F486132
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 934 | 334 | 1868 | 251 |
Family's Representative Sequence
| Representative Sequence | 3300044719|Ga0466971_0094047|Ga0466971_0094047_375_1307 |
| Length | 310 |
| Sequence | MYTEVMSTSKLKSISVSRLLVNPVGSKSIFVFIRIYLWRKNLSVAKDLFLYFCSPKIDTMKLLEGKIAIVTGAARGIGEAIAYKLAEHGAHVAFTYVSDSSAEKATQLEEKIKALGVKSKAYKSNAGNFAECETFVNDVIKEFGTVDVCVNNAGISKDNLLLRLTPEQWDEVMTVNLKSVYNMTKQIIRPMMKAKKGSIINMSSIIGERGNAGQSSYAASKAGIIGFTKSVAHELGSRNIRCNAIAPGFIETDMTQYLKDGDSAKAFLEKIPLGRFGKSEEIANTTLFLASDLSSYITGQVISACGGLNI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 87 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 120 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 186 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 187 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 189 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 190 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 191 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 192 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 195 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 196 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 197 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 198 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 200 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 202 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 205 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 207 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 208 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 209 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 210 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 211 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 212 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 213 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 214 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 216 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 217 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 218 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 219 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 220 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 221 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 222 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 223 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 224 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 225 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 226 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 227 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 228 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 229 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 230 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 231 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 232 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 233 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 234 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 235 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 254 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 255 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 256 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 257 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 258 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 259 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 282 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 283 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 284 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 285 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 286 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 287 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 288 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 289 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 290 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 291 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 292 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 293 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 294 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 295 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 296 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 297 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 298 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 299 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 304 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 308 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 315 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 316 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 317 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 318 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 319 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 320 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 321 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 322 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 323 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 324 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 325 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 326 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 327 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 328 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 329 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 330 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 332 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 334 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.21 |
| Nodule | 0 |
| Rhizoplane | 0.64 |
| Rhizosphere | 93.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466971_0094047 | 3300044719 | Bacteria | 1374 |
| 2 | JGI24740J21852_10027924 | 3300001979 | Unclassified | 1871 |
| 3 | JGI24744J21845_10011658 | 3300002077 | Bacteria | 1795 |
| 4 | rootH2_10045629 | 3300003320 | Bacteria | 6173 |
| 5 | rootL2_10007799 | 3300003322 | Bacteria | 6721 |
| 6 | rootH1_10020501 | 3300003323 | Bacteria | 26877 |
| 7 | rootH1_10091167 | 3300003323 | Bacteria | 3824 |
| 8 | rootH1_10110187 | 3300003323 | Bacteria | 3817 |
| 9 | rootH1_10233433 | 3300003323 | Bacteria | 4817 |
| 10 | rootH1_10360310 | 3300003323 | Bacteria | 2992 |
| 11 | JGI25160J50197_1001126 | 3300003354 | Bacteria | 13660 |
| 12 | Ga0065704_10231174 | 3300005289 | Bacteria | 1042 |
| 13 | Ga0065712_10151133 | 3300005290 | Bacteria | 1367 |
| 14 | Ga0070658_10020879 | 3300005327 | Bacteria | 5246 |
| 15 | Ga0070658_10120126 | 3300005327 | Unclassified | 2183 |
| 16 | Ga0070658_10175107 | 3300005327 | Bacteria | 1804 |
| 17 | Ga0070658_10245921 | 3300005327 | Bacteria | 1517 |
| 18 | Ga0070658_10504616 | 3300005327 | Bacteria | 1045 |
| 19 | Ga0070676_10005328 | 3300005328 | Bacteria | 6846 |
| 20 | Ga0070676_10017475 | 3300005328 | Bacteria | 3970 |
| 21 | Ga0070676_10065452 | 3300005328 | Bacteria | 2170 |
| 22 | Ga0070683_100001753 | 3300005329 | Bacteria | 16903 |
| 23 | Ga0070683_100008191 | 3300005329 | Bacteria | 8878 |
| 24 | Ga0070683_100120864 | 3300005329 | Unclassified | 2474 |
| 25 | Ga0070683_100222713 | 3300005329 | Bacteria | 1793 |
| 26 | Ga0070683_100435638 | 3300005329 | Unclassified | 1251 |
| 27 | Ga0070683_100444048 | 3300005329 | Bacteria | 1238 |
| 28 | Ga0070690_100008288 | 3300005330 | Bacteria | 5977 |
| 29 | Ga0070690_100012515 | 3300005330 | Bacteria | 4993 |
| 30 | Ga0070690_100474639 | 3300005330 | Bacteria | 931 |
| 31 | Ga0070670_100024150 | 3300005331 | Bacteria | 5230 |
| 32 | Ga0070670_100071294 | 3300005331 | Bacteria | 2983 |
| 33 | Ga0068869_100002434 | 3300005334 | Bacteria | 11222 |
| 34 | Ga0068869_100005896 | 3300005334 | Bacteria | 7736 |
| 35 | Ga0068869_100045335 | 3300005334 | Bacteria | 3165 |
| 36 | Ga0068869_100340827 | 3300005334 | Bacteria | 1220 |
| 37 | Ga0070666_10000180 | 3300005335 | Bacteria | 43265 |
| 38 | Ga0070666_10005857 | 3300005335 | Bacteria | 7551 |
| 39 | Ga0070666_10011450 | 3300005335 | Bacteria | 5567 |
| 40 | Ga0070666_10340487 | 3300005335 | Unclassified | 1072 |
| 41 | Ga0070680_100000160 | 3300005336 | Bacteria | 42287 |
| 42 | Ga0070680_100008618 | 3300005336 | Bacteria | 7816 |
| 43 | Ga0070680_100028415 | 3300005336 | Bacteria | 4485 |
| 44 | Ga0070680_100099186 | 3300005336 | Bacteria | 2417 |
| 45 | Ga0070680_100309643 | 3300005336 | Bacteria | 1340 |
| 46 | Ga0070682_100037628 | 3300005337 | Bacteria | 2964 |
| 47 | Ga0070682_100048972 | 3300005337 | Bacteria | 2633 |
| 48 | Ga0070682_100058138 | 3300005337 | Bacteria | 2438 |
| 49 | Ga0068868_100007696 | 3300005338 | Bacteria | 7683 |
| 50 | Ga0068868_100012050 | 3300005338 | Bacteria | 6313 |
| 51 | Ga0068868_100038299 | 3300005338 | Bacteria | 3722 |
| 52 | Ga0068868_100063905 | 3300005338 | Bacteria | 2920 |
| 53 | Ga0068868_100109922 | 3300005338 | Bacteria | 2239 |
| 54 | Ga0068868_100156479 | 3300005338 | Bacteria | 1880 |
| 55 | Ga0070660_100111515 | 3300005339 | Bacteria | 2177 |
| 56 | Ga0070689_100064413 | 3300005340 | Bacteria | 2853 |
| 57 | Ga0070689_100382674 | 3300005340 | Bacteria | 1186 |
| 58 | Ga0070691_10013373 | 3300005341 | Bacteria | 3759 |
| 59 | Ga0070687_100221274 | 3300005343 | Bacteria | 1159 |
| 60 | Ga0070661_100000673 | 3300005344 | Bacteria | 25107 |
| 61 | Ga0070668_100117427 | 3300005347 | Bacteria | 2122 |
| 62 | Ga0070668_100828070 | 3300005347 | Bacteria | 824 |
| 63 | Ga0070669_100016770 | 3300005353 | Bacteria | 5227 |
| 64 | Ga0070669_100033590 | 3300005353 | Bacteria | 3711 |
| 65 | Ga0070669_100288054 | 3300005353 | Bacteria | 1318 |
| 66 | Ga0070675_100015247 | 3300005354 | Bacteria | 6071 |
| 67 | Ga0070675_100049965 | 3300005354 | Bacteria | 3433 |
| 68 | Ga0070675_100424540 | 3300005354 | Bacteria | 1189 |
| 69 | Ga0070671_100048424 | 3300005355 | Bacteria | 3534 |
| 70 | Ga0070671_100085996 | 3300005355 | Bacteria | 2631 |
| 71 | Ga0070671_100091725 | 3300005355 | Bacteria | 2545 |
| 72 | Ga0070671_100133000 | 3300005355 | Bacteria | 2095 |
| 73 | Ga0070671_100305510 | 3300005355 | Bacteria | 1354 |
| 74 | Ga0070671_100700711 | 3300005355 | Bacteria | 878 |
| 75 | Ga0070674_100006931 | 3300005356 | Bacteria | 6645 |
| 76 | Ga0070674_100177769 | 3300005356 | Bacteria | 1627 |
| 77 | Ga0070673_100011533 | 3300005364 | Bacteria | 6036 |
| 78 | Ga0070673_100012386 | 3300005364 | Bacteria | 5853 |
| 79 | Ga0070673_100015554 | 3300005364 | Bacteria | 5349 |
| 80 | Ga0070673_100071680 | 3300005364 | Bacteria | 2785 |
| 81 | Ga0070673_100076433 | 3300005364 | Bacteria | 2704 |
| 82 | Ga0070673_100195098 | 3300005364 | Unclassified | 1741 |
| 83 | Ga0070688_100002105 | 3300005365 | Bacteria | 10044 |
| 84 | Ga0070688_100017578 | 3300005365 | Bacteria | 4106 |
| 85 | Ga0070688_100028097 | 3300005365 | Bacteria | 3355 |
| 86 | Ga0070688_100049641 | 3300005365 | Bacteria | 2612 |
| 87 | Ga0070659_100007500 | 3300005366 | Bacteria | 7926 |
| 88 | Ga0070659_100043633 | 3300005366 | Bacteria | 3507 |
| 89 | Ga0070659_100366109 | 3300005366 | Unclassified | 1212 |
| 90 | Ga0070667_100011123 | 3300005367 | Bacteria | 7444 |
| 91 | Ga0070667_100078527 | 3300005367 | Bacteria | 2820 |
| 92 | Ga0070667_100096637 | 3300005367 | Bacteria | 2548 |
| 93 | Ga0070667_100765651 | 3300005367 | Bacteria | 895 |
| 94 | Ga0070705_100343587 | 3300005440 | Bacteria | 1086 |
| 95 | Ga0070708_100284530 | 3300005445 | Bacteria | 1556 |
| 96 | Ga0070663_100031733 | 3300005455 | Bacteria | 3634 |
| 97 | Ga0070663_100194504 | 3300005455 | Bacteria | 1580 |
| 98 | Ga0070663_100408776 | 3300005455 | Bacteria | 1111 |
| 99 | Ga0070663_100514676 | 3300005455 | Bacteria | 996 |
| 100 | Ga0070678_100002640 | 3300005456 | Bacteria | 9871 |
| 101 | Ga0070678_100217658 | 3300005456 | Bacteria | 1586 |
| 102 | Ga0070678_100640989 | 3300005456 | Unclassified | 952 |
| 103 | Ga0070662_100025737 | 3300005457 | Bacteria | 4067 |
