F486132

General Info

Members Datasets Scaffolds Average Seq Length
934 334 1868 251

Family's Representative Sequence

Representative Sequence 3300044719|Ga0466971_0094047|Ga0466971_0094047_375_1307
Length 310
Sequence MYTEVMSTSKLKSISVSRLLVNPVGSKSIFVFIRIYLWRKNLSVAKDLFLYFCSPKIDTMKLLEGKIAIVTGAARGIGEAIAYKLAEHGAHVAFTYVSDSSAEKATQLEEKIKALGVKSKAYKSNAGNFAECETFVNDVIKEFGTVDVCVNNAGISKDNLLLRLTPEQWDEVMTVNLKSVYNMTKQIIRPMMKAKKGSIINMSSIIGERGNAGQSSYAASKAGIIGFTKSVAHELGSRNIRCNAIAPGFIETDMTQYLKDGDSAKAFLEKIPLGRFGKSEEIANTTLFLASDLSSYITGQVISACGGLNI

Samples

Sample ID Description Type Environment
1 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
120 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
188 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
189 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
190 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
191 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
192 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
197 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
198 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
199 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
200 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
201 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
213 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
214 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
215 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
216 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
217 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
218 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
219 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
220 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
221 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
222 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
223 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
224 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
225 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
226 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
227 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
228 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
229 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
230 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
231 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
232 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
233 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
234 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
235 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
236 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
237 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
238 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
239 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
240 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
241 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
242 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
243 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
244 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
245 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
248 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
249 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
250 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
256 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
257 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
258 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
259 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
280 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
281 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
282 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
283 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
284 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
285 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
286 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
287 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
288 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
289 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
290 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
291 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
292 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
293 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
294 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
295 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
296 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
297 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
298 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
299 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
300 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
301 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
302 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
303 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
304 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
307 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
308 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
309 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
310 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
311 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
312 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
313 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
314 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
315 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
316 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
317 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
318 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
319 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
320 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
321 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
322 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
323 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
324 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
325 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
326 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
327 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
328 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
329 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
330 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
331 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
332 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
333 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
334 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.21
Nodule 0
Rhizoplane 0.64
Rhizosphere 93.36
Stem 0
Stem Tuber 0
Unclassified 4.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466971_0094047 3300044719 Bacteria 1374
2 JGI24740J21852_10027924 3300001979 Unclassified 1871
3 JGI24744J21845_10011658 3300002077 Bacteria 1795
4 rootH2_10045629 3300003320 Bacteria 6173
5 rootL2_10007799 3300003322 Bacteria 6721
6 rootH1_10020501 3300003323 Bacteria 26877
7 rootH1_10091167 3300003323 Bacteria 3824
8 rootH1_10110187 3300003323 Bacteria 3817
9 rootH1_10233433 3300003323 Bacteria 4817
10 rootH1_10360310 3300003323 Bacteria 2992
11 JGI25160J50197_1001126 3300003354 Bacteria 13660
12 Ga0065704_10231174 3300005289 Bacteria 1042
13 Ga0065712_10151133 3300005290 Bacteria 1367
14 Ga0070658_10020879 3300005327 Bacteria 5246
15 Ga0070658_10120126 3300005327 Unclassified 2183
16 Ga0070658_10175107 3300005327 Bacteria 1804
17 Ga0070658_10245921 3300005327 Bacteria 1517
18 Ga0070658_10504616 3300005327 Bacteria 1045
19 Ga0070676_10005328 3300005328 Bacteria 6846
20 Ga0070676_10017475 3300005328 Bacteria 3970
21 Ga0070676_10065452 3300005328 Bacteria 2170
22 Ga0070683_100001753 3300005329 Bacteria 16903
23 Ga0070683_100008191 3300005329 Bacteria 8878
24 Ga0070683_100120864 3300005329 Unclassified 2474
25 Ga0070683_100222713 3300005329 Bacteria 1793
26 Ga0070683_100435638 3300005329 Unclassified 1251
27 Ga0070683_100444048 3300005329 Bacteria 1238
28 Ga0070690_100008288 3300005330 Bacteria 5977
29 Ga0070690_100012515 3300005330 Bacteria 4993
30 Ga0070690_100474639 3300005330 Bacteria 931
31 Ga0070670_100024150 3300005331 Bacteria 5230
32 Ga0070670_100071294 3300005331 Bacteria 2983
33 Ga0068869_100002434 3300005334 Bacteria 11222
34 Ga0068869_100005896 3300005334 Bacteria 7736
35 Ga0068869_100045335 3300005334 Bacteria 3165
36 Ga0068869_100340827 3300005334 Bacteria 1220
37 Ga0070666_10000180 3300005335 Bacteria 43265
38 Ga0070666_10005857 3300005335 Bacteria 7551
39 Ga0070666_10011450 3300005335 Bacteria 5567
40 Ga0070666_10340487 3300005335 Unclassified 1072
41 Ga0070680_100000160 3300005336 Bacteria 42287
42 Ga0070680_100008618 3300005336 Bacteria 7816
43 Ga0070680_100028415 3300005336 Bacteria 4485
44 Ga0070680_100099186 3300005336 Bacteria 2417
45 Ga0070680_100309643 3300005336 Bacteria 1340
46 Ga0070682_100037628 3300005337 Bacteria 2964
47 Ga0070682_100048972 3300005337 Bacteria 2633
48 Ga0070682_100058138 3300005337 Bacteria 2438
49 Ga0068868_100007696 3300005338 Bacteria 7683
50 Ga0068868_100012050 3300005338 Bacteria 6313
51 Ga0068868_100038299 3300005338 Bacteria 3722
52 Ga0068868_100063905 3300005338 Bacteria 2920
53 Ga0068868_100109922 3300005338 Bacteria 2239
54 Ga0068868_100156479 3300005338 Bacteria 1880
55 Ga0070660_100111515 3300005339 Bacteria 2177
56 Ga0070689_100064413 3300005340 Bacteria 2853
57 Ga0070689_100382674 3300005340 Bacteria 1186
