F486027

General Info

Members Datasets Scaffolds Average Seq Length
930 537 810 230

Family's Representative Sequence

Representative Sequence 3300046535|Ga0495586_0047311|Ga0495586_0047311_828_1724
Length 275
Sequence LLIHRGGHDRSRAEKSRVLLAYSLSPRNVKLAHFCRRPAADRSFVKTGNLSKGFMFTLFHHPFCPHSRFIRLALGEYGLDLRLVEERTWERREGFLALNPAGTTPVLFAEGRPAIPGVGVIAEYLDEAHGNVLAERRLLPSAMGERIEVRRLTAWFNEKFFEEASNPLVTERIYKRFMSEDVIRAAKANVRYHLAYIGWLARTRNYLAGDRLTYADLAAAAHLSAIDYLGDVPWIEDDAAKAWYARVKSRPSFRPLLSEWLAGVPASRTYVDLDF

Samples

Sample ID Description Type Environment
1 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
2 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
3 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
4 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
5 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
6 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
7 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
8 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
9 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
10 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
11 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
12 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
13 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
14 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
15 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
16 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
17 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
18 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
19 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
20 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
21 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
22 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
23 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
24 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
25 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
26 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
27 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
28 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
29 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
30 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
31 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
32 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
33 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
34 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
35 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
36 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
37 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
38 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
39 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
40 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
41 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
42 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
43 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
44 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
45 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
46 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
47 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
48 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
49 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
50 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
51 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
52 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
53 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
54 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
55 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
56 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
57 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
58 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
59 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
60 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
61 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
62 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
63 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
64 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
65 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
66 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
67 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
68 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
69 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
70 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
71 2922368715
72 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
73 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
74 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
75 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
76 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
77 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
78 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
79 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
80 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
81 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
82 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
83 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
84 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
85 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
86 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
87 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
88 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
89 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
90 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
91 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
92 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
93 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
94 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
95 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
96 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
97 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
98 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
99 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
100 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
101 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
102 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
103 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
104 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
105 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
106 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
107 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
108 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
109 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
110 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
111 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
112 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
113 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
114 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
115 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
116 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
117 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
118 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
119 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
120 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
121 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
122 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
123 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
124 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
125 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
126 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
127 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
128 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
129 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
130 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
131 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
132 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
133 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
134 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
135 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
136 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
137 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
138 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
139 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
140 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
141 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
142 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
143 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
144 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
145 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
146 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
147 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
148 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
149 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
150 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
151 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
152 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
153 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
154 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
155 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
156 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
157 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
158 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
159 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
160 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
161 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
162 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
163 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
164 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
165 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
166 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
167 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
168 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
169 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
170 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
171 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
172 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
173 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
174 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
175 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
176 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
177 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
