_0788106 | |||
| 1798 | Ga0496111_0004922 | |||
| 1799 | Ga0496111_0022876 | |||
| 1800 | Ga0496112_0000555 | |||
| 1801 | Ga0496112_0142478 | |||
| 1802 | Ga0496112_0296872 | |||
| 1803 | Ga0496112_0688649 | |||
| 1804 | Ga0496113_0031690 | |||
| 1805 | Ga0496113_0032801 | |||
| 1806 | Ga0496113_0035217 | |||
| 1807 | Ga0496113_0682354 | |||
| 1808 | Ga0496114_0006141 | |||
| 1809 | Ga0496114_0061818 | |||
| 1810 | Ga0496114_0146772 | |||
| 1811 | Ga0496114_0288679 | |||
| 1812 | Ga0496114_0356933 | |||
| 1813 | Ga0496114_0768009 | |||
| 1814 | Ga0496114_1327168 | |||
| 1815 | Ga0496114_1335450 | |||
| 1816 | Ga0496115_0029629 | |||
| 1817 | Ga0496115_0085445 | |||
| 1818 | Ga0496115_0379645 | |||
| 1819 | Ga0496115_0693695 | |||
| 1820 | Ga0496119_0090394 | |||
| 1821 | Ga0496126_0028014 | |||
| 1822 | Ga0496126_0789095 | |||
| 1823 | Ga0501031_0063792 | |||
| 1824 | Ga0501042_1061028 | |||
| 1825 | Ga0501047_0623194 | |||
| 1826 | Ga0501069_0120164 | |||
| 1827 | Ga0501070_0009955 | |||
| 1828 | Ga0501070_0558537 | |||
| 1829 | Ga0501074_0527329 | |||
| 1830 | Ga0501074_0577034 | |||
| 1831 | Ga0501075_0584028 | |||
| 1832 | Ga0501076_0377577 | |||
| 1833 | Ga0501080_0528278 | |||
| 1834 | nmdc:mga05p37_21572_c1 | |||
| 1835 | nmdc:mga05p37_338150_c1 | |||
| 1836 | nmdc:mga09592_49013_c1 | |||
| 1837 | nmdc:mga06r32_640586_c1 | |||
| 1838 | nmdc:mga0n895_243588_c1 | |||
| 1839 | nmdc:mga0n895_387107_c1 | |||
| 1840 | nmdc:mga0rr50_616257_c1 | |||
| 1841 | nmdc:mga0rr50_7131_c1 | |||
| 1842 | nmdc:mga0rr50_73405_c1 | |||
| 1843 | nmdc:mga08x19_132610_c1 | |||
| 1844 | nmdc:mga08x19_193102_c1 | |||
| 1845 | nmdc:mga08x19_243092_c1 | |||
| 1846 | nmdc:mga08x19_249211_c1 | |||
| 1847 | nmdc:mga08x19_32832_c1 | |||
| 1848 | nmdc:mga0a205_5191_c1 | |||
| 1849 | Ga0495601_0003370 | |||
| 1850 | Ga0495601_0056233 | |||
| 1851 | Ga0495601_0084051 | |||
| 1852 | Ga0495601_0286462 | |||
| 1853 | Ga0495612_0013917 | |||
| 1854 | Ga0495612_0015530 | |||
| 1855 | Ga0495612_0035866 | |||
| 1856 | Ga0495595_0186368 | |||
| 1857 | Ga0495595_0447451 | |||
| 1858 | Ga0495595_0555363 | |||
| 1859 | Ga0495619_0010591 | |||
| 1860 | Ga0495619_0015371 | |||
| 1861 | Ga0495619_0268347 | |||
| 1862 | Ga0495619_0301857 | |||
| 1863 | Ga0500655_021105 | |||
| 1864 | Ga0500577_0113327 | |||
| 1865 | Ga0500630_182400 | |||
| 1866 | Ga0466962_0106168 | |||
| 1867 | Ga0466962_0214620 | |||
| 1868 | 2623500177 | |||
| 1869 | 3003001834 | |||
| 1870 | 8056065082 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4j07-assembly1.cif.gz_B | crystal structure of a probable riboflavin synthase, beta chain ribh (6,7-dimethyl-8-ribityllumazine synthase, dmrl synthase, lumazine synthase) from mycobacterium leprae | 0.9826 | 12 | 158 |
| 2c9b-assembly2.cif.gz_G | lumazine synthase from mycobacterium tuberculosus bound to 3-(1,3,7- trihydro-9-d-ribityl-2,6,8-purinetrione-7-yl) | 0.9699 | 13 | 158 |
| 4j07-assembly1.cif.gz_B | crystal structure of a probable riboflavin synthase, beta chain ribh (6,7-dimethyl-8-ribityllumazine synthase, dmrl synthase, lumazine synthase) from mycobacterium leprae | 0.9695 | 12 | 158 |
| 2c9b-assembly2.cif.gz_G | lumazine synthase from mycobacterium tuberculosus bound to 3-(1,3,7- trihydro-9-d-ribityl-2,6,8-purinetrione-7-yl) | 0.957 | 13 | 158 |
| 7a4h-assembly1.cif.gz_BK | aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-2 (180-mer) | 0.9525 | 13 | 77 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2vi5I00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase | 0.9756 | 13 | 158 | 3.40.50.960 |
| 2vi5I00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase | 0.9437 | 13 | 158 | 3.40.50.960 |
| 3mk3100 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase | 0.9241 | 9 | 149 | 3.40.50.960 |
| 4kq6B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase | 0.9196 | 10 | 149 | 3.40.50.960 |
| af_B4FBV7_62_217_3.40.50.960 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase | 0.9146 | 9 | 153 | 3.40.50.960 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W5T3Z0-F1-model_v4 | deleted | 0.9813 | 12 | 158 |
|
| AF-A0A0K2RD09-F1-model_v4 | 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) | 0.9793 | 32 | 155 |
GO:0000906
GO:0005829 GO:0009231 GO:0009349 |
| AF-A0A399J9J1-F1-model_v4 | 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) | 0.9776 | 20 | 151 |
GO:0000906
GO:0005829 GO:0009231 GO:0009349 |
| AF-A0A2S8MPP9-F1-model_v4 | deleted | 0.9751 | 10 | 142 |
|
| AF-A0A7W5T3Z0-F1-model_v4 | deleted | 0.9747 | 12 | 158 |
|