| 104 | Ga0070662_100036854 | 3300005457 | Bacteria | 3463 |
| 105 | Ga0070662_100037770 | 3300005457 | Bacteria | 3425 |
| 106 | Ga0070662_100302486 | 3300005457 | Bacteria | 1300 |
| 107 | Ga0070681_10010880 | 3300005458 | Bacteria | 8994 |
| 108 | Ga0070681_10012368 | 3300005458 | Bacteria | 8463 |
| 109 | Ga0070681_10060327 | 3300005458 | Bacteria | 3770 |
| 110 | Ga0070681_10183060 | 3300005458 | Bacteria | 2016 |
| 111 | Ga0068867_100032189 | 3300005459 | Bacteria | 3791 |
| 112 | Ga0068867_100036850 | 3300005459 | Bacteria | 3553 |
| 113 | Ga0068867_100042237 | 3300005459 | Bacteria | 3335 |
| 114 | Ga0068867_100075887 | 3300005459 | Bacteria | 2523 |
| 115 | Ga0068867_100078426 | 3300005459 | Bacteria | 2484 |
| 116 | Ga0068867_100186769 | 3300005459 | Bacteria | 1651 |
| 117 | Ga0068867_100548989 | 3300005459 | Bacteria | 1001 |
| 118 | Ga0070685_10220514 | 3300005466 | Bacteria | 1242 |
| 119 | Ga0070706_100108822 | 3300005467 | Bacteria | 2579 |
| 120 | Ga0070706_100385776 | 3300005467 | Bacteria | 1304 |
| 121 | Ga0070707_100019962 | 3300005468 | Bacteria | 6317 |
| 122 | Ga0070707_100045685 | 3300005468 | Bacteria | 4191 |
| 123 | Ga0070698_100100334 | 3300005471 | Bacteria | 2867 |
| 124 | Ga0070698_100212900 | 3300005471 | Bacteria | 1867 |
| 125 | Ga0070699_100097893 | 3300005518 | Bacteria | 2570 |
| 126 | Ga0070679_100000373 | 3300005530 | Bacteria | 38042 |
| 127 | Ga0070679_100002115 | 3300005530 | Bacteria | 17887 |
| 128 | Ga0070679_100008347 | 3300005530 | Bacteria | 9745 |
| 129 | Ga0070679_100017813 | 3300005530 | Bacteria | 6879 |
| 130 | Ga0070679_100072103 | 3300005530 | Bacteria | 3445 |
| 131 | Ga0070679_100099933 | 3300005530 | Bacteria | 2888 |
| 132 | Ga0070684_100000308 | 3300005535 | Bacteria | 33720 |
| 133 | Ga0070684_100001157 | 3300005535 | Bacteria | 18949 |
| 134 | Ga0070684_100074530 | 3300005535 | Bacteria | 2992 |
| 135 | Ga0070684_100444288 | 3300005535 | Bacteria | 1198 |
| 136 | Ga0070697_100347038 | 3300005536 | Bacteria | 1281 |
| 137 | Ga0070697_100471611 | 3300005536 | Bacteria | 1095 |
| 138 | Ga0070697_100719298 | 3300005536 | Bacteria | 881 |
| 139 | Ga0068853_100000957 | 3300005539 | Bacteria | 20289 |
| 140 | Ga0068853_100006084 | 3300005539 | Bacteria | 9553 |
| 141 | Ga0068853_100031721 | 3300005539 | Bacteria | 4470 |
| 142 | Ga0068853_100066128 | 3300005539 | Bacteria | 3139 |
| 143 | Ga0068853_100080141 | 3300005539 | Bacteria | 2856 |
| 144 | Ga0068853_100101860 | 3300005539 | Bacteria | 2540 |
| 145 | Ga0068853_100109828 | 3300005539 | Unclassified | 2448 |
| 146 | Ga0068853_100172222 | 3300005539 | Bacteria | 1959 |
| 147 | Ga0068853_100223577 | 3300005539 | Bacteria | 1720 |
| 148 | Ga0068853_100309131 | 3300005539 | Bacteria | 1463 |
| 149 | Ga0070672_100031368 | 3300005543 | Bacteria | 3999 |
| 150 | Ga0070672_100035102 | 3300005543 | Bacteria | 3809 |
| 151 | Ga0070672_100050513 | 3300005543 | Unclassified | 3239 |
| 152 | Ga0070672_100083725 | 3300005543 | Bacteria | 2560 |
| 153 | Ga0070672_100131228 | 3300005543 | Bacteria | 2059 |
| 154 | Ga0070686_100012543 | 3300005544 | Bacteria | 4829 |
| 155 | Ga0070686_100088009 | 3300005544 | Bacteria | 2072 |
| 156 | Ga0070686_100129350 | 3300005544 | Bacteria | 1744 |
| 157 | Ga0070693_100026036 | 3300005547 | Bacteria | 3154 |
| 158 | Ga0070665_100006640 | 3300005548 | Bacteria | 11761 |
| 159 | Ga0070665_100009608 | 3300005548 | Bacteria | 9784 |
| 160 | Ga0070665_100097871 | 3300005548 | Bacteria | 2939 |
| 161 | Ga0070665_100571604 | 3300005548 | Bacteria | 1143 |
| 162 | Ga0068855_100002019 | 3300005563 | Bacteria | 25173 |
| 163 | Ga0068855_100023611 | 3300005563 | Bacteria | 7365 |
| 164 | Ga0068855_100032608 | 3300005563 | Bacteria | 6218 |
| 165 | Ga0068855_100046237 | 3300005563 | Bacteria | 5145 |
| 166 | Ga0068855_100048404 | 3300005563 | Bacteria | 5017 |
| 167 | Ga0068855_100048612 | 3300005563 | Bacteria | 5005 |
| 168 | Ga0068855_100080927 | 3300005563 | Bacteria | 3766 |
| 169 | Ga0068855_100259612 | 3300005563 | Bacteria | 1936 |
| 170 | Ga0070664_100000958 | 3300005564 | Bacteria | 22561 |
| 171 | Ga0070664_100015270 | 3300005564 | Bacteria | 6277 |
| 172 | Ga0070664_100021342 | 3300005564 | Bacteria | 5336 |
| 173 | Ga0070664_100231410 | 3300005564 | Bacteria | 1657 |
| 174 | Ga0070664_100240380 | 3300005564 | Unclassified | 1625 |
| 175 | Ga0070664_100249759 | 3300005564 | Bacteria | 1594 |
| 176 | Ga0070664_100656072 | 3300005564 | Unclassified | 975 |
| 177 | Ga0068857_100001014 | 3300005577 | Bacteria | 21648 |
| 178 | Ga0068857_100002017 | 3300005577 | Bacteria | 16457 |
| 179 | Ga0068857_100029491 | 3300005577 | Bacteria | 4841 |
| 180 | Ga0068857_100100527 | 3300005577 | Bacteria | 2594 |
| 181 | Ga0068857_100156703 | 3300005577 | Bacteria | 2065 |
| 182 | Ga0068857_100239379 | 3300005577 | Bacteria | 1661 |
| 183 | Ga0068854_100022206 | 3300005578 | Bacteria | 4319 |
| 184 | Ga0068854_100059430 | 3300005578 | Bacteria | 2763 |
| 185 | Ga0068854_100067054 | 3300005578 | Bacteria | 2613 |
| 186 | Ga0068854_100082962 | 3300005578 | Bacteria | 2370 |
| 187 | Ga0068854_100092561 | 3300005578 | Bacteria | 2252 |
| 188 | Ga0068856_100008367 | 3300005614 | Bacteria | 10081 |
| 189 | Ga0068856_100031265 | 3300005614 | Bacteria | 5208 |
| 190 | Ga0068856_100063747 | 3300005614 | Bacteria | 3641 |
| 191 | Ga0068856_100077004 | 3300005614 | Bacteria | 3304 |
| 192 | Ga0068856_100190293 | 3300005614 | Bacteria | 2066 |
| 193 | Ga0068856_100238671 | 3300005614 | Bacteria | 1833 |
| 194 | Ga0068856_100300471 | 3300005614 | Bacteria | 1623 |
| 195 | Ga0070702_100135901 | 3300005615 | Bacteria | 1560 |
| 196 | Ga0068852_100000391 | 3300005616 | Bacteria | 29415 |
| 197 | Ga0068852_100002613 | 3300005616 | Bacteria | 12447 |
| 198 | Ga0068852_100009517 | 3300005616 | Bacteria | 7220 |
| 199 | Ga0068852_100027775 | 3300005616 | Bacteria | 4618 |
| 200 | Ga0068852_100050186 | 3300005616 | Bacteria | 3574 |
| 201 | Ga0068852_100052369 | 3300005616 | Bacteria | 3508 |
| 202 | Ga0068852_100067638 | 3300005616 | Bacteria | 3124 |
| 203 | Ga0068852_100129164 | 3300005616 | Bacteria | 2325 |
| 204 | Ga0068852_100365622 | 3300005616 | Bacteria | 1412 |
| 205 | Ga0068852_100471710 | 3300005616 | Bacteria | 1246 |
| 206 | Ga0068852_100725881 | 3300005616 | Bacteria | 1005 |
| 207 | Ga0068859_100000003 | 3300005617 | Bacteria | 479218 |
| 208 | Ga0068859_100026207 | 3300005617 | Bacteria | 5847 |
| 209 | Ga0068859_100032310 | 3300005617 | Bacteria | 5257 |
| 210 | Ga0068859_100054117 | 3300005617 | Bacteria | 4036 |
| 211 | Ga0068859_100076244 | 3300005617 | Bacteria | 3393 |
| 212 | Ga0068859_100483069 | 3300005617 | Bacteria | 1334 |
| 213 | Ga0068864_100003333 | 3300005618 | Bacteria | 13277 |
| 214 | Ga0068864_100063041 | 3300005618 | Bacteria | 3212 |
| 215 | Ga0068864_100089257 | 3300005618 | Bacteria | 2716 |
| 216 | Ga0068864_100242112 | 3300005618 | Bacteria | 1672 |
| 217 | Ga0068864_100309553 | 3300005618 | Bacteria | 1481 |
| 218 | Ga0068864_100311447 | 3300005618 | Bacteria | 1476 |
| 219 | Ga0068866_10011382 | 3300005718 | Bacteria | 3847 |
| 220 | Ga0068866_10024077 | 3300005718 | Bacteria | 2840 |
| 221 | Ga0068861_100098237 | 3300005719 | Bacteria | 2324 |
| 222 | Ga0068861_100375128 | 3300005719 | Unclassified | 1255 |
| 223 | Ga0068861_100750677 | 3300005719 | Bacteria | 911 |
| 224 | Ga0068851_10093714 | 3300005834 | Bacteria | 1585 |
| 225 | Ga0068870_10015034 | 3300005840 | Bacteria | 3666 |
| 226 | Ga0068863_100005788 | 3300005841 | Bacteria | 12118 |
| 227 | Ga0068863_100012606 | 3300005841 | Bacteria | 8154 |
| 228 | Ga0068863_100016247 | 3300005841 | Bacteria | 7141 |
| 229 | Ga0068863_100213568 | 3300005841 | Bacteria | 1858 |
| 230 | Ga0068863_100426051 | 3300005841 | Unclassified | 1300 |
| 231 | Ga0068858_100026971 | 3300005842 | Bacteria | 5336 |
| 232 | Ga0068858_100201531 | 3300005842 | Bacteria | 1882 |
| 233 | Ga0068858_100229802 | 3300005842 | Bacteria | 1759 |
| 234 | Ga0068858_100302355 | 3300005842 | Bacteria | 1526 |
| 235 | Ga0068858_100514434 | 3300005842 | Bacteria | 1157 |
| 236 | Ga0068860_100000003 | 3300005843 | Bacteria | 575741 |
| 237 | Ga0068860_100002558 | 3300005843 | Bacteria | 19021 |
| 238 | Ga0068860_100003354 | 3300005843 | Bacteria | 16492 |
| 239 | Ga0068860_100003552 | 3300005843 | Bacteria | 16035 |
| 240 | Ga0068860_100006921 | 3300005843 | Bacteria | 11364 |
| 241 | Ga0068860_100018142 | 3300005843 | Bacteria | 6850 |
| 242 | Ga0068860_100026287 | 3300005843 | Bacteria | 5612 |
| 243 | Ga0068860_100048563 | 3300005843 | Bacteria | 4045 |
| 244 | Ga0068860_100098485 | 3300005843 | Unclassified | 2788 |
| 245 | Ga0068860_100109663 | 3300005843 | Bacteria | 2638 |
| 246 | Ga0068860_100320370 | 3300005843 | Bacteria | 1521 |
| 247 | Ga0068862_100015156 | 3300005844 | Bacteria | 6401 |
| 248 | Ga0068862_100027769 | 3300005844 | Bacteria | 4765 |
| 249 | Ga0068862_100047364 | 3300005844 | Bacteria | 3669 |
| 250 | Ga0068862_100522522 | 3300005844 | Unclassified | 1130 |
| 251 | Ga0081539_10000874 | 3300005985 | Bacteria | 57737 |
| 252 | Ga0081539_10013810 | 3300005985 | Bacteria | 6047 |
| 253 | Ga0070715_10031753 | 3300006163 | Bacteria | 2146 |
| 254 | Ga0070715_10078026 | 3300006163 | Bacteria | 1496 |
| 255 | Ga0070715_10164093 | 3300006163 | Bacteria | 1100 |
| 256 | Ga0070716_100551449 | 3300006173 | Bacteria | 859 |
| 257 | Ga0075366_10017273 | 3300006195 | Bacteria | 4151 |
| 258 | Ga0097621_100023546 | 3300006237 | Bacteria | 4796 |
| 259 | Ga0097621_100127133 | 3300006237 | Bacteria | 2166 |
| 260 | Ga0097621_100425678 | 3300006237 | Bacteria | 1192 |
| 261 | Ga0097621_100469822 | 3300006237 | Bacteria | 1136 |
| 262 | Ga0068871_100013234 | 3300006358 | Bacteria | 6118 |
| 263 | Ga0068871_100050582 | 3300006358 | Bacteria | 3362 |
| 264 | Ga0068871_100548856 | 3300006358 | Bacteria | 1046 |
| 265 | Ga0068871_100708247 | 3300006358 | Bacteria | 923 |
| 266 | Ga0075428_100056033 | 3300006844 | Bacteria | 4318 |
| 267 | Ga0075431_100003549 | 3300006847 | Bacteria | 15101 |
| 268 | Ga0075433_10050116 | 3300006852 | Bacteria | 3634 |
| 269 | Ga0075434_100652521 | 3300006871 | Bacteria | 1070 |
| 270 | Ga0075429_100114668 | 3300006880 | Unclassified | 2356 |
| 271 | Ga0075429_100242249 | 3300006880 | Bacteria | 1579 |
| 272 | Ga0075429_100335895 | 3300006880 | Bacteria | 1322 |
| 273 | Ga0068865_100001391 | 3300006881 | Bacteria | 14060 |
| 274 | Ga0068865_100150544 | 3300006881 | Bacteria | 1765 |
| 275 | Ga0068865_100739134 | 3300006881 | Bacteria | 844 |
| 276 | Ga0075436_100240193 | 3300006914 | Unclassified | 1288 |
| 277 | Ga0097620_100000003 | 3300006931 | Bacteria | 479218 |
| 278 | Ga0097620_100026206 | 3300006931 | Bacteria | 5847 |
| 279 | Ga0097620_100032311 | 3300006931 | Bacteria | 5257 |
| 280 | Ga0097620_100054117 | 3300006931 | Bacteria | 4036 |
| 281 | Ga0097620_100076244 | 3300006931 | Bacteria | 3393 |
| 282 | Ga0097620_100483140 | 3300006931 | Bacteria | 1334 |
| 283 | Ga0075435_100041523 | 3300007076 | Bacteria | 3677 |
| 284 | Ga0075435_100146901 | 3300007076 | Bacteria | 1981 |
| 285 | Ga0099794_10006781 | 3300007265 | Bacteria | 4661 |
| 286 | Ga0105251_10059696 | 3300009011 | Bacteria | 1798 |
| 287 | Ga0105244_10000339 | 3300009036 | Bacteria | 43963 |
| 288 | Ga0105240_10000664 | 3300009093 | Bacteria | 63206 |
| 289 | Ga0105240_10003417 | 3300009093 | Bacteria | 24669 |
| 290 | Ga0105240_10005202 | 3300009093 | Bacteria | 19460 |
| 291 | Ga0105240_10007539 | 3300009093 | Bacteria | 15772 |
| 292 | Ga0105240_10013672 | 3300009093 | Bacteria | 11131 |
| 293 | Ga0105240_10028985 | 3300009093 | Bacteria | 7220 |
| 294 | Ga0105240_10030484 | 3300009093 | Bacteria | 7010 |
| 295 | Ga0105240_10080146 | 3300009093 | Bacteria | 4016 |
| 296 | Ga0105240_10730103 | 3300009093 | Bacteria | 1078 |
| 297 | Ga0111539_10001581 | 3300009094 | Bacteria | 30313 |
| 298 | Ga0111539_10235359 | 3300009094 | Bacteria | 2132 |