178 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
179 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
180 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
181 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
182 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
183 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
184 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
185 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
186 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
187 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
188 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
189 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
190 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
191 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
192 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
193 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
194 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
195 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
196 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
197 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
198 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
199 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
200 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
201 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
202 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
203 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
204 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
205 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
206 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
207 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
208 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
209 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
210 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
211 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
212 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
213 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
214 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
215 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
216 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
217 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
218 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
219 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
220 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
221 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
222 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
223 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
224 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
225 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
226 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
227 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
228 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
230 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
232 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
233 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
234 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
235 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
236 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
285 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
286 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
287 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
288 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
292 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
293 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
294 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
295 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
296 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
297 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
298 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
299 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
300 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
301 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
302 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
303 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
304 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
305 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
306 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
307 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
308 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
309 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
310 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
311 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
312 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
313 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
314 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
315 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
316 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
317 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
318 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
319 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
320 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
321 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
322 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
323 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
324 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
325 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
326 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
327 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
328 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
329 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
330 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
331 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
332 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
333 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
334 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
335 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
336 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
337 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
338 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
339 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
340 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
341 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
342 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
343 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
344 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
345 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
346 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
347 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
348 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
349 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
350 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
351 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
352 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
353 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
354 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
355 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
356 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
357 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
358 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
359 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
360 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
361 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
362 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
363 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
364 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
365 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
366 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
367 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
368 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
369 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
370 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
371 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
372 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
373 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
374 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
375 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
376 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
377 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
378 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
379 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
380 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
381 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
382 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
383 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
384 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
385 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
386 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
387 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
388 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
389 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
390 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
391 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
392 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
393 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
394 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
395 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
396 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
397 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
398 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
399 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
400 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
401 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
402 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
403 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
404 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
405 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
406 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
407 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
408 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
409 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
410 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
411 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
412 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
413 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