58 Ga0070691_10013373 3300005341 Bacteria 3759
59 Ga0070687_100221274 3300005343 Bacteria 1159
60 Ga0070661_100000673 3300005344 Bacteria 25107
61 Ga0070668_100117427 3300005347 Bacteria 2122
62 Ga0070668_100828070 3300005347 Bacteria 824
63 Ga0070669_100016770 3300005353 Bacteria 5227
64 Ga0070669_100033590 3300005353 Bacteria 3711
65 Ga0070669_100288054 3300005353 Bacteria 1318
66 Ga0070675_100015247 3300005354 Bacteria 6071
67 Ga0070675_100049965 3300005354 Bacteria 3433
68 Ga0070675_100424540 3300005354 Bacteria 1189
69 Ga0070671_100048424 3300005355 Bacteria 3534
70 Ga0070671_100085996 3300005355 Bacteria 2631
71 Ga0070671_100091725 3300005355 Bacteria 2545
72 Ga0070671_100133000 3300005355 Bacteria 2095
73 Ga0070671_100305510 3300005355 Bacteria 1354
74 Ga0070671_100700711 3300005355 Bacteria 878
75 Ga0070674_100006931 3300005356 Bacteria 6645
76 Ga0070674_100177769 3300005356 Bacteria 1627
77 Ga0070673_100011533 3300005364 Bacteria 6036
78 Ga0070673_100012386 3300005364 Bacteria 5853
79 Ga0070673_100015554 3300005364 Bacteria 5349
80 Ga0070673_100071680 3300005364 Bacteria 2785
81 Ga0070673_100076433 3300005364 Bacteria 2704
82 Ga0070673_100195098 3300005364 Unclassified 1741
83 Ga0070688_100002105 3300005365 Bacteria 10044
84 Ga0070688_100017578 3300005365 Bacteria 4106
85 Ga0070688_100028097 3300005365 Bacteria 3355
86 Ga0070688_100049641 3300005365 Bacteria 2612
87 Ga0070659_100007500 3300005366 Bacteria 7926
88 Ga0070659_100043633 3300005366 Bacteria 3507
89 Ga0070659_100366109 3300005366 Unclassified 1212
90 Ga0070667_100011123 3300005367 Bacteria 7444
91 Ga0070667_100078527 3300005367 Bacteria 2820
92 Ga0070667_100096637 3300005367 Bacteria 2548
93 Ga0070667_100765651 3300005367 Bacteria 895
94 Ga0070705_100343587 3300005440 Bacteria 1086
95 Ga0070708_100284530 3300005445 Bacteria 1556
96 Ga0070663_100031733 3300005455 Bacteria 3634
97 Ga0070663_100194504 3300005455 Bacteria 1580
98 Ga0070663_100408776 3300005455 Bacteria 1111
99 Ga0070663_100514676 3300005455 Bacteria 996
100 Ga0070678_100002640 3300005456 Bacteria 9871
101 Ga0070678_100217658 3300005456 Bacteria 1586
102 Ga0070678_100640989 3300005456 Unclassified 952
103 Ga0070662_100025737 3300005457 Bacteria 4067
104 Ga0070662_100036854 3300005457 Bacteria 3463
105 Ga0070662_100037770 3300005457 Bacteria 3425
106 Ga0070662_100302486 3300005457 Bacteria 1300
107 Ga0070681_10010880 3300005458 Bacteria 8994
108 Ga0070681_10012368 3300005458 Bacteria 8463
109 Ga0070681_10060327 3300005458 Bacteria 3770
110 Ga0070681_10183060 3300005458 Bacteria 2016
111 Ga0068867_100032189 3300005459 Bacteria 3791
112 Ga0068867_100036850 3300005459 Bacteria 3553
113 Ga0068867_100042237 3300005459 Bacteria 3335
114 Ga0068867_100075887 3300005459 Bacteria 2523
115 Ga0068867_100078426 3300005459 Bacteria 2484
116 Ga0068867_100186769 3300005459 Bacteria 1651
117 Ga0068867_100548989 3300005459 Bacteria 1001
118 Ga0070685_10220514 3300005466 Bacteria 1242
119 Ga0070706_100108822 3300005467 Bacteria 2579
120 Ga0070706_100385776 3300005467 Bacteria 1304
121 Ga0070707_100019962 3300005468 Bacteria 6317
122 Ga0070707_100045685 3300005468 Bacteria 4191
123 Ga0070698_100100334 3300005471 Bacteria 2867
124 Ga0070698_100212900 3300005471 Bacteria 1867
125 Ga0070699_100097893 3300005518 Bacteria 2570
126 Ga0070679_100000373 3300005530 Bacteria 38042
127 Ga0070679_100002115 3300005530 Bacteria 17887
128 Ga0070679_100008347 3300005530 Bacteria 9745
129 Ga0070679_100017813 3300005530 Bacteria 6879
130 Ga0070679_100072103 3300005530 Bacteria 3445
131 Ga0070679_100099933 3300005530 Bacteria 2888
132 Ga0070684_100000308 3300005535 Bacteria 33720
133 Ga0070684_100001157 3300005535 Bacteria 18949
134 Ga0070684_100074530 3300005535 Bacteria 2992
135 Ga0070684_100444288 3300005535 Bacteria 1198
136 Ga0070697_100347038 3300005536 Bacteria 1281
137 Ga0070697_100471611 3300005536 Bacteria 1095
138 Ga0070697_100719298 3300005536 Bacteria 881
139 Ga0068853_100000957 3300005539 Bacteria 20289
140 Ga0068853_100006084 3300005539 Bacteria 9553
141 Ga0068853_100031721 3300005539 Bacteria 4470
142 Ga0068853_100066128 3300005539 Bacteria 3139
143 Ga0068853_100080141 3300005539 Bacteria 2856
144 Ga0068853_100101860 3300005539 Bacteria 2540
145 Ga0068853_100109828 3300005539 Unclassified 2448
146 Ga0068853_100172222 3300005539 Bacteria 1959
147 Ga0068853_100223577 3300005539 Bacteria 1720
148 Ga0068853_100309131 3300005539 Bacteria 1463
149 Ga0070672_100031368 3300005543 Bacteria 3999
150 Ga0070672_100035102 3300005543 Bacteria 3809
151 Ga0070672_100050513 3300005543 Unclassified 3239
152 Ga0070672_100083725 3300005543 Bacteria 2560
153 Ga0070672_100131228 3300005543 Bacteria 2059
154 Ga0070686_100012543 3300005544 Bacteria 4829
155 Ga0070686_100088009 3300005544 Bacteria 2072
156 Ga0070686_100129350 3300005544 Bacteria 1744
157 Ga0070693_100026036 3300005547 Bacteria 3154
158 Ga0070665_100006640 3300005548 Bacteria 11761
159 Ga0070665_100009608 3300005548 Bacteria 9784
160 Ga0070665_100097871 3300005548 Bacteria 2939
161 Ga0070665_100571604 3300005548 Bacteria 1143
162 Ga0068855_100002019 3300005563 Bacteria 25173
163 Ga0068855_100023611 3300005563 Bacteria 7365
164 Ga0068855_100032608 3300005563 Bacteria 6218
165 Ga0068855_100046237 3300005563 Bacteria 5145
166 Ga0068855_100048404 3300005563 Bacteria 5017
167 Ga0068855_100048612 3300005563 Bacteria 5005
168 Ga0068855_100080927 3300005563 Bacteria 3766
169 Ga0068855_100259612 3300005563 Bacteria 1936
170 Ga0070664_100000958 3300005564 Bacteria 22561
171 Ga0070664_100015270 3300005564 Bacteria 6277
172 Ga0070664_100021342 3300005564 Bacteria 5336
173 Ga0070664_100231410 3300005564 Bacteria 1657
174 Ga0070664_100240380 3300005564 Unclassified 1625
175 Ga0070664_100249759 3300005564 Bacteria 1594
176 Ga0070664_100656072 3300005564 Unclassified 975
177 Ga0068857_100001014 3300005577 Bacteria 21648
178 Ga0068857_100002017 3300005577 Bacteria 16457
179 Ga0068857_100029491 3300005577 Bacteria 4841
180 Ga0068857_100100527 3300005577 Bacteria 2594
181 Ga0068857_100156703 3300005577 Bacteria 2065
182 Ga0068857_100239379 3300005577 Bacteria 1661
183 Ga0068854_100022206 3300005578 Bacteria 4319
184 Ga0068854_100059430 3300005578 Bacteria 2763
185 Ga0068854_100067054 3300005578 Bacteria 2613
186 Ga0068854_100082962 3300005578 Bacteria 2370
187 Ga0068854_100092561 3300005578 Bacteria 2252
188 Ga0068856_100008367 3300005614 Bacteria 10081
189 Ga0068856_100031265 3300005614 Bacteria 5208
190 Ga0068856_100063747 3300005614 Bacteria 3641
191 Ga0068856_100077004 3300005614 Bacteria 3304
192 Ga0068856_100190293 3300005614 Bacteria 2066
193 Ga0068856_100238671 3300005614 Bacteria 1833
194 Ga0068856_100300471 3300005614 Bacteria 1623
195 Ga0070702_100135901 3300005615 Bacteria 1560
196 Ga0068852_100000391 3300005616 Bacteria 29415
197 Ga0068852_100002613 3300005616 Bacteria 12447
198 Ga0068852_100009517 3300005616 Bacteria 7220
199 Ga0068852_100027775 3300005616 Bacteria 4618
200 Ga0068852_100050186 3300005616 Bacteria 3574
201 Ga0068852_100052369 3300005616 Bacteria 3508
202 Ga0068852_100067638 3300005616 Bacteria 3124
203 Ga0068852_100129164 3300005616 Bacteria 2325
204 Ga0068852_100365622 3300005616 Bacteria 1412
205 Ga0068852_100471710 3300005616 Bacteria 1246
206 Ga0068852_100725881 3300005616 Bacteria 1005
207 Ga0068859_100000003 3300005617 Bacteria 479218
208 Ga0068859_100026207 3300005617 Bacteria 5847
209 Ga0068859_100032310 3300005617 Bacteria 5257
210 Ga0068859_100054117 3300005617 Bacteria 4036
211 Ga0068859_100076244 3300005617 Bacteria 3393
212 Ga0068859_100483069 3300005617 Bacteria 1334
213 Ga0068864_100003333 3300005618 Bacteria 13277
214 Ga0068864_100063041 3300005618 Bacteria 3212
215 Ga0068864_100089257 3300005618 Bacteria 2716
216 Ga0068864_100242112 3300005618 Bacteria 1672
217 Ga0068864_100309553 3300005618 Bacteria 1481
218 Ga0068864_100311447 3300005618 Bacteria 1476
219 Ga0068866_10011382 3300005718 Bacteria 3847
220 Ga0068866_10024077 3300005718 Bacteria 2840
221 Ga0068861_100098237 3300005719 Bacteria 2324
222 Ga0068861_100375128 3300005719 Unclassified 1255
223 Ga0068861_100750677 3300005719 Bacteria 911
224 Ga0068851_10093714 3300005834 Bacteria 1585
225 Ga0068870_10015034 3300005840 Bacteria 3666
226 Ga0068863_100005788 3300005841 Bacteria 12118
227 Ga0068863_100012606 3300005841 Bacteria 8154
228 Ga0068863_100016247 3300005841 Bacteria 7141
229 Ga0068863_100213568 3300005841 Bacteria 1858
230 Ga0068863_100426051 3300005841 Unclassified 1300
231 Ga0068858_100026971 3300005842 Bacteria 5336
232 Ga0068858_100201531 3300005842 Bacteria 1882
233 Ga0068858_100229802 3300005842 Bacteria 1759
234 Ga0068858_100302355 3300005842 Bacteria 1526
235 Ga0068858_100514434 3300005842 Bacteria 1157
236 Ga0068860_100000003 3300005843 Bacteria 575741
237 Ga0068860_100002558 3300005843 Bacteria 19021
238 Ga0068860_100003354 3300005843 Bacteria 16492
239 Ga0068860_100003552 3300005843 Bacteria 16035
240 Ga0068860_100006921 3300005843 Bacteria 11364
241 Ga0068860_100018142 3300005843 Bacteria 6850
242 Ga0068860_100026287 3300005843 Bacteria 5612
243 Ga0068860_100048563 3300005843 Bacteria 4045
244 Ga0068860_100098485 3300005843 Unclassified 2788
245 Ga0068860_100109663 3300005843 Bacteria 2638
246 Ga0068860_100320370 3300005843 Bacteria 1521
247 Ga0068862_100015156 3300005844 Bacteria 6401
248 Ga0068862_100027769 3300005844 Bacteria 4765
249 Ga0068862_100047364 3300005844 Bacteria 3669
250 Ga0068862_100522522 3300005844 Unclassified 1130