| 299 | Ga0105245_10032550 | 3300009098 | Bacteria | 4616 |
| 300 | Ga0105245_10106189 | 3300009098 | Bacteria | 2605 |
| 301 | Ga0105245_10885541 | 3300009098 | Bacteria | 934 |
| 302 | Ga0105247_10002199 | 3300009101 | Bacteria | 13422 |
| 303 | Ga0105247_10241224 | 3300009101 | Unclassified | 1232 |
| 304 | Ga0114129_10544516 | 3300009147 | Bacteria | 1510 |
| 305 | Ga0105243_10234429 | 3300009148 | Bacteria | 1630 |
| 306 | Ga0105241_10000439 | 3300009174 | Bacteria | 31338 |
| 307 | Ga0105241_10003204 | 3300009174 | Bacteria | 12178 |
| 308 | Ga0105241_10008515 | 3300009174 | Bacteria | 7542 |
| 309 | Ga0105241_10009295 | 3300009174 | Bacteria | 7226 |
| 310 | Ga0105241_10091778 | 3300009174 | Bacteria | 2397 |
| 311 | Ga0105241_10145220 | 3300009174 | Unclassified | 1935 |
| 312 | Ga0105241_10975732 | 3300009174 | Bacteria | 791 |
| 313 | Ga0105242_10126139 | 3300009176 | Bacteria | 2203 |
| 314 | Ga0105242_10200577 | 3300009176 | Bacteria | 1772 |
| 315 | Ga0105242_10220383 | 3300009176 | Bacteria | 1695 |
| 316 | Ga0105242_10343054 | 3300009176 | Bacteria | 1377 |
| 317 | Ga0105242_10377363 | 3300009176 | Bacteria | 1317 |
| 318 | Ga0105242_10509121 | 3300009176 | Bacteria | 1146 |
| 319 | Ga0105248_10693517 | 3300009177 | Bacteria | 1149 |
| 320 | Ga0105237_10000144 | 3300009545 | Bacteria | 100105 |
| 321 | Ga0105237_10001444 | 3300009545 | Bacteria | 31385 |
| 322 | Ga0105237_10001848 | 3300009545 | Bacteria | 27201 |
| 323 | Ga0105237_10006055 | 3300009545 | Bacteria | 13528 |
| 324 | Ga0105237_10006468 | 3300009545 | Bacteria | 12988 |
| 325 | Ga0105237_10006867 | 3300009545 | Bacteria | 12548 |
| 326 | Ga0105237_10011763 | 3300009545 | Bacteria | 9258 |
| 327 | Ga0105237_10030017 | 3300009545 | Bacteria | 5523 |
| 328 | Ga0105237_10058802 | 3300009545 | Bacteria | 3847 |
| 329 | Ga0105237_10127139 | 3300009545 | Bacteria | 2543 |
| 330 | Ga0105237_10867548 | 3300009545 | Bacteria | 909 |
| 331 | Ga0105238_10001637 | 3300009551 | Bacteria | 22439 |
| 332 | Ga0105238_10123249 | 3300009551 | Bacteria | 2571 |
| 333 | Ga0105238_10383260 | 3300009551 | Bacteria | 1397 |
| 334 | Ga0105249_10022903 | 3300009553 | Bacteria | 5600 |
| 335 | Ga0105249_10025203 | 3300009553 | Bacteria | 5351 |
| 336 | Ga0105249_10136703 | 3300009553 | Bacteria | 2346 |
| 337 | Ga0105249_10292430 | 3300009553 | Bacteria | 1631 |
| 338 | Ga0105249_10382898 | 3300009553 | Bacteria | 1433 |
| 339 | Ga0105239_10000488 | 3300010375 | Bacteria | 57554 |
| 340 | Ga0105239_10001785 | 3300010375 | Bacteria | 28298 |
| 341 | Ga0105239_10003818 | 3300010375 | Bacteria | 18313 |
| 342 | Ga0105239_10008966 | 3300010375 | Bacteria | 11320 |
| 343 | Ga0105239_10033745 | 3300010375 | Bacteria | 5619 |
| 344 | Ga0105239_10047335 | 3300010375 | Bacteria | 4714 |
| 345 | Ga0105239_10053132 | 3300010375 | Bacteria | 4445 |
| 346 | Ga0105239_10057502 | 3300010375 | Bacteria | 4266 |
| 347 | Ga0105239_10061065 | 3300010375 | Bacteria | 4137 |
| 348 | Ga0105239_10552075 | 3300010375 | Bacteria | 1312 |
| 349 | Ga0105246_10019885 | 3300011119 | Bacteria | 4301 |
| 350 | Ga0105246_10340982 | 3300011119 | Bacteria | 1225 |
| 351 | Ga0157373_10019736 | 3300013100 | Bacteria | 4903 |
| 352 | Ga0157373_10020245 | 3300013100 | Bacteria | 4840 |
| 353 | Ga0157373_10035440 | 3300013100 | Bacteria | 3582 |
| 354 | Ga0157373_10065050 | 3300013100 | Unclassified | 2581 |
| 355 | Ga0157373_10105215 | 3300013100 | Bacteria | 1985 |
| 356 | Ga0157373_10129817 | 3300013100 | Bacteria | 1772 |
| 357 | Ga0157373_10234566 | 3300013100 | Unclassified | 1296 |
| 358 | Ga0157371_10002684 | 3300013102 | Bacteria | 16831 |
| 359 | Ga0157371_10011287 | 3300013102 | Bacteria | 6898 |
| 360 | Ga0157371_10014557 | 3300013102 | Bacteria | 5932 |
| 361 | Ga0157371_10021639 | 3300013102 | Unclassified | 4719 |
| 362 | Ga0157371_10039728 | 3300013102 | Bacteria | 3364 |
| 363 | Ga0157371_10040190 | 3300013102 | Bacteria | 3342 |
| 364 | Ga0157371_10045338 | 3300013102 | Bacteria | 3129 |
| 365 | Ga0157371_10048001 | 3300013102 | Bacteria | 3035 |
| 366 | Ga0157371_10072741 | 3300013102 | Bacteria | 2434 |
| 367 | Ga0157371_10109636 | 3300013102 | Bacteria | 1959 |
| 368 | Ga0157371_10239821 | 3300013102 | Bacteria | 1304 |
| 369 | Ga0157371_10244953 | 3300013102 | Unclassified | 1290 |
| 370 | Ga0157371_10255970 | 3300013102 | Bacteria | 1261 |
| 371 | Ga0157370_10001484 | 3300013104 | Bacteria | 29041 |
| 372 | Ga0157370_10001848 | 3300013104 | Bacteria | 26098 |
| 373 | Ga0157370_10006166 | 3300013104 | Bacteria | 13302 |
| 374 | Ga0157370_10008668 | 3300013104 | Bacteria | 10945 |
| 375 | Ga0157370_10367155 | 3300013104 | Bacteria | 1326 |
| 376 | Ga0157370_10540032 | 3300013104 | Bacteria | 1069 |
| 377 | Ga0157370_10544911 | 3300013104 | Unclassified | 1064 |
| 378 | Ga0157369_10026472 | 3300013105 | Bacteria | 6432 |
| 379 | Ga0157369_10031028 | 3300013105 | Bacteria | 5890 |
| 380 | Ga0157369_10078140 | 3300013105 | Bacteria | 3546 |
| 381 | Ga0157369_10202206 | 3300013105 | Bacteria | 2085 |
| 382 | Ga0157369_10318581 | 3300013105 | Bacteria | 1617 |
| 383 | Ga0157369_10433005 | 3300013105 | Bacteria | 1363 |
| 384 | Ga0157374_10031460 | 3300013296 | Bacteria | 4824 |
| 385 | Ga0157374_10035657 | 3300013296 | Unclassified | 4551 |
| 386 | Ga0157374_10048484 | 3300013296 | Bacteria | 3941 |
| 387 | Ga0157374_10119424 | 3300013296 | Bacteria | 2543 |
| 388 | Ga0157374_10150905 | 3300013296 | Bacteria | 2259 |
| 389 | Ga0157374_10364111 | 3300013296 | Bacteria | 1438 |
| 390 | Ga0157378_10003719 | 3300013297 | Bacteria | 13528 |
| 391 | Ga0157378_10005510 | 3300013297 | Bacteria | 11093 |
| 392 | Ga0157378_10016875 | 3300013297 | Bacteria | 6399 |
| 393 | Ga0157378_10053515 | 3300013297 | Bacteria | 3593 |
| 394 | Ga0157378_10108130 | 3300013297 | Unclassified | 2546 |
| 395 | Ga0157378_10168242 | 3300013297 | Bacteria | 2054 |
| 396 | Ga0157378_10238526 | 3300013297 | Bacteria | 1736 |
| 397 | Ga0157378_10494629 | 3300013297 | Bacteria | 1221 |
| 398 | Ga0163162_10001183 | 3300013306 | Bacteria | 24333 |
| 399 | Ga0163162_10002547 | 3300013306 | Bacteria | 17248 |
| 400 | Ga0163162_10003339 | 3300013306 | Bacteria | 15355 |
| 401 | Ga0163162_10024718 | 3300013306 | Bacteria | 5932 |
| 402 | Ga0163162_10107083 | 3300013306 | Bacteria | 2891 |
| 403 | Ga0163162_10107340 | 3300013306 | Bacteria | 2887 |
| 404 | Ga0163162_10162201 | 3300013306 | Bacteria | 2357 |
| 405 | Ga0163162_10297209 | 3300013306 | Bacteria | 1746 |
| 406 | Ga0163162_10880576 | 3300013306 | Bacteria | 1009 |
| 407 | Ga0157372_10000747 | 3300013307 | Bacteria | 35352 |
| 408 | Ga0157372_10002589 | 3300013307 | Bacteria | 19570 |
| 409 | Ga0157372_10010981 | 3300013307 | Bacteria | 9640 |
| 410 | Ga0157372_10019462 | 3300013307 | Bacteria | 7317 |
| 411 | Ga0157372_10032285 | 3300013307 | Bacteria | 5740 |
| 412 | Ga0157372_10038383 | 3300013307 | Bacteria | 5284 |
| 413 | Ga0157372_10039880 | 3300013307 | Bacteria | 5185 |
| 414 | Ga0157372_10047116 | 3300013307 | Bacteria | 4788 |
| 415 | Ga0157372_10049341 | 3300013307 | Bacteria | 4681 |
| 416 | Ga0157372_10076348 | 3300013307 | Bacteria | 3783 |
| 417 | Ga0157372_10084058 | 3300013307 | Bacteria | 3606 |
| 418 | Ga0157372_10085944 | 3300013307 | Bacteria | 3568 |
| 419 | Ga0157372_10090318 | 3300013307 | Bacteria | 3482 |
| 420 | Ga0157372_10131510 | 3300013307 | Bacteria | 2879 |
| 421 | Ga0157372_10137285 | 3300013307 | Bacteria | 2817 |
| 422 | Ga0157372_10152899 | 3300013307 | Bacteria | 2664 |
| 423 | Ga0157372_10187976 | 3300013307 | Bacteria | 2392 |
| 424 | Ga0157372_10353237 | 3300013307 | Bacteria | 1713 |
| 425 | Ga0157372_10371657 | 3300013307 | Bacteria | 1666 |
| 426 | Ga0157372_10411734 | 3300013307 | Bacteria | 1575 |
| 427 | Ga0157372_10532779 | 3300013307 | Bacteria | 1369 |
| 428 | Ga0157372_10624938 | 3300013307 | Bacteria | 1255 |
| 429 | Ga0157372_10648110 | 3300013307 | Unclassified | 1230 |
| 430 | Ga0157372_10739288 | 3300013307 | Bacteria | 1144 |
| 431 | Ga0157375_10192270 | 3300013308 | Bacteria | 2196 |
| 432 | Ga0157375_10430058 | 3300013308 | Bacteria | 1486 |
| 433 | Ga0157375_10445622 | 3300013308 | Bacteria | 1460 |
| 434 | Ga0157375_10682159 | 3300013308 | Bacteria | 1182 |
| 435 | Ga0157375_10693870 | 3300013308 | Bacteria | 1172 |
| 436 | Ga0163163_10001099 | 3300014325 | Bacteria | 22954 |
| 437 | Ga0163163_10189183 | 3300014325 | Bacteria | 2107 |
| 438 | Ga0163163_10222935 | 3300014325 | Bacteria | 1934 |
| 439 | Ga0157380_10360944 | 3300014326 | Bacteria | 1363 |
| 440 | Ga0157380_10384579 | 3300014326 | Bacteria | 1326 |
| 441 | Ga0157377_10004427 | 3300014745 | Bacteria | 6467 |
| 442 | Ga0157379_10027316 | 3300014968 | Bacteria | 5081 |
| 443 | Ga0157379_10102588 | 3300014968 | Bacteria | 2567 |
| 444 | Ga0157379_10441801 | 3300014968 | Bacteria | 1200 |
| 445 | Ga0157376_10008791 | 3300014969 | Bacteria | 7308 |
| 446 | Ga0157376_10014902 | 3300014969 | Bacteria | 5855 |
| 447 | Ga0157376_10024860 | 3300014969 | Bacteria | 4710 |
| 448 | Ga0157376_10027426 | 3300014969 | Bacteria | 4514 |
| 449 | Ga0157376_10126663 | 3300014969 | Bacteria | 2273 |
| 450 | Ga0157376_10539513 | 3300014969 | Unclassified | 1153 |
| 451 | Ga0163161_10021103 | 3300017792 | Bacteria | 4578 |
| 452 | Ga0163161_10040298 | 3300017792 | Bacteria | 3354 |
| 453 | Ga0163161_10127244 | 3300017792 | Bacteria | 1919 |
| 454 | Ga0213876_10079219 | 3300021384 | Bacteria | 1736 |
| 455 | Ga0209646_1007702 | 3300025246 | Bacteria | 1748 |
| 456 | Ga0207426_1000230 | 3300025302 | Bacteria | 128357 |
| 457 | Ga0207697_10105975 | 3300025315 | Bacteria | 1201 |
| 458 | Ga0207655_1000319 | 3300025728 | Bacteria | 71324 |
| 459 | Ga0207642_10145644 | 3300025899 | Bacteria | 1254 |
| 460 | Ga0207710_10004189 | 3300025900 | Bacteria | 6324 |
| 461 | Ga0207688_10177988 | 3300025901 | Bacteria | 1267 |
| 462 | Ga0207680_10000073 | 3300025903 | Bacteria | 44634 |
| 463 | Ga0207680_10133144 | 3300025903 | Bacteria | 1640 |
| 464 | Ga0207680_10140021 | 3300025903 | Bacteria | 1603 |
| 465 | Ga0207680_10218186 | 3300025903 | Bacteria | 1306 |
| 466 | Ga0207680_10305253 | 3300025903 | Unclassified | 1110 |
| 467 | Ga0207647_10131066 | 3300025904 | Bacteria | 1473 |
| 468 | Ga0207647_10208838 | 3300025904 | Bacteria | 1128 |
| 469 | Ga0207685_10029153 | 3300025905 | Bacteria | 1951 |
| 470 | Ga0207645_10001118 | 3300025907 | Bacteria | 22193 |
| 471 | Ga0207645_10001159 | 3300025907 | Bacteria | 21794 |
| 472 | Ga0207645_10112007 | 3300025907 | Bacteria | 1767 |
| 473 | Ga0207645_10175408 | 3300025907 | Bacteria | 1406 |
| 474 | Ga0207645_10258663 | 3300025907 | Bacteria | 1153 |
| 475 | Ga0207643_10049069 | 3300025908 | Bacteria | 2392 |
| 476 | Ga0207705_10012442 | 3300025909 | Bacteria | 6147 |
| 477 | Ga0207705_10053674 | 3300025909 | Bacteria | 2904 |
| 478 | Ga0207705_10103224 | 3300025909 | Unclassified | 2100 |
| 479 | Ga0207705_10182593 | 3300025909 | Bacteria | 1584 |
| 480 | Ga0207705_10252420 | 3300025909 | Bacteria | 1345 |
| 481 | Ga0207684_10304793 | 3300025910 | Bacteria | 1373 |
| 482 | Ga0207654_10007264 | 3300025911 | Bacteria | 5583 |
| 483 | Ga0207654_10008116 | 3300025911 | Bacteria | 5296 |
| 484 | Ga0207654_10015008 | 3300025911 | Bacteria | 4012 |
| 485 | Ga0207707_10004345 | 3300025912 | Bacteria | 12541 |
| 486 | Ga0207707_10082925 | 3300025912 | Bacteria | 2799 |
| 487 | Ga0207707_10118105 | 3300025912 | Bacteria | 2318 |
| 488 | Ga0207695_10009734 | 3300025913 | Bacteria | 11831 |
| 489 | Ga0207695_10020430 | 3300025913 | Bacteria | 7585 |
| 490 | Ga0207695_10035578 | 3300025913 | Bacteria | 5398 |
| 491 | Ga0207695_10062093 | 3300025913 | Bacteria | 3859 |
| 492 | Ga0207695_10066998 | 3300025913 | Bacteria | 3684 |
| 493 | Ga0207695_10097308 | 3300025913 | Bacteria | 2944 |
| 494 | Ga0207695_10205612 | 3300025913 | Bacteria | 1882 |
| 495 | Ga0207671_10000340 | 3300025914 | Bacteria | 68615 |
| 496 | Ga0207671_10001368 | 3300025914 | Bacteria | 28441 |