414 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
415 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
416 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
417 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
418 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
419 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
420 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
421 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
422 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
423 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
424 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
425 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
426 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
427 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
428 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
429 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
430 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
431 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
432 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
433 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
434 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
435 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
436 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
437 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
438 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
439 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
442 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
447 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
448 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
449 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
450 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
452 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
453 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
454 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
455 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
456 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
457 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
458 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
459 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
460 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
461 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
462 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
463 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
464 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
465 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
466 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
467 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
468 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
471 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
472 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
473 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
474 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
475 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
476 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
477 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
478 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
479 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
480 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
481 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
482 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
483 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
484 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
485 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
486 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
487 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
488 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
489 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
490 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
491 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
492 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
493 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
494 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
495 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
496 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
497 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
498 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
499 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
500 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
501 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
502 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
503 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
504 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
505 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
506 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
507 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
508 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
509 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
510 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
511 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
512 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
513 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
514 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
515 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
516 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
517 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
518 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
519 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
520 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
521 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
522 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
523 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
524 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
525 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
526 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
527 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
528 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
529 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
530 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
531 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
532 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
533 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
534 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
535 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
536 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
537 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.19
Metatranscriptomes 0
Isolates 12.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.95
Nodule 9.46
Rhizoplane 6.67
Rhizosphere 60.11
Stem 0
Stem Tuber 0
Unclassified 8.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10092894 3300002067 Bacteria 865
2 JGI25153J46596_10004886 3300003215 Bacteria 7127
3 JGI25153J46596_10008982 3300003215 Bacteria 4706
4 JGI25153J46596_10024972 3300003215 Bacteria 2144
5 JGI25160J50197_1002942 3300003354 Bacteria 7785
6 JGI25160J50197_1014077 3300003354 Bacteria 2693
7 JGI25404J52841_10003452 3300003659 Bacteria 3126
8 JGI25404J52841_10011291 3300003659 Bacteria 1925
9 JGI25404J52841_10012295 3300003659 Bacteria 1853
10 Ga0055539_1004135 3300003752 Bacteria 1954
11 Ga0055531_10021303 3300003794 Bacteria 2520
12 Ga0065165_1003108 3300005262 Bacteria 12328
13 Ga0065165_1008177 3300005262 Bacteria 4969
14 Ga0065165_1023855 3300005262 Bacteria 2066
15 Ga0070676_10056318 3300005328 Bacteria 2323
16 Ga0070683_100480083 3300005329 Bacteria 1187
17 Ga0070690_100016343 3300005330 Bacteria 4443
18 Ga0070690_100049808 3300005330 Bacteria 2671
19 Ga0070677_10074166 3300005333 Bacteria 1439
20 Ga0070682_100046546 3300005337 Bacteria 2692
21 Ga0068868_100221941 3300005338 Bacteria 1582
22 Ga0070689_100005739 3300005340 Bacteria 8509
23 Ga0070689_100201744 3300005340 Bacteria 1624
24 Ga0070689_100590851 3300005340 Bacteria 961
25 Ga0070687_100283633 3300005343 Bacteria 1044
26 Ga0070661_100057065 3300005344 Bacteria 2861
27 Ga0070661_100152390 3300005344 Bacteria 1748
28 Ga0070692_10098216 3300005345 Bacteria 1601
29 Ga0070668_100131471 3300005347 Bacteria 2009
30 Ga0070668_100517265 3300005347 Bacteria 1035
31 Ga0070669_100087084 3300005353 Bacteria 2335
32 Ga0070669_100100352 3300005353 Bacteria 2182
33 Ga0070675_100279495 3300005354 Bacteria 1467
34 Ga0070671_100003341 3300005355 Bacteria 12514
35 Ga0070671_100102364 3300005355 Bacteria 2403
36 Ga0070671_100148726 3300005355 Bacteria 1977
37 Ga0070674_100023733 3300005356 Bacteria 3974
38 Ga0070673_100053597 3300005364 Bacteria 3169
39 Ga0070673_100496168 3300005364 Bacteria 1104
40 Ga0070673_100705201 3300005364 Bacteria 927
41 Ga0070659_100060904 3300005366 Bacteria 2982
42 Ga0070667_100173800 3300005367 Bacteria 1903
43 Ga0070667_100226549 3300005367 Bacteria 1665
44 Ga0070667_100356696 3300005367 Bacteria 1325
45 Ga0070709_10010783 3300005434 Bacteria 5071
46 Ga0070709_10339827 3300005434 Bacteria 1107
47 Ga0070709_10690191 3300005434 Bacteria 793
48 Ga0070714_100027788 3300005435 Bacteria 4687
49 Ga0070714_100055517 3300005435 Bacteria 3385
50 Ga0070713_100005457 3300005436 Bacteria 8691
51 Ga0070713_100248247 3300005436 Bacteria 1622
52 Ga0070713_100461263 3300005436 Bacteria 1195
53 Ga0070710_10004329 3300005437 Bacteria 6729
54 Ga0070711_100006098 3300005439 Bacteria 7245
55 Ga0070711_100156300 3300005439 Unclassified 1724
56 Ga0070694_100147575 3300005444 Bacteria 1714
57 Ga0070663_100002254 3300005455 Bacteria 10805
58 Ga0070678_100345356 3300005456 Bacteria 1278
59 Ga0070678_100353712 3300005456 Bacteria 1264
60 Ga0070678_100655844 3300005456 Bacteria 942
61 Ga0070681_10012145 3300005458 Bacteria 8543
62 Ga0068867_100091881 3300005459 Bacteria 2304
63 Ga0070685_10151389 3300005466 Bacteria 1470
64 Ga0070706_100305684 3300005467 Bacteria 1484
65 Ga0070699_100467433 3300005518 Bacteria 1144
66 Ga0070679_100415401 3300005530 Bacteria 1291
67 Ga0070679_100447885 3300005530 Bacteria 1236
68 Ga0070684_100371606 3300005535 Bacteria 1316
69 Ga0068853_100078313 3300005539 Bacteria 2888
70 Ga0068853_100302337 3300005539 Bacteria 1479
71 Ga0070672_100047257 3300005543 Bacteria 3339
72 Ga0070672_100050282 3300005543 Bacteria 3246
73 Ga0070686_100429049 3300005544 Bacteria 1011
74 Ga0070665_100007664 3300005548 Bacteria 10972
75 Ga0070665_100247082 3300005548 Bacteria 1785
76 Ga0070665_100260772 3300005548 Bacteria 1734
77 Ga0070665_100379111 3300005548 Bacteria 1421
78 Ga0068855_100173531 3300005563 Bacteria 2440
79 Ga0068855_100565536 3300005563 Bacteria 1229