251 Ga0081539_10000874 3300005985 Bacteria 57737
252 Ga0081539_10013810 3300005985 Bacteria 6047
253 Ga0070715_10031753 3300006163 Bacteria 2146
254 Ga0070715_10078026 3300006163 Bacteria 1496
255 Ga0070715_10164093 3300006163 Bacteria 1100
256 Ga0070716_100551449 3300006173 Bacteria 859
257 Ga0075366_10017273 3300006195 Bacteria 4151
258 Ga0097621_100023546 3300006237 Bacteria 4796
259 Ga0097621_100127133 3300006237 Bacteria 2166
260 Ga0097621_100425678 3300006237 Bacteria 1192
261 Ga0097621_100469822 3300006237 Bacteria 1136
262 Ga0068871_100013234 3300006358 Bacteria 6118
263 Ga0068871_100050582 3300006358 Bacteria 3362
264 Ga0068871_100548856 3300006358 Bacteria 1046
265 Ga0068871_100708247 3300006358 Bacteria 923
266 Ga0075428_100056033 3300006844 Bacteria 4318
267 Ga0075431_100003549 3300006847 Bacteria 15101
268 Ga0075433_10050116 3300006852 Bacteria 3634
269 Ga0075434_100652521 3300006871 Bacteria 1070
270 Ga0075429_100114668 3300006880 Unclassified 2356
271 Ga0075429_100242249 3300006880 Bacteria 1579
272 Ga0075429_100335895 3300006880 Bacteria 1322
273 Ga0068865_100001391 3300006881 Bacteria 14060
274 Ga0068865_100150544 3300006881 Bacteria 1765
275 Ga0068865_100739134 3300006881 Bacteria 844
276 Ga0075436_100240193 3300006914 Unclassified 1288
277 Ga0097620_100000003 3300006931 Bacteria 479218
278 Ga0097620_100026206 3300006931 Bacteria 5847
279 Ga0097620_100032311 3300006931 Bacteria 5257
280 Ga0097620_100054117 3300006931 Bacteria 4036
281 Ga0097620_100076244 3300006931 Bacteria 3393
282 Ga0097620_100483140 3300006931 Bacteria 1334
283 Ga0075435_100041523 3300007076 Bacteria 3677
284 Ga0075435_100146901 3300007076 Bacteria 1981
285 Ga0099794_10006781 3300007265 Bacteria 4661
286 Ga0105251_10059696 3300009011 Bacteria 1798
287 Ga0105244_10000339 3300009036 Bacteria 43963
288 Ga0105240_10000664 3300009093 Bacteria 63206
289 Ga0105240_10003417 3300009093 Bacteria 24669
290 Ga0105240_10005202 3300009093 Bacteria 19460
291 Ga0105240_10007539 3300009093 Bacteria 15772
292 Ga0105240_10013672 3300009093 Bacteria 11131
293 Ga0105240_10028985 3300009093 Bacteria 7220
294 Ga0105240_10030484 3300009093 Bacteria 7010
295 Ga0105240_10080146 3300009093 Bacteria 4016
296 Ga0105240_10730103 3300009093 Bacteria 1078
297 Ga0111539_10001581 3300009094 Bacteria 30313
298 Ga0111539_10235359 3300009094 Bacteria 2132
299 Ga0105245_10032550 3300009098 Bacteria 4616
300 Ga0105245_10106189 3300009098 Bacteria 2605
301 Ga0105245_10885541 3300009098 Bacteria 934
302 Ga0105247_10002199 3300009101 Bacteria 13422
303 Ga0105247_10241224 3300009101 Unclassified 1232
304 Ga0114129_10544516 3300009147 Bacteria 1510
305 Ga0105243_10234429 3300009148 Bacteria 1630
306 Ga0105241_10000439 3300009174 Bacteria 31338
307 Ga0105241_10003204 3300009174 Bacteria 12178
308 Ga0105241_10008515 3300009174 Bacteria 7542
309 Ga0105241_10009295 3300009174 Bacteria 7226
310 Ga0105241_10091778 3300009174 Bacteria 2397
311 Ga0105241_10145220 3300009174 Unclassified 1935
312 Ga0105241_10975732 3300009174 Bacteria 791
313 Ga0105242_10126139 3300009176 Bacteria 2203
314 Ga0105242_10200577 3300009176 Bacteria 1772
315 Ga0105242_10220383 3300009176 Bacteria 1695
316 Ga0105242_10343054 3300009176 Bacteria 1377
317 Ga0105242_10377363 3300009176 Bacteria 1317
318 Ga0105242_10509121 3300009176 Bacteria 1146
319 Ga0105248_10693517 3300009177 Bacteria 1149
320 Ga0105237_10000144 3300009545 Bacteria 100105
321 Ga0105237_10001444 3300009545 Bacteria 31385
322 Ga0105237_10001848 3300009545 Bacteria 27201
323 Ga0105237_10006055 3300009545 Bacteria 13528
324 Ga0105237_10006468 3300009545 Bacteria 12988
325 Ga0105237_10006867 3300009545 Bacteria 12548
326 Ga0105237_10011763 3300009545 Bacteria 9258
327 Ga0105237_10030017 3300009545 Bacteria 5523
328 Ga0105237_10058802 3300009545 Bacteria 3847
329 Ga0105237_10127139 3300009545 Bacteria 2543
330 Ga0105237_10867548 3300009545 Bacteria 909
331 Ga0105238_10001637 3300009551 Bacteria 22439
332 Ga0105238_10123249 3300009551 Bacteria 2571
333 Ga0105238_10383260 3300009551 Bacteria 1397
334 Ga0105249_10022903 3300009553 Bacteria 5600
335 Ga0105249_10025203 3300009553 Bacteria 5351
336 Ga0105249_10136703 3300009553 Bacteria 2346
337 Ga0105249_10292430 3300009553 Bacteria 1631
338 Ga0105249_10382898 3300009553 Bacteria 1433
339 Ga0105239_10000488 3300010375 Bacteria 57554
340 Ga0105239_10001785 3300010375 Bacteria 28298
341 Ga0105239_10003818 3300010375 Bacteria 18313
342 Ga0105239_10008966 3300010375 Bacteria 11320
343 Ga0105239_10033745 3300010375 Bacteria 5619
344 Ga0105239_10047335 3300010375 Bacteria 4714
345 Ga0105239_10053132 3300010375 Bacteria 4445
346 Ga0105239_10057502 3300010375 Bacteria 4266
347 Ga0105239_10061065 3300010375 Bacteria 4137
348 Ga0105239_10552075 3300010375 Bacteria 1312
349 Ga0105246_10019885 3300011119 Bacteria 4301
350 Ga0105246_10340982 3300011119 Bacteria 1225
351 Ga0157373_10019736 3300013100 Bacteria 4903
352 Ga0157373_10020245 3300013100 Bacteria 4840
353 Ga0157373_10035440 3300013100 Bacteria 3582
354 Ga0157373_10065050 3300013100 Unclassified 2581
355 Ga0157373_10105215 3300013100 Bacteria 1985
356 Ga0157373_10129817 3300013100 Bacteria 1772
357 Ga0157373_10234566 3300013100 Unclassified 1296
358 Ga0157371_10002684 3300013102 Bacteria 16831
359 Ga0157371_10011287 3300013102 Bacteria 6898
360 Ga0157371_10014557 3300013102 Bacteria 5932
361 Ga0157371_10021639 3300013102 Unclassified 4719
362 Ga0157371_10039728 3300013102 Bacteria 3364
363 Ga0157371_10040190 3300013102 Bacteria 3342
364 Ga0157371_10045338 3300013102 Bacteria 3129
365 Ga0157371_10048001 3300013102 Bacteria 3035
366 Ga0157371_10072741 3300013102 Bacteria 2434
367 Ga0157371_10109636 3300013102 Bacteria 1959
368 Ga0157371_10239821 3300013102 Bacteria 1304
369 Ga0157371_10244953 3300013102 Unclassified 1290
370 Ga0157371_10255970 3300013102 Bacteria 1261
371 Ga0157370_10001484 3300013104 Bacteria 29041
372 Ga0157370_10001848 3300013104 Bacteria 26098
373 Ga0157370_10006166 3300013104 Bacteria 13302
374 Ga0157370_10008668 3300013104 Bacteria 10945
375 Ga0157370_10367155 3300013104 Bacteria 1326
376 Ga0157370_10540032 3300013104 Bacteria 1069
377 Ga0157370_10544911 3300013104 Unclassified 1064
378 Ga0157369_10026472 3300013105 Bacteria 6432
379 Ga0157369_10031028 3300013105 Bacteria 5890
380 Ga0157369_10078140 3300013105 Bacteria 3546
381 Ga0157369_10202206 3300013105 Bacteria 2085
382 Ga0157369_10318581 3300013105 Bacteria 1617
383 Ga0157369_10433005 3300013105 Bacteria 1363
384 Ga0157374_10031460 3300013296 Bacteria 4824
385 Ga0157374_10035657 3300013296 Unclassified 4551
386 Ga0157374_10048484 3300013296 Bacteria 3941
387 Ga0157374_10119424 3300013296 Bacteria 2543
388 Ga0157374_10150905 3300013296 Bacteria 2259
389 Ga0157374_10364111 3300013296 Bacteria 1438
390 Ga0157378_10003719 3300013297 Bacteria 13528
391 Ga0157378_10005510 3300013297 Bacteria 11093
392 Ga0157378_10016875 3300013297 Bacteria 6399
393 Ga0157378_10053515 3300013297 Bacteria 3593
394 Ga0157378_10108130 3300013297 Unclassified 2546
395 Ga0157378_10168242 3300013297 Bacteria 2054
396 Ga0157378_10238526 3300013297 Bacteria 1736
397 Ga0157378_10494629 3300013297 Bacteria 1221
398 Ga0163162_10001183 3300013306 Bacteria 24333
399 Ga0163162_10002547 3300013306 Bacteria 17248
400 Ga0163162_10003339 3300013306 Bacteria 15355
401 Ga0163162_10024718 3300013306 Bacteria 5932
402 Ga0163162_10107083 3300013306 Bacteria 2891
403 Ga0163162_10107340 3300013306 Bacteria 2887
404 Ga0163162_10162201 3300013306 Bacteria 2357
405 Ga0163162_10297209 3300013306 Bacteria 1746
406 Ga0163162_10880576 3300013306 Bacteria 1009
407 Ga0157372_10000747 3300013307 Bacteria 35352
408 Ga0157372_10002589 3300013307 Bacteria 19570
409 Ga0157372_10010981 3300013307 Bacteria 9640
410 Ga0157372_10019462 3300013307 Bacteria 7317
411 Ga0157372_10032285 3300013307 Bacteria 5740
412 Ga0157372_10038383 3300013307 Bacteria 5284
413 Ga0157372_10039880 3300013307 Bacteria 5185
414 Ga0157372_10047116 3300013307 Bacteria 4788
415 Ga0157372_10049341 3300013307 Bacteria 4681
416 Ga0157372_10076348 3300013307 Bacteria 3783
417 Ga0157372_10084058 3300013307 Bacteria 3606
418 Ga0157372_10085944 3300013307 Bacteria 3568
419 Ga0157372_10090318 3300013307 Bacteria 3482
420 Ga0157372_10131510 3300013307 Bacteria 2879
421 Ga0157372_10137285 3300013307 Bacteria 2817
422 Ga0157372_10152899 3300013307 Bacteria 2664
423 Ga0157372_10187976 3300013307 Bacteria 2392
424 Ga0157372_10353237 3300013307 Bacteria 1713
425 Ga0157372_10371657 3300013307 Bacteria 1666
426 Ga0157372_10411734 3300013307 Bacteria 1575
427 Ga0157372_10532779 3300013307 Bacteria 1369
428 Ga0157372_10624938 3300013307 Bacteria 1255
429 Ga0157372_10648110 3300013307 Unclassified 1230
430 Ga0157372_10739288 3300013307 Bacteria 1144
431 Ga0157375_10192270 3300013308 Bacteria 2196
432 Ga0157375_10430058 3300013308 Bacteria 1486
433 Ga0157375_10445622 3300013308 Bacteria 1460
434 Ga0157375_10682159 3300013308 Bacteria 1182
435 Ga0157375_10693870 3300013308 Bacteria 1172
436 Ga0163163_10001099 3300014325 Bacteria 22954
437 Ga0163163_10189183 3300014325 Bacteria 2107
438 Ga0163163_10222935 3300014325 Bacteria 1934
439 Ga0157380_10360944 3300014326 Bacteria 1363
440 Ga0157380_10384579 3300014326 Bacteria 1326
441 Ga0157377_10004427 3300014745 Bacteria 6467
442 Ga0157379_10027316 3300014968 Bacteria 5081
443 Ga0157379_10102588 3300014968 Bacteria 2567
444 Ga0157379_10441801 3300014968 Bacteria 1200
445 Ga0157376_10008791 3300014969 Bacteria 7308
446 Ga0157376_10014902 3300014969 Bacteria 5855