| 497 | Ga0207671_10001764 | 3300025914 | Bacteria | 24323 |
| 498 | Ga0207671_10004891 | 3300025914 | Bacteria | 12589 |
| 499 | Ga0207671_10006860 | 3300025914 | Bacteria | 10049 |
| 500 | Ga0207671_10057113 | 3300025914 | Unclassified | 2892 |
| 501 | Ga0207671_10080582 | 3300025914 | Bacteria | 2440 |
| 502 | Ga0207671_10083349 | 3300025914 | Bacteria | 2400 |
| 503 | Ga0207671_10443760 | 3300025914 | Bacteria | 1033 |
| 504 | Ga0207693_10006758 | 3300025915 | Bacteria | 9471 |
| 505 | Ga0207660_10032252 | 3300025917 | Bacteria | 3615 |
| 506 | Ga0207660_10230062 | 3300025917 | Bacteria | 1457 |
| 507 | Ga0207662_10076734 | 3300025918 | Bacteria | 2031 |
| 508 | Ga0207662_10175341 | 3300025918 | Bacteria | 1377 |
| 509 | Ga0207657_10029156 | 3300025919 | Bacteria | 5028 |
| 510 | Ga0207649_10000652 | 3300025920 | Bacteria | 23164 |
| 511 | Ga0207649_10051820 | 3300025920 | Bacteria | 2543 |
| 512 | Ga0207649_10072850 | 3300025920 | Bacteria | 2199 |
| 513 | Ga0207652_10002096 | 3300025921 | Bacteria | 17145 |
| 514 | Ga0207652_10003075 | 3300025921 | Bacteria | 13931 |
| 515 | Ga0207652_10036008 | 3300025921 | Bacteria | 4182 |
| 516 | Ga0207652_10068797 | 3300025921 | Bacteria | 3072 |
| 517 | Ga0207652_10129241 | 3300025921 | Bacteria | 2252 |
| 518 | Ga0207646_10119142 | 3300025922 | Bacteria | 2371 |
| 519 | Ga0207646_10119966 | 3300025922 | Bacteria | 2362 |
| 520 | Ga0207646_10120713 | 3300025922 | Bacteria | 2354 |
| 521 | Ga0207681_10133920 | 3300025923 | Bacteria | 1836 |
| 522 | Ga0207681_10185533 | 3300025923 | Bacteria | 1588 |
| 523 | Ga0207681_10207398 | 3300025923 | Bacteria | 1508 |
| 524 | Ga0207694_10002249 | 3300025924 | Bacteria | 15815 |
| 525 | Ga0207694_10208699 | 3300025924 | Bacteria | 1591 |
| 526 | Ga0207694_10264494 | 3300025924 | Bacteria | 1410 |
| 527 | Ga0207694_10275059 | 3300025924 | Bacteria | 1382 |
| 528 | Ga0207650_10117284 | 3300025925 | Bacteria | 2068 |
| 529 | Ga0207650_10553510 | 3300025925 | Bacteria | 965 |
| 530 | Ga0207659_10009411 | 3300025926 | Bacteria | 6103 |
| 531 | Ga0207659_10078035 | 3300025926 | Bacteria | 2439 |
| 532 | Ga0207659_10206055 | 3300025926 | Bacteria | 1573 |
| 533 | Ga0207659_10438346 | 3300025926 | Unclassified | 1098 |
| 534 | Ga0207687_10102671 | 3300025927 | Bacteria | 2107 |
| 535 | Ga0207644_10186187 | 3300025931 | Bacteria | 1630 |
| 536 | Ga0207644_10196624 | 3300025931 | Bacteria | 1588 |
| 537 | Ga0207644_10414714 | 3300025931 | Bacteria | 1102 |
| 538 | Ga0207644_10514443 | 3300025931 | Bacteria | 988 |
| 539 | Ga0207690_10011269 | 3300025932 | Bacteria | 5340 |
| 540 | Ga0207690_10088570 | 3300025932 | Bacteria | 2181 |
| 541 | Ga0207690_10351645 | 3300025932 | Unclassified | 1165 |
| 542 | Ga0207706_10013035 | 3300025933 | Bacteria | 7566 |
| 543 | Ga0207706_10049929 | 3300025933 | Bacteria | 3697 |
| 544 | Ga0207706_10102106 | 3300025933 | Bacteria | 2523 |
| 545 | Ga0207706_10257795 | 3300025933 | Bacteria | 1523 |
| 546 | Ga0207706_10310377 | 3300025933 | Bacteria | 1373 |
| 547 | Ga0207686_10039957 | 3300025934 | Bacteria | 2849 |
| 548 | Ga0207686_10079789 | 3300025934 | Bacteria | 2132 |
| 549 | Ga0207686_10179549 | 3300025934 | Bacteria | 1500 |
| 550 | Ga0207686_10255047 | 3300025934 | Bacteria | 1283 |
| 551 | Ga0207670_10056714 | 3300025936 | Bacteria | 2654 |
| 552 | Ga0207670_10353159 | 3300025936 | Bacteria | 1165 |
| 553 | Ga0207669_10013085 | 3300025937 | Bacteria | 4107 |
| 554 | Ga0207669_10391680 | 3300025937 | Bacteria | 1085 |
| 555 | Ga0207704_10331598 | 3300025938 | Bacteria | 1178 |
| 556 | Ga0207665_10249128 | 3300025939 | Bacteria | 1312 |
| 557 | Ga0207691_10027569 | 3300025940 | Bacteria | 5324 |
| 558 | Ga0207691_10029587 | 3300025940 | Bacteria | 5123 |
| 559 | Ga0207691_10043865 | 3300025940 | Bacteria | 4119 |
| 560 | Ga0207691_10050536 | 3300025940 | Bacteria | 3805 |
| 561 | Ga0207691_10053181 | 3300025940 | Bacteria | 3698 |
| 562 | Ga0207691_10290802 | 3300025940 | Unclassified | 1405 |
| 563 | Ga0207691_10324183 | 3300025940 | Bacteria | 1320 |
| 564 | Ga0207691_10337574 | 3300025940 | Bacteria | 1290 |
| 565 | Ga0207689_10000401 | 3300025942 | Bacteria | 40564 |
| 566 | Ga0207689_10002161 | 3300025942 | Bacteria | 18495 |
| 567 | Ga0207689_10007614 | 3300025942 | Bacteria | 9486 |
| 568 | Ga0207689_10028784 | 3300025942 | Bacteria | 4645 |
| 569 | Ga0207689_10246368 | 3300025942 | Bacteria | 1478 |
| 570 | Ga0207661_10000183 | 3300025944 | Bacteria | 40561 |
| 571 | Ga0207661_10171704 | 3300025944 | Bacteria | 1888 |
| 572 | Ga0207661_10268831 | 3300025944 | Bacteria | 1521 |
| 573 | Ga0207661_10354337 | 3300025944 | Bacteria | 1324 |
| 574 | Ga0207679_10000308 | 3300025945 | Bacteria | 36802 |
| 575 | Ga0207679_10001821 | 3300025945 | Bacteria | 13283 |
| 576 | Ga0207679_10093390 | 3300025945 | Bacteria | 2333 |
| 577 | Ga0207679_10780230 | 3300025945 | Bacteria | 870 |
| 578 | Ga0207667_10001839 | 3300025949 | Bacteria | 26648 |
| 579 | Ga0207667_10027111 | 3300025949 | Bacteria | 6246 |
| 580 | Ga0207667_10027484 | 3300025949 | Bacteria | 6191 |
| 581 | Ga0207667_10044303 | 3300025949 | Bacteria | 4716 |
| 582 | Ga0207667_10048503 | 3300025949 | Bacteria | 4490 |
| 583 | Ga0207667_10049946 | 3300025949 | Bacteria | 4414 |
| 584 | Ga0207667_10071860 | 3300025949 | Bacteria | 3597 |
| 585 | Ga0207667_10208296 | 3300025949 | Bacteria | 2005 |
| 586 | Ga0207651_10079722 | 3300025960 | Bacteria | 2353 |
| 587 | Ga0207651_10165324 | 3300025960 | Bacteria | 1739 |
| 588 | Ga0207651_10181635 | 3300025960 | Bacteria | 1669 |
| 589 | Ga0207651_10242481 | 3300025960 | Bacteria | 1470 |
| 590 | Ga0207712_10015315 | 3300025961 | Bacteria | 4943 |
| 591 | Ga0207712_10043042 | 3300025961 | Bacteria | 3113 |
| 592 | Ga0207712_10474337 | 3300025961 | Bacteria | 1065 |
| 593 | Ga0207668_10081267 | 3300025972 | Bacteria | 2350 |
| 594 | Ga0207668_10115649 | 3300025972 | Bacteria | 2021 |
| 595 | Ga0207640_10027790 | 3300025981 | Bacteria | 3451 |
| 596 | Ga0207640_10028369 | 3300025981 | Bacteria | 3422 |
| 597 | Ga0207640_10102146 | 3300025981 | Bacteria | 2013 |
| 598 | Ga0207640_10378316 | 3300025981 | Bacteria | 1146 |
| 599 | Ga0207658_10018404 | 3300025986 | Bacteria | 4824 |
| 600 | Ga0207658_10039102 | 3300025986 | Bacteria | 3422 |
| 601 | Ga0207658_10794151 | 3300025986 | Bacteria | 859 |
| 602 | Ga0207677_10078621 | 3300026023 | Bacteria | 2356 |
| 603 | Ga0207677_10087739 | 3300026023 | Bacteria | 2253 |
| 604 | Ga0207677_10095717 | 3300026023 | Bacteria | 2171 |
| 605 | Ga0207677_10137814 | 3300026023 | Bacteria | 1863 |
| 606 | Ga0207677_10162319 | 3300026023 | Bacteria | 1737 |
| 607 | Ga0207703_10005399 | 3300026035 | Bacteria | 10291 |
| 608 | Ga0207703_10160115 | 3300026035 | Unclassified | 1971 |
| 609 | Ga0207703_10289225 | 3300026035 | Bacteria | 1491 |
| 610 | Ga0207639_10000781 | 3300026041 | Bacteria | 21658 |
| 611 | Ga0207639_10031366 | 3300026041 | Bacteria | 3905 |
| 612 | Ga0207639_10055426 | 3300026041 | Bacteria | 3034 |
| 613 | Ga0207639_10077394 | 3300026041 | Bacteria | 2622 |
| 614 | Ga0207639_10080265 | 3300026041 | Bacteria | 2580 |
| 615 | Ga0207639_10081993 | 3300026041 | Bacteria | 2556 |
| 616 | Ga0207639_10105021 | 3300026041 | Bacteria | 2291 |
| 617 | Ga0207639_10348196 | 3300026041 | Bacteria | 1323 |
| 618 | Ga0207678_10198191 | 3300026067 | Bacteria | 1716 |
| 619 | Ga0207678_10251539 | 3300026067 | Bacteria | 1513 |
| 620 | Ga0207678_10673256 | 3300026067 | Bacteria | 910 |
| 621 | Ga0207708_10063391 | 3300026075 | Bacteria | 2824 |
| 622 | Ga0207708_10084925 | 3300026075 | Bacteria | 2435 |
| 623 | Ga0207702_10046094 | 3300026078 | Bacteria | 3669 |
| 624 | Ga0207702_10063143 | 3300026078 | Bacteria | 3166 |
| 625 | Ga0207702_10150941 | 3300026078 | Bacteria | 2113 |
| 626 | Ga0207702_10187298 | 3300026078 | Bacteria | 1910 |
| 627 | Ga0207702_10804366 | 3300026078 | Unclassified | 929 |
| 628 | Ga0207641_10000026 | 3300026088 | Bacteria | 245091 |
| 629 | Ga0207641_10052405 | 3300026088 | Bacteria | 3455 |
| 630 | Ga0207641_10107554 | 3300026088 | Bacteria | 2467 |
| 631 | Ga0207641_10112838 | 3300026088 | Bacteria | 2412 |
| 632 | Ga0207641_10120558 | 3300026088 | Bacteria | 2340 |
| 633 | Ga0207641_10894064 | 3300026088 | Bacteria | 882 |
| 634 | Ga0207648_10006875 | 3300026089 | Bacteria | 11280 |
| 635 | Ga0207648_10010880 | 3300026089 | Bacteria | 8598 |
| 636 | Ga0207648_10032100 | 3300026089 | Bacteria | 4639 |
| 637 | Ga0207648_10044012 | 3300026089 | Bacteria | 3918 |
| 638 | Ga0207648_10079887 | 3300026089 | Bacteria | 2853 |
| 639 | Ga0207648_10098697 | 3300026089 | Bacteria | 2557 |
| 640 | Ga0207648_10215645 | 3300026089 | Bacteria | 1705 |
| 641 | Ga0207648_10301549 | 3300026089 | Bacteria | 1437 |
| 642 | Ga0207648_10575192 | 3300026089 | Bacteria | 1037 |
| 643 | Ga0207676_10004939 | 3300026095 | Bacteria | 9453 |
| 644 | Ga0207676_10012670 | 3300026095 | Bacteria | 6048 |
| 645 | Ga0207676_10073296 | 3300026095 | Bacteria | 2755 |
| 646 | Ga0207676_10136904 | 3300026095 | Bacteria | 2091 |
| 647 | Ga0207676_10284854 | 3300026095 | Bacteria | 1502 |
| 648 | Ga0207676_10516291 | 3300026095 | Bacteria | 1137 |
| 649 | Ga0207674_10001969 | 3300026116 | Bacteria | 26000 |
| 650 | Ga0207674_10002814 | 3300026116 | Bacteria | 21653 |
| 651 | Ga0207674_10035586 | 3300026116 | Bacteria | 5196 |
| 652 | Ga0207674_10091190 | 3300026116 | Bacteria | 3038 |
| 653 | Ga0207675_100081816 | 3300026118 | Bacteria | 3028 |
| 654 | Ga0207683_10001619 | 3300026121 | Bacteria | 20189 |
| 655 | Ga0207683_10040532 | 3300026121 | Bacteria | 4064 |
| 656 | Ga0207683_10072459 | 3300026121 | Bacteria | 3047 |
| 657 | Ga0207683_10489616 | 3300026121 | Bacteria | 1135 |
| 658 | Ga0207683_10629286 | 3300026121 | Bacteria | 994 |
| 659 | Ga0207698_10000497 | 3300026142 | Bacteria | 22930 |
| 660 | Ga0207698_10007369 | 3300026142 | Bacteria | 6894 |
| 661 | Ga0207698_10012029 | 3300026142 | Bacteria | 5641 |
| 662 | Ga0207698_10022588 | 3300026142 | Bacteria | 4375 |
| 663 | Ga0207698_10113560 | 3300026142 | Bacteria | 2276 |
| 664 | Ga0207698_10136153 | 3300026142 | Bacteria | 2108 |
| 665 | Ga0207698_10145348 | 3300026142 | Bacteria | 2050 |
| 666 | Ga0207698_10266545 | 3300026142 | Bacteria | 1576 |
| 667 | Ga0207698_10503965 | 3300026142 | Bacteria | 1178 |
| 668 | Ga0207698_10635663 | 3300026142 | Bacteria | 1056 |
| 669 | Ga0209982_1012733 | 3300027552 | Unclassified | 1264 |
| 670 | Ga0207428_10001077 | 3300027907 | Bacteria | 29791 |
| 671 | Ga0268266_10038672 | 3300028379 | Bacteria | 4061 |
| 672 | Ga0268266_10373176 | 3300028379 | Unclassified | 1344 |
| 673 | Ga0268266_10652240 | 3300028379 | Bacteria | 1013 |
| 674 | Ga0268265_10204101 | 3300028380 | Bacteria | 1717 |
| 675 | Ga0268265_10287793 | 3300028380 | Unclassified | 1473 |
| 676 | Ga0268264_10000063 | 3300028381 | Bacteria | 301702 |
| 677 | Ga0268264_10002827 | 3300028381 | Bacteria | 15156 |
| 678 | Ga0268264_10003689 | 3300028381 | Bacteria | 13138 |
| 679 | Ga0268264_10006688 | 3300028381 | Bacteria | 9690 |
| 680 | Ga0268264_10007051 | 3300028381 | Bacteria | 9425 |
| 681 | Ga0268264_10008422 | 3300028381 | Bacteria | 8572 |
| 682 | Ga0268264_10064841 | 3300028381 | Bacteria | 3075 |
| 683 | Ga0268264_10084121 | 3300028381 | Bacteria | 2727 |
| 684 | Ga0268264_10109516 | 3300028381 | Bacteria | 2417 |
| 685 | Ga0268264_10171735 | 3300028381 | Bacteria | 1961 |
| 686 | Ga0268264_10268391 | 3300028381 | Bacteria | 1593 |
| 687 | Ga0268264_10741239 | 3300028381 | Bacteria | 978 |
| 688 | Ga0307517_10000487 | 3300028786 | Bacteria | 68165 |
| 689 | Ga0307517_10248707 | 3300028786 | Bacteria | 1046 |
| 690 | Ga0307515_10000031 | 3300028794 | Bacteria | 358648 |
| 691 | Ga0265324_10043530 | 3300029957 | Bacteria | 1549 |
| 692 | Ga0307511_10000409 | 3300030521 | Bacteria | 45829 |
| 693 | Ga0265327_10000361 | 3300031251 | Bacteria | 86574 |
| 694 | Ga0265327_10002040 | 3300031251 | Bacteria | 22722 |