80 Ga0068854_100399671 3300005578 Bacteria 1137
81 Ga0068856_100032409 3300005614 Bacteria 5115
82 Ga0068852_100299793 3300005616 Bacteria 1555
83 Ga0068859_100088953 3300005617 Bacteria 3138
84 Ga0068859_100169020 3300005617 Bacteria 2267
85 Ga0068864_100278893 3300005618 Bacteria 1559
86 Ga0068861_100494380 3300005719 Bacteria 1104
87 Ga0068861_100540471 3300005719 Bacteria 1060
88 Ga0068851_10123505 3300005834 Bacteria 1394
89 Ga0068863_100144840 3300005841 Bacteria 2272
90 Ga0068858_100416641 3300005842 Bacteria 1291
91 Ga0068860_100145468 3300005843 Bacteria 2280
92 Ga0068862_100676688 3300005844 Bacteria 998
93 Ga0081538_10072576 3300005981 Bacteria 1886
94 Ga0081540_1000569 3300005983 Bacteria 35803
95 Ga0081540_1001159 3300005983 Bacteria 23221
96 Ga0081540_1013129 3300005983 Bacteria 5407
97 Ga0081540_1082179 3300005983 Bacteria 1446
98 Ga0081539_10017955 3300005985 Bacteria 4936
99 Ga0081539_10064486 3300005985 Bacteria 1993
100 Ga0070717_10197399 3300006028 Bacteria 1761
101 Ga0075365_10009255 3300006038 Bacteria 5650
102 Ga0075365_10012376 3300006038 Bacteria 5066
103 Ga0075365_10058472 3300006038 Bacteria 2567
104 Ga0075365_10178221 3300006038 Bacteria 1485
105 Ga0075365_10431489 3300006038 Bacteria 930
106 Ga0075368_10019950 3300006042 Bacteria 2534
107 Ga0075368_10023227 3300006042 Bacteria 2366
108 Ga0075368_10077200 3300006042 Bacteria 1352
109 Ga0075368_10078216 3300006042 Bacteria 1343
110 Ga0075363_100002280 3300006048 Bacteria 7777
111 Ga0075363_100009997 3300006048 Bacteria 4482
112 Ga0075363_100095188 3300006048 Bacteria 1642
113 Ga0075363_100151453 3300006048 Bacteria 1309
114 Ga0075363_100241980 3300006048 Bacteria 1037
115 Ga0075364_10043405 3300006051 Bacteria 2923
116 Ga0075364_10098351 3300006051 Bacteria 1946
117 Ga0075364_10330755 3300006051 Bacteria 1038
118 Ga0075364_10336955 3300006051 Bacteria 1028
119 Ga0070715_10002578 3300006163 Bacteria 5595
120 Ga0070716_100008223 3300006173 Bacteria 5170
121 Ga0070712_100039773 3300006175 Bacteria 3219
122 Ga0070712_100097308 3300006175 Bacteria 2169
123 Ga0070712_100102505 3300006175 Bacteria 2119
124 Ga0075362_10111130 3300006177 Bacteria 1290
125 Ga0075362_10120780 3300006177 Bacteria 1240
126 Ga0075362_10125068 3300006177 Bacteria 1219
127 Ga0075367_10002064 3300006178 Bacteria 8994
128 Ga0075367_10028955 3300006178 Bacteria 3164
129 Ga0075367_10048775 3300006178 Bacteria 2495
130 Ga0075367_10051155 3300006178 Bacteria 2441
131 Ga0075367_10076847 3300006178 Bacteria 2015
132 Ga0075367_10155979 3300006178 Bacteria 1418
133 Ga0075367_10254078 3300006178 Bacteria 1102
134 Ga0075369_10039263 3300006186 Bacteria 2021
135 Ga0075369_10146423 3300006186 Bacteria 1078
136 Ga0075366_10015443 3300006195 Bacteria 4376
137 Ga0075366_10027253 3300006195 Bacteria 3351
138 Ga0075366_10044834 3300006195 Bacteria 2621
139 Ga0075366_10139261 3300006195 Bacteria 1466
140 Ga0075366_10317749 3300006195 Bacteria 954
141 Ga0075370_10009950 3300006353 Bacteria 4955
142 Ga0075370_10055204 3300006353 Bacteria 2257
143 Ga0075370_10156586 3300006353 Bacteria 1336
144 Ga0075370_10224513 3300006353 Bacteria 1110
145 Ga0075370_10312131 3300006353 Bacteria 936
146 Ga0068871_100238074 3300006358 Bacteria 1581
147 Ga0068871_100511235 3300006358 Bacteria 1084
148 Ga0075428_100052164 3300006844 Bacteria 4484
149 Ga0075430_100000014 3300006846 Bacteria 90404
150 Ga0075430_100043547 3300006846 Bacteria 3794
151 Ga0075430_100374617 3300006846 Bacteria 1175
152 Ga0075431_100056737 3300006847 Bacteria 4039
153 Ga0075431_100247243 3300006847 Bacteria 1813
154 Ga0075429_100084746 3300006880 Bacteria 2762
155 Ga0075429_100417558 3300006880 Bacteria 1175
156 Ga0097620_100088953 3300006931 Bacteria 3138
157 Ga0097620_100169008 3300006931 Bacteria 2267
158 Ga0099825_1041139 3300006941 Bacteria 1340
159 Ga0099824_1022711 3300006942 Bacteria 4068
160 Ga0099822_1053452 3300006943 Bacteria 1570
161 Ga0099823_1016287 3300006944 Bacteria 7313
162 Ga0075435_100120735 3300007076 Bacteria 2187
163 Ga0099795_10028605 3300007788 Bacteria 1897
164 Ga0099795_10204835 3300007788 Bacteria 833
165 Ga0105250_10068914 3300009092 Bacteria 1428
166 Ga0105240_10163514 3300009093 Bacteria 2641
167 Ga0105240_10335429 3300009093 Bacteria 1719
168 Ga0111539_10439530 3300009094 Bacteria 1519
169 Ga0111539_11343212 3300009094 Bacteria 829
170 Ga0105245_10069249 3300009098 Bacteria 3199
171 Ga0105245_10116277 3300009098 Bacteria 2494
172 Ga0105247_10146625 3300009101 Bacteria 1552
173 Ga0105247_10440915 3300009101 Bacteria 937
174 Ga0114129_10497452 3300009147 Bacteria 1593
175 Ga0105243_10133873 3300009148 Bacteria 2106
176 Ga0105241_11036203 3300009174 Bacteria 769
177 Ga0105242_10533659 3300009176 Bacteria 1122
178 Ga0105248_10088758 3300009177 Bacteria 3480
179 Ga0105248_10224430 3300009177 Bacteria 2115
180 Ga0105248_10783281 3300009177 Bacteria 1076
181 Ga0105248_10899867 3300009177 Bacteria 999
182 Ga0105237_10545918 3300009545 Bacteria 1166
183 Ga0105238_10347055 3300009551 Bacteria 1473
184 Ga0105238_10474450 3300009551 Bacteria 1250
185 Ga0105249_10017103 3300009553 Bacteria 6435
186 Ga0099796_10016207 3300010159 Bacteria 2196
187 Ga0099796_10132104 3300010159 Bacteria 969
188 Ga0105239_10353329 3300010375 Bacteria 1659
189 Ga0105239_10397343 3300010375 Bacteria 1560
190 Ga0105239_10404613 3300010375 Bacteria 1545
191 Ga0105239_10638672 3300010375 Bacteria 1215
192 Ga0105246_10028814 3300011119 Bacteria 3650
193 Ga0105246_10692864 3300011119 Bacteria 892
194 Ga0157373_10179078 3300013100 Bacteria 1492
195 Ga0157369_10017624 3300013105 Bacteria 8028
196 Ga0157374_10318983 3300013296 Bacteria 1540
197 Ga0157378_10226692 3300013297 Bacteria 1779
198 Ga0157378_11023894 3300013297 Bacteria 861
199 Ga0163162_10541041 3300013306 Bacteria 1293
200 Ga0163162_11019948 3300013306 Bacteria 936
201 Ga0157375_10163233 3300013308 Bacteria 2371
202 Ga0163163_10079712 3300014325 Bacteria 3273
203 Ga0163163_10149491 3300014325 Bacteria 2380
204 Ga0163163_10153451 3300014325 Bacteria 2346
205 Ga0157380_10133334 3300014326 Bacteria 2123
206 Ga0157380_10724492 3300014326 Bacteria 1003
207 Ga0157377_10095179 3300014745 Bacteria 1765
208 Ga0157379_10260644 3300014968 Bacteria 1575
209 Ga0157379_10363672 3300014968 Bacteria 1326
210 Ga0182006_1082223 3300015261 Bacteria 1173
211 Ga0163161_10090790 3300017792 Bacteria 2260
212 Ga0214544_1000072 3300021320 Bacteria 124664
213 Ga0214544_1026539 3300021320 Bacteria 2557
214 Ga0214542_1004635 3300021321 Bacteria 27060
215 Ga0214545_1004199 3300021324 Bacteria 27060
216 Ga0214543_1019164 3300021327 Bacteria 5983
217 Ga0213876_10240857 3300021384 Bacteria 962
218 Ga0209563_101386 3300025230 Bacteria 6518
219 Ga0207425_1010124 3300025245 Bacteria 2309
220 Ga0209677_101289 3300025253 Bacteria 11184
221 Ga0209233_1029903 3300025261 Bacteria 1288
222 Ga0209673_1022942 3300025273 Bacteria 2138
223 Ga0209564_1004992 3300025295 Bacteria 7807
224 Ga0209758_1000443 3300025297 Bacteria 69228
225 Ga0209758_1000546 3300025297 Bacteria 59757
226 Ga0209758_1000634 3300025297 Bacteria 53757
227 Ga0209758_1001177 3300025297 Bacteria 33138
228 Ga0209758_1004442 3300025297 Bacteria 11664
229 Ga0209758_1008497 3300025297 Bacteria 6628
230 Ga0207426_1002219 3300025302 Bacteria 13027
231 Ga0207426_1015553 3300025302 Bacteria 2756
232 Ga0209257_1001004 3300025304 Bacteria 38186
233 Ga0207682_10017946 3300025893 Bacteria 2762
234 Ga0207692_10004321 3300025898 Bacteria 5621
235 Ga0207692_10223055 3300025898 Bacteria 1118
236 Ga0207642_10066135 3300025899 Bacteria 1701
237 Ga0207699_10013831 3300025906 Bacteria 4142
238 Ga0207699_10094399 3300025906 Bacteria 1884
239 Ga0207645_10014781 3300025907 Bacteria 5212
240 Ga0207643_10177931 3300025908 Bacteria 1286
241 Ga0207654_10647077 3300025911 Bacteria 757
242 Ga0207707_10000100 3300025912 Bacteria 85682
243 Ga0207707_10378244 3300025912 Bacteria 1218
244 Ga0207695_10020001 3300025913 Bacteria 7683
245 Ga0207671_10164456 3300025914 Bacteria 1720
246 Ga0207693_10007779 3300025915 Bacteria 8792
247 Ga0207693_10386539 3300025915 Bacteria 1094
248 Ga0207663_10004278 3300025916 Bacteria 7087
249 Ga0207663_10136189 3300025916 Unclassified 1704
250 Ga0207660_10190724 3300025917 Bacteria 1596
251 Ga0207660_10624286 3300025917 Bacteria 878
252 Ga0207662_10084608 3300025918 Bacteria 1941
253 Ga0207657_10047437 3300025919 Bacteria 3756
254 Ga0207657_10066926 3300025919 Bacteria 3057
255 Ga0207657_10299604 3300025919 Bacteria 1274
256 Ga0207649_10183535 3300025920 Bacteria 1466
257 Ga0207652_10014690 3300025921 Bacteria 6346
258 Ga0207694_10136927 3300025924 Bacteria 1967
259 Ga0207687_10031619 3300025927 Bacteria 3578
260 Ga0207700_10464147 3300025928 Bacteria 1117
261 Ga0207664_10029215 3300025929 Bacteria 4197
262 Ga0207664_10210219 3300025929 Bacteria 1683
263 Ga0207644_10007950 3300025931 Bacteria 6936
264 Ga0207706_10066190 3300025933 Bacteria 3180
265 Ga0207706_10412869 3300025933 Bacteria 1170
266 Ga0207686_10103181 3300025934 Bacteria 1908
267 Ga0207686_10271000 3300025934 Bacteria 1249
268 Ga0207709_10053072 3300025935 Bacteria 2493
269 Ga0207670_10012326 3300025936 Bacteria 4998
270 Ga0207670_10090782 3300025936 Bacteria 2159
271 Ga0207669_10003549 3300025937 Bacteria 6756
272 Ga0207704_10081014 3300025938 Bacteria 2098
273 Ga0207665_10001903 3300025939 Bacteria 14060
274 Ga0207665_10031388 3300025939 Bacteria 3515
275 Ga0207665_10074727 3300025939 Bacteria 2320
276 Ga0207691_10098258 3300025940 Bacteria 2615
277 Ga0207691_10309515 3300025940 Bacteria 1356
278 Ga0207711_10037079 3300025941 Bacteria 4139
279 Ga0207711_10187783 3300025941 Bacteria 1882
280 Ga0207711_10376203 3300025941 Bacteria 1317
281 Ga0207689_10278608 3300025942 Bacteria 1385
282 Ga0207667_10219874 3300025949 Bacteria 1946
283 Ga0207667_10440501 3300025949 Bacteria 1325
284 Ga0207667_10460117 3300025949 Bacteria 1292
285 Ga0207651_10065494 3300025960 Bacteria 2548
286 Ga0207651_10356428 3300025960 Bacteria 1233
287 Ga0207668_10025116 3300025972 Bacteria 3852
288 Ga0207668_10207757 3300025972 Bacteria 1564
289 Ga0207658_10094588 3300025986 Bacteria 2326
290 Ga0207658_10418196 3300025986 Bacteria 1181
291 Ga0207703_10045609 3300026035 Bacteria 3527
292 Ga0207703_10493342 3300026035 Bacteria 1149
293 Ga0207639_10094865 3300026041 Bacteria 2396
294 Ga0207639_10136190 3300026041 Bacteria 2040
295 Ga0207639_10555374 3300026041 Bacteria 1055
296 Ga0207678_10053990 3300026067 Bacteria 3461
297 Ga0207678_10130549 3300026067 Bacteria 2143
298 Ga0207678_10150637 3300026067 Bacteria 1986
299 Ga0207678_10190763 3300026067 Bacteria 1751
300 Ga0207708_10201193 3300026075 Bacteria 1589
301 Ga0207702_10035301 3300026078 Bacteria 4181