447 Ga0157376_10024860 3300014969 Bacteria 4710
448 Ga0157376_10027426 3300014969 Bacteria 4514
449 Ga0157376_10126663 3300014969 Bacteria 2273
450 Ga0157376_10539513 3300014969 Unclassified 1153
451 Ga0163161_10021103 3300017792 Bacteria 4578
452 Ga0163161_10040298 3300017792 Bacteria 3354
453 Ga0163161_10127244 3300017792 Bacteria 1919
454 Ga0213876_10079219 3300021384 Bacteria 1736
455 Ga0209646_1007702 3300025246 Bacteria 1748
456 Ga0207426_1000230 3300025302 Bacteria 128357
457 Ga0207697_10105975 3300025315 Bacteria 1201
458 Ga0207655_1000319 3300025728 Bacteria 71324
459 Ga0207642_10145644 3300025899 Bacteria 1254
460 Ga0207710_10004189 3300025900 Bacteria 6324
461 Ga0207688_10177988 3300025901 Bacteria 1267
462 Ga0207680_10000073 3300025903 Bacteria 44634
463 Ga0207680_10133144 3300025903 Bacteria 1640
464 Ga0207680_10140021 3300025903 Bacteria 1603
465 Ga0207680_10218186 3300025903 Bacteria 1306
466 Ga0207680_10305253 3300025903 Unclassified 1110
467 Ga0207647_10131066 3300025904 Bacteria 1473
468 Ga0207647_10208838 3300025904 Bacteria 1128
469 Ga0207685_10029153 3300025905 Bacteria 1951
470 Ga0207645_10001118 3300025907 Bacteria 22193
471 Ga0207645_10001159 3300025907 Bacteria 21794
472 Ga0207645_10112007 3300025907 Bacteria 1767
473 Ga0207645_10175408 3300025907 Bacteria 1406
474 Ga0207645_10258663 3300025907 Bacteria 1153
475 Ga0207643_10049069 3300025908 Bacteria 2392
476 Ga0207705_10012442 3300025909 Bacteria 6147
477 Ga0207705_10053674 3300025909 Bacteria 2904
478 Ga0207705_10103224 3300025909 Unclassified 2100
479 Ga0207705_10182593 3300025909 Bacteria 1584
480 Ga0207705_10252420 3300025909 Bacteria 1345
481 Ga0207684_10304793 3300025910 Bacteria 1373
482 Ga0207654_10007264 3300025911 Bacteria 5583
483 Ga0207654_10008116 3300025911 Bacteria 5296
484 Ga0207654_10015008 3300025911 Bacteria 4012
485 Ga0207707_10004345 3300025912 Bacteria 12541
486 Ga0207707_10082925 3300025912 Bacteria 2799
487 Ga0207707_10118105 3300025912 Bacteria 2318
488 Ga0207695_10009734 3300025913 Bacteria 11831
489 Ga0207695_10020430 3300025913 Bacteria 7585
490 Ga0207695_10035578 3300025913 Bacteria 5398
491 Ga0207695_10062093 3300025913 Bacteria 3859
492 Ga0207695_10066998 3300025913 Bacteria 3684
493 Ga0207695_10097308 3300025913 Bacteria 2944
494 Ga0207695_10205612 3300025913 Bacteria 1882
495 Ga0207671_10000340 3300025914 Bacteria 68615
496 Ga0207671_10001368 3300025914 Bacteria 28441
497 Ga0207671_10001764 3300025914 Bacteria 24323
498 Ga0207671_10004891 3300025914 Bacteria 12589
499 Ga0207671_10006860 3300025914 Bacteria 10049
500 Ga0207671_10057113 3300025914 Unclassified 2892
501 Ga0207671_10080582 3300025914 Bacteria 2440
502 Ga0207671_10083349 3300025914 Bacteria 2400
503 Ga0207671_10443760 3300025914 Bacteria 1033
504 Ga0207693_10006758 3300025915 Bacteria 9471
505 Ga0207660_10032252 3300025917 Bacteria 3615
506 Ga0207660_10230062 3300025917 Bacteria 1457
507 Ga0207662_10076734 3300025918 Bacteria 2031
508 Ga0207662_10175341 3300025918 Bacteria 1377
509 Ga0207657_10029156 3300025919 Bacteria 5028
510 Ga0207649_10000652 3300025920 Bacteria 23164
511 Ga0207649_10051820 3300025920 Bacteria 2543
512 Ga0207649_10072850 3300025920 Bacteria 2199
513 Ga0207652_10002096 3300025921 Bacteria 17145
514 Ga0207652_10003075 3300025921 Bacteria 13931
515 Ga0207652_10036008 3300025921 Bacteria 4182
516 Ga0207652_10068797 3300025921 Bacteria 3072
517 Ga0207652_10129241 3300025921 Bacteria 2252
518 Ga0207646_10119142 3300025922 Bacteria 2371
519 Ga0207646_10119966 3300025922 Bacteria 2362
520 Ga0207646_10120713 3300025922 Bacteria 2354
521 Ga0207681_10133920 3300025923 Bacteria 1836
522 Ga0207681_10185533 3300025923 Bacteria 1588
523 Ga0207681_10207398 3300025923 Bacteria 1508
524 Ga0207694_10002249 3300025924 Bacteria 15815
525 Ga0207694_10208699 3300025924 Bacteria 1591
526 Ga0207694_10264494 3300025924 Bacteria 1410
527 Ga0207694_10275059 3300025924 Bacteria 1382
528 Ga0207650_10117284 3300025925 Bacteria 2068
529 Ga0207650_10553510 3300025925 Bacteria 965
530 Ga0207659_10009411 3300025926 Bacteria 6103
531 Ga0207659_10078035 3300025926 Bacteria 2439
532 Ga0207659_10206055 3300025926 Bacteria 1573
533 Ga0207659_10438346 3300025926 Unclassified 1098
534 Ga0207687_10102671 3300025927 Bacteria 2107
535 Ga0207644_10186187 3300025931 Bacteria 1630
536 Ga0207644_10196624 3300025931 Bacteria 1588
537 Ga0207644_10414714 3300025931 Bacteria 1102
538 Ga0207644_10514443 3300025931 Bacteria 988
539 Ga0207690_10011269 3300025932 Bacteria 5340
540 Ga0207690_10088570 3300025932 Bacteria 2181
541 Ga0207690_10351645 3300025932 Unclassified 1165
542 Ga0207706_10013035 3300025933 Bacteria 7566
543 Ga0207706_10049929 3300025933 Bacteria 3697
544 Ga0207706_10102106 3300025933 Bacteria 2523
545 Ga0207706_10257795 3300025933 Bacteria 1523
546 Ga0207706_10310377 3300025933 Bacteria 1373
547 Ga0207686_10039957 3300025934 Bacteria 2849
548 Ga0207686_10079789 3300025934 Bacteria 2132
549 Ga0207686_10179549 3300025934 Bacteria 1500
550 Ga0207686_10255047 3300025934 Bacteria 1283
551 Ga0207670_10056714 3300025936 Bacteria 2654
552 Ga0207670_10353159 3300025936 Bacteria 1165
553 Ga0207669_10013085 3300025937 Bacteria 4107
554 Ga0207669_10391680 3300025937 Bacteria 1085
555 Ga0207704_10331598 3300025938 Bacteria 1178
556 Ga0207665_10249128 3300025939 Bacteria 1312
557 Ga0207691_10027569 3300025940 Bacteria 5324
558 Ga0207691_10029587 3300025940 Bacteria 5123
559 Ga0207691_10043865 3300025940 Bacteria 4119
560 Ga0207691_10050536 3300025940 Bacteria 3805
561 Ga0207691_10053181 3300025940 Bacteria 3698
562 Ga0207691_10290802 3300025940 Unclassified 1405
563 Ga0207691_10324183 3300025940 Bacteria 1320
564 Ga0207691_10337574 3300025940 Bacteria 1290
565 Ga0207689_10000401 3300025942 Bacteria 40564
566 Ga0207689_10002161 3300025942 Bacteria 18495
567 Ga0207689_10007614 3300025942 Bacteria 9486
568 Ga0207689_10028784 3300025942 Bacteria 4645
569 Ga0207689_10246368 3300025942 Bacteria 1478
570 Ga0207661_10000183 3300025944 Bacteria 40561
571 Ga0207661_10171704 3300025944 Bacteria 1888
572 Ga0207661_10268831 3300025944 Bacteria 1521
573 Ga0207661_10354337 3300025944 Bacteria 1324
574 Ga0207679_10000308 3300025945 Bacteria 36802
575 Ga0207679_10001821 3300025945 Bacteria 13283
576 Ga0207679_10093390 3300025945 Bacteria 2333
577 Ga0207679_10780230 3300025945 Bacteria 870
578 Ga0207667_10001839 3300025949 Bacteria 26648
579 Ga0207667_10027111 3300025949 Bacteria 6246
580 Ga0207667_10027484 3300025949 Bacteria 6191
581 Ga0207667_10044303 3300025949 Bacteria 4716
582 Ga0207667_10048503 3300025949 Bacteria 4490
583 Ga0207667_10049946 3300025949 Bacteria 4414
584 Ga0207667_10071860 3300025949 Bacteria 3597
585 Ga0207667_10208296 3300025949 Bacteria 2005
586 Ga0207651_10079722 3300025960 Bacteria 2353
587 Ga0207651_10165324 3300025960 Bacteria 1739
588 Ga0207651_10181635 3300025960 Bacteria 1669
589 Ga0207651_10242481 3300025960 Bacteria 1470
590 Ga0207712_10015315 3300025961 Bacteria 4943
591 Ga0207712_10043042 3300025961 Bacteria 3113
592 Ga0207712_10474337 3300025961 Bacteria 1065
593 Ga0207668_10081267 3300025972 Bacteria 2350
594 Ga0207668_10115649 3300025972 Bacteria 2021
595 Ga0207640_10027790 3300025981 Bacteria 3451
596 Ga0207640_10028369 3300025981 Bacteria 3422
597 Ga0207640_10102146 3300025981 Bacteria 2013
598 Ga0207640_10378316 3300025981 Bacteria 1146
599 Ga0207658_10018404 3300025986 Bacteria 4824
600 Ga0207658_10039102 3300025986 Bacteria 3422
601 Ga0207658_10794151 3300025986 Bacteria 859
602 Ga0207677_10078621 3300026023 Bacteria 2356
603 Ga0207677_10087739 3300026023 Bacteria 2253
604 Ga0207677_10095717 3300026023 Bacteria 2171
605 Ga0207677_10137814 3300026023 Bacteria 1863
606 Ga0207677_10162319 3300026023 Bacteria 1737
607 Ga0207703_10005399 3300026035 Bacteria 10291
608 Ga0207703_10160115 3300026035 Unclassified 1971
609 Ga0207703_10289225 3300026035 Bacteria 1491
610 Ga0207639_10000781 3300026041 Bacteria 21658
611 Ga0207639_10031366 3300026041 Bacteria 3905
612 Ga0207639_10055426 3300026041 Bacteria 3034
613 Ga0207639_10077394 3300026041 Bacteria 2622
614 Ga0207639_10080265 3300026041 Bacteria 2580
615 Ga0207639_10081993 3300026041 Bacteria 2556
616 Ga0207639_10105021 3300026041 Bacteria 2291
617 Ga0207639_10348196 3300026041 Bacteria 1323
618 Ga0207678_10198191 3300026067 Bacteria 1716
619 Ga0207678_10251539 3300026067 Bacteria 1513
620 Ga0207678_10673256 3300026067 Bacteria 910
621 Ga0207708_10063391 3300026075 Bacteria 2824
622 Ga0207708_10084925 3300026075 Bacteria 2435
623 Ga0207702_10046094 3300026078 Bacteria 3669
624 Ga0207702_10063143 3300026078 Bacteria 3166
625 Ga0207702_10150941 3300026078 Bacteria 2113
626 Ga0207702_10187298 3300026078 Bacteria 1910
627 Ga0207702_10804366 3300026078 Unclassified 929
628 Ga0207641_10000026 3300026088 Bacteria 245091
629 Ga0207641_10052405 3300026088 Bacteria 3455
630 Ga0207641_10107554 3300026088 Bacteria 2467
631 Ga0207641_10112838 3300026088 Bacteria 2412
632 Ga0207641_10120558 3300026088 Bacteria 2340
633 Ga0207641_10894064 3300026088 Bacteria 882
634 Ga0207648_10006875 3300026089 Bacteria 11280
635 Ga0207648_10010880 3300026089 Bacteria 8598
636 Ga0207648_10032100 3300026089 Bacteria 4639
637 Ga0207648_10044012 3300026089 Bacteria 3918
638 Ga0207648_10079887 3300026089 Bacteria 2853
639 Ga0207648_10098697 3300026089 Bacteria 2557
640 Ga0207648_10215645 3300026089 Bacteria 1705
641 Ga0207648_10301549 3300026089 Bacteria 1437
642 Ga0207648_10575192 3300026089 Bacteria 1037
643 Ga0207676_10004939 3300026095 Bacteria 9453