| 695 | Ga0265327_10025120 | 3300031251 | Bacteria | 3481 |
| 696 | Ga0265327_10045674 | 3300031251 | Bacteria | 2326 |
| 697 | Ga0265327_10059461 | 3300031251 | Bacteria | 1957 |
| 698 | Ga0265327_10073047 | 3300031251 | Bacteria | 1712 |
| 699 | Ga0307513_10064018 | 3300031456 | Bacteria | 3878 |
| 700 | Ga0307513_10106136 | 3300031456 | Bacteria | 2816 |
| 701 | Ga0307513_10181570 | 3300031456 | Bacteria | 1967 |
| 702 | Ga0307509_10029747 | 3300031507 | Bacteria | 6057 |
| 703 | Ga0307509_10030741 | 3300031507 | Bacteria | 5937 |
| 704 | Ga0307509_10097984 | 3300031507 | Bacteria | 2979 |
| 705 | Ga0307509_10314268 | 3300031507 | Bacteria | 1307 |
| 706 | Ga0307508_10001223 | 3300031616 | Bacteria | 29382 |
| 707 | Ga0307412_10625761 | 3300031911 | Bacteria | 915 |
| 708 | Ga0307414_10076475 | 3300032004 | Bacteria | 2433 |
| 709 | Ga0307415_100294833 | 3300032126 | Bacteria | 1341 |
| 710 | Ga0307507_10320594 | 3300033179 | Bacteria | 933 |
| 711 | Ga0307510_10000336 | 3300033180 | Bacteria | 43815 |
| 712 | Ga0373940_0012715 | 3300035088 | Bacteria | 2021 |
| 713 | Ga0373952_0053528 | 3300035092 | Bacteria | 969 |
| 714 | Ga0373932_0009426 | 3300035112 | Bacteria | 2348 |
| 715 | Ga0373936_0051884 | 3300035113 | Bacteria | 1661 |
| 716 | Ga0373943_0214058 | 3300035170 | Bacteria | 1071 |
| 717 | Ga0373931_0348427 | 3300035691 | Bacteria | 927 |
| 718 | Ga0373947_0140452 | 3300035725 | Bacteria | 1549 |
| 719 | Ga0373925_0452009 | 3300037068 | Bacteria | 1052 |
| 720 | Ga0395899_0089923 | 3300037312 | Bacteria | 2226 |
| 721 | Ga0395899_0254323 | 3300037312 | Bacteria | 1204 |
| 722 | Ga0395899_0304986 | 3300037312 | Unclassified | 1076 |
| 723 | Ga0395899_0373142 | 3300037312 | Bacteria | 949 |
| 724 | Ga0395900_0005734 | 3300037418 | Bacteria | 12981 |
| 725 | Ga0395900_0008143 | 3300037418 | Bacteria | 10789 |
| 726 | Ga0395900_0037400 | 3300037418 | Bacteria | 5005 |
| 727 | Ga0395900_0120690 | 3300037418 | Bacteria | 2690 |
| 728 | Ga0395900_0121931 | 3300037418 | Bacteria | 2674 |
| 729 | Ga0395900_0461272 | 3300037418 | Bacteria | 1225 |
| 730 | Ga0395898_0030880 | 3300037466 | Bacteria | 5359 |
| 731 | Ga0395898_0094181 | 3300037466 | Bacteria | 2878 |
| 732 | Ga0395898_0175600 | 3300037466 | Bacteria | 2047 |
| 733 | Ga0395898_0221924 | 3300037466 | Unclassified | 1803 |
| 734 | Ga0395905_0004944 | 3300037471 | Bacteria | 13731 |
| 735 | Ga0395901_0020717 | 3300038443 | Bacteria | 6731 |
| 736 | Ga0395901_0069764 | 3300038443 | Bacteria | 3660 |
| 737 | Ga0395901_0535612 | 3300038443 | Bacteria | 1188 |
| 738 | Ga0395901_0924696 | 3300038443 | Bacteria | 852 |
| 739 | Ga0436365_0072673 | 3300039437 | Bacteria | 6638 |
| 740 | Ga0439436_0001458 | 3300041404 | Bacteria | 6861 |
| 741 | Ga0439439_0083060 | 3300041406 | Bacteria | 868 |
| 742 | Ga0451798_1071503 | 3300041458 | Bacteria | 1028 |
| 743 | Ga0451853_1545065 | 3300041512 | Bacteria | 978 |
| 744 | Ga0439431_0001238 | 3300041997 | Bacteria | 5597 |
| 745 | Ga0439445_0082182 | 3300042004 | Bacteria | 901 |
| 746 | Ga0439449_0043975 | 3300042007 | Bacteria | 1657 |
| 747 | Ga0439462_0010105 | 3300042015 | Bacteria | 2389 |
| 748 | Ga0450894_010142 | 3300042131 | Bacteria | 1221 |
| 749 | Ga0451577_0102058 | 3300042876 | Bacteria | 2563 |
| 750 | Ga0466969_0000106 | 3300044656 | Bacteria | 44435 |
| 751 | Ga0466972_0000001 | 3300044658 | Bacteria | 412457 |
| 752 | Ga0466972_0000009 | 3300044658 | Bacteria | 256374 |
| 753 | Ga0466972_0013745 | 3300044658 | Bacteria | 4063 |
| 754 | Ga0453683_0378811 | 3300044673 | Bacteria | 911 |
| 755 | Ga0466965_0152012 | 3300044683 | Bacteria | 1210 |
| 756 | Ga0466966_0013873 | 3300044684 | Bacteria | 5333 |
| 757 | Ga0466966_0219284 | 3300044684 | Bacteria | 1149 |
| 758 | Ga0466961_0081762 | 3300044693 | Bacteria | 2044 |
| 759 | Ga0466964_0052211 | 3300044706 | Unclassified | 1680 |
| 760 | Ga0453684_0059693 | 3300044712 | Bacteria | 4914 |
| 761 | Ga0453684_0667490 | 3300044712 | Bacteria | 1133 |
| 762 | Ga0466971_0016757 | 3300044719 | Bacteria | 3236 |
| 763 | Ga0466968_0003751 | 3300044735 | Bacteria | 5632 |
| 764 | Ga0466970_0000065 | 3300044765 | Bacteria | 41709 |
| 765 | Ga0466957_0018840 | 3300044842 | Bacteria | 4057 |
| 766 | Ga0466957_0068514 | 3300044842 | Bacteria | 2191 |
| 767 | Ga0466957_0154036 | 3300044842 | Bacteria | 1488 |
| 768 | Ga0466959_0000003 | 3300045049 | Bacteria | 285164 |
| 769 | Ga0466959_0000676 | 3300045049 | Bacteria | 19916 |
| 770 | Ga0466959_0005241 | 3300045049 | Bacteria | 8848 |
| 771 | Ga0466958_0002924 | 3300045836 | Bacteria | 8729 |
| 772 | Ga0495580_0005114 | 3300046472 | Bacteria | 10913 |
| 773 | Ga0495580_0271100 | 3300046472 | Bacteria | 1159 |
| 774 | Ga0495606_0004941 | 3300046507 | Bacteria | 13036 |
| 775 | Ga0495608_0336371 | 3300046511 | Bacteria | 931 |
| 776 | Ga0495630_0003451 | 3300046517 | Bacteria | 10989 |
| 777 | Ga0495648_0002648 | 3300046524 | Bacteria | 16239 |
| 778 | Ga0495642_0070152 | 3300046528 | Bacteria | 1465 |
| 779 | Ga0495587_0052848 | 3300046536 | Bacteria | 2396 |
| 780 | Ga0495667_0136777 | 3300046559 | Bacteria | 1580 |
| 781 | Ga0495668_0022644 | 3300046616 | Bacteria | 3590 |
| 782 | Ga0495613_0114858 | 3300046689 | Bacteria | 1938 |
| 783 | Ga0495649_0010201 | 3300046694 | Bacteria | 5550 |
| 784 | Ga0495674_0085719 | 3300047319 | Bacteria | 2698 |
| 785 | Ga0495676_0200965 | 3300047321 | Bacteria | 1385 |
| 786 | Ga0495680_0121204 | 3300047322 | Bacteria | 1931 |
| 787 | Ga0495687_001778 | 3300047443 | Bacteria | 19030 |
| 788 | Ga0495686_0000010 | 3300047472 | Bacteria | 573229 |
| 789 | Ga0496104_0245051 | 3300048907 | Bacteria | 1705 |
| 790 | Ga0496104_0602399 | 3300048907 | Unclassified | 1009 |
| 791 | Ga0496109_0097878 | 3300048912 | Bacteria | 2720 |
| 792 | Ga0496110_0088733 | 3300048913 | Bacteria | 2763 |
| 793 | Ga0496115_0284468 | 3300048918 | Bacteria | 1357 |
| 794 | Ga0496124_0037486 | 3300048927 | Bacteria | 4216 |
| 795 | Ga0501290_010528 | 3300049513 | Bacteria | 1184 |
| 796 | Ga0501298_010684 | 3300049521 | Bacteria | 1584 |
| 797 | Ga0501298_041262 | 3300049521 | Bacteria | 936 |
| 798 | Ga0501300_014174 | 3300049523 | Bacteria | 1164 |
| 799 | Ga0501032_0007076 | 3300049569 | Bacteria | 8225 |
| 800 | Ga0501032_0288537 | 3300049569 | Bacteria | 1062 |
| 801 | Ga0501033_0064223 | 3300049570 | Bacteria | 2702 |
| 802 | Ga0501033_0149431 | 3300049570 | Bacteria | 1686 |
| 803 | Ga0501034_0000152 | 3300049571 | Bacteria | 130576 |
| 804 | Ga0501034_0008450 | 3300049571 | Bacteria | 10874 |
| 805 | Ga0501034_0024790 | 3300049571 | Bacteria | 6103 |
| 806 | Ga0501034_0031305 | 3300049571 | Bacteria | 5404 |
| 807 | Ga0501034_0552084 | 3300049571 | Bacteria | 1061 |
| 808 | Ga0501034_0562196 | 3300049571 | Bacteria | 1049 |
| 809 | Ga0501036_0042178 | 3300049572 | Bacteria | 3863 |
| 810 | Ga0501036_0322833 | 3300049572 | Bacteria | 1290 |
| 811 | Ga0501036_0387965 | 3300049572 | Bacteria | 1165 |
| 812 | Ga0501037_0006142 | 3300049573 | Bacteria | 8773 |
| 813 | Ga0501038_0006185 | 3300049574 | Bacteria | 11070 |
| 814 | Ga0501038_0009079 | 3300049574 | Bacteria | 9127 |
| 815 | Ga0501038_0403250 | 3300049574 | Bacteria | 1058 |
| 816 | Ga0501039_0080013 | 3300049575 | Bacteria | 2543 |
| 817 | Ga0501041_0063233 | 3300049577 | Bacteria | 2266 |
| 818 | Ga0501042_0044253 | 3300049578 | Bacteria | 3171 |
| 819 | Ga0501043_0020054 | 3300049579 | Bacteria | 5247 |
| 820 | Ga0501043_0165712 | 3300049579 | Bacteria | 1726 |
| 821 | Ga0501043_0350530 | 3300049579 | Bacteria | 1122 |
| 822 | Ga0501046_0011187 | 3300049580 | Bacteria | 7688 |
| 823 | Ga0501046_0081279 | 3300049580 | Bacteria | 2503 |
| 824 | Ga0501046_0165800 | 3300049580 | Bacteria | 1660 |
| 825 | Ga0501047_0007979 | 3300049581 | Bacteria | 9983 |
| 826 | Ga0501047_0009217 | 3300049581 | Bacteria | 9317 |
| 827 | Ga0501047_0084821 | 3300049581 | Bacteria | 3044 |
| 828 | Ga0501047_0200057 | 3300049581 | Bacteria | 1859 |
| 829 | Ga0501047_0220913 | 3300049581 | Bacteria | 1751 |
| 830 | Ga0501048_0026137 | 3300049582 | Bacteria | 4251 |
| 831 | Ga0501068_0042014 | 3300049584 | Bacteria | 2749 |
| 832 | Ga0501068_0259670 | 3300049584 | Bacteria | 1108 |
| 833 | Ga0501069_0219812 | 3300049585 | Bacteria | 1104 |
| 834 | Ga0501069_0239217 | 3300049585 | Bacteria | 1058 |
| 835 | Ga0501070_0163857 | 3300049586 | Bacteria | 1832 |
| 836 | Ga0501070_0189532 | 3300049586 | Bacteria | 1691 |
| 837 | Ga0501071_0059108 | 3300049587 | Bacteria | 2773 |
| 838 | Ga0501072_0006066 | 3300049588 | Bacteria | 9227 |
| 839 | Ga0501073_0064375 | 3300049589 | Bacteria | 2557 |
| 840 | Ga0501073_0086868 | 3300049589 | Bacteria | 2175 |
| 841 | Ga0501074_0204295 | 3300049590 | Bacteria | 1408 |
| 842 | Ga0501075_0002025 | 3300049591 | Bacteria | 13402 |
| 843 | Ga0501076_0003428 | 3300049592 | Bacteria | 11127 |
| 844 | Ga0501076_0100327 | 3300049592 | Bacteria | 2332 |
| 845 | Ga0501198_009601 | 3300049649 | Bacteria | 1423 |
| 846 | Ga0501206_000324 | 3300049653 | Bacteria | 5629 |
| 847 | Ga0501207_012263 | 3300049654 | Bacteria | 1286 |
| 848 | Ga0501217_015107 | 3300049661 | Bacteria | 1754 |
| 849 | Ga0501223_011703 | 3300049663 | Bacteria | 1761 |
| 850 | Ga0501224_000489 | 3300049664 | Bacteria | 4773 |
| 851 | Ga0501233_032625 | 3300049668 | Bacteria | 1186 |
| 852 | Ga0501242_002056 | 3300049674 | Bacteria | 2098 |
| 853 | Ga0501242_005447 | 3300049674 | Bacteria | 1433 |
| 854 | Ga0501243_000061 | 3300049675 | Bacteria | 10533 |
| 855 | Ga0501243_003314 | 3300049675 | Bacteria | 2378 |
| 856 | Ga0501243_003321 | 3300049675 | Bacteria | 2377 |
| 857 | Ga0501252_010134 | 3300049682 | Bacteria | 1109 |
| 858 | Ga0501253_001848 | 3300049683 | Bacteria | 2263 |
| 859 | Ga0501257_003658 | 3300049686 | Bacteria | 3317 |
| 860 | Ga0501259_051283 | 3300049688 | Bacteria | 838 |
| 861 | Ga0501261_000633 | 3300049690 | Bacteria | 4460 |
| 862 | Ga0501261_007819 | 3300049690 | Bacteria | 1375 |
| 863 | Ga0501221_000225 | 3300049704 | Bacteria | 8102 |
| 864 | Ga0501225_0000299 | 3300049705 | Bacteria | 15453 |
| 865 | Ga0501225_0000690 | 3300049705 | Bacteria | 10562 |
| 866 | Ga0501225_0083494 | 3300049705 | Unclassified | 919 |
| 867 | Ga0501234_015115 | 3300049707 | Bacteria | 1214 |
| 868 | Ga0501245_005175 | 3300049708 | Bacteria | 1805 |
| 869 | Ga0501079_0007962 | 3300049741 | Bacteria | 8036 |
| 870 | Ga0501079_0032533 | 3300049741 | Bacteria | 4010 |
| 871 | Ga0501079_0032966 | 3300049741 | Bacteria | 3984 |
| 872 | Ga0501080_0019380 | 3300049742 | Bacteria | 6303 |
| 873 | Ga0501080_0283343 | 3300049742 | Bacteria | 1506 |
| 874 | Ga0501080_0321796 | 3300049742 | Bacteria | 1400 |
| 875 | Ga0501080_0553085 | 3300049742 | Bacteria | 1025 |
| 876 | Ga0501081_0006803 | 3300049743 | Bacteria | 7435 |
| 877 | Ga0501081_0123049 | 3300049743 | Bacteria | 1849 |
| 878 | Ga0501083_0083919 | 3300049744 | Bacteria | 2109 |
| 879 | Ga0501268_026199 | 3300049765 | Bacteria | 1029 |
| 880 | Ga0501035_0018095 | 3300049822 | Bacteria | 6493 |
| 881 | Ga0501035_0349642 | 3300049822 | Bacteria | 1237 |
| 882 | Ga0501035_0581988 | 3300049822 | Bacteria | 914 |
| 883 | Ga0501044_0005753 | 3300049823 | Bacteria | 13720 |
| 884 | Ga0501044_0012344 | 3300049823 | Bacteria | 9248 |
| 885 | Ga0501044_0033294 | 3300049823 | Bacteria | 5417 |
| 886 | Ga0501044_0061055 | 3300049823 | Bacteria | 3857 |
| 887 | Ga0501044_0139850 | 3300049823 | Bacteria | 2410 |
| 888 | Ga0501044_0184441 | 3300049823 | Bacteria | 2052 |
| 889 | Ga0501044_0187091 | 3300049823 | Bacteria | 2035 |
| 890 | Ga0501044_0239934 | 3300049823 | Bacteria | 1757 |
| 891 | Ga0501045_0150715 | 3300049824 | Bacteria | 1730 |
| 892 | nmdc:mga0k408_38879_c1 | 3300050493 | Bacteria | 2732 |
| 893 | nmdc:mga0k408_50943_c1 | 3300050493 | Bacteria | 2397 |
| 894 | nmdc:mga05p37_467355_c1 | 3300050507 | Bacteria | 1456 |
| 895 | nmdc:mga09592_152715_c1 | 3300050508 | Bacteria | 1993 |