302 Ga0207702_10544542 3300026078 Bacteria 1135
303 Ga0207641_10429029 3300026088 Bacteria 1274
304 Ga0207648_10131965 3300026089 Bacteria 2199
305 Ga0207676_10040530 3300026095 Bacteria 3569
306 Ga0207675_100198795 3300026118 Bacteria 1925
307 Ga0207675_100345161 3300026118 Bacteria 1458
308 Ga0207675_100484343 3300026118 Bacteria 1230
309 Ga0207675_100903991 3300026118 Bacteria 899
310 Ga0207683_10038424 3300026121 Bacteria 4172
311 Ga0207683_10075531 3300026121 Bacteria 2983
312 Ga0207683_10088356 3300026121 Bacteria 2757
313 Ga0207683_10331269 3300026121 Bacteria 1395
314 Ga0207698_10888859 3300026142 Bacteria 898
315 Ga0209389_1000153 3300027296 Bacteria 58606
316 Ga0209389_1002328 3300027296 Bacteria 14446
317 Ga0209589_1000032 3300027357 Bacteria 141881
318 Ga0209489_100936 3300027361 Bacteria 58586
319 Ga0209489_102825 3300027361 Bacteria 34712
320 Ga0209700_100011 3300027363 Bacteria 362159
321 Ga0268266_10007673 3300028379 Bacteria 9691
322 Ga0268266_10035191 3300028379 Bacteria 4260
323 Ga0268266_10092493 3300028379 Bacteria 2653
324 Ga0268266_10115575 3300028379 Bacteria 2382
325 Ga0268266_10469143 3300028379 Bacteria 1198
326 Ga0268265_10096565 3300028380 Bacteria 2375
327 Ga0268265_10281344 3300028380 Bacteria 1488
328 Ga0268264_10229252 3300028381 Bacteria 1714
329 Ga0307512_10291337 3300030522 Bacteria 770
330 Ga0265328_10000008 3300031239 Bacteria 208282
331 Ga0265325_10000095 3300031241 Bacteria 62028
332 Ga0265325_10028703 3300031241 Bacteria 2996
333 Ga0265340_10020052 3300031247 Bacteria 3440
334 Ga0265340_10022058 3300031247 Bacteria 3258
335 Ga0265339_10030169 3300031249 Bacteria 3072
336 Ga0265331_10002096 3300031250 Bacteria 13763
337 Ga0265316_10000608 3300031344 Bacteria 39845
338 Ga0265316_10169113 3300031344 Bacteria 1631
339 Ga0307513_10390165 3300031456 Bacteria 1129
340 Ga0307509_10093644 3300031507 Bacteria 3065
341 Ga0265313_10007848 3300031595 Bacteria 7199
342 Ga0307508_10219166 3300031616 Bacteria 1503
343 Ga0307514_10210319 3300031649 Bacteria 1209
344 Ga0265342_10046498 3300031712 Bacteria 2608
345 Ga0307516_10052602 3300031730 Bacteria 3985
346 Ga0307405_10036667 3300031731 Bacteria 2940
347 Ga0307405_10421616 3300031731 Bacteria 1050
348 Ga0307413_10121135 3300031824 Bacteria 1772
349 Ga0307410_10190256 3300031852 Bacteria 1560
350 Ga0307406_10881950 3300031901 Bacteria 760
351 Ga0307415_100073210 3300032126 Bacteria 2416
352 Ga0307415_100103527 3300032126 Bacteria 2095
353 Ga0307415_100143624 3300032126 Bacteria 1826
354 Ga0307510_10003373 3300033180 Bacteria 18626
355 Ga0307510_10009621 3300033180 Bacteria 11521
356 Ga0307510_10082786 3300033180 Bacteria 3102
357 Ga0307510_10156113 3300033180 Bacteria 1888
358 Ga0373950_0026880 3300034818 Bacteria 1047
359 Ga0373958_0006826 3300034819 Bacteria 1795
360 Ga0373928_0037988 3300035084 Bacteria 1094
361 Ga0373934_0053466 3300035086 Bacteria 1602
362 Ga0373940_0034519 3300035088 Bacteria 1365
363 Ga0373949_0008441 3300035090 Bacteria 2254
364 Ga0373923_0028527 3300035111 Bacteria 2233
365 Ga0373923_0137346 3300035111 Bacteria 1103
366 Ga0373939_0015610 3300035114 Bacteria 1990
367 Ga0373939_0172121 3300035114 Bacteria 802
368 Ga0373941_0037756 3300035115 Bacteria 1475
369 Ga0373953_0019333 3300035117 Bacteria 2533
370 Ga0373954_0053752 3300035118 Bacteria 1893
371 Ga0373954_0145854 3300035118 Unclassified 1155
372 Ga0373956_0019145 3300035119 Bacteria 2902
373 Ga0373956_0095112 3300035119 Bacteria 1377
374 Ga0373957_0029071 3300035120 Bacteria 2017
375 Ga0373957_0055239 3300035120 Bacteria 1526
376 Ga0373960_0011827 3300035121 Bacteria 2157
377 Ga0373955_0004568 3300035172 Bacteria 6133
378 Ga0373924_0004146 3300035410 Bacteria 5042
379 Ga0373924_0071380 3300035410 Bacteria 1465
380 Ga0373931_0002622 3300035691 Bacteria 8005
381 Ga0373931_0004016 3300035691 Bacteria 6664
382 Ga0373935_0022316 3300035692 Bacteria 3880
383 Ga0373935_0147935 3300035692 Bacteria 1592
384 Ga0373927_0073155 3300035695 Bacteria 2219
385 Ga0373927_0336458 3300035695 Bacteria 994
386 Ga0373947_0097246 3300035725 Bacteria 1845
387 Ga0373947_0374760 3300035725 Bacteria 957
388 Ga0373937_0007161 3300036401 Bacteria 9645
389 Ga0373937_0709029 3300036401 Bacteria 953
390 Ga0373925_0011850 3300037068 Bacteria 6310
391 Ga0373925_0322123 3300037068 Bacteria 1251
392 Ga0373925_0644328 3300037068 Bacteria 873
393 Ga0395899_0103451 3300037312 Bacteria 2054
394 Ga0395899_0201946 3300037312 Bacteria 1385
395 Ga0395900_0000623 3300037418 Bacteria 47633
396 Ga0395900_0013523 3300037418 Bacteria 8338
397 Ga0395900_0125989 3300037418 Bacteria 2627
398 Ga0395900_0493107 3300037418 Bacteria 1176
399 Ga0395898_0006403 3300037466 Bacteria 12567
400 Ga0395898_0026676 3300037466 Bacteria 5808
401 Ga0395898_0092783 3300037466 Bacteria 2903
402 Ga0395898_0140041 3300037466 Bacteria 2316
403 Ga0395898_0222243 3300037466 Bacteria 1801
404 Ga0395905_0003532 3300037471 Bacteria 16666
405 Ga0395905_0538532 3300037471 Bacteria 1068
406 Ga0395905_0629228 3300037471 Bacteria 975
407 Ga0436364_0806179 3300037853 Bacteria 1471
408 Ga0436364_1071255 3300037853 Bacteria 5327
409 Ga0395901_0155181 3300038443 Bacteria 2404
410 Ga0395901_0288666 3300038443 Bacteria 1703
411 Ga0436365_0986794 3300039437 Bacteria 1594
412 Ga0436365_1002699 3300039437 Bacteria 675
413 Ga0436365_1271825 3300039437 Bacteria 4480
414 Ga0436365_1324461 3300039437 Bacteria 1542
415 Ga0436365_1357054 3300039437 Bacteria 2640
416 Ga0436365_1744779 3300039437 Bacteria 868
417 Ga0436363_0276125 3300039450 Bacteria 1055
418 Ga0436363_1375376 3300039450 Unclassified 1276
419 Ga0451795_1442667 3300041456 Bacteria 1052
420 Ga0451807_0943623 3300041486 Bacteria 1231
421 Ga0450898_037527 3300042134 Bacteria 908
422 Ga0439459_0050520 3300042438 Bacteria 912
423 Ga0466972_0000214 3300044658 Bacteria 40946
424 Ga0466972_0005666 3300044658 Bacteria 6264
425 Ga0466972_0201147 3300044658 Bacteria 933
426 Ga0466963_0023549 3300044694 Bacteria 3912
427 Ga0466968_0000951 3300044735 Bacteria 10202
428 Ga0466960_0025665 3300044901 Bacteria 2668
429 Ga0451576_0301294 3300045051 Bacteria 1677
430 Ga0466967_0179255 3300045976 Bacteria 1997
431 Ga0466967_0511156 3300045976 Bacteria 1180
432 Ga0495592_0020331 3300046454 Bacteria 5050
433 Ga0495592_0067098 3300046454 Bacteria 2623
434 Ga0495592_0148457 3300046454 Bacteria 1623
435 Ga0495603_0023829 3300046455 Bacteria 3702
436 Ga0495603_0037954 3300046455 Bacteria 2890
437 Ga0495603_0071525 3300046455 Bacteria 2039
438 Ga0495603_0173964 3300046455 Bacteria 1247
439 Ga0495629_0090351 3300046459 Bacteria 2136
440 Ga0495638_0001656 3300046460 Bacteria 19727
441 Ga0495638_0066248 3300046460 Bacteria 2220
442 Ga0495651_0008047 3300046462 Bacteria 8083
443 Ga0495651_0115556 3300046462 Bacteria 1978
444 Ga0495651_0145618 3300046462 Bacteria 1713
445 Ga0495651_0309744 3300046462 Bacteria 1056
446 Ga0495653_0132656 3300046463 Bacteria 1761
447 Ga0495582_0055364 3300046473 Bacteria 2187
448 Ga0495605_0063860 3300046474 Bacteria 1755
449 Ga0495639_0108454 3300046475 Bacteria 1315
450 Ga0495662_0050832 3300046476 Bacteria 2001
451 Ga0495664_0027227 3300046477 Bacteria 3332
452 Ga0495664_0090429 3300046477 Bacteria 1840
453 Ga0495664_0142342 3300046477 Bacteria 1454
454 Ga0495584_0116119 3300046491 Bacteria 1355
455 Ga0495585_0069235 3300046492 Bacteria 1926
456 Ga0495594_0032422 3300046499 Bacteria 2836
457 Ga0495606_0032339 3300046507 Bacteria 3625
458 Ga0495608_0012281 3300046511 Bacteria 5949
459 Ga0495608_0017571 3300046511 Bacteria 4947
460 Ga0495608_0218939 3300046511 Bacteria 1195
461 Ga0495616_0042811 3300046513 Bacteria 2303
462 Ga0495618_0114302 3300046514 Bacteria 1728
463 Ga0495618_0134523 3300046514 Bacteria 1582
464 Ga0495628_0001017 3300046516 Bacteria 25597
465 Ga0495628_0058379 3300046516 Bacteria 3032
466 Ga0495630_0145091 3300046517 Bacteria 1805
467 Ga0495630_0281388 3300046517 Bacteria 1271
468 Ga0495631_0061101 3300046518 Bacteria 1634
469 Ga0495631_0139798 3300046518 Bacteria 1040
470 Ga0495632_0084208 3300046519 Bacteria 1513
471 Ga0495648_0007591 3300046524 Bacteria 8661
472 Ga0495648_0087070 3300046524 Bacteria 1760
473 Ga0495663_0037310 3300046525 Bacteria 1465
474 Ga0495652_0017324 3300046529 Bacteria 6429
475 Ga0495654_0140876 3300046530 Bacteria 1075
476 Ga0495640_0034260 3300046533 Bacteria 3602
477 Ga0495640_0231650 3300046533 Bacteria 1161
478 Ga0495586_0047311 3300046535 Bacteria 2322
479 Ga0495587_0079491 3300046536 Bacteria 1901
480 Ga0495645_0062580 3300046543 Bacteria 2695
481 Ga0495645_0288432 3300046543 Bacteria 1077
482 Ga0495622_0057179 3300046557 Bacteria 1808
483 Ga0495622_0110561 3300046557 Bacteria 1258
484 Ga0495622_0192042 3300046557 Bacteria 912
485 Ga0495667_0003759 3300046559 Bacteria 10205
486 Ga0495656_0079351 3300046615 Bacteria 1477
487 Ga0495668_0073804 3300046616 Bacteria 1873
488 Ga0495668_0134082 3300046616 Bacteria 1355
489 Ga0495668_0206190 3300046616 Bacteria 1076
490 Ga0495634_0022629 3300046642 Bacteria 4427
491 Ga0495611_0053437 3300046648 Bacteria 1823
492 Ga0495625_0069181 3300046660 Bacteria 2480
493 Ga0495625_0198107 3300046660 Bacteria 1327
494 Ga0495635_0008534 3300046663 Bacteria 7156
495 Ga0495635_0010388 3300046663 Bacteria 6511
496 Ga0495635_0020625 3300046663 Bacteria 4590
497 Ga0495588_0009691 3300046674 Bacteria 4463
498 Ga0495657_0008309 3300046675 Bacteria 7953
499 Ga0495657_0054517 3300046675 Bacteria 2670
500 Ga0495599_0014581 3300046678 Bacteria 4867
501 Ga0495599_0018479 3300046678 Bacteria 4343
502 Ga0495599_0046413 3300046678 Bacteria 2724
503 Ga0495599_0385951 3300046678 Bacteria 836
504 Ga0495623_0003900 3300046679 Bacteria 9836
505 Ga0495646_0099690 3300046680 Bacteria 1667
506 Ga0495646_0156883 3300046680 Bacteria 1262
507 Ga0495669_0227461 3300046684 Bacteria 894
508 Ga0495669_0237151 3300046684 Bacteria 875
509 Ga0495613_0111436 3300046689 Bacteria 1971
510 Ga0495613_0272332 3300046689 Bacteria 1177
511 Ga0495670_0276018 3300046691 Bacteria 898
512 Ga0495671_0082552 3300046692 Bacteria 1575
513 Ga0495649_0141716 3300046694 Bacteria 1265
514 Ga0495600_0012269 3300046809 Bacteria 5353
515 Ga0495600_0018591 3300046809 Bacteria 4429
516 Ga0495600_0024592 3300046809 Bacteria 3878
517 Ga0495604_0001877 3300047317 Bacteria 17074
518 Ga0495604_0016427 3300047317 Bacteria 5916
519 Ga0495604_0102094 3300047317 Bacteria 2106
520 Ga0495674_0024696 3300047319 Bacteria 5516
521 Ga0495674_0051300 3300047319 Bacteria 3637
522 Ga0495672_0104768 3300047320 Bacteria 1528
523 Ga0495676_0067366 3300047321 Bacteria 2770
524 Ga0495676_0506836 3300047321 Bacteria 791
525 Ga0495680_0009331 3300047322 Bacteria 8837
526 Ga0495680_0014667 3300047322 Bacteria 6778