644 Ga0207676_10012670 3300026095 Bacteria 6048
645 Ga0207676_10073296 3300026095 Bacteria 2755
646 Ga0207676_10136904 3300026095 Bacteria 2091
647 Ga0207676_10284854 3300026095 Bacteria 1502
648 Ga0207676_10516291 3300026095 Bacteria 1137
649 Ga0207674_10001969 3300026116 Bacteria 26000
650 Ga0207674_10002814 3300026116 Bacteria 21653
651 Ga0207674_10035586 3300026116 Bacteria 5196
652 Ga0207674_10091190 3300026116 Bacteria 3038
653 Ga0207675_100081816 3300026118 Bacteria 3028
654 Ga0207683_10001619 3300026121 Bacteria 20189
655 Ga0207683_10040532 3300026121 Bacteria 4064
656 Ga0207683_10072459 3300026121 Bacteria 3047
657 Ga0207683_10489616 3300026121 Bacteria 1135
658 Ga0207683_10629286 3300026121 Bacteria 994
659 Ga0207698_10000497 3300026142 Bacteria 22930
660 Ga0207698_10007369 3300026142 Bacteria 6894
661 Ga0207698_10012029 3300026142 Bacteria 5641
662 Ga0207698_10022588 3300026142 Bacteria 4375
663 Ga0207698_10113560 3300026142 Bacteria 2276
664 Ga0207698_10136153 3300026142 Bacteria 2108
665 Ga0207698_10145348 3300026142 Bacteria 2050
666 Ga0207698_10266545 3300026142 Bacteria 1576
667 Ga0207698_10503965 3300026142 Bacteria 1178
668 Ga0207698_10635663 3300026142 Bacteria 1056
669 Ga0209982_1012733 3300027552 Unclassified 1264
670 Ga0207428_10001077 3300027907 Bacteria 29791
671 Ga0268266_10038672 3300028379 Bacteria 4061
672 Ga0268266_10373176 3300028379 Unclassified 1344
673 Ga0268266_10652240 3300028379 Bacteria 1013
674 Ga0268265_10204101 3300028380 Bacteria 1717
675 Ga0268265_10287793 3300028380 Unclassified 1473
676 Ga0268264_10000063 3300028381 Bacteria 301702
677 Ga0268264_10002827 3300028381 Bacteria 15156
678 Ga0268264_10003689 3300028381 Bacteria 13138
679 Ga0268264_10006688 3300028381 Bacteria 9690
680 Ga0268264_10007051 3300028381 Bacteria 9425
681 Ga0268264_10008422 3300028381 Bacteria 8572
682 Ga0268264_10064841 3300028381 Bacteria 3075
683 Ga0268264_10084121 3300028381 Bacteria 2727
684 Ga0268264_10109516 3300028381 Bacteria 2417
685 Ga0268264_10171735 3300028381 Bacteria 1961
686 Ga0268264_10268391 3300028381 Bacteria 1593
687 Ga0268264_10741239 3300028381 Bacteria 978
688 Ga0307517_10000487 3300028786 Bacteria 68165
689 Ga0307517_10248707 3300028786 Bacteria 1046
690 Ga0307515_10000031 3300028794 Bacteria 358648
691 Ga0265324_10043530 3300029957 Bacteria 1549
692 Ga0307511_10000409 3300030521 Bacteria 45829
693 Ga0265327_10000361 3300031251 Bacteria 86574
694 Ga0265327_10002040 3300031251 Bacteria 22722
695 Ga0265327_10025120 3300031251 Bacteria 3481
696 Ga0265327_10045674 3300031251 Bacteria 2326
697 Ga0265327_10059461 3300031251 Bacteria 1957
698 Ga0265327_10073047 3300031251 Bacteria 1712
699 Ga0307513_10064018 3300031456 Bacteria 3878
700 Ga0307513_10106136 3300031456 Bacteria 2816
701 Ga0307513_10181570 3300031456 Bacteria 1967
702 Ga0307509_10029747 3300031507 Bacteria 6057
703 Ga0307509_10030741 3300031507 Bacteria 5937
704 Ga0307509_10097984 3300031507 Bacteria 2979
705 Ga0307509_10314268 3300031507 Bacteria 1307
706 Ga0307508_10001223 3300031616 Bacteria 29382
707 Ga0307412_10625761 3300031911 Bacteria 915
708 Ga0307414_10076475 3300032004 Bacteria 2433
709 Ga0307415_100294833 3300032126 Bacteria 1341
710 Ga0307507_10320594 3300033179 Bacteria 933
711 Ga0307510_10000336 3300033180 Bacteria 43815
712 Ga0373940_0012715 3300035088 Bacteria 2021
713 Ga0373952_0053528 3300035092 Bacteria 969
714 Ga0373932_0009426 3300035112 Bacteria 2348
715 Ga0373936_0051884 3300035113 Bacteria 1661
716 Ga0373943_0214058 3300035170 Bacteria 1071
717 Ga0373931_0348427 3300035691 Bacteria 927
718 Ga0373947_0140452 3300035725 Bacteria 1549
719 Ga0373925_0452009 3300037068 Bacteria 1052
720 Ga0395899_0089923 3300037312 Bacteria 2226
721 Ga0395899_0254323 3300037312 Bacteria 1204
722 Ga0395899_0304986 3300037312 Unclassified 1076
723 Ga0395899_0373142 3300037312 Bacteria 949
724 Ga0395900_0005734 3300037418 Bacteria 12981
725 Ga0395900_0008143 3300037418 Bacteria 10789
726 Ga0395900_0037400 3300037418 Bacteria 5005
727 Ga0395900_0120690 3300037418 Bacteria 2690
728 Ga0395900_0121931 3300037418 Bacteria 2674
729 Ga0395900_0461272 3300037418 Bacteria 1225
730 Ga0395898_0030880 3300037466 Bacteria 5359
731 Ga0395898_0094181 3300037466 Bacteria 2878
732 Ga0395898_0175600 3300037466 Bacteria 2047
733 Ga0395898_0221924 3300037466 Unclassified 1803
734 Ga0395905_0004944 3300037471 Bacteria 13731
735 Ga0395901_0020717 3300038443 Bacteria 6731
736 Ga0395901_0069764 3300038443 Bacteria 3660
737 Ga0395901_0535612 3300038443 Bacteria 1188
738 Ga0395901_0924696 3300038443 Bacteria 852
739 Ga0436365_0072673 3300039437 Bacteria 6638
740 Ga0439436_0001458 3300041404 Bacteria 6861
741 Ga0439439_0083060 3300041406 Bacteria 868
742 Ga0451798_1071503 3300041458 Bacteria 1028
743 Ga0451853_1545065 3300041512 Bacteria 978
744 Ga0439431_0001238 3300041997 Bacteria 5597
745 Ga0439445_0082182 3300042004 Bacteria 901
746 Ga0439449_0043975 3300042007 Bacteria 1657
747 Ga0439462_0010105 3300042015 Bacteria 2389
748 Ga0450894_010142 3300042131 Bacteria 1221
749 Ga0451577_0102058 3300042876 Bacteria 2563
750 Ga0466969_0000106 3300044656 Bacteria 44435
751 Ga0466972_0000001 3300044658 Bacteria 412457
752 Ga0466972_0000009 3300044658 Bacteria 256374
753 Ga0466972_0013745 3300044658 Bacteria 4063
754 Ga0453683_0378811 3300044673 Bacteria 911
755 Ga0466965_0152012 3300044683 Bacteria 1210
756 Ga0466966_0013873 3300044684 Bacteria 5333
757 Ga0466966_0219284 3300044684 Bacteria 1149
758 Ga0466961_0081762 3300044693 Bacteria 2044
759 Ga0466964_0052211 3300044706 Unclassified 1680
760 Ga0453684_0059693 3300044712 Bacteria 4914
761 Ga0453684_0667490 3300044712 Bacteria 1133
762 Ga0466971_0016757 3300044719 Bacteria 3236
763 Ga0466968_0003751 3300044735 Bacteria 5632
764 Ga0466970_0000065 3300044765 Bacteria 41709
765 Ga0466957_0018840 3300044842 Bacteria 4057
766 Ga0466957_0068514 3300044842 Bacteria 2191
767 Ga0466957_0154036 3300044842 Bacteria 1488
768 Ga0466959_0000003 3300045049 Bacteria 285164
769 Ga0466959_0000676 3300045049 Bacteria 19916
770 Ga0466959_0005241 3300045049 Bacteria 8848
771 Ga0466958_0002924 3300045836 Bacteria 8729
772 Ga0495580_0005114 3300046472 Bacteria 10913
773 Ga0495580_0271100 3300046472 Bacteria 1159
774 Ga0495606_0004941 3300046507 Bacteria 13036
775 Ga0495608_0336371 3300046511 Bacteria 931
776 Ga0495630_0003451 3300046517 Bacteria 10989
777 Ga0495648_0002648 3300046524 Bacteria 16239
778 Ga0495642_0070152 3300046528 Bacteria 1465
779 Ga0495587_0052848 3300046536 Bacteria 2396
780 Ga0495667_0136777 3300046559 Bacteria 1580
781 Ga0495668_0022644 3300046616 Bacteria 3590
782 Ga0495613_0114858 3300046689 Bacteria 1938
783 Ga0495649_0010201 3300046694 Bacteria 5550
784 Ga0495674_0085719 3300047319 Bacteria 2698
785 Ga0495676_0200965 3300047321 Bacteria 1385
786 Ga0495680_0121204 3300047322 Bacteria 1931
787 Ga0495687_001778 3300047443 Bacteria 19030
788 Ga0495686_0000010 3300047472 Bacteria 573229
789 Ga0496104_0245051 3300048907 Bacteria 1705
790 Ga0496104_0602399 3300048907 Unclassified 1009
791 Ga0496109_0097878 3300048912 Bacteria 2720
792 Ga0496110_0088733 3300048913 Bacteria 2763
793 Ga0496115_0284468 3300048918 Bacteria 1357
794 Ga0496124_0037486 3300048927 Bacteria 4216
795 Ga0501290_010528 3300049513 Bacteria 1184
796 Ga0501298_010684 3300049521 Bacteria 1584
797 Ga0501298_041262 3300049521 Bacteria 936
798 Ga0501300_014174 3300049523 Bacteria 1164
799 Ga0501032_0007076 3300049569 Bacteria 8225
800 Ga0501032_0288537 3300049569 Bacteria 1062
801 Ga0501033_0064223 3300049570 Bacteria 2702
802 Ga0501033_0149431 3300049570 Bacteria 1686
803 Ga0501034_0000152 3300049571 Bacteria 130576
804 Ga0501034_0008450 3300049571 Bacteria 10874
805 Ga0501034_0024790 3300049571 Bacteria 6103
806 Ga0501034_0031305 3300049571 Bacteria 5404
807 Ga0501034_0552084 3300049571 Bacteria 1061
808 Ga0501034_0562196 3300049571 Bacteria 1049
809 Ga0501036_0042178 3300049572 Bacteria 3863
810 Ga0501036_0322833 3300049572 Bacteria 1290
811 Ga0501036_0387965 3300049572 Bacteria 1165
812 Ga0501037_0006142 3300049573 Bacteria 8773
813 Ga0501038_0006185 3300049574 Bacteria 11070
814 Ga0501038_0009079 3300049574 Bacteria 9127
815 Ga0501038_0403250 3300049574 Bacteria 1058
816 Ga0501039_0080013 3300049575 Bacteria 2543
817 Ga0501041_0063233 3300049577 Bacteria 2266
818 Ga0501042_0044253 3300049578 Bacteria 3171
819 Ga0501043_0020054 3300049579 Bacteria 5247
820 Ga0501043_0165712 3300049579 Bacteria 1726
821 Ga0501043_0350530 3300049579 Bacteria 1122
822 Ga0501046_0011187 3300049580 Bacteria 7688
823 Ga0501046_0081279 3300049580 Bacteria 2503
824 Ga0501046_0165800 3300049580 Bacteria 1660
825 Ga0501047_0007979 3300049581 Bacteria 9983
826 Ga0501047_0009217 3300049581 Bacteria 9317
827 Ga0501047_0084821 3300049581 Bacteria 3044
828 Ga0501047_0200057 3300049581 Bacteria 1859
829 Ga0501047_0220913 3300049581 Bacteria 1751
830 Ga0501048_0026137 3300049582 Bacteria 4251
831 Ga0501068_0042014 3300049584 Bacteria 2749
832 Ga0501068_0259670 3300049584 Bacteria 1108
833 Ga0501069_0219812 3300049585 Bacteria 1104
834 Ga0501069_0239217 3300049585 Bacteria 1058
835 Ga0501070_0163857 3300049586 Bacteria 1832
836 Ga0501070_0189532 3300049586 Bacteria 1691
837 Ga0501071_0059108 3300049587 Bacteria 2773
838 Ga0501072_0006066 3300049588 Bacteria 9227
839 Ga0501073_0064375 3300049589 Bacteria 2557
840 Ga0501073_0086868 3300049589 Bacteria 2175
841 Ga0501074_0204295 3300049590 Bacteria 1408
842 Ga0501075_0002025 3300049591 Bacteria 13402