| 896 | nmdc:mga09592_289660_c1 | 3300050508 | Bacteria | 1420 |
| 897 | nmdc:mga0qj67_10919_c2 | 3300050509 | Bacteria | 2210 |
| 898 | nmdc:mga06r32_635193_c1 | 3300050510 | Bacteria | 1037 |
| 899 | nmdc:mga08y16_774_c1 | 3300050511 | Bacteria | 30485 |
| 900 | nmdc:mga08y16_810615_c1 | 3300050511 | Bacteria | 928 |
| 901 | nmdc:mga08x19_212493_c1 | 3300050514 | Unclassified | 1328 |
| 902 | Ga0500578_0001100 | 3300053086 | Bacteria | 29178 |
| 903 | Ga0500578_0042281 | 3300053086 | Bacteria | 2927 |
| 904 | Ga0500646_0019687 | 3300053090 | Bacteria | 1787 |
| 905 | Ga0500583_0000178 | 3300053092 | Bacteria | 26108 |
| 906 | Ga0500583_0000423 | 3300053092 | Bacteria | 13374 |
| 907 | Ga0500583_0005597 | 3300053092 | Bacteria | 4230 |
| 908 | Ga0500651_0199022 | 3300053093 | Bacteria | 1183 |
| 909 | Ga0500650_0025566 | 3300053098 | Bacteria | 2641 |
| 910 | Ga0500562_000024 | 3300053108 | Bacteria | 105996 |
| 911 | Ga0500642_0080352 | 3300053130 | Bacteria | 1497 |
| 912 | Ga0500658_0000784 | 3300053134 | Bacteria | 13145 |
| 913 | Ga0500559_0115378 | 3300053136 | Bacteria | 1246 |
| 914 | Ga0500577_0002983 | 3300053142 | Bacteria | 4362 |
| 915 | Ga0500588_0012718 | 3300053146 | Bacteria | 2094 |
| 916 | Ga0500589_015859 | 3300053147 | Bacteria | 3370 |
| 917 | Ga0500589_033158 | 3300053147 | Bacteria | 2410 |
| 918 | Ga0500616_0004239 | 3300053153 | Bacteria | 10316 |
| 919 | Ga0500616_0004541 | 3300053153 | Bacteria | 9835 |
| 920 | Ga0500616_0117772 | 3300053153 | Bacteria | 1273 |
| 921 | Ga0500619_034445 | 3300053154 | Bacteria | 1565 |
| 922 | Ga0500622_0000604 | 3300053156 | Bacteria | 32597 |
| 923 | Ga0500622_0004624 | 3300053156 | Bacteria | 8541 |
| 924 | Ga0500622_0006488 | 3300053156 | Bacteria | 6771 |
| 925 | Ga0500637_0110281 | 3300053178 | Bacteria | 1596 |
| 926 | Ga0501084_0009204 | 3300054114 | Bacteria | 8167 |
| 927 | Ga0501084_0020525 | 3300054114 | Bacteria | 5511 |
| 928 | Ga0501084_0021111 | 3300054114 | Bacteria | 5431 |
| 929 | Ga0500661_022751 | 3300055283 | Bacteria | 1110 |
| 930 | Ga0501082_0030525 | 3300060353 | Bacteria | 4645 |
| 931 | Ga0501082_0082191 | 3300060353 | Bacteria | 2779 |
| 932 | Ga0466962_0007361 | 3300061719 | Bacteria | 5283 |
| 933 | Ga0530510_0164347 | 3300061734 | Bacteria | 1642 |
| 934 | Ga0530510_0234677 | 3300061734 | Bacteria | 1365 |
| 935 | Ga0466971_0094047 | |||
| 936 | JGI24740J21852_10027924 | |||
| 937 | JGI24744J21845_10011658 | |||
| 938 | rootH2_10045629 | |||
| 939 | rootL2_10007799 | |||
| 940 | rootH1_10020501 | |||
| 941 | rootH1_10091167 | |||
| 942 | rootH1_10110187 | |||
| 943 | rootH1_10233433 | |||
| 944 | rootH1_10360310 | |||
| 945 | JGI25160J50197_1001126 | |||
| 946 | Ga0065704_10231174 | |||
| 947 | Ga0065712_10151133 | |||
| 948 | Ga0070658_10020879 | |||
| 949 | Ga0070658_10120126 | |||
| 950 | Ga0070658_10175107 | |||
| 951 | Ga0070658_10245921 | |||
| 952 | Ga0070658_10504616 | |||
| 953 | Ga0070676_10005328 | |||
| 954 | Ga0070676_10017475 | |||
| 955 | Ga0070676_10065452 | |||
| 956 | Ga0070683_100001753 | |||
| 957 | Ga0070683_100008191 | |||
| 958 | Ga0070683_100120864 | |||
| 959 | Ga0070683_100222713 | |||
| 960 | Ga0070683_100435638 | |||
| 961 | Ga0070683_100444048 | |||
| 962 | Ga0070690_100008288 | |||
| 963 | Ga0070690_100012515 | |||
| 964 | Ga0070690_100474639 | |||
| 965 | Ga0070670_100024150 | |||
| 966 | Ga0070670_100071294 | |||
| 967 | Ga0068869_100002434 | |||
| 968 | Ga0068869_100005896 | |||
| 969 | Ga0068869_100045335 | |||
| 970 | Ga0068869_100340827 | |||
| 971 | Ga0070666_10000180 | |||
| 972 | Ga0070666_10005857 | |||
| 973 | Ga0070666_10011450 | |||
| 974 | Ga0070666_10340487 | |||
| 975 | Ga0070680_100000160 | |||
| 976 | Ga0070680_100008618 | |||
| 977 | Ga0070680_100028415 | |||
| 978 | Ga0070680_100099186 | |||
| 979 | Ga0070680_100309643 | |||
| 980 | Ga0070682_100037628 | |||
| 981 | Ga0070682_100048972 | |||
| 982 | Ga0070682_100058138 | |||
| 983 | Ga0068868_100007696 | |||
| 984 | Ga0068868_100012050 | |||
| 985 | Ga0068868_100038299 | |||
| 986 | Ga0068868_100063905 | |||
| 987 | Ga0068868_100109922 | |||
| 988 | Ga0068868_100156479 | |||
| 989 | Ga0070660_100111515 | |||
| 990 | Ga0070689_100064413 | |||
| 991 | Ga0070689_100382674 | |||
| 992 | Ga0070691_10013373 | |||
| 993 | Ga0070687_100221274 | |||
| 994 | Ga0070661_100000673 | |||
| 995 | Ga0070668_100117427 | |||
| 996 | Ga0070668_100828070 | |||
| 997 | Ga0070669_100016770 | |||
| 998 | Ga0070669_100033590 | |||
| 999 | Ga0070669_100288054 | |||
| 1000 | Ga0070675_100015247 | |||
| 1001 | Ga0070675_100049965 | |||
| 1002 | Ga0070675_100424540 | |||
| 1003 | Ga0070671_100048424 | |||
| 1004 | Ga0070671_100085996 | |||
| 1005 | Ga0070671_100091725 | |||
| 1006 | Ga0070671_100133000 | |||
| 1007 | Ga0070671_100305510 | |||
| 1008 | Ga0070671_100700711 | |||
| 1009 | Ga0070674_100006931 | |||
| 1010 | Ga0070674_100177769 | |||
| 1011 | Ga0070673_100011533 | |||
| 1012 | Ga0070673_100012386 | |||
| 1013 | Ga0070673_100015554 | |||
| 1014 | Ga0070673_100071680 | |||
| 1015 | Ga0070673_100076433 | |||
| 1016 | Ga0070673_100195098 | |||
| 1017 | Ga0070688_100002105 | |||
| 1018 | Ga0070688_100017578 | |||
| 1019 | Ga0070688_100028097 | |||
| 1020 | Ga0070688_100049641 | |||
| 1021 | Ga0070659_100007500 | |||
| 1022 | Ga0070659_100043633 | |||
| 1023 | Ga0070659_100366109 | |||
| 1024 | Ga0070667_100011123 | |||
| 1025 | Ga0070667_100078527 | |||
| 1026 | Ga0070667_100096637 | |||
| 1027 | Ga0070667_100765651 | |||
| 1028 | Ga0070705_100343587 | |||
| 1029 | Ga0070708_100284530 | |||
| 1030 | Ga0070663_100031733 | |||
| 1031 | Ga0070663_100194504 | |||
| 1032 | Ga0070663_100408776 | |||
| 1033 | Ga0070663_100514676 | |||
| 1034 | Ga0070678_100002640 | |||
| 1035 | Ga0070678_100217658 | |||
| 1036 | Ga0070678_100640989 | |||
| 1037 | Ga0070662_100025737 | |||
| 1038 | Ga0070662_100036854 | |||
| 1039 | Ga0070662_100037770 | |||
| 1040 | Ga0070662_100302486 | |||
| 1041 | Ga0070681_10010880 | |||
| 1042 | Ga0070681_10012368 | |||
| 1043 | Ga0070681_10060327 | |||
| 1044 | Ga0070681_10183060 | |||
| 1045 | Ga0068867_100032189 | |||
| 1046 | Ga0068867_100036850 | |||
| 1047 | Ga0068867_100042237 | |||
| 1048 | Ga0068867_100075887 | |||
| 1049 | Ga0068867_100078426 | |||
| 1050 | Ga0068867_100186769 | |||
| 1051 | Ga0068867_100548989 | |||
| 1052 | Ga0070685_10220514 | |||
| 1053 | Ga0070706_100108822 | |||
| 1054 | Ga0070706_100385776 | |||
| 1055 | Ga0070707_100019962 | |||
| 1056 | Ga0070707_100045685 | |||
| 1057 | Ga0070698_100100334 | |||
| 1058 | Ga0070698_100212900 | |||
| 1059 | Ga0070699_100097893 | |||
| 1060 | Ga0070679_100000373 | |||
| 1061 | Ga0070679_100002115 | |||
| 1062 | Ga0070679_100008347 | |||
| 1063 | Ga0070679_100017813 | |||
| 1064 | Ga0070679_100072103 | |||
| 1065 | Ga0070679_100099933 | |||
| 1066 | Ga0070684_100000308 | |||
| 1067 | Ga0070684_100001157 | |||
| 1068 | Ga0070684_100074530 | |||
| 1069 | Ga0070684_100444288 | |||
| 1070 | Ga0070697_100347038 | |||
| 1071 | Ga0070697_100471611 | |||
| 1072 | Ga0070697_100719298 | |||
| 1073 | Ga0068853_100000957 | |||
| 1074 | Ga0068853_100006084 | |||
| 1075 | Ga0068853_100031721 | |||
| 1076 | Ga0068853_100066128 | |||
| 1077 | Ga0068853_100080141 | |||
| 1078 | Ga0068853_100101860 | |||
| 1079 | Ga0068853_100109828 | |||
| 1080 | Ga0068853_100172222 | |||
| 1081 | Ga0068853_100223577 | |||
| 1082 | Ga0068853_100309131 | |||
| 1083 | Ga0070672_100031368 | |||
| 1084 | Ga0070672_100035102 | |||
| 1085 | Ga0070672_100050513 | |||
| 1086 | Ga0070672_100083725 | |||
| 1087 | Ga0070672_100131228 | |||
| 1088 | Ga0070686_100012543 | |||
| 1089 | Ga0070686_100088009 | |||
| 1090 | Ga0070686_100129350 | |||
| 1091 | Ga0070693_100026036 | |||
| 1092 | Ga0070665_100006640 | |||
| 1093 | Ga0070665_100009608 | |||
| 1094 | Ga0070665_100097871 | |||
| 1095 | Ga0070665_100571604 | |||
| 1096 | Ga0068855_100002019 | |||
| 1097 | Ga0068855_100023611 | |||
| 1098 | Ga0068855_100032608 | |||
| 1099 | Ga0068855_100046237 | |||
| 1100 | Ga0068855_100048404 | |||
| 1101 | Ga0068855_100048612 | |||
| 1102 | Ga0068855_100080927 | |||
| 1103 | Ga0068855_100259612 | |||
| 1104 | Ga0070664_100000958 | |||
| 1105 | Ga0070664_100015270 | |||
| 1106 | Ga0070664_100021342 | |||
| 1107 | Ga0070664_100231410 | |||
| 1108 | Ga0070664_100240380 | |||
| 1109 | Ga0070664_100249759 | |||
| 1110 | Ga0070664_100656072 | |||
| 1111 | Ga0068857_100001014 | |||
| 1112 | Ga0068857_100002017 | |||
| 1113 | Ga0068857_100029491 | |||
| 1114 | Ga0068857_100100527 | |||
| 1115 | Ga0068857_100156703 | |||
| 1116 | Ga0068857_100239379 | |||
| 1117 | Ga0068854_100022206 | |||
| 1118 | Ga0068854_100059430 | |||
| 1119 | Ga0068854_100067054 | |||
| 1120 | Ga0068854_100082962 | |||
| 1121 | Ga0068854_100092561 | |||
| 1122 | Ga0068856_100008367 | |||
| 1123 | Ga0068856_100031265 | |||
| 1124 | Ga0068856_100063747 | |||
| 1125 | Ga0068856_100077004 | |||
| 1126 | Ga0068856_100190293 | |||
| 1127 | Ga0068856_100238671 | |||
| 1128 | Ga0068856_100300471 | |||
| 1129 | Ga0070702_100135901 | |||
| 1130 | Ga0068852_100000391 | |||
| 1131 | Ga0068852_100002613 | |||
| 1132 | Ga0068852_100009517 | |||
| 1133 | Ga0068852_100027775 | |||
| 1134 | Ga0068852_100050186 | |||
| 1135 | Ga0068852_100052369 | |||
| 1136 | Ga0068852_100067638 | |||
| 1137 | Ga0068852_100129164 | |||
| 1138 | Ga0068852_100365622 | |||
| 1139 | Ga0068852_100471710 | |||
| 1140 | Ga0068852_100725881 | |||
| 1141 | Ga0068859_100000003 | |||
| 1142 | Ga0068859_100026207 | |||
| 1143 | Ga0068859_100032310 | |||
| 1144 | Ga0068859_100054117 | |||
| 1145 | Ga0068859_100076244 | |||
| 1146 | Ga0068859_100483069 | |||
| 1147 | Ga0068864_100003333 | |||
| 1148 | Ga0068864_100063041 | |||
| 1149 | Ga0068864_100089257 | |||
| 1150 | Ga0068864_100242112 | |||
| 1151 | Ga0068864_100309553 | |||
| 1152 | Ga0068864_100311447 | |||
| 1153 | Ga0068866_10011382 | |||
| 1154 | Ga0068866_10024077 | |||
| 1155 | Ga0068861_100098237 | |||
| 1156 | Ga0068861_100375128 | |||
| 1157 | Ga0068861_100750677 | |||
| 1158 | Ga0068851_10093714 | |||
| 1159 | Ga0068870_10015034 | |||
| 1160 | Ga0068863_100005788 | |||
| 1161 | Ga0068863_100012606 | |||
| 1162 | Ga0068863_100016247 | |||
| 1163 | Ga0068863_100213568 | |||
| 1164 | Ga0068863_100426051 | |||
| 1165 | Ga0068858_100026971 | |||
| 1166 | Ga0068858_100201531 | |||
| 1167 | Ga0068858_100229802 | |||
| 1168 | Ga0068858_100302355 | |||
| 1169 | Ga0068858_100514434 | |||
| 1170 | Ga0068860_100000003 | |||
| 1171 | Ga0068860_100002558 | |||
| 1172 | Ga0068860_100003354 | |||
| 1173 | Ga0068860_100003552 | |||
| 1174 | Ga0068860_100006921 | |||
| 1175 | Ga0068860_100018142 | |||
| 1176 | Ga0068860_100026287 | |||
| 1177 | Ga0068860_100048563 | |||
| 1178 | Ga0068860_100098485 | |||
| 1179 | Ga0068860_100109663 | |||
| 1180 | Ga0068860_100320370 | |||
| 1181 | Ga0068862_100015156 | |||
| 1182 | Ga0068862_100027769 | |||
| 1183 | Ga0068862_100047364 | |||
| 1184 | Ga0068862_100522522 | |||
| 1185 | Ga0081539_10000874 | |||
| 1186 | Ga0081539_10013810 | |||
| 1187 | Ga0070715_10031753 | |||
| 1188 | Ga0070715_10078026 | |||
| 1189 | Ga0070715_10164093 | |||
| 1190 | Ga0070716_100551449 | |||
| 1191 | Ga0075366_10017273 | |||
| 1192 | Ga0097621_100023546 | |||
| 1193 | Ga0097621_100127133 | |||
| 1194 | Ga0097621_100425678 | |||
| 1195 | Ga0097621_100469822 | |||
| 1196 | Ga0068871_100013234 | |||
| 1197 | Ga0068871_100050582 | |||
| 1198 | Ga0068871_100548856 | |||
| 1199 | Ga0068871_100708247 | |||
| 1200 | Ga0075428_100056033 | |||
| 1201 | Ga0075431_100003549 | |||
| 1202 | Ga0075433_10050116 | |||
| 1203 | Ga0075434_100652521 | |||
| 1204 | Ga0075429_100114668 | |||
| 1205 | Ga0075429_100242249 | |||
| 1206 | Ga0075429_100335895 | |||
| 1207 | Ga0068865_100001391 | |||
| 1208 | Ga0068865_100150544 | |||
| 1209 | Ga0068865_100739134 | |||
| 1210 | Ga0075436_100240193 | |||
| 1211 | Ga0097620_100000003 | |||
| 1212 | Ga0097620_100026206 | |||