527 Ga0495683_0115128 3300047323 Bacteria 1280
528 Ga0495683_0136383 3300047323 Bacteria 1153
529 Ga0495687_011173 3300047443 Bacteria 4849
530 Ga0495675_0002868 3300047444 Bacteria 10339
531 Ga0495677_0016874 3300047445 Bacteria 2648
532 Ga0495673_0100057 3300047469 Bacteria 1173
533 Ga0495684_0031576 3300047471 Bacteria 4067
534 Ga0495684_0062545 3300047471 Bacteria 2831
535 Ga0495684_0364304 3300047471 Bacteria 1023
536 Ga0495686_0046645 3300047472 Bacteria 2738
537 Ga0495686_0133476 3300047472 Bacteria 1470
538 Ga0495593_0184274 3300047673 Bacteria 1051
539 Ga0495602_0004680 3300048088 Bacteria 14292
540 Ga0495602_0006250 3300048088 Bacteria 12494
541 Ga0495602_0036752 3300048088 Bacteria 4553
542 Ga0495602_0110483 3300048088 Bacteria 2234
543 Ga0496100_0008700 3300048903 Bacteria 5672
544 Ga0496100_0177266 3300048903 Bacteria 1539
545 Ga0496100_0282649 3300048903 Bacteria 1237
546 Ga0496100_0508904 3300048903 Bacteria 928
547 Ga0496101_0016346 3300048904 Bacteria 5010
548 Ga0496101_0089074 3300048904 Bacteria 2293
549 Ga0496101_0118741 3300048904 Bacteria 1997
550 Ga0496101_0159518 3300048904 Bacteria 1729
551 Ga0496102_0067020 3300048905 Bacteria 3291
552 Ga0496102_0127950 3300048905 Bacteria 2375
553 Ga0496102_0317535 3300048905 Bacteria 1468
554 Ga0496102_0516074 3300048905 Bacteria 1117
555 Ga0496103_0007790 3300048906 Bacteria 6367
556 Ga0496103_0045362 3300048906 Bacteria 2713
557 Ga0496103_0050935 3300048906 Bacteria 2562
558 Ga0496104_0000232 3300048907 Bacteria 49094
559 Ga0496104_0013139 3300048907 Bacteria 7463
560 Ga0496104_0187994 3300048907 Bacteria 1976
561 Ga0496104_0206690 3300048907 Bacteria 1875
562 Ga0496104_0305064 3300048907 Bacteria 1504
563 Ga0496104_0440117 3300048907 Bacteria 1215
564 Ga0496105_0000238 3300048908 Bacteria 37100
565 Ga0496105_0008712 3300048908 Bacteria 7893
566 Ga0496105_0044558 3300048908 Bacteria 3659
567 Ga0496105_0048375 3300048908 Bacteria 3510
568 Ga0496105_0086081 3300048908 Bacteria 2597
569 Ga0496105_0273293 3300048908 Bacteria 1364
570 Ga0496106_0009906 3300048909 Bacteria 7037
571 Ga0496106_0192226 3300048909 Bacteria 1623
572 Ga0496106_0239591 3300048909 Bacteria 1449
573 Ga0496106_0364135 3300048909 Bacteria 1161
574 Ga0496106_0602729 3300048909 Bacteria 880
575 Ga0496107_0035135 3300048910 Bacteria 3593
576 Ga0496107_0060201 3300048910 Bacteria 2748
577 Ga0496108_0016193 3300048911 Bacteria 6081
578 Ga0496108_0226693 3300048911 Bacteria 1624
579 Ga0496108_0269097 3300048911 Bacteria 1483
580 Ga0496109_0148075 3300048912 Bacteria 2197
581 Ga0496109_0152390 3300048912 Bacteria 2164
582 Ga0496109_0327027 3300048912 Bacteria 1447
583 Ga0496109_0414022 3300048912 Bacteria 1273
584 Ga0496109_0627225 3300048912 Bacteria 1011
585 Ga0496110_0020628 3300048913 Bacteria 5567
586 Ga0496110_0032461 3300048913 Bacteria 4510
587 Ga0496110_0254196 3300048913 Bacteria 1599
588 Ga0496111_0075304 3300048914 Bacteria 2459
589 Ga0496111_0479754 3300048914 Bacteria 916
590 Ga0496112_0020629 3300048915 Bacteria 6248
591 Ga0496112_0071411 3300048915 Bacteria 3431
592 Ga0496112_0172254 3300048915 Bacteria 2130
593 Ga0496112_0394209 3300048915 Bacteria 1325
594 Ga0496112_0995748 3300048915 Bacteria 758
595 Ga0496113_0193063 3300048916 Bacteria 1616
596 Ga0496113_0651469 3300048916 Bacteria 842
597 Ga0496114_0030000 3300048917 Bacteria 4472
598 Ga0496114_0033513 3300048917 Bacteria 4233
599 Ga0496114_0499357 3300048917 Bacteria 1076
600 Ga0496115_0010118 3300048918 Bacteria 7036
601 Ga0496115_0015521 3300048918 Bacteria 5780
602 Ga0496115_0111143 3300048918 Bacteria 2251
603 Ga0496117_0154711 3300048920 Bacteria 1352
604 Ga0496117_0180425 3300048920 Bacteria 1214
605 Ga0496118_0069270 3300048921 Bacteria 2556
606 Ga0496119_0096702 3300048922 Bacteria 1665
607 Ga0496119_0123296 3300048922 Bacteria 1421
608 Ga0496120_0276056 3300048923 Bacteria 779
609 Ga0496121_0047043 3300048924 Bacteria 3684
610 Ga0496121_0050170 3300048924 Bacteria 3528
611 Ga0496121_0142915 3300048924 Bacteria 1772
612 Ga0496121_0451251 3300048924 Bacteria 828
613 Ga0496124_0059172 3300048927 Bacteria 3219
614 Ga0496124_0264627 3300048927 Bacteria 1263
615 Ga0496125_0216562 3300048928 Bacteria 1238
616 Ga0496126_0014106 3300048929 Bacteria 8091
617 Ga0496126_0059143 3300048929 Bacteria 3452
618 Ga0495682_0055885 3300049460 Bacteria 1431
619 Ga0501031_0003455 3300049568 Bacteria 10137
620 Ga0501031_0013770 3300049568 Bacteria 5272
621 Ga0501031_0026876 3300049568 Bacteria 3751
622 Ga0501031_0267175 3300049568 Bacteria 1111
623 Ga0501032_0003450 3300049569 Bacteria 12113
624 Ga0501032_0025553 3300049569 Bacteria 4070
625 Ga0501032_0164967 3300049569 Bacteria 1454
626 Ga0501033_0005832 3300049570 Bacteria 9686
627 Ga0501033_0021947 3300049570 Bacteria 4816
628 Ga0501033_0032049 3300049570 Bacteria 3946
629 Ga0501033_0034617 3300049570 Bacteria 3787
630 Ga0501034_0131878 3300049571 Bacteria 2482
631 Ga0501034_0299466 3300049571 Bacteria 1545
632 Ga0501034_0483366 3300049571 Bacteria 1154
633 Ga0501034_0520696 3300049571 Bacteria 1101
634 Ga0501034_0804590 3300049571 Bacteria 832
635 Ga0501036_0031362 3300049572 Bacteria 4491
636 Ga0501036_0048960 3300049572 Bacteria 3578
637 Ga0501036_0130348 3300049572 Bacteria 2123
638 Ga0501036_0786153 3300049572 Bacteria 784
639 Ga0501036_0854100 3300049572 Bacteria 748
640 Ga0501037_0006333 3300049573 Bacteria 8654
641 Ga0501037_0018072 3300049573 Bacteria 5193
642 Ga0501038_0006913 3300049574 Bacteria 10479
643 Ga0501038_0017332 3300049574 Bacteria 6511
644 Ga0501038_0027677 3300049574 Bacteria 5041
645 Ga0501038_0175676 3300049574 Bacteria 1731
646 Ga0501039_0006903 3300049575 Bacteria 8638
647 Ga0501039_0022198 3300049575 Bacteria 4872
648 Ga0501039_0039097 3300049575 Bacteria 3664
649 Ga0501039_0305679 3300049575 Bacteria 1250
650 Ga0501039_0329705 3300049575 Bacteria 1199
651 Ga0501040_0267485 3300049576 Bacteria 1220
652 Ga0501041_0236177 3300049577 Bacteria 1148
653 Ga0501041_0377852 3300049577 Bacteria 896
654 Ga0501042_0054993 3300049578 Bacteria 2839
655 Ga0501042_0082387 3300049578 Bacteria 2306
656 Ga0501042_0260340 3300049578 Bacteria 1252
657 Ga0501043_0002883 3300049579 Bacteria 14360
658 Ga0501043_0012233 3300049579 Bacteria 6708
659 Ga0501043_0132217 3300049579 Bacteria 1955
660 Ga0501043_0150999 3300049579 Bacteria 1818
661 Ga0501046_0175530 3300049580 Bacteria 1605
662 Ga0501047_0020718 3300049581 Bacteria 6315
663 Ga0501047_0023538 3300049581 Bacteria 5911
664 Ga0501047_0076403 3300049581 Bacteria 3223
665 Ga0501047_0082386 3300049581 Bacteria 3092
666 Ga0501047_0575813 3300049581 Bacteria 949
667 Ga0501048_0001786 3300049582 Bacteria 16352
668 Ga0501048_0094821 3300049582 Bacteria 2105
669 Ga0501048_0217328 3300049582 Bacteria 1355
670 Ga0501067_0011871 3300049583 Bacteria 4828
671 Ga0501067_0312615 3300049583 Bacteria 875
672 Ga0501068_0028302 3300049584 Bacteria 3313
673 Ga0501068_0054545 3300049584 Bacteria 2422
674 Ga0501069_0004000 3300049585 Bacteria 7611
675 Ga0501071_0005716 3300049587 Bacteria 8022
676 Ga0501071_0155995 3300049587 Bacteria 1704
677 Ga0501072_0045413 3300049588 Bacteria 3454
678 Ga0501072_0082013 3300049588 Bacteria 2557
679 Ga0501072_0265596 3300049588 Bacteria 1366
680 Ga0501073_0002379 3300049589 Bacteria 14087
681 Ga0501073_0208694 3300049589 Bacteria 1350
682 Ga0501074_0016822 3300049590 Bacteria 5307
683 Ga0501075_0028753 3300049591 Bacteria 4105
684 Ga0501076_0273553 3300049592 Bacteria 1383
685 Ga0501076_0372062 3300049592 Bacteria 1174
686 Ga0501077_0065210 3300049593 Bacteria 2310
687 Ga0501079_0061565 3300049741 Bacteria 2895
688 Ga0501079_0260517 3300049741 Bacteria 1355
689 Ga0501080_0121169 3300049742 Bacteria 2424
690 Ga0501080_0649698 3300049742 Bacteria 933
691 Ga0501081_0170867 3300049743 Bacteria 1569
692 Ga0501083_0002606 3300049744 Bacteria 12413
693 Ga0501083_0031690 3300049744 Bacteria 3628
694 Ga0501035_0006045 3300049822 Bacteria 11399
695 Ga0501035_0016145 3300049822 Bacteria 6890
696 Ga0501035_0077949 3300049822 Bacteria 2928
697 Ga0501035_0366391 3300049822 Bacteria 1203
698 Ga0501044_0019836 3300049823 Bacteria 7181
699 Ga0501044_0032579 3300049823 Bacteria 5477
700 Ga0501044_0042033 3300049823 Bacteria 4757
701 Ga0501044_0047827 3300049823 Bacteria 4423
702 Ga0501044_0380142 3300049823 Bacteria 1327
703 Ga0501044_0389126 3300049823 Bacteria 1308
704 Ga0501045_0102216 3300049824 Bacteria 2122
705 Ga0501045_0227568 3300049824 Bacteria 1388
706 Ga0501045_0276297 3300049824 Bacteria 1250
707 Ga0501045_0909198 3300049824 Bacteria 646
708 nmdc:mga03683_17476_c1 3300050489 Bacteria 2715
709 nmdc:mga03683_65874_c1 3300050489 Bacteria 1539
710 nmdc:mga03n38_3488_c1 3300050490 Bacteria 5061
711 nmdc:mga03n38_51216_c1 3300050490 Bacteria 1843
712 nmdc:mga03n38_9077_c1 3300050490 Bacteria 3598
713 nmdc:mga03n38_91720_c1 3300050490 Bacteria 1448
714 nmdc:mga00v17_156450_c1 3300050491 Bacteria 1466
715 nmdc:mga00v17_201652_c1 3300050491 Bacteria 1286
716 nmdc:mga00v17_38559_c1 3300050491 Bacteria 2857
717 nmdc:mga00v17_395882_c1 3300050491 Bacteria 898
718 nmdc:mga0yw44_106686_c1 3300050492 Bacteria 1791
719 nmdc:mga0yw44_119710_c1 3300050492 Bacteria 1695
720 nmdc:mga0yw44_128386_c1 3300050492 Bacteria 1639
721 nmdc:mga0k408_116490_c1 3300050493 Bacteria 1581
722 nmdc:mga0k408_17198_c1 3300050493 Bacteria 4025
723 nmdc:mga0k408_2007_c1 3300050493 Bacteria 10922
724 nmdc:mga0k408_223595_c1 3300050493 Bacteria 1124
725 nmdc:mga0k408_49151_c1 3300050493 Bacteria 2441
726 nmdc:mga0k408_97954_c1 3300050493 Bacteria 1728
727 nmdc:mga06z11_126755_c1 3300050494 Bacteria 1429
728 nmdc:mga06z11_147176_c1 3300050494 Bacteria 1336
729 nmdc:mga06z11_33638_c1 3300050494 Bacteria 2510
730 nmdc:mga06z11_51906_c1 3300050494 Bacteria 2101
731 nmdc:mga06z11_67997_c1 3300050494 Bacteria 1877
732 nmdc:mga04h51_24466_c1 3300050495 Bacteria 1849
733 nmdc:mga04h51_97501_c1 3300050495 Bacteria 1067
734 nmdc:mga07m45_159419_c2 3300050496 Bacteria 1008
735 nmdc:mga07m45_317078_c1 3300050496 Bacteria 906
736 nmdc:mga07m45_43658_c1 3300050496 Bacteria 2514
737 nmdc:mga07m45_48277_c1 3300050496 Bacteria 2394
738 nmdc:mga05p37_474227_c1 3300050507 Bacteria 1443
739 nmdc:mga05p37_85370_c1 3300050507 Bacteria 3890
740 nmdc:mga09592_277634_c1 3300050508 Bacteria 1453
741 nmdc:mga09592_8496_c1 3300050508 Bacteria 8351
742 nmdc:mga0qj67_191_c1 3300050509 Bacteria 41800
743 nmdc:mga06r32_29634_c1 3300050510 Bacteria 5131
744 nmdc:mga06r32_963729_c1 3300050510 Bacteria 807
745 nmdc:mga0n895_332176_c1 3300050512 Bacteria 1540
746 nmdc:mga0n895_85190_c1 3300050512 Bacteria 3154
747 nmdc:mga0sz30_139037_c1 3300050516 Bacteria 1072
748 Ga0495601_0000114 3300053077 Bacteria 44359