843 Ga0501076_0003428 3300049592 Bacteria 11127
844 Ga0501076_0100327 3300049592 Bacteria 2332
845 Ga0501198_009601 3300049649 Bacteria 1423
846 Ga0501206_000324 3300049653 Bacteria 5629
847 Ga0501207_012263 3300049654 Bacteria 1286
848 Ga0501217_015107 3300049661 Bacteria 1754
849 Ga0501223_011703 3300049663 Bacteria 1761
850 Ga0501224_000489 3300049664 Bacteria 4773
851 Ga0501233_032625 3300049668 Bacteria 1186
852 Ga0501242_002056 3300049674 Bacteria 2098
853 Ga0501242_005447 3300049674 Bacteria 1433
854 Ga0501243_000061 3300049675 Bacteria 10533
855 Ga0501243_003314 3300049675 Bacteria 2378
856 Ga0501243_003321 3300049675 Bacteria 2377
857 Ga0501252_010134 3300049682 Bacteria 1109
858 Ga0501253_001848 3300049683 Bacteria 2263
859 Ga0501257_003658 3300049686 Bacteria 3317
860 Ga0501259_051283 3300049688 Bacteria 838
861 Ga0501261_000633 3300049690 Bacteria 4460
862 Ga0501261_007819 3300049690 Bacteria 1375
863 Ga0501221_000225 3300049704 Bacteria 8102
864 Ga0501225_0000299 3300049705 Bacteria 15453
865 Ga0501225_0000690 3300049705 Bacteria 10562
866 Ga0501225_0083494 3300049705 Unclassified 919
867 Ga0501234_015115 3300049707 Bacteria 1214
868 Ga0501245_005175 3300049708 Bacteria 1805
869 Ga0501079_0007962 3300049741 Bacteria 8036
870 Ga0501079_0032533 3300049741 Bacteria 4010
871 Ga0501079_0032966 3300049741 Bacteria 3984
872 Ga0501080_0019380 3300049742 Bacteria 6303
873 Ga0501080_0283343 3300049742 Bacteria 1506
874 Ga0501080_0321796 3300049742 Bacteria 1400
875 Ga0501080_0553085 3300049742 Bacteria 1025
876 Ga0501081_0006803 3300049743 Bacteria 7435
877 Ga0501081_0123049 3300049743 Bacteria 1849
878 Ga0501083_0083919 3300049744 Bacteria 2109
879 Ga0501268_026199 3300049765 Bacteria 1029
880 Ga0501035_0018095 3300049822 Bacteria 6493
881 Ga0501035_0349642 3300049822 Bacteria 1237
882 Ga0501035_0581988 3300049822 Bacteria 914
883 Ga0501044_0005753 3300049823 Bacteria 13720
884 Ga0501044_0012344 3300049823 Bacteria 9248
885 Ga0501044_0033294 3300049823 Bacteria 5417
886 Ga0501044_0061055 3300049823 Bacteria 3857
887 Ga0501044_0139850 3300049823 Bacteria 2410
888 Ga0501044_0184441 3300049823 Bacteria 2052
889 Ga0501044_0187091 3300049823 Bacteria 2035
890 Ga0501044_0239934 3300049823 Bacteria 1757
891 Ga0501045_0150715 3300049824 Bacteria 1730
892 nmdc:mga0k408_38879_c1 3300050493 Bacteria 2732
893 nmdc:mga0k408_50943_c1 3300050493 Bacteria 2397
894 nmdc:mga05p37_467355_c1 3300050507 Bacteria 1456
895 nmdc:mga09592_152715_c1 3300050508 Bacteria 1993
896 nmdc:mga09592_289660_c1 3300050508 Bacteria 1420
897 nmdc:mga0qj67_10919_c2 3300050509 Bacteria 2210
898 nmdc:mga06r32_635193_c1 3300050510 Bacteria 1037
899 nmdc:mga08y16_774_c1 3300050511 Bacteria 30485
900 nmdc:mga08y16_810615_c1 3300050511 Bacteria 928
901 nmdc:mga08x19_212493_c1 3300050514 Unclassified 1328
902 Ga0500578_0001100 3300053086 Bacteria 29178
903 Ga0500578_0042281 3300053086 Bacteria 2927
904 Ga0500646_0019687 3300053090 Bacteria 1787
905 Ga0500583_0000178 3300053092 Bacteria 26108
906 Ga0500583_0000423 3300053092 Bacteria 13374
907 Ga0500583_0005597 3300053092 Bacteria 4230
908 Ga0500651_0199022 3300053093 Bacteria 1183
909 Ga0500650_0025566 3300053098 Bacteria 2641
910 Ga0500562_000024 3300053108 Bacteria 105996
911 Ga0500642_0080352 3300053130 Bacteria 1497
912 Ga0500658_0000784 3300053134 Bacteria 13145
913 Ga0500559_0115378 3300053136 Bacteria 1246
914 Ga0500577_0002983 3300053142 Bacteria 4362
915 Ga0500588_0012718 3300053146 Bacteria 2094
916 Ga0500589_015859 3300053147 Bacteria 3370
917 Ga0500589_033158 3300053147 Bacteria 2410
918 Ga0500616_0004239 3300053153 Bacteria 10316
919 Ga0500616_0004541 3300053153 Bacteria 9835
920 Ga0500616_0117772 3300053153 Bacteria 1273
921 Ga0500619_034445 3300053154 Bacteria 1565
922 Ga0500622_0000604 3300053156 Bacteria 32597
923 Ga0500622_0004624 3300053156 Bacteria 8541
924 Ga0500622_0006488 3300053156 Bacteria 6771
925 Ga0500637_0110281 3300053178 Bacteria 1596
926 Ga0501084_0009204 3300054114 Bacteria 8167
927 Ga0501084_0020525 3300054114 Bacteria 5511
928 Ga0501084_0021111 3300054114 Bacteria 5431
929 Ga0500661_022751 3300055283 Bacteria 1110
930 Ga0501082_0030525 3300060353 Bacteria 4645
931 Ga0501082_0082191 3300060353 Bacteria 2779
932 Ga0466962_0007361 3300061719 Bacteria 5283
933 Ga0530510_0164347 3300061734 Bacteria 1642
934 Ga0530510_0234677 3300061734 Bacteria 1365
935 Ga0466971_0094047
936 JGI24740J21852_10027924
937 JGI24744J21845_10011658
938 rootH2_10045629
939 rootL2_10007799
940 rootH1_10020501
941 rootH1_10091167
942 rootH1_10110187
943 rootH1_10233433
944 rootH1_10360310
945 JGI25160J50197_1001126
946 Ga0065704_10231174
947 Ga0065712_10151133
948 Ga0070658_10020879
949 Ga0070658_10120126
950 Ga0070658_10175107
951 Ga0070658_10245921
952 Ga0070658_10504616
953 Ga0070676_10005328
954 Ga0070676_10017475
955 Ga0070676_10065452
956 Ga0070683_100001753
957 Ga0070683_100008191
958 Ga0070683_100120864
959 Ga0070683_100222713
960 Ga0070683_100435638
961 Ga0070683_100444048
962 Ga0070690_100008288
963 Ga0070690_100012515
964 Ga0070690_100474639
965 Ga0070670_100024150
966 Ga0070670_100071294
967 Ga0068869_100002434
968 Ga0068869_100005896
969 Ga0068869_100045335
970 Ga0068869_100340827
971 Ga0070666_10000180
972 Ga0070666_10005857
973 Ga0070666_10011450
974 Ga0070666_10340487
975 Ga0070680_100000160
976 Ga0070680_100008618
977 Ga0070680_100028415
978 Ga0070680_100099186
979 Ga0070680_100309643
980 Ga0070682_100037628
981 Ga0070682_100048972
982 Ga0070682_100058138
983 Ga0068868_100007696
984 Ga0068868_100012050
985 Ga0068868_100038299
986 Ga0068868_100063905
987 Ga0068868_100109922
988 Ga0068868_100156479
989 Ga0070660_100111515
990 Ga0070689_100064413
991 Ga0070689_100382674
992 Ga0070691_10013373
993 Ga0070687_100221274
994 Ga0070661_100000673
995 Ga0070668_100117427
996 Ga0070668_100828070
997 Ga0070669_100016770
998 Ga0070669_100033590
999 Ga0070669_100288054
1000 Ga0070675_100015247
1001 Ga0070675_100049965
1002 Ga0070675_100424540
1003 Ga0070671_100048424
1004 Ga0070671_100085996
1005 Ga0070671_100091725
1006 Ga0070671_100133000
1007 Ga0070671_100305510
1008 Ga0070671_100700711
1009 Ga0070674_100006931
1010 Ga0070674_100177769
1011 Ga0070673_100011533
1012 Ga0070673_100012386
1013 Ga0070673_100015554
1014 Ga0070673_100071680
1015 Ga0070673_100076433
1016 Ga0070673_100195098
1017 Ga0070688_100002105
1018 Ga0070688_100017578
1019 Ga0070688_100028097
1020 Ga0070688_100049641
1021 Ga0070659_100007500
1022 Ga0070659_100043633
1023 Ga0070659_100366109
1024 Ga0070667_100011123
1025 Ga0070667_100078527
1026 Ga0070667_100096637
1027 Ga0070667_100765651
1028 Ga0070705_100343587
1029 Ga0070708_100284530
1030 Ga0070663_100031733
1031 Ga0070663_100194504
1032 Ga0070663_100408776
1033 Ga0070663_100514676
1034 Ga0070678_100002640
1035 Ga0070678_100217658
1036 Ga0070678_100640989
1037 Ga0070662_100025737
1038 Ga0070662_100036854
1039 Ga0070662_100037770
1040 Ga0070662_100302486
1041 Ga0070681_10010880
1042 Ga0070681_10012368
1043 Ga0070681_10060327
1044 Ga0070681_10183060
1045 Ga0068867_100032189
1046 Ga0068867_100036850
1047 Ga0068867_100042237
1048 Ga0068867_100075887
1049 Ga0068867_100078426
1050 Ga0068867_100186769
1051 Ga0068867_100548989
1052 Ga0070685_10220514
1053 Ga0070706_100108822
1054 Ga0070706_100385776
1055 Ga0070707_100019962
1056 Ga0070707_100045685
1057 Ga0070698_100100334
1058 Ga0070698_100212900
1059 Ga0070699_100097893
1060 Ga0070679_100000373
1061 Ga0070679_100002115
1062 Ga0070679_100008347
1063 Ga0070679_100017813
1064 Ga0070679_100072103
1065 Ga0070679_100099933
1066 Ga0070684_100000308
1067 Ga0070684_100001157
1068 Ga0070684_100074530
1069 Ga0070684_100444288
1070 Ga0070697_100347038
1071 Ga0070697_100471611
1072 Ga0070697_100719298
1073 Ga0068853_100000957
1074 Ga0068853_100006084
1075 Ga0068853_100031721
1076 Ga0068853_100066128
1077 Ga0068853_100080141
1078 Ga0068853_100101860
1079 Ga0068853_100109828
1080 Ga0068853_100172222
1081 Ga0068853_100223577
1082 Ga0068853_100309131
1083 Ga0070672_100031368
1084 Ga0070672_100035102
1085 Ga0070672_100050513
1086 Ga0070672_100083725
1087 Ga0070672_100131228
1088 Ga0070686_100012543
1089 Ga0070686_100088009
1090 Ga0070686_100129350
1091 Ga0070693_100026036
1092 Ga0070665_100006640
1093 Ga0070665_100009608
1094 Ga0070665_100097871
1095 Ga0070665_100571604
1096 Ga0068855_100002019
1097 Ga0068855_100023611
1098 Ga0068855_100032608
1099 Ga0068855_100046237
1100 Ga0068855_100048404
1101 Ga0068855_100048612
1102 Ga0068855_100080927
1103 Ga0068855_100259612
1104 Ga0070664_100000958
1105 Ga0070664_100015270
1106 Ga0070664_100021342
1107 Ga0070664_100231410
1108 Ga0070664_100240380
1109 Ga0070664_100249759
1110 Ga0070664_100656072
1111 Ga0068857_100001014
1112 Ga0068857_100002017
1113 Ga0068857_100029491
1114 Ga0068857_100100527
1115 Ga0068857_100156703
1116 Ga0068857_100239379
1117 Ga0068854_100022206
1118 Ga0068854_100059430
1119 Ga0068854_100067054
1120 Ga0068854_100082962
1121 Ga0068854_100092561
1122 Ga0068856_100008367
1123 Ga0068856_100031265
1124 Ga0068856_100063747
1125 Ga0068856_100077004
1126 Ga0068856_100190293
1127 Ga0068856_100238671
1128 Ga0068856_100300471
1129 Ga0070702_100135901
1130 Ga0068852_100000391
1131 Ga0068852_100002613
1132 Ga0068852_100009517
1133 Ga0068852_100027775
1134 Ga0068852_100050186
1135 Ga0068852_100052369
1136 Ga0068852_100067638
1137 Ga0068852_100129164
1138 Ga0068852_100365622
1139 Ga0068852_100471710
1140 Ga0068852_100725881
1141 Ga0068859_100000003
1142 Ga0068859_100026207
1143 Ga0068859_100032310
1144 Ga0068859_100054117