| 1213 | Ga0097620_100032311 | |||
| 1214 | Ga0097620_100054117 | |||
| 1215 | Ga0097620_100076244 | |||
| 1216 | Ga0097620_100483140 | |||
| 1217 | Ga0075435_100041523 | |||
| 1218 | Ga0075435_100146901 | |||
| 1219 | Ga0099794_10006781 | |||
| 1220 | Ga0105251_10059696 | |||
| 1221 | Ga0105244_10000339 | |||
| 1222 | Ga0105240_10000664 | |||
| 1223 | Ga0105240_10003417 | |||
| 1224 | Ga0105240_10005202 | |||
| 1225 | Ga0105240_10007539 | |||
| 1226 | Ga0105240_10013672 | |||
| 1227 | Ga0105240_10028985 | |||
| 1228 | Ga0105240_10030484 | |||
| 1229 | Ga0105240_10080146 | |||
| 1230 | Ga0105240_10730103 | |||
| 1231 | Ga0111539_10001581 | |||
| 1232 | Ga0111539_10235359 | |||
| 1233 | Ga0105245_10032550 | |||
| 1234 | Ga0105245_10106189 | |||
| 1235 | Ga0105245_10885541 | |||
| 1236 | Ga0105247_10002199 | |||
| 1237 | Ga0105247_10241224 | |||
| 1238 | Ga0114129_10544516 | |||
| 1239 | Ga0105243_10234429 | |||
| 1240 | Ga0105241_10000439 | |||
| 1241 | Ga0105241_10003204 | |||
| 1242 | Ga0105241_10008515 | |||
| 1243 | Ga0105241_10009295 | |||
| 1244 | Ga0105241_10091778 | |||
| 1245 | Ga0105241_10145220 | |||
| 1246 | Ga0105241_10975732 | |||
| 1247 | Ga0105242_10126139 | |||
| 1248 | Ga0105242_10200577 | |||
| 1249 | Ga0105242_10220383 | |||
| 1250 | Ga0105242_10343054 | |||
| 1251 | Ga0105242_10377363 | |||
| 1252 | Ga0105242_10509121 | |||
| 1253 | Ga0105248_10693517 | |||
| 1254 | Ga0105237_10000144 | |||
| 1255 | Ga0105237_10001444 | |||
| 1256 | Ga0105237_10001848 | |||
| 1257 | Ga0105237_10006055 | |||
| 1258 | Ga0105237_10006468 | |||
| 1259 | Ga0105237_10006867 | |||
| 1260 | Ga0105237_10011763 | |||
| 1261 | Ga0105237_10030017 | |||
| 1262 | Ga0105237_10058802 | |||
| 1263 | Ga0105237_10127139 | |||
| 1264 | Ga0105237_10867548 | |||
| 1265 | Ga0105238_10001637 | |||
| 1266 | Ga0105238_10123249 | |||
| 1267 | Ga0105238_10383260 | |||
| 1268 | Ga0105249_10022903 | |||
| 1269 | Ga0105249_10025203 | |||
| 1270 | Ga0105249_10136703 | |||
| 1271 | Ga0105249_10292430 | |||
| 1272 | Ga0105249_10382898 | |||
| 1273 | Ga0105239_10000488 | |||
| 1274 | Ga0105239_10001785 | |||
| 1275 | Ga0105239_10003818 | |||
| 1276 | Ga0105239_10008966 | |||
| 1277 | Ga0105239_10033745 | |||
| 1278 | Ga0105239_10047335 | |||
| 1279 | Ga0105239_10053132 | |||
| 1280 | Ga0105239_10057502 | |||
| 1281 | Ga0105239_10061065 | |||
| 1282 | Ga0105239_10552075 | |||
| 1283 | Ga0105246_10019885 | |||
| 1284 | Ga0105246_10340982 | |||
| 1285 | Ga0157373_10019736 | |||
| 1286 | Ga0157373_10020245 | |||
| 1287 | Ga0157373_10035440 | |||
| 1288 | Ga0157373_10065050 | |||
| 1289 | Ga0157373_10105215 | |||
| 1290 | Ga0157373_10129817 | |||
| 1291 | Ga0157373_10234566 | |||
| 1292 | Ga0157371_10002684 | |||
| 1293 | Ga0157371_10011287 | |||
| 1294 | Ga0157371_10014557 | |||
| 1295 | Ga0157371_10021639 | |||
| 1296 | Ga0157371_10039728 | |||
| 1297 | Ga0157371_10040190 | |||
| 1298 | Ga0157371_10045338 | |||
| 1299 | Ga0157371_10048001 | |||
| 1300 | Ga0157371_10072741 | |||
| 1301 | Ga0157371_10109636 | |||
| 1302 | Ga0157371_10239821 | |||
| 1303 | Ga0157371_10244953 | |||
| 1304 | Ga0157371_10255970 | |||
| 1305 | Ga0157370_10001484 | |||
| 1306 | Ga0157370_10001848 | |||
| 1307 | Ga0157370_10006166 | |||
| 1308 | Ga0157370_10008668 | |||
| 1309 | Ga0157370_10367155 | |||
| 1310 | Ga0157370_10540032 | |||
| 1311 | Ga0157370_10544911 | |||
| 1312 | Ga0157369_10026472 | |||
| 1313 | Ga0157369_10031028 | |||
| 1314 | Ga0157369_10078140 | |||
| 1315 | Ga0157369_10202206 | |||
| 1316 | Ga0157369_10318581 | |||
| 1317 | Ga0157369_10433005 | |||
| 1318 | Ga0157374_10031460 | |||
| 1319 | Ga0157374_10035657 | |||
| 1320 | Ga0157374_10048484 | |||
| 1321 | Ga0157374_10119424 | |||
| 1322 | Ga0157374_10150905 | |||
| 1323 | Ga0157374_10364111 | |||
| 1324 | Ga0157378_10003719 | |||
| 1325 | Ga0157378_10005510 | |||
| 1326 | Ga0157378_10016875 | |||
| 1327 | Ga0157378_10053515 | |||
| 1328 | Ga0157378_10108130 | |||
| 1329 | Ga0157378_10168242 | |||
| 1330 | Ga0157378_10238526 | |||
| 1331 | Ga0157378_10494629 | |||
| 1332 | Ga0163162_10001183 | |||
| 1333 | Ga0163162_10002547 | |||
| 1334 | Ga0163162_10003339 | |||
| 1335 | Ga0163162_10024718 | |||
| 1336 | Ga0163162_10107083 | |||
| 1337 | Ga0163162_10107340 | |||
| 1338 | Ga0163162_10162201 | |||
| 1339 | Ga0163162_10297209 | |||
| 1340 | Ga0163162_10880576 | |||
| 1341 | Ga0157372_10000747 | |||
| 1342 | Ga0157372_10002589 | |||
| 1343 | Ga0157372_10010981 | |||
| 1344 | Ga0157372_10019462 | |||
| 1345 | Ga0157372_10032285 | |||
| 1346 | Ga0157372_10038383 | |||
| 1347 | Ga0157372_10039880 | |||
| 1348 | Ga0157372_10047116 | |||
| 1349 | Ga0157372_10049341 | |||
| 1350 | Ga0157372_10076348 | |||
| 1351 | Ga0157372_10084058 | |||
| 1352 | Ga0157372_10085944 | |||
| 1353 | Ga0157372_10090318 | |||
| 1354 | Ga0157372_10131510 | |||
| 1355 | Ga0157372_10137285 | |||
| 1356 | Ga0157372_10152899 | |||
| 1357 | Ga0157372_10187976 | |||
| 1358 | Ga0157372_10353237 | |||
| 1359 | Ga0157372_10371657 | |||
| 1360 | Ga0157372_10411734 | |||
| 1361 | Ga0157372_10532779 | |||
| 1362 | Ga0157372_10624938 | |||
| 1363 | Ga0157372_10648110 | |||
| 1364 | Ga0157372_10739288 | |||
| 1365 | Ga0157375_10192270 | |||
| 1366 | Ga0157375_10430058 | |||
| 1367 | Ga0157375_10445622 | |||
| 1368 | Ga0157375_10682159 | |||
| 1369 | Ga0157375_10693870 | |||
| 1370 | Ga0163163_10001099 | |||
| 1371 | Ga0163163_10189183 | |||
| 1372 | Ga0163163_10222935 | |||
| 1373 | Ga0157380_10360944 | |||
| 1374 | Ga0157380_10384579 | |||
| 1375 | Ga0157377_10004427 | |||
| 1376 | Ga0157379_10027316 | |||
| 1377 | Ga0157379_10102588 | |||
| 1378 | Ga0157379_10441801 | |||
| 1379 | Ga0157376_10008791 | |||
| 1380 | Ga0157376_10014902 | |||
| 1381 | Ga0157376_10024860 | |||
| 1382 | Ga0157376_10027426 | |||
| 1383 | Ga0157376_10126663 | |||
| 1384 | Ga0157376_10539513 | |||
| 1385 | Ga0163161_10021103 | |||
| 1386 | Ga0163161_10040298 | |||
| 1387 | Ga0163161_10127244 | |||
| 1388 | Ga0213876_10079219 | |||
| 1389 | Ga0209646_1007702 | |||
| 1390 | Ga0207426_1000230 | |||
| 1391 | Ga0207697_10105975 | |||
| 1392 | Ga0207655_1000319 | |||
| 1393 | Ga0207642_10145644 | |||
| 1394 | Ga0207710_10004189 | |||
| 1395 | Ga0207688_10177988 | |||
| 1396 | Ga0207680_10000073 | |||
| 1397 | Ga0207680_10133144 | |||
| 1398 | Ga0207680_10140021 | |||
| 1399 | Ga0207680_10218186 | |||
| 1400 | Ga0207680_10305253 | |||
| 1401 | Ga0207647_10131066 | |||
| 1402 | Ga0207647_10208838 | |||
| 1403 | Ga0207685_10029153 | |||
| 1404 | Ga0207645_10001118 | |||
| 1405 | Ga0207645_10001159 | |||
| 1406 | Ga0207645_10112007 | |||
| 1407 | Ga0207645_10175408 | |||
| 1408 | Ga0207645_10258663 | |||
| 1409 | Ga0207643_10049069 | |||
| 1410 | Ga0207705_10012442 | |||
| 1411 | Ga0207705_10053674 | |||
| 1412 | Ga0207705_10103224 | |||
| 1413 | Ga0207705_10182593 | |||
| 1414 | Ga0207705_10252420 | |||
| 1415 | Ga0207684_10304793 | |||
| 1416 | Ga0207654_10007264 | |||
| 1417 | Ga0207654_10008116 | |||
| 1418 | Ga0207654_10015008 | |||
| 1419 | Ga0207707_10004345 | |||
| 1420 | Ga0207707_10082925 | |||
| 1421 | Ga0207707_10118105 | |||
| 1422 | Ga0207695_10009734 | |||
| 1423 | Ga0207695_10020430 | |||
| 1424 | Ga0207695_10035578 | |||
| 1425 | Ga0207695_10062093 | |||
| 1426 | Ga0207695_10066998 | |||
| 1427 | Ga0207695_10097308 | |||
| 1428 | Ga0207695_10205612 | |||
| 1429 | Ga0207671_10000340 | |||
| 1430 | Ga0207671_10001368 | |||
| 1431 | Ga0207671_10001764 | |||
| 1432 | Ga0207671_10004891 | |||
| 1433 | Ga0207671_10006860 | |||
| 1434 | Ga0207671_10057113 | |||
| 1435 | Ga0207671_10080582 | |||
| 1436 | Ga0207671_10083349 | |||
| 1437 | Ga0207671_10443760 | |||
| 1438 | Ga0207693_10006758 | |||
| 1439 | Ga0207660_10032252 | |||
| 1440 | Ga0207660_10230062 | |||
| 1441 | Ga0207662_10076734 | |||
| 1442 | Ga0207662_10175341 | |||
| 1443 | Ga0207657_10029156 | |||
| 1444 | Ga0207649_10000652 | |||
| 1445 | Ga0207649_10051820 | |||
| 1446 | Ga0207649_10072850 | |||
| 1447 | Ga0207652_10002096 | |||
| 1448 | Ga0207652_10003075 | |||
| 1449 | Ga0207652_10036008 | |||
| 1450 | Ga0207652_10068797 | |||
| 1451 | Ga0207652_10129241 | |||
| 1452 | Ga0207646_10119142 | |||
| 1453 | Ga0207646_10119966 | |||
| 1454 | Ga0207646_10120713 | |||
| 1455 | Ga0207681_10133920 | |||
| 1456 | Ga0207681_10185533 | |||
| 1457 | Ga0207681_10207398 | |||
| 1458 | Ga0207694_10002249 | |||
| 1459 | Ga0207694_10208699 | |||
| 1460 | Ga0207694_10264494 | |||
| 1461 | Ga0207694_10275059 | |||
| 1462 | Ga0207650_10117284 | |||
| 1463 | Ga0207650_10553510 | |||
| 1464 | Ga0207659_10009411 | |||
| 1465 | Ga0207659_10078035 | |||
| 1466 | Ga0207659_10206055 | |||
| 1467 | Ga0207659_10438346 | |||
| 1468 | Ga0207687_10102671 | |||
| 1469 | Ga0207644_10186187 | |||
| 1470 | Ga0207644_10196624 | |||
| 1471 | Ga0207644_10414714 | |||
| 1472 | Ga0207644_10514443 | |||
| 1473 | Ga0207690_10011269 | |||
| 1474 | Ga0207690_10088570 | |||
| 1475 | Ga0207690_10351645 | |||
| 1476 | Ga0207706_10013035 | |||
| 1477 | Ga0207706_10049929 | |||
| 1478 | Ga0207706_10102106 | |||
| 1479 | Ga0207706_10257795 | |||
| 1480 | Ga0207706_10310377 | |||
| 1481 | Ga0207686_10039957 | |||
| 1482 | Ga0207686_10079789 | |||
| 1483 | Ga0207686_10179549 | |||
| 1484 | Ga0207686_10255047 | |||
| 1485 | Ga0207670_10056714 | |||
| 1486 | Ga0207670_10353159 | |||
| 1487 | Ga0207669_10013085 | |||
| 1488 | Ga0207669_10391680 | |||
| 1489 | Ga0207704_10331598 | |||
| 1490 | Ga0207665_10249128 | |||
| 1491 | Ga0207691_10027569 | |||
| 1492 | Ga0207691_10029587 | |||
| 1493 | Ga0207691_10043865 | |||
| 1494 | Ga0207691_10050536 | |||
| 1495 | Ga0207691_10053181 | |||
| 1496 | Ga0207691_10290802 | |||
| 1497 | Ga0207691_10324183 | |||
| 1498 | Ga0207691_10337574 | |||
| 1499 | Ga0207689_10000401 | |||
| 1500 | Ga0207689_10002161 | |||
| 1501 | Ga0207689_10007614 | |||
| 1502 | Ga0207689_10028784 | |||
| 1503 | Ga0207689_10246368 | |||
| 1504 | Ga0207661_10000183 | |||
| 1505 | Ga0207661_10171704 | |||
| 1506 | Ga0207661_10268831 | |||
| 1507 | Ga0207661_10354337 | |||
| 1508 | Ga0207679_10000308 | |||
| 1509 | Ga0207679_10001821 | |||
| 1510 | Ga0207679_10093390 | |||
| 1511 | Ga0207679_10780230 | |||
| 1512 | Ga0207667_10001839 | |||
| 1513 | Ga0207667_10027111 | |||
| 1514 | Ga0207667_10027484 | |||
| 1515 | Ga0207667_10044303 | |||
| 1516 | Ga0207667_10048503 | |||
| 1517 | Ga0207667_10049946 | |||
| 1518 | Ga0207667_10071860 | |||
| 1519 | Ga0207667_10208296 | |||
| 1520 | Ga0207651_10079722 | |||
| 1521 | Ga0207651_10165324 | |||
| 1522 | Ga0207651_10181635 | |||
| 1523 | Ga0207651_10242481 | |||
| 1524 | Ga0207712_10015315 | |||
| 1525 | Ga0207712_10043042 | |||
| 1526 | Ga0207712_10474337 | |||
| 1527 | Ga0207668_10081267 | |||
| 1528 | Ga0207668_10115649 | |||
| 1529 | Ga0207640_10027790 | |||
| 1530 | Ga0207640_10028369 | |||
| 1531 | Ga0207640_10102146 | |||
| 1532 | Ga0207640_10378316 | |||
| 1533 | Ga0207658_10018404 | |||
| 1534 | Ga0207658_10039102 | |||
| 1535 | Ga0207658_10794151 | |||
| 1536 | Ga0207677_10078621 | |||
| 1537 | Ga0207677_10087739 | |||
| 1538 | Ga0207677_10095717 | |||
| 1539 | Ga0207677_10137814 | |||
| 1540 | Ga0207677_10162319 | |||
| 1541 | Ga0207703_10005399 | |||
| 1542 | Ga0207703_10160115 | |||
| 1543 | Ga0207703_10289225 | |||
| 1544 | Ga0207639_10000781 | |||
| 1545 | Ga0207639_10031366 | |||
| 1546 | Ga0207639_10055426 | |||
| 1547 | Ga0207639_10077394 | |||
| 1548 | Ga0207639_10080265 | |||
| 1549 | Ga0207639_10081993 | |||
| 1550 | Ga0207639_10105021 | |||
| 1551 | Ga0207639_10348196 | |||
| 1552 | Ga0207678_10198191 | |||
| 1553 | Ga0207678_10251539 | |||
| 1554 | Ga0207678_10673256 | |||
| 1555 | Ga0207708_10063391 | |||
| 1556 | Ga0207708_10084925 | |||
| 1557 | Ga0207702_10046094 | |||
| 1558 | Ga0207702_10063143 | |||
| 1559 | Ga0207702_10150941 | |||
| 1560 | Ga0207702_10187298 | |||
| 1561 | Ga0207702_10804366 | |||
| 1562 | Ga0207641_10000026 | |||
| 1563 | Ga0207641_10052405 | |||