749 Ga0495601_0054790 3300053077 Bacteria 2523
750 Ga0495601_0127122 3300053077 Bacteria 1658
751 Ga0495612_0001726 3300053078 Bacteria 8981
752 Ga0495655_0008684 3300053083 Bacteria 1941
753 Ga0495655_0150116 3300053083 Bacteria 732
754 Ga0495595_0033375 3300053084 Bacteria 2322
755 Ga0495595_0052209 3300053084 Bacteria 1896
756 Ga0495619_0064629 3300053085 Bacteria 2440
757 Ga0495619_0149801 3300053085 Bacteria 1609
758 Ga0495619_0272379 3300053085 Bacteria 1173
759 Ga0495619_0441042 3300053085 Bacteria 898
760 Ga0500578_0181605 3300053086 Bacteria 1296
761 Ga0500643_036479 3300053087 Bacteria 1468
762 Ga0500647_0084083 3300053091 Bacteria 1526
763 Ga0500651_0063769 3300053093 Bacteria 2299
764 Ga0500566_0001036 3300053094 Bacteria 16076
765 Ga0500554_000779 3300053102 Bacteria 6356
766 Ga0500555_022030 3300053103 Bacteria 1832
767 Ga0500556_0024828 3300053104 Bacteria 1973
768 Ga0500557_000113 3300053105 Bacteria 22739
769 Ga0500592_005874 3300053116 Bacteria 1951
770 Ga0500595_030325 3300053119 Bacteria 1823
771 Ga0500595_096393 3300053119 Bacteria 851
772 Ga0500614_017337 3300053123 Bacteria 1626
773 Ga0500642_0000056 3300053130 Bacteria 67746
774 Ga0500642_0014704 3300053130 Bacteria 2920
775 Ga0500642_0082111 3300053130 Bacteria 1482
776 Ga0500655_056987 3300053133 Bacteria 783
777 Ga0500658_0116803 3300053134 Bacteria 1179
778 Ga0500559_0095969 3300053136 Bacteria 1361
779 Ga0500568_0010093 3300053139 Bacteria 4446
780 Ga0500568_0074591 3300053139 Bacteria 1294
781 Ga0500577_0048023 3300053142 Bacteria 1590
782 Ga0500577_0145790 3300053142 Bacteria 1001
783 Ga0500588_0133205 3300053146 Bacteria 887
784 Ga0500589_115963 3300053147 Bacteria 1141
785 Ga0500590_067495 3300053148 Bacteria 1784
786 Ga0500590_081376 3300053148 Bacteria 1590
787 Ga0500603_001192 3300053150 Bacteria 6032
788 Ga0500616_0015698 3300053153 Bacteria 4324
789 Ga0500619_011336 3300053154 Bacteria 2289
790 Ga0500620_020184 3300053155 Bacteria 1972
791 Ga0500622_0003747 3300053156 Bacteria 9936
792 Ga0500634_0059925 3300053161 Bacteria 2022
793 Ga0500634_0130045 3300053161 Bacteria 1210
794 Ga0500636_0002161 3300053177 Bacteria 10852
795 Ga0500637_0000360 3300053178 Bacteria 17211
796 Ga0500611_057717 3300053727 Bacteria 910
797 Ga0500625_000216 3300053729 Bacteria 13088
798 Ga0500645_042173 3300053730 Bacteria 1347
799 Ga0500609_006928 3300053731 Bacteria 1535
800 Ga0500609_041016 3300053731 Bacteria 640
801 Ga0500599_003632 3300053736 Bacteria 1889
802 Ga0500601_000047 3300053737 Bacteria 25181
803 Ga0501084_0054483 3300054114 Bacteria 3346
804 Ga0501084_0066065 3300054114 Bacteria 3026
805 Ga0501082_0000028 3300060353 Bacteria 100580
806 Ga0501082_0009479 3300060353 Bacteria 8383
807 Ga0501082_0095532 3300060353 Bacteria 2569
808 Ga0501082_0299697 3300060353 Bacteria 1400
809 Ga0530510_0009803 3300061734 Bacteria 6722
810 Ga0530510_0152702 3300061734 Bacteria 1706

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049824 Ga0501045_0909198 Ga0501045_0909198_19_624 201
2 3300053731 Ga0500609_041016 Ga0500609_041016_24_629 201
3 3300037471 Ga0395905_0538532 Ga0395905_0538532_327_1019 212
4 3300037068 Ga0373925_0644328 Ga0373925_0644328_19_666 215
5 3300039437 Ga0436365_1002699 Ga0436365_1002699_14_661 215
6 3300050494 nmdc:mga06z11_126755_c1 nmdc:mga06z11_126755_c1_472_1260 219
7 3300046454 Ga0495592_0148457 Ga0495592_0148457_728_1420 220
8 3300006175 Ga0070712_100097308 Ga0070712_1000973082 221
9 3300035086 Ga0373934_0053466 Ga0373934_0053466_492_1184 221
10 3300035111 Ga0373923_0028527 Ga0373923_0028527_381_1073 221
11 3300035118 Ga0373954_0053752 Ga0373954_0053752_573_1265 221
12 3300035119 Ga0373956_0095112 Ga0373956_0095112_483_1175 221
13 3300035120 Ga0373957_0055239 Ga0373957_0055239_656_1348 221
14 3300035410 Ga0373924_0071380 Ga0373924_0071380_454_1146 221
15 3300035692 Ga0373935_0022316 Ga0373935_0022316_568_1260 221
16 3300046462 Ga0495651_0115556 Ga0495651_0115556_49_741 221
17 3300046477 Ga0495664_0027227 Ga0495664_0027227_321_1013 221
18 3300046514 Ga0495618_0114302 Ga0495618_0114302_381_1073 221
19 3300046516 Ga0495628_0058379 Ga0495628_0058379_1422_2114 221
20 3300046517 Ga0495630_0145091 Ga0495630_0145091_532_1224 221
21 3300046533 Ga0495640_0231650 Ga0495640_0231650_136_1032 221
22 3300046535 Ga0495586_0047311 Ga0495586_0047311_828_1724 221
23 3300046663 Ga0495635_0010388 Ga0495635_0010388_4467_5363 221
24 3300046678 Ga0495599_0018479 Ga0495599_0018479_2833_3729 221
25 3300047471 Ga0495684_0031576 Ga0495684_0031576_2292_2984 221
26 3300048088 Ga0495602_0110483 Ga0495602_0110483_51_743 221
27 3300048903 Ga0496100_0282649 Ga0496100_0282649_94_786 221
28 3300053077 Ga0495601_0054790 Ga0495601_0054790_1820_2512 221
29 3300053084 Ga0495595_0052209 Ga0495595_0052209_49_741 221
30 3300053093 Ga0500651_0063769 Ga0500651_0063769_937_1629 221
31 3300053133 Ga0500655_056987 Ga0500655_056987_62_754 221
32 3300053731 Ga0500609_006928 Ga0500609_006928_779_1471 221
33 iso_pu_bacteria 2513237087 2513590708 225
34 iso_pu_bacteria 2906626472 2906633377 225
35 iso_pu_bacteria 8016583857 8016586468 225
36 iso_pu_bacteria 2511231028 2511400859 226
37 iso_pu_bacteria 2513237092 2513626222 226
38 iso_pu_bacteria 2513237095 2513647682 226
39 iso_pu_bacteria 2513237102 2513702416 226
40 iso_pu_bacteria 2513237104 2513719775 226
41 iso_pu_bacteria 2513237139 2513873611 226
42 iso_pu_bacteria 2513237161 2514012402 226
43 iso_pu_bacteria 2517093001 2517107105 226
44 iso_pu_bacteria 2524023205 2524436002 226
45 iso_pu_bacteria 2528768022 2528851279 226
46 iso_pu_bacteria 2617270735 2617351018 226
47 iso_pu_bacteria 2617270741 2617373681 226
48 iso_pu_bacteria 2744054633 2745081599 226
49 iso_pu_bacteria 2791355196 2793064872 226
50 iso_pu_bacteria 2802429603 2805915695 226
51 iso_pu_bacteria 2816332527 2818237562 226
52 iso_pu_bacteria 2824600985 2824606106 226
53 iso_pu_bacteria 2824609381 2824612242 226
54 iso_pu_bacteria 2824617872 2824620730 226
55 iso_pu_bacteria 2824626560 2824629842 226
56 iso_pu_bacteria 2824635225 2824638257 226
57 iso_pu_bacteria 2824644064 2824650855 226
58 iso_pu_bacteria 2824653114 2824655494 226
59 iso_pu_bacteria 2824661429 2824663833 226
60 iso_pu_bacteria 2824671348 2824678186 226
61 iso_pu_bacteria 2824679649 2824682678 226
62 iso_pu_bacteria 2824687955 2824691027 226
63 iso_pu_bacteria 2824696289 2824699067 226
64 iso_pu_bacteria 2824704595 2824709957 226
65 iso_pu_bacteria 2824714736 2824719942 226
66 iso_pu_bacteria 2824723954 2824730301 226
67 iso_pu_bacteria 2824732956 2824735199 226
68 iso_pu_bacteria 2824746037 2824750585 226
69 iso_pu_bacteria 2824753945 2824757709 226
70 iso_pu_bacteria 2824763712 2824768779 226
71 iso_pu_bacteria 2824773399 2824775605 226
72 iso_pu_bacteria 2838122688 2838124430 226
73 iso_pu_bacteria 2841941048 2841945116 226
74 iso_pu_bacteria 2841949485 2841951898 226
75 iso_pu_bacteria 2841957949 2841965707 226
76 iso_pu_bacteria 2841966195 2841970707 226
77 iso_pu_bacteria 2841974524 2841980056 226
78 iso_pu_bacteria 2841983080 2841985235 226
79 iso_pu_bacteria 2842038055 2842043590 226
80 iso_pu_bacteria 2842045827 2842052420 226
81 iso_pu_bacteria 2847930680 2847930992 226
82 iso_pu_bacteria 2847939898 2847942069 226
83 iso_pu_bacteria 2849076700 2849082956 226
84 iso_pu_bacteria 2857509624 2857511842 226
85 iso_pu_bacteria 2874612657 2874619260 226
86 iso_pu_bacteria 2874620515 2874624701 226
87 iso_pu_bacteria 2874628541 2874628892 226
88 iso_pu_bacteria 2876761206 2876765525 226
89 iso_pu_bacteria 2876808645 2876813156 226
90 iso_pu_bacteria 2879083081 2879085828 226
91 iso_pu_bacteria 2879099564 2879108639 226
92 iso_pu_bacteria 2879110137 2879113084 226
93 iso_pu_bacteria 2881364244 2881365744 226
94 iso_pu_bacteria 2881665667 2881665981 226
95 iso_pu_bacteria 2885366525 2885371109 226
96 iso_pu_bacteria 2885409591 2885418788 226
97 iso_pu_bacteria 2888378607 2888379681 226
98 iso_pu_bacteria 2888388044 2888390760 226
99 iso_pu_bacteria 2888419890 2888420389 226
100 iso_pu_bacteria 2904666416 2904670344 226
101 iso_pu_bacteria 2904711408 2904713089 226
102 iso_pu_bacteria 2906643746 2906647430 226
103 iso_pu_bacteria 2908775508 2908776171 226
104 iso_pu_bacteria 2922368715 2922378707 226
105 iso_pu_bacteria 2922386360 2922392652 226
106 iso_pu_bacteria 2922393267 2922398930 226
107 iso_pu_bacteria 2929615660 2929618512 226
108 iso_pu_bacteria 2929624759 2929628803 226
109 iso_pu_bacteria 2932784394 2932786700 226
110 iso_pu_bacteria 2932809354 2932812256 226
111 iso_pu_bacteria 2932818245 2932823247 226
112 iso_pu_bacteria 2932828146 2932829913 226
113 iso_pu_bacteria 2933577622 2933580776 226
114 iso_pu_bacteria 2935616580 2935618431 226
115 iso_pu_bacteria 2935638405 2935641171 226
116 iso_pu_bacteria 2935665750 2935670087 226
117 iso_pu_bacteria 2935675223 2935680919 226
118 iso_pu_bacteria 2935684952 2935689934 226
119 iso_pu_bacteria 2935694250 2935698455 226
120 iso_pu_bacteria 2935703347 2935707597 226
121 iso_pu_bacteria 2935713505 2935717453 226
122 iso_pu_bacteria 2935722832 2935723877 226
123 iso_pu_bacteria 2935732158 2935740086 226
124 iso_pu_bacteria 2935741537 2935749349 226
125 iso_pu_bacteria 2935750917 2935757288 226
126 iso_pu_bacteria 2935760218 2935763626 226
127 iso_pu_bacteria 2935801545 2935804015 226
128 iso_pu_bacteria 2935810662 2935815109 226
129 iso_pu_bacteria 2935827899 2935830902 226
130 iso_pu_bacteria 2935837841 2935841512 226
131 iso_pu_bacteria 2935855204 2935862474 226
132 iso_pu_bacteria 2935864058 2935866598 226
133 iso_pu_bacteria 2935873716 2935874905 226
134 iso_pu_bacteria 2935959822 2935962554 226
135 iso_pu_bacteria 2935992306 2935994411 226
136 iso_pu_bacteria 2936002035 2936004611 226
137 iso_pu_bacteria 2936037263 2936043176 226
138 iso_pu_bacteria 2940556831 2940563201 226
139 iso_pu_bacteria 2941538514 2941543118 226
140 iso_pu_bacteria 3005483717 3005486817 226
141 iso_pu_bacteria 3005506211 3005509244 226
142 iso_pu_bacteria 3005587118 3005593156 226
143 iso_pu_bacteria 3005710791 3005710915 226
144 iso_pu_bacteria 8006984368 8006990836 226
145 iso_pu_bacteria 8016511872 8016518279 226
146 iso_pu_bacteria 8017057580 8017058374 226
147 iso_pu_bacteria 8019576017 8019577326 226
148 iso_pu_bacteria 8019586578 8019595408 226
149 iso_pu_bacteria 8019597564 8019606354 226
150 iso_pu_bacteria 8019608314 8019612181 226
151 iso_pu_bacteria 8055742211 8055742362 226
152 iso_pu_bacteria 8056673599 8056675655 226
153 3300003215 JGI25153J46596_10004886 JGI25153J46596_100048866 229
154 3300006846 Ga0075430_100374617 Ga0075430_1003746172 229
155 3300006880 Ga0075429_100417558 Ga0075429_1004175582 229
156 3300025297 Ga0209758_1000634 Ga0209758_10006346 229