1145 Ga0068859_100076244
1146 Ga0068859_100483069
1147 Ga0068864_100003333
1148 Ga0068864_100063041
1149 Ga0068864_100089257
1150 Ga0068864_100242112
1151 Ga0068864_100309553
1152 Ga0068864_100311447
1153 Ga0068866_10011382
1154 Ga0068866_10024077
1155 Ga0068861_100098237
1156 Ga0068861_100375128
1157 Ga0068861_100750677
1158 Ga0068851_10093714
1159 Ga0068870_10015034
1160 Ga0068863_100005788
1161 Ga0068863_100012606
1162 Ga0068863_100016247
1163 Ga0068863_100213568
1164 Ga0068863_100426051
1165 Ga0068858_100026971
1166 Ga0068858_100201531
1167 Ga0068858_100229802
1168 Ga0068858_100302355
1169 Ga0068858_100514434
1170 Ga0068860_100000003
1171 Ga0068860_100002558
1172 Ga0068860_100003354
1173 Ga0068860_100003552
1174 Ga0068860_100006921
1175 Ga0068860_100018142
1176 Ga0068860_100026287
1177 Ga0068860_100048563
1178 Ga0068860_100098485
1179 Ga0068860_100109663
1180 Ga0068860_100320370
1181 Ga0068862_100015156
1182 Ga0068862_100027769
1183 Ga0068862_100047364
1184 Ga0068862_100522522
1185 Ga0081539_10000874
1186 Ga0081539_10013810
1187 Ga0070715_10031753
1188 Ga0070715_10078026
1189 Ga0070715_10164093
1190 Ga0070716_100551449
1191 Ga0075366_10017273
1192 Ga0097621_100023546
1193 Ga0097621_100127133
1194 Ga0097621_100425678
1195 Ga0097621_100469822
1196 Ga0068871_100013234
1197 Ga0068871_100050582
1198 Ga0068871_100548856
1199 Ga0068871_100708247
1200 Ga0075428_100056033
1201 Ga0075431_100003549
1202 Ga0075433_10050116
1203 Ga0075434_100652521
1204 Ga0075429_100114668
1205 Ga0075429_100242249
1206 Ga0075429_100335895
1207 Ga0068865_100001391
1208 Ga0068865_100150544
1209 Ga0068865_100739134
1210 Ga0075436_100240193
1211 Ga0097620_100000003
1212 Ga0097620_100026206
1213 Ga0097620_100032311
1214 Ga0097620_100054117
1215 Ga0097620_100076244
1216 Ga0097620_100483140
1217 Ga0075435_100041523
1218 Ga0075435_100146901
1219 Ga0099794_10006781
1220 Ga0105251_10059696
1221 Ga0105244_10000339
1222 Ga0105240_10000664
1223 Ga0105240_10003417
1224 Ga0105240_10005202
1225 Ga0105240_10007539
1226 Ga0105240_10013672
1227 Ga0105240_10028985
1228 Ga0105240_10030484
1229 Ga0105240_10080146
1230 Ga0105240_10730103
1231 Ga0111539_10001581
1232 Ga0111539_10235359
1233 Ga0105245_10032550
1234 Ga0105245_10106189
1235 Ga0105245_10885541
1236 Ga0105247_10002199
1237 Ga0105247_10241224
1238 Ga0114129_10544516
1239 Ga0105243_10234429
1240 Ga0105241_10000439
1241 Ga0105241_10003204
1242 Ga0105241_10008515
1243 Ga0105241_10009295
1244 Ga0105241_10091778
1245 Ga0105241_10145220
1246 Ga0105241_10975732
1247 Ga0105242_10126139
1248 Ga0105242_10200577
1249 Ga0105242_10220383
1250 Ga0105242_10343054
1251 Ga0105242_10377363
1252 Ga0105242_10509121
1253 Ga0105248_10693517
1254 Ga0105237_10000144
1255 Ga0105237_10001444
1256 Ga0105237_10001848
1257 Ga0105237_10006055
1258 Ga0105237_10006468
1259 Ga0105237_10006867
1260 Ga0105237_10011763
1261 Ga0105237_10030017
1262 Ga0105237_10058802
1263 Ga0105237_10127139
1264 Ga0105237_10867548
1265 Ga0105238_10001637
1266 Ga0105238_10123249
1267 Ga0105238_10383260
1268 Ga0105249_10022903
1269 Ga0105249_10025203
1270 Ga0105249_10136703
1271 Ga0105249_10292430
1272 Ga0105249_10382898
1273 Ga0105239_10000488
1274 Ga0105239_10001785
1275 Ga0105239_10003818
1276 Ga0105239_10008966
1277 Ga0105239_10033745
1278 Ga0105239_10047335
1279 Ga0105239_10053132
1280 Ga0105239_10057502
1281 Ga0105239_10061065
1282 Ga0105239_10552075
1283 Ga0105246_10019885
1284 Ga0105246_10340982
1285 Ga0157373_10019736
1286 Ga0157373_10020245
1287 Ga0157373_10035440
1288 Ga0157373_10065050
1289 Ga0157373_10105215
1290 Ga0157373_10129817
1291 Ga0157373_10234566
1292 Ga0157371_10002684
1293 Ga0157371_10011287
1294 Ga0157371_10014557
1295 Ga0157371_10021639
1296 Ga0157371_10039728
1297 Ga0157371_10040190
1298 Ga0157371_10045338
1299 Ga0157371_10048001
1300 Ga0157371_10072741
1301 Ga0157371_10109636
1302 Ga0157371_10239821
1303 Ga0157371_10244953
1304 Ga0157371_10255970
1305 Ga0157370_10001484
1306 Ga0157370_10001848
1307 Ga0157370_10006166
1308 Ga0157370_10008668
1309 Ga0157370_10367155
1310 Ga0157370_10540032
1311 Ga0157370_10544911
1312 Ga0157369_10026472
1313 Ga0157369_10031028
1314 Ga0157369_10078140
1315 Ga0157369_10202206
1316 Ga0157369_10318581
1317 Ga0157369_10433005
1318 Ga0157374_10031460
1319 Ga0157374_10035657
1320 Ga0157374_10048484
1321 Ga0157374_10119424
1322 Ga0157374_10150905
1323 Ga0157374_10364111
1324 Ga0157378_10003719
1325 Ga0157378_10005510
1326 Ga0157378_10016875
1327 Ga0157378_10053515
1328 Ga0157378_10108130
1329 Ga0157378_10168242
1330 Ga0157378_10238526
1331 Ga0157378_10494629
1332 Ga0163162_10001183
1333 Ga0163162_10002547
1334 Ga0163162_10003339
1335 Ga0163162_10024718
1336 Ga0163162_10107083
1337 Ga0163162_10107340
1338 Ga0163162_10162201
1339 Ga0163162_10297209
1340 Ga0163162_10880576
1341 Ga0157372_10000747
1342 Ga0157372_10002589
1343 Ga0157372_10010981
1344 Ga0157372_10019462
1345 Ga0157372_10032285
1346 Ga0157372_10038383
1347 Ga0157372_10039880
1348 Ga0157372_10047116
1349 Ga0157372_10049341
1350 Ga0157372_10076348
1351 Ga0157372_10084058
1352 Ga0157372_10085944
1353 Ga0157372_10090318
1354 Ga0157372_10131510
1355 Ga0157372_10137285
1356 Ga0157372_10152899
1357 Ga0157372_10187976
1358 Ga0157372_10353237
1359 Ga0157372_10371657
1360 Ga0157372_10411734
1361 Ga0157372_10532779
1362 Ga0157372_10624938
1363 Ga0157372_10648110
1364 Ga0157372_10739288
1365 Ga0157375_10192270
1366 Ga0157375_10430058
1367 Ga0157375_10445622
1368 Ga0157375_10682159
1369 Ga0157375_10693870
1370 Ga0163163_10001099
1371 Ga0163163_10189183
1372 Ga0163163_10222935
1373 Ga0157380_10360944
1374 Ga0157380_10384579
1375 Ga0157377_10004427
1376 Ga0157379_10027316
1377 Ga0157379_10102588
1378 Ga0157379_10441801
1379 Ga0157376_10008791
1380 Ga0157376_10014902
1381 Ga0157376_10024860
1382 Ga0157376_10027426
1383 Ga0157376_10126663
1384 Ga0157376_10539513
1385 Ga0163161_10021103
1386 Ga0163161_10040298
1387 Ga0163161_10127244
1388 Ga0213876_10079219
1389 Ga0209646_1007702
1390 Ga0207426_1000230
1391 Ga0207697_10105975
1392 Ga0207655_1000319
1393 Ga0207642_10145644
1394 Ga0207710_10004189
1395 Ga0207688_10177988
1396 Ga0207680_10000073
1397 Ga0207680_10133144
1398 Ga0207680_10140021
1399 Ga0207680_10218186
1400 Ga0207680_10305253
1401 Ga0207647_10131066
1402 Ga0207647_10208838
1403 Ga0207685_10029153
1404 Ga0207645_10001118
1405 Ga0207645_10001159
1406 Ga0207645_10112007
1407 Ga0207645_10175408
1408 Ga0207645_10258663
1409 Ga0207643_10049069
1410 Ga0207705_10012442
1411 Ga0207705_10053674
1412 Ga0207705_10103224
1413 Ga0207705_10182593
1414 Ga0207705_10252420
1415 Ga0207684_10304793
1416 Ga0207654_10007264
1417 Ga0207654_10008116
1418 Ga0207654_10015008
1419 Ga0207707_10004345
1420 Ga0207707_10082925
1421 Ga0207707_10118105
1422 Ga0207695_10009734
1423 Ga0207695_10020430
1424 Ga0207695_10035578
1425 Ga0207695_10062093
1426 Ga0207695_10066998
1427 Ga0207695_10097308
1428 Ga0207695_10205612
1429 Ga0207671_10000340
1430 Ga0207671_10001368
1431 Ga0207671_10001764
1432 Ga0207671_10004891
1433 Ga0207671_10006860
1434 Ga0207671_10057113
1435 Ga0207671_10080582
1436 Ga0207671_10083349
1437 Ga0207671_10443760
1438 Ga0207693_10006758
1439 Ga0207660_10032252
1440 Ga0207660_10230062
1441 Ga0207662_10076734
1442 Ga0207662_10175341
1443 Ga0207657_10029156
1444 Ga0207649_10000652
1445 Ga0207649_10051820
1446 Ga0207649_10072850
1447 Ga0207652_10002096
1448 Ga0207652_10003075
1449 Ga0207652_10036008
1450 Ga0207652_10068797
1451 Ga0207652_10129241
1452 Ga0207646_10119142
1453 Ga0207646_10119966
1454 Ga0207646_10120713
1455 Ga0207681_10133920
1456 Ga0207681_10185533
1457 Ga0207681_10207398
1458 Ga0207694_10002249
1459 Ga0207694_10208699
1460 Ga0207694_10264494
1461 Ga0207694_10275059
1462 Ga0207650_10117284
1463 Ga0207650_10553510
1464 Ga0207659_10009411
1465 Ga0207659_10078035
1466 Ga0207659_10206055
1467 Ga0207659_10438346
1468 Ga0207687_10102671
1469 Ga0207644_10186187
1470 Ga0207644_10196624
1471 Ga0207644_10414714
1472 Ga0207644_10514443
1473 Ga0207690_10011269
1474 Ga0207690_10088570
1475 Ga0207690_10351645
1476 Ga0207706_10013035
1477 Ga0207706_10049929
1478 Ga0207706_10102106
1479 Ga0207706_10257795
1480 Ga0207706_10310377
1481 Ga0207686_10039957
1482 Ga0207686_10079789
1483 Ga0207686_10179549
1484 Ga0207686_10255047
1485 Ga0207670_10056714
1486 Ga0207670_10353159
1487 Ga0207669_10013085
1488 Ga0207669_10391680
1489 Ga0207704_10331598
1490 Ga0207665_10249128
1491 Ga0207691_10027569
1492 Ga0207691_10029587
1493 Ga0207691_10043865
1494 Ga0207691_10050536
1495 Ga0207691_10053181
1496 Ga0207691_10290802
1497 Ga0207691_10324183
1498 Ga0207691_10337574
1499 Ga0207689_10000401
1500 Ga0207689_10002161
1501 Ga0207689_10007614
1502 Ga0207689_10028784
1503 Ga0207689_10246368
1504 Ga0207661_10000183
1505 Ga0207661_10171704
1506 Ga0207661_10268831
1507 Ga0207661_10354337
1508 Ga0207679_10000308
1509 Ga0207679_10001821
1510 Ga0207679_10093390
1511 Ga0207679_10780230
1512 Ga0207667_10001839
1513 Ga0207667_10027111
1514 Ga0207667_10027484
1515 Ga0207667_10044303
1516 Ga0207667_10048503
1517 Ga0207667_10049946
1518 Ga0207667_10071860
1519 Ga0207667_10208296
1520 Ga0207651_10079722
1521 Ga0207651_10165324
1522 Ga0207651_10181635
1523 Ga0207651_10242481
1524 Ga0207712_10015315
1525 Ga0207712_10043042
1526 Ga0207712_10474337
1527 Ga0207668_10081267
1528 Ga0207668_10115649
1529 Ga0207640_10027790
1530 Ga0207640_10028369
1531 Ga0207640_10102146
1532 Ga0207640_10378316
1533 Ga0207658_10018404
1534 Ga0207658_10039102
1535 Ga0207658_10794151
1536 Ga0207677_10078621
1537 Ga0207677_10087739