| 1564 | Ga0207641_10107554 | |||
| 1565 | Ga0207641_10112838 | |||
| 1566 | Ga0207641_10120558 | |||
| 1567 | Ga0207641_10894064 | |||
| 1568 | Ga0207648_10006875 | |||
| 1569 | Ga0207648_10010880 | |||
| 1570 | Ga0207648_10032100 | |||
| 1571 | Ga0207648_10044012 | |||
| 1572 | Ga0207648_10079887 | |||
| 1573 | Ga0207648_10098697 | |||
| 1574 | Ga0207648_10215645 | |||
| 1575 | Ga0207648_10301549 | |||
| 1576 | Ga0207648_10575192 | |||
| 1577 | Ga0207676_10004939 | |||
| 1578 | Ga0207676_10012670 | |||
| 1579 | Ga0207676_10073296 | |||
| 1580 | Ga0207676_10136904 | |||
| 1581 | Ga0207676_10284854 | |||
| 1582 | Ga0207676_10516291 | |||
| 1583 | Ga0207674_10001969 | |||
| 1584 | Ga0207674_10002814 | |||
| 1585 | Ga0207674_10035586 | |||
| 1586 | Ga0207674_10091190 | |||
| 1587 | Ga0207675_100081816 | |||
| 1588 | Ga0207683_10001619 | |||
| 1589 | Ga0207683_10040532 | |||
| 1590 | Ga0207683_10072459 | |||
| 1591 | Ga0207683_10489616 | |||
| 1592 | Ga0207683_10629286 | |||
| 1593 | Ga0207698_10000497 | |||
| 1594 | Ga0207698_10007369 | |||
| 1595 | Ga0207698_10012029 | |||
| 1596 | Ga0207698_10022588 | |||
| 1597 | Ga0207698_10113560 | |||
| 1598 | Ga0207698_10136153 | |||
| 1599 | Ga0207698_10145348 | |||
| 1600 | Ga0207698_10266545 | |||
| 1601 | Ga0207698_10503965 | |||
| 1602 | Ga0207698_10635663 | |||
| 1603 | Ga0209982_1012733 | |||
| 1604 | Ga0207428_10001077 | |||
| 1605 | Ga0268266_10038672 | |||
| 1606 | Ga0268266_10373176 | |||
| 1607 | Ga0268266_10652240 | |||
| 1608 | Ga0268265_10204101 | |||
| 1609 | Ga0268265_10287793 | |||
| 1610 | Ga0268264_10000063 | |||
| 1611 | Ga0268264_10002827 | |||
| 1612 | Ga0268264_10003689 | |||
| 1613 | Ga0268264_10006688 | |||
| 1614 | Ga0268264_10007051 | |||
| 1615 | Ga0268264_10008422 | |||
| 1616 | Ga0268264_10064841 | |||
| 1617 | Ga0268264_10084121 | |||
| 1618 | Ga0268264_10109516 | |||
| 1619 | Ga0268264_10171735 | |||
| 1620 | Ga0268264_10268391 | |||
| 1621 | Ga0268264_10741239 | |||
| 1622 | Ga0307517_10000487 | |||
| 1623 | Ga0307517_10248707 | |||
| 1624 | Ga0307515_10000031 | |||
| 1625 | Ga0265324_10043530 | |||
| 1626 | Ga0307511_10000409 | |||
| 1627 | Ga0265327_10000361 | |||
| 1628 | Ga0265327_10002040 | |||
| 1629 | Ga0265327_10025120 | |||
| 1630 | Ga0265327_10045674 | |||
| 1631 | Ga0265327_10059461 | |||
| 1632 | Ga0265327_10073047 | |||
| 1633 | Ga0307513_10064018 | |||
| 1634 | Ga0307513_10106136 | |||
| 1635 | Ga0307513_10181570 | |||
| 1636 | Ga0307509_10029747 | |||
| 1637 | Ga0307509_10030741 | |||
| 1638 | Ga0307509_10097984 | |||
| 1639 | Ga0307509_10314268 | |||
| 1640 | Ga0307508_10001223 | |||
| 1641 | Ga0307412_10625761 | |||
| 1642 | Ga0307414_10076475 | |||
| 1643 | Ga0307415_100294833 | |||
| 1644 | Ga0307507_10320594 | |||
| 1645 | Ga0307510_10000336 | |||
| 1646 | Ga0373940_0012715 | |||
| 1647 | Ga0373952_0053528 | |||
| 1648 | Ga0373932_0009426 | |||
| 1649 | Ga0373936_0051884 | |||
| 1650 | Ga0373943_0214058 | |||
| 1651 | Ga0373931_0348427 | |||
| 1652 | Ga0373947_0140452 | |||
| 1653 | Ga0373925_0452009 | |||
| 1654 | Ga0395899_0089923 | |||
| 1655 | Ga0395899_0254323 | |||
| 1656 | Ga0395899_0304986 | |||
| 1657 | Ga0395899_0373142 | |||
| 1658 | Ga0395900_0005734 | |||
| 1659 | Ga0395900_0008143 | |||
| 1660 | Ga0395900_0037400 | |||
| 1661 | Ga0395900_0120690 | |||
| 1662 | Ga0395900_0121931 | |||
| 1663 | Ga0395900_0461272 | |||
| 1664 | Ga0395898_0030880 | |||
| 1665 | Ga0395898_0094181 | |||
| 1666 | Ga0395898_0175600 | |||
| 1667 | Ga0395898_0221924 | |||
| 1668 | Ga0395905_0004944 | |||
| 1669 | Ga0395901_0020717 | |||
| 1670 | Ga0395901_0069764 | |||
| 1671 | Ga0395901_0535612 | |||
| 1672 | Ga0395901_0924696 | |||
| 1673 | Ga0436365_0072673 | |||
| 1674 | Ga0439436_0001458 | |||
| 1675 | Ga0439439_0083060 | |||
| 1676 | Ga0451798_1071503 | |||
| 1677 | Ga0451853_1545065 | |||
| 1678 | Ga0439431_0001238 | |||
| 1679 | Ga0439445_0082182 | |||
| 1680 | Ga0439449_0043975 | |||
| 1681 | Ga0439462_0010105 | |||
| 1682 | Ga0450894_010142 | |||
| 1683 | Ga0451577_0102058 | |||
| 1684 | Ga0466969_0000106 | |||
| 1685 | Ga0466972_0000001 | |||
| 1686 | Ga0466972_0000009 | |||
| 1687 | Ga0466972_0013745 | |||
| 1688 | Ga0453683_0378811 | |||
| 1689 | Ga0466965_0152012 | |||
| 1690 | Ga0466966_0013873 | |||
| 1691 | Ga0466966_0219284 | |||
| 1692 | Ga0466961_0081762 | |||
| 1693 | Ga0466964_0052211 | |||
| 1694 | Ga0453684_0059693 | |||
| 1695 | Ga0453684_0667490 | |||
| 1696 | Ga0466971_0016757 | |||
| 1697 | Ga0466968_0003751 | |||
| 1698 | Ga0466970_0000065 | |||
| 1699 | Ga0466957_0018840 | |||
| 1700 | Ga0466957_0068514 | |||
| 1701 | Ga0466957_0154036 | |||
| 1702 | Ga0466959_0000003 | |||
| 1703 | Ga0466959_0000676 | |||
| 1704 | Ga0466959_0005241 | |||
| 1705 | Ga0466958_0002924 | |||
| 1706 | Ga0495580_0005114 | |||
| 1707 | Ga0495580_0271100 | |||
| 1708 | Ga0495606_0004941 | |||
| 1709 | Ga0495608_0336371 | |||
| 1710 | Ga0495630_0003451 | |||
| 1711 | Ga0495648_0002648 | |||
| 1712 | Ga0495642_0070152 | |||
| 1713 | Ga0495587_0052848 | |||
| 1714 | Ga0495667_0136777 | |||
| 1715 | Ga0495668_0022644 | |||
| 1716 | Ga0495613_0114858 | |||
| 1717 | Ga0495649_0010201 | |||
| 1718 | Ga0495674_0085719 | |||
| 1719 | Ga0495676_0200965 | |||
| 1720 | Ga0495680_0121204 | |||
| 1721 | Ga0495687_001778 | |||
| 1722 | Ga0495686_0000010 | |||
| 1723 | Ga0496104_0245051 | |||
| 1724 | Ga0496104_0602399 | |||
| 1725 | Ga0496109_0097878 | |||
| 1726 | Ga0496110_0088733 | |||
| 1727 | Ga0496115_0284468 | |||
| 1728 | Ga0496124_0037486 | |||
| 1729 | Ga0501290_010528 | |||
| 1730 | Ga0501298_010684 | |||
| 1731 | Ga0501298_041262 | |||
| 1732 | Ga0501300_014174 | |||
| 1733 | Ga0501032_0007076 | |||
| 1734 | Ga0501032_0288537 | |||
| 1735 | Ga0501033_0064223 | |||
| 1736 | Ga0501033_0149431 | |||
| 1737 | Ga0501034_0000152 | |||
| 1738 | Ga0501034_0008450 | |||
| 1739 | Ga0501034_0024790 | |||
| 1740 | Ga0501034_0031305 | |||
| 1741 | Ga0501034_0552084 | |||
| 1742 | Ga0501034_0562196 | |||
| 1743 | Ga0501036_0042178 | |||
| 1744 | Ga0501036_0322833 | |||
| 1745 | Ga0501036_0387965 | |||
| 1746 | Ga0501037_0006142 | |||
| 1747 | Ga0501038_0006185 | |||
| 1748 | Ga0501038_0009079 | |||
| 1749 | Ga0501038_0403250 | |||
| 1750 | Ga0501039_0080013 | |||
| 1751 | Ga0501041_0063233 | |||
| 1752 | Ga0501042_0044253 | |||
| 1753 | Ga0501043_0020054 | |||
| 1754 | Ga0501043_0165712 | |||
| 1755 | Ga0501043_0350530 | |||
| 1756 | Ga0501046_0011187 | |||
| 1757 | Ga0501046_0081279 | |||
| 1758 | Ga0501046_0165800 | |||
| 1759 | Ga0501047_0007979 | |||
| 1760 | Ga0501047_0009217 | |||
| 1761 | Ga0501047_0084821 | |||
| 1762 | Ga0501047_0200057 | |||
| 1763 | Ga0501047_0220913 | |||
| 1764 | Ga0501048_0026137 | |||
| 1765 | Ga0501068_0042014 | |||
| 1766 | Ga0501068_0259670 | |||
| 1767 | Ga0501069_0219812 | |||
| 1768 | Ga0501069_0239217 | |||
| 1769 | Ga0501070_0163857 | |||
| 1770 | Ga0501070_0189532 | |||
| 1771 | Ga0501071_0059108 | |||
| 1772 | Ga0501072_0006066 | |||
| 1773 | Ga0501073_0064375 | |||
| 1774 | Ga0501073_0086868 | |||
| 1775 | Ga0501074_0204295 | |||
| 1776 | Ga0501075_0002025 | |||
| 1777 | Ga0501076_0003428 | |||
| 1778 | Ga0501076_0100327 | |||
| 1779 | Ga0501198_009601 | |||
| 1780 | Ga0501206_000324 | |||
| 1781 | Ga0501207_012263 | |||
| 1782 | Ga0501217_015107 | |||
| 1783 | Ga0501223_011703 | |||
| 1784 | Ga0501224_000489 | |||
| 1785 | Ga0501233_032625 | |||
| 1786 | Ga0501242_002056 | |||
| 1787 | Ga0501242_005447 | |||
| 1788 | Ga0501243_000061 | |||
| 1789 | Ga0501243_003314 | |||
| 1790 | Ga0501243_003321 | |||
| 1791 | Ga0501252_010134 | |||
| 1792 | Ga0501253_001848 | |||
| 1793 | Ga0501257_003658 | |||
| 1794 | Ga0501259_051283 | |||
| 1795 | Ga0501261_000633 | |||
| 1796 | Ga0501261_007819 | |||
| 1797 | Ga0501221_000225 | |||
| 1798 | Ga0501225_0000299 | |||
| 1799 | Ga0501225_0000690 | |||
| 1800 | Ga0501225_0083494 | |||
| 1801 | Ga0501234_015115 | |||
| 1802 | Ga0501245_005175 | |||
| 1803 | Ga0501079_0007962 | |||
| 1804 | Ga0501079_0032533 | |||
| 1805 | Ga0501079_0032966 | |||
| 1806 | Ga0501080_0019380 | |||
| 1807 | Ga0501080_0283343 | |||
| 1808 | Ga0501080_0321796 | |||
| 1809 | Ga0501080_0553085 | |||
| 1810 | Ga0501081_0006803 | |||
| 1811 | Ga0501081_0123049 | |||
| 1812 | Ga0501083_0083919 | |||
| 1813 | Ga0501268_026199 | |||
| 1814 | Ga0501035_0018095 | |||
| 1815 | Ga0501035_0349642 | |||
| 1816 | Ga0501035_0581988 | |||
| 1817 | Ga0501044_0005753 | |||
| 1818 | Ga0501044_0012344 | |||
| 1819 | Ga0501044_0033294 | |||
| 1820 | Ga0501044_0061055 | |||
| 1821 | Ga0501044_0139850 | |||
| 1822 | Ga0501044_0184441 | |||
| 1823 | Ga0501044_0187091 | |||
| 1824 | Ga0501044_0239934 | |||
| 1825 | Ga0501045_0150715 | |||
| 1826 | nmdc:mga0k408_38879_c1 | |||
| 1827 | nmdc:mga0k408_50943_c1 | |||
| 1828 | nmdc:mga05p37_467355_c1 | |||
| 1829 | nmdc:mga09592_152715_c1 | |||
| 1830 | nmdc:mga09592_289660_c1 | |||
| 1831 | nmdc:mga0qj67_10919_c2 | |||
| 1832 | nmdc:mga06r32_635193_c1 | |||
| 1833 | nmdc:mga08y16_774_c1 | |||
| 1834 | nmdc:mga08y16_810615_c1 | |||
| 1835 | nmdc:mga08x19_212493_c1 | |||
| 1836 | Ga0500578_0001100 | |||
| 1837 | Ga0500578_0042281 | |||
| 1838 | Ga0500646_0019687 | |||
| 1839 | Ga0500583_0000178 | |||
| 1840 | Ga0500583_0000423 | |||
| 1841 | Ga0500583_0005597 | |||
| 1842 | Ga0500651_0199022 | |||
| 1843 | Ga0500650_0025566 | |||
| 1844 | Ga0500562_000024 | |||
| 1845 | Ga0500642_0080352 | |||
| 1846 | Ga0500658_0000784 | |||
| 1847 | Ga0500559_0115378 | |||
| 1848 | Ga0500577_0002983 | |||
| 1849 | Ga0500588_0012718 | |||
| 1850 | Ga0500589_015859 | |||
| 1851 | Ga0500589_033158 | |||
| 1852 | Ga0500616_0004239 | |||
| 1853 | Ga0500616_0004541 | |||
| 1854 | Ga0500616_0117772 | |||
| 1855 | Ga0500619_034445 | |||
| 1856 | Ga0500622_0000604 | |||
| 1857 | Ga0500622_0004624 | |||
| 1858 | Ga0500622_0006488 | |||
| 1859 | Ga0500637_0110281 | |||
| 1860 | Ga0501084_0009204 | |||
| 1861 | Ga0501084_0020525 | |||
| 1862 | Ga0501084_0021111 | |||
| 1863 | Ga0500661_022751 | |||
| 1864 | Ga0501082_0030525 | |||
| 1865 | Ga0501082_0082191 | |||
| 1866 | Ga0466962_0007361 | |||
| 1867 | Ga0530510_0164347 | |||
| 1868 | Ga0530510_0234677 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4jro-assembly1.cif.gz_D | crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ | 0.9896 | 3 | 251 |
| 4jro-assembly1.cif.gz_B | crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ | 0.9884 | 3 | 251 |
| 4jro-assembly1.cif.gz_C | crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ | 0.9876 | 3 | 251 |
| 8jfa-assembly1.cif.gz_C | crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadph from helicobacter pylori | 0.9861 | 7 | 251 |
| 4iin-assembly1.cif.gz_B | crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from helicobacter pylori 26695 complexed with nad+ | 0.9839 | 7 | 251 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4iinB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9839 | 7 | 251 | 3.40.50.720 |
| af_Q54N15_5_159_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9824 | 63 | 182 | 3.40.50.720 |
| 4hsyA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9686 | 4 | 249 | 3.40.50.720 |
| 4weoA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9662 | 4 | 251 | 3.40.50.720 |
| 4cqmK00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9658 | 7 | 249 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0R9Z9-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) | 1 | 1 | 251 |
GO:0004316
GO:0006633 GO:0051287 |
| AF-A0A2M9CSI1-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) | 0.9969 | 1 | 251 |
GO:0004316
GO:0006633 GO:0051287 |
| AF-A0A7V8VZS3-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) | 0.9967 | 1 | 251 |
GO:0004316
GO:0006633 GO:0051287 |
| AF-A0A3B9C073-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) | 0.9953 | 1 | 251 |
GO:0004316
GO:0006633 GO:0051287 |
| AF-A0A7X9KRV3-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9932 | 1 | 165 |
|