1538 Ga0207677_10095717
1539 Ga0207677_10137814
1540 Ga0207677_10162319
1541 Ga0207703_10005399
1542 Ga0207703_10160115
1543 Ga0207703_10289225
1544 Ga0207639_10000781
1545 Ga0207639_10031366
1546 Ga0207639_10055426
1547 Ga0207639_10077394
1548 Ga0207639_10080265
1549 Ga0207639_10081993
1550 Ga0207639_10105021
1551 Ga0207639_10348196
1552 Ga0207678_10198191
1553 Ga0207678_10251539
1554 Ga0207678_10673256
1555 Ga0207708_10063391
1556 Ga0207708_10084925
1557 Ga0207702_10046094
1558 Ga0207702_10063143
1559 Ga0207702_10150941
1560 Ga0207702_10187298
1561 Ga0207702_10804366
1562 Ga0207641_10000026
1563 Ga0207641_10052405
1564 Ga0207641_10107554
1565 Ga0207641_10112838
1566 Ga0207641_10120558
1567 Ga0207641_10894064
1568 Ga0207648_10006875
1569 Ga0207648_10010880
1570 Ga0207648_10032100
1571 Ga0207648_10044012
1572 Ga0207648_10079887
1573 Ga0207648_10098697
1574 Ga0207648_10215645
1575 Ga0207648_10301549
1576 Ga0207648_10575192
1577 Ga0207676_10004939
1578 Ga0207676_10012670
1579 Ga0207676_10073296
1580 Ga0207676_10136904
1581 Ga0207676_10284854
1582 Ga0207676_10516291
1583 Ga0207674_10001969
1584 Ga0207674_10002814
1585 Ga0207674_10035586
1586 Ga0207674_10091190
1587 Ga0207675_100081816
1588 Ga0207683_10001619
1589 Ga0207683_10040532
1590 Ga0207683_10072459
1591 Ga0207683_10489616
1592 Ga0207683_10629286
1593 Ga0207698_10000497
1594 Ga0207698_10007369
1595 Ga0207698_10012029
1596 Ga0207698_10022588
1597 Ga0207698_10113560
1598 Ga0207698_10136153
1599 Ga0207698_10145348
1600 Ga0207698_10266545
1601 Ga0207698_10503965
1602 Ga0207698_10635663
1603 Ga0209982_1012733
1604 Ga0207428_10001077
1605 Ga0268266_10038672
1606 Ga0268266_10373176
1607 Ga0268266_10652240
1608 Ga0268265_10204101
1609 Ga0268265_10287793
1610 Ga0268264_10000063
1611 Ga0268264_10002827
1612 Ga0268264_10003689
1613 Ga0268264_10006688
1614 Ga0268264_10007051
1615 Ga0268264_10008422
1616 Ga0268264_10064841
1617 Ga0268264_10084121
1618 Ga0268264_10109516
1619 Ga0268264_10171735
1620 Ga0268264_10268391
1621 Ga0268264_10741239
1622 Ga0307517_10000487
1623 Ga0307517_10248707
1624 Ga0307515_10000031
1625 Ga0265324_10043530
1626 Ga0307511_10000409
1627 Ga0265327_10000361
1628 Ga0265327_10002040
1629 Ga0265327_10025120
1630 Ga0265327_10045674
1631 Ga0265327_10059461
1632 Ga0265327_10073047
1633 Ga0307513_10064018
1634 Ga0307513_10106136
1635 Ga0307513_10181570
1636 Ga0307509_10029747
1637 Ga0307509_10030741
1638 Ga0307509_10097984
1639 Ga0307509_10314268
1640 Ga0307508_10001223
1641 Ga0307412_10625761
1642 Ga0307414_10076475
1643 Ga0307415_100294833
1644 Ga0307507_10320594
1645 Ga0307510_10000336
1646 Ga0373940_0012715
1647 Ga0373952_0053528
1648 Ga0373932_0009426
1649 Ga0373936_0051884
1650 Ga0373943_0214058
1651 Ga0373931_0348427
1652 Ga0373947_0140452
1653 Ga0373925_0452009
1654 Ga0395899_0089923
1655 Ga0395899_0254323
1656 Ga0395899_0304986
1657 Ga0395899_0373142
1658 Ga0395900_0005734
1659 Ga0395900_0008143
1660 Ga0395900_0037400
1661 Ga0395900_0120690
1662 Ga0395900_0121931
1663 Ga0395900_0461272
1664 Ga0395898_0030880
1665 Ga0395898_0094181
1666 Ga0395898_0175600
1667 Ga0395898_0221924
1668 Ga0395905_0004944
1669 Ga0395901_0020717
1670 Ga0395901_0069764
1671 Ga0395901_0535612
1672 Ga0395901_0924696
1673 Ga0436365_0072673
1674 Ga0439436_0001458
1675 Ga0439439_0083060
1676 Ga0451798_1071503
1677 Ga0451853_1545065
1678 Ga0439431_0001238
1679 Ga0439445_0082182
1680 Ga0439449_0043975
1681 Ga0439462_0010105
1682 Ga0450894_010142
1683 Ga0451577_0102058
1684 Ga0466969_0000106
1685 Ga0466972_0000001
1686 Ga0466972_0000009
1687 Ga0466972_0013745
1688 Ga0453683_0378811
1689 Ga0466965_0152012
1690 Ga0466966_0013873
1691 Ga0466966_0219284
1692 Ga0466961_0081762
1693 Ga0466964_0052211
1694 Ga0453684_0059693
1695 Ga0453684_0667490
1696 Ga0466971_0016757
1697 Ga0466968_0003751
1698 Ga0466970_0000065
1699 Ga0466957_0018840
1700 Ga0466957_0068514
1701 Ga0466957_0154036
1702 Ga0466959_0000003
1703 Ga0466959_0000676
1704 Ga0466959_0005241
1705 Ga0466958_0002924
1706 Ga0495580_0005114
1707 Ga0495580_0271100
1708 Ga0495606_0004941
1709 Ga0495608_0336371
1710 Ga0495630_0003451
1711 Ga0495648_0002648
1712 Ga0495642_0070152
1713 Ga0495587_0052848
1714 Ga0495667_0136777
1715 Ga0495668_0022644
1716 Ga0495613_0114858
1717 Ga0495649_0010201
1718 Ga0495674_0085719
1719 Ga0495676_0200965
1720 Ga0495680_0121204
1721 Ga0495687_001778
1722 Ga0495686_0000010
1723 Ga0496104_0245051
1724 Ga0496104_0602399
1725 Ga0496109_0097878
1726 Ga0496110_0088733
1727 Ga0496115_0284468
1728 Ga0496124_0037486
1729 Ga0501290_010528
1730 Ga0501298_010684
1731 Ga0501298_041262
1732 Ga0501300_014174
1733 Ga0501032_0007076
1734 Ga0501032_0288537
1735 Ga0501033_0064223
1736 Ga0501033_0149431
1737 Ga0501034_0000152
1738 Ga0501034_0008450
1739 Ga0501034_0024790
1740 Ga0501034_0031305
1741 Ga0501034_0552084
1742 Ga0501034_0562196
1743 Ga0501036_0042178
1744 Ga0501036_0322833
1745 Ga0501036_0387965
1746 Ga0501037_0006142
1747 Ga0501038_0006185
1748 Ga0501038_0009079
1749 Ga0501038_0403250
1750 Ga0501039_0080013
1751 Ga0501041_0063233
1752 Ga0501042_0044253
1753 Ga0501043_0020054
1754 Ga0501043_0165712
1755 Ga0501043_0350530
1756 Ga0501046_0011187
1757 Ga0501046_0081279
1758 Ga0501046_0165800
1759 Ga0501047_0007979
1760 Ga0501047_0009217
1761 Ga0501047_0084821
1762 Ga0501047_0200057
1763 Ga0501047_0220913
1764 Ga0501048_0026137
1765 Ga0501068_0042014
1766 Ga0501068_0259670
1767 Ga0501069_0219812
1768 Ga0501069_0239217
1769 Ga0501070_0163857
1770 Ga0501070_0189532
1771 Ga0501071_0059108
1772 Ga0501072_0006066
1773 Ga0501073_0064375
1774 Ga0501073_0086868
1775 Ga0501074_0204295
1776 Ga0501075_0002025
1777 Ga0501076_0003428
1778 Ga0501076_0100327
1779 Ga0501198_009601
1780 Ga0501206_000324
1781 Ga0501207_012263
1782 Ga0501217_015107
1783 Ga0501223_011703
1784 Ga0501224_000489
1785 Ga0501233_032625
1786 Ga0501242_002056
1787 Ga0501242_005447
1788 Ga0501243_000061
1789 Ga0501243_003314
1790 Ga0501243_003321
1791 Ga0501252_010134
1792 Ga0501253_001848
1793 Ga0501257_003658
1794 Ga0501259_051283
1795 Ga0501261_000633
1796 Ga0501261_007819
1797 Ga0501221_000225
1798 Ga0501225_0000299
1799 Ga0501225_0000690
1800 Ga0501225_0083494
1801 Ga0501234_015115
1802 Ga0501245_005175
1803 Ga0501079_0007962
1804 Ga0501079_0032533
1805 Ga0501079_0032966
1806 Ga0501080_0019380
1807 Ga0501080_0283343
1808 Ga0501080_0321796
1809 Ga0501080_0553085
1810 Ga0501081_0006803
1811 Ga0501081_0123049
1812 Ga0501083_0083919
1813 Ga0501268_026199
1814 Ga0501035_0018095
1815 Ga0501035_0349642
1816 Ga0501035_0581988
1817 Ga0501044_0005753
1818 Ga0501044_0012344
1819 Ga0501044_0033294
1820 Ga0501044_0061055
1821 Ga0501044_0139850
1822 Ga0501044_0184441
1823 Ga0501044_0187091
1824 Ga0501044_0239934
1825 Ga0501045_0150715
1826 nmdc:mga0k408_38879_c1
1827 nmdc:mga0k408_50943_c1
1828 nmdc:mga05p37_467355_c1
1829 nmdc:mga09592_152715_c1
1830 nmdc:mga09592_289660_c1
1831 nmdc:mga0qj67_10919_c2
1832 nmdc:mga06r32_635193_c1
1833 nmdc:mga08y16_774_c1
1834 nmdc:mga08y16_810615_c1
1835 nmdc:mga08x19_212493_c1
1836 Ga0500578_0001100
1837 Ga0500578_0042281
1838 Ga0500646_0019687
1839 Ga0500583_0000178
1840 Ga0500583_0000423
1841 Ga0500583_0005597
1842 Ga0500651_0199022
1843 Ga0500650_0025566
1844 Ga0500562_000024
1845 Ga0500642_0080352
1846 Ga0500658_0000784
1847 Ga0500559_0115378
1848 Ga0500577_0002983
1849 Ga0500588_0012718
1850 Ga0500589_015859
1851 Ga0500589_033158
1852 Ga0500616_0004239
1853 Ga0500616_0004541
1854 Ga0500616_0117772
1855 Ga0500619_034445
1856 Ga0500622_0000604
1857 Ga0500622_0004624
1858 Ga0500622_0006488
1859 Ga0500637_0110281
1860 Ga0501084_0009204
1861 Ga0501084_0020525
1862 Ga0501084_0021111
1863 Ga0500661_022751
1864 Ga0501082_0030525
1865 Ga0501082_0082191
1866 Ga0466962_0007361
1867 Ga0530510_0164347
1868 Ga0530510_0234677

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

66

263

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

72

309

0.94

PF08659

KR

KR domain

67

251

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jro-assembly1.cif.gz_D crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.9896 3 251
4jro-assembly1.cif.gz_B crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.9884 3 251
4jro-assembly1.cif.gz_C crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.9876 3 251
8jfa-assembly1.cif.gz_C crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadph from helicobacter pylori 0.9861 7 251
4iin-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from helicobacter pylori 26695 complexed with nad+ 0.9839 7 251
ID Description Score Start End Superfamily
4iinB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9839 7 251 3.40.50.720
af_Q54N15_5_159_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9824 63 182 3.40.50.720
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9686 4 249 3.40.50.720
4weoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9662 4 251 3.40.50.720
4cqmK00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9658 7 249 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3C0R9Z9-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 1 1 251 GO:0004316
GO:0006633
GO:0051287
AF-A0A2M9CSI1-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9969 1 251 GO:0004316
GO:0006633
GO:0051287
AF-A0A7V8VZS3-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9967 1 251 GO:0004316
GO:0006633
GO:0051287
AF-A0A3B9C073-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9953 1 251 GO:0004316
GO:0006633
GO:0051287
AF-A0A7X9KRV3-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9932 1 165

Map