157 3300045976 Ga0466967_0511156 Ga0466967_0511156_330_1019 229
158 3300049568 Ga0501031_0267175 Ga0501031_0267175_364_1056 229
159 3300049569 Ga0501032_0164967 Ga0501032_0164967_244_936 229
160 3300049571 Ga0501034_0483366 Ga0501034_0483366_160_849 229
161 3300049572 Ga0501036_0130348 Ga0501036_0130348_61_753 229
162 3300049575 Ga0501039_0006903 Ga0501039_0006903_900_1592 229
163 3300049588 Ga0501072_0082013 Ga0501072_0082013_942_1634 229
164 3300049743 Ga0501081_0170867 Ga0501081_0170867_822_1514 229
165 3300049824 Ga0501045_0102216 Ga0501045_0102216_60_752 229
166 3300053142 Ga0500577_0048023 Ga0500577_0048023_140_829 229
167 3300053146 Ga0500588_0133205 Ga0500588_0133205_120_809 229
168 3300002067 JGI24735J21928_10092894 JGI24735J21928_100928942 230
169 3300003215 JGI25153J46596_10008982 JGI25153J46596_100089821 230
170 3300003215 JGI25153J46596_10024972 JGI25153J46596_100249721 230
171 3300003354 JGI25160J50197_1002942 JGI25160J50197_10029423 230
172 3300003354 JGI25160J50197_1014077 JGI25160J50197_10140772 230
173 3300003659 JGI25404J52841_10003452 JGI25404J52841_100034522 230
174 3300003659 JGI25404J52841_10011291 JGI25404J52841_100112912 230
175 3300003659 JGI25404J52841_10012295 JGI25404J52841_100122952 230
176 3300003752 Ga0055539_1004135 Ga0055539_10041352 230
177 3300003794 Ga0055531_10021303 Ga0055531_100213031 230
178 3300005262 Ga0065165_1003108 Ga0065165_10031086 230
179 3300005262 Ga0065165_1008177 Ga0065165_10081771 230
180 3300005262 Ga0065165_1023855 Ga0065165_10238551 230
181 3300005328 Ga0070676_10056318 Ga0070676_100563182 230
182 3300005329 Ga0070683_100480083 Ga0070683_1004800832 230
183 3300005330 Ga0070690_100016343 Ga0070690_1000163434 230
184 3300005330 Ga0070690_100049808 Ga0070690_1000498082 230
185 3300005333 Ga0070677_10074166 Ga0070677_100741662 230
186 3300005337 Ga0070682_100046546 Ga0070682_1000465463 230
187 3300005338 Ga0068868_100221941 Ga0068868_1002219412 230
188 3300005340 Ga0070689_100005739 Ga0070689_1000057392 230
189 3300005340 Ga0070689_100201744 Ga0070689_1002017442 230
190 3300005340 Ga0070689_100590851 Ga0070689_1005908512 230
191 3300005343 Ga0070687_100283633 Ga0070687_1002836332 230
192 3300005344 Ga0070661_100057065 Ga0070661_1000570653 230
193 3300005344 Ga0070661_100152390 Ga0070661_1001523902 230
194 3300005345 Ga0070692_10098216 Ga0070692_100982162 230
195 3300005347 Ga0070668_100131471 Ga0070668_1001314712 230
196 3300005347 Ga0070668_100517265 Ga0070668_1005172652 230
197 3300005353 Ga0070669_100087084 Ga0070669_1000870842 230
198 3300005353 Ga0070669_100100352 Ga0070669_1001003523 230
199 3300005354 Ga0070675_100279495 Ga0070675_1002794951 230
200 3300005355 Ga0070671_100003341 Ga0070671_1000033418 230
201 3300005355 Ga0070671_100102364 Ga0070671_1001023643 230
202 3300005355 Ga0070671_100148726 Ga0070671_1001487262 230
203 3300005356 Ga0070674_100023733 Ga0070674_1000237333 230
204 3300005364 Ga0070673_100053597 Ga0070673_1000535971 230
205 3300005364 Ga0070673_100496168 Ga0070673_1004961682 230
206 3300005364 Ga0070673_100705201 Ga0070673_1007052011 230
207 3300005366 Ga0070659_100060904 Ga0070659_1000609043 230
208 3300005367 Ga0070667_100173800 Ga0070667_1001738002 230
209 3300005367 Ga0070667_100226549 Ga0070667_1002265491 230
210 3300005367 Ga0070667_100356696 Ga0070667_1003566962 230
211 3300005434 Ga0070709_10010783 Ga0070709_100107837 230
212 3300005434 Ga0070709_10339827 Ga0070709_103398272 230
213 3300005434 Ga0070709_10690191 Ga0070709_106901911 230
214 3300005435 Ga0070714_100027788 Ga0070714_1000277883 230
215 3300005435 Ga0070714_100055517 Ga0070714_1000555172 230
216 3300005436 Ga0070713_100005457 Ga0070713_10000545710 230
217 3300005436 Ga0070713_100248247 Ga0070713_1002482471 230
218 3300005436 Ga0070713_100461263 Ga0070713_1004612632 230
219 3300005437 Ga0070710_10004329 Ga0070710_100043297 230
220 3300005439 Ga0070711_100006098 Ga0070711_1000060987 230
221 3300005439 Ga0070711_100156300 Ga0070711_1001563002 230
222 3300005444 Ga0070694_100147575 Ga0070694_1001475752 230
223 3300005455 Ga0070663_100002254 Ga0070663_1000022543 230
224 3300005456 Ga0070678_100345356 Ga0070678_1003453561 230
225 3300005456 Ga0070678_100353712 Ga0070678_1003537121 230
226 3300005456 Ga0070678_100655844 Ga0070678_1006558441 230
227 3300005458 Ga0070681_10012145 Ga0070681_100121455 230
228 3300005459 Ga0068867_100091881 Ga0068867_1000918813 230
229 3300005466 Ga0070685_10151389 Ga0070685_101513892 230
230 3300005467 Ga0070706_100305684 Ga0070706_1003056842 230
231 3300005518 Ga0070699_100467433 Ga0070699_1004674331 230
232 3300005530 Ga0070679_100415401 Ga0070679_1004154012 230
233 3300005530 Ga0070679_100447885 Ga0070679_1004478852 230
234 3300005535 Ga0070684_100371606 Ga0070684_1003716062 230
235 3300005539 Ga0068853_100078313 Ga0068853_1000783132 230
236 3300005539 Ga0068853_100302337 Ga0068853_1003023372 230
237 3300005543 Ga0070672_100047257 Ga0070672_1000472573 230
238 3300005543 Ga0070672_100050282 Ga0070672_1000502823 230
239 3300005544 Ga0070686_100429049 Ga0070686_1004290491 230
240 3300005548 Ga0070665_100007664 Ga0070665_1000076645 230
241 3300005548 Ga0070665_100247082 Ga0070665_1002470822 230
242 3300005548 Ga0070665_100260772 Ga0070665_1002607722 230
243 3300005548 Ga0070665_100379111 Ga0070665_1003791112 230
244 3300005563 Ga0068855_100173531 Ga0068855_1001735312 230
245 3300005563 Ga0068855_100565536 Ga0068855_1005655362 230
246 3300005578 Ga0068854_100399671 Ga0068854_1003996712 230
247 3300005614 Ga0068856_100032409 Ga0068856_1000324097 230
248 3300005616 Ga0068852_100299793 Ga0068852_1002997932 230
249 3300005617 Ga0068859_100088953 Ga0068859_1000889533 230
250 3300005617 Ga0068859_100169020 Ga0068859_1001690202 230
251 3300005618 Ga0068864_100278893 Ga0068864_1002788932 230
252 3300005719 Ga0068861_100494380 Ga0068861_1004943802 230
253 3300005719 Ga0068861_100540471 Ga0068861_1005404712 230
254 3300005834 Ga0068851_10123505 Ga0068851_101235052 230
255 3300005841 Ga0068863_100144840 Ga0068863_1001448402 230
256 3300005842 Ga0068858_100416641 Ga0068858_1004166411 230
257 3300005843 Ga0068860_100145468 Ga0068860_1001454681 230
258 3300005844 Ga0068862_100676688 Ga0068862_1006766882 230
259 3300005981 Ga0081538_10072576 Ga0081538_100725762 230
260 3300005983 Ga0081540_1000569 Ga0081540_100056923 230
261 3300005983 Ga0081540_1001159 Ga0081540_100115915 230
262 3300005983 Ga0081540_1013129 Ga0081540_10131294 230
263 3300005983 Ga0081540_1082179 Ga0081540_10821791 230
264 3300005985 Ga0081539_10017955 Ga0081539_100179552 230
265 3300005985 Ga0081539_10064486 Ga0081539_100644864 230
266 3300006028 Ga0070717_10197399 Ga0070717_101973992 230
267 3300006038 Ga0075365_10009255 Ga0075365_100092555 230
268 3300006038 Ga0075365_10012376 Ga0075365_100123764 230
269 3300006038 Ga0075365_10058472 Ga0075365_100584722 230
270 3300006038 Ga0075365_10178221 Ga0075365_101782212 230
271 3300006038 Ga0075365_10431489 Ga0075365_104314892 230
272 3300006042 Ga0075368_10019950 Ga0075368_100199502 230
273 3300006042 Ga0075368_10023227 Ga0075368_100232273 230
274 3300006042 Ga0075368_10077200 Ga0075368_100772002 230
275 3300006042 Ga0075368_10078216 Ga0075368_100782162 230
276 3300006048 Ga0075363_100002280 Ga0075363_1000022804 230
277 3300006048 Ga0075363_100009997 Ga0075363_1000099975 230
278 3300006048 Ga0075363_100095188 Ga0075363_1000951882 230
279 3300006048 Ga0075363_100151453 Ga0075363_1001514531 230
280 3300006048 Ga0075363_100241980 Ga0075363_1002419801 230
281 3300006051 Ga0075364_10043405 Ga0075364_100434052 230
282 3300006051 Ga0075364_10098351 Ga0075364_100983511 230
283 3300006051 Ga0075364_10330755 Ga0075364_103307551 230
284 3300006051 Ga0075364_10336955 Ga0075364_103369552 230
285 3300006163 Ga0070715_10002578 Ga0070715_100025786 230
286 3300006173 Ga0070716_100008223 Ga0070716_1000082237 230
287 3300006175 Ga0070712_100039773 Ga0070712_1000397736 230
288 3300006175 Ga0070712_100102505 Ga0070712_1001025052 230
289 3300006177 Ga0075362_10111130 Ga0075362_101111302 230
290 3300006177 Ga0075362_10120780 Ga0075362_101207802 230
291 3300006177 Ga0075362_10125068 Ga0075362_101250681 230
292 3300006178 Ga0075367_10002064 Ga0075367_100020643 230
293 3300006178 Ga0075367_10028955 Ga0075367_100289554 230
294 3300006178 Ga0075367_10048775 Ga0075367_100487753 230
295 3300006178 Ga0075367_10051155 Ga0075367_100511552 230
296 3300006178 Ga0075367_10076847 Ga0075367_100768472 230
297 3300006178 Ga0075367_10155979 Ga0075367_101559792 230
298 3300006178 Ga0075367_10254078 Ga0075367_102540781 230
299 3300006186 Ga0075369_10039263 Ga0075369_100392632 230
300 3300006186 Ga0075369_10146423 Ga0075369_101464231 230
301 3300006195 Ga0075366_10015443 Ga0075366_100154433 230
302 3300006195 Ga0075366_10027253 Ga0075366_100272533 230
303 3300006195 Ga0075366_10044834 Ga0075366_100448343 230
304 3300006195 Ga0075366_10139261 Ga0075366_101392612 230
305 3300006195 Ga0075366_10317749 Ga0075366_103177492 230
306 3300006353 Ga0075370_10009950 Ga0075370_100099502 230
307 3300006353 Ga0075370_10055204 Ga0075370_100552042 230
308 3300006353 Ga0075370_10156586 Ga0075370_101565861 230
309 3300006353 Ga0075370_10224513 Ga0075370_102245132 230
310 3300006353 Ga0075370_10312131 Ga0075370_103121312 230
311 3300006358 Ga0068871_100238074 Ga0068871_1002380742 230
312 3300006358 Ga0068871_100511235 Ga0068871_1005112352 230
313 3300006844 Ga0075428_100052164 Ga0075428_1000521645 230
314 3300006846 Ga0075430_100000014 Ga0075430_10000001427 230
315 3300006846 Ga0075430_100043547 Ga0075430_1000435472 230
316 3300006847 Ga0075431_100056737 Ga0075431_1000567375 230
317 3300006847 Ga0075431_100247243 Ga0075431_1002472432 230
318 3300006880 Ga0075429_100084746 Ga0075429_1000847463 230
319 3300006931 Ga0097620_100088953 Ga0097620_1000889533 230
320 3300006931 Ga0097620_100169008 Ga0097620_1001690082 230
321 3300006941 Ga0099825_1041139 Ga0099825_10411392 230
322 3300006942 Ga0099824_1022711 Ga0099824_10227116 230
323 3300006943 Ga0099822_1053452 Ga0099822_10534521 230
324 3300006944 Ga0099823_1016287 Ga0099823_10162873 230
325 3300007076 Ga0075435_100120735 Ga0075435_1001207353 230
326 3300007788 Ga0099795_10028605 Ga0099795_100286052 230
327 3300007788 Ga0099795_10204835 Ga0099795_102048351 230
328 3300009092 Ga0105250_10068914 Ga0105250_100689142 230
329 3300009093 Ga0105240_10163514 Ga0105240_101635142 230
330 3300009093 Ga0105240_10335429 Ga0105240_103354292 230
331 3300009094 Ga0111539_10439530 Ga0111539_104395302 230
332 3300009094 Ga0111539_11343212 Ga0111539_113432121 230
333 3300009098 Ga0105245_10069249 Ga0105245_100692492 230
334 3300009098 Ga0105245_10116277 Ga0105245_101162772 230
335 3300009101 Ga0105247_10146625 Ga0105247_101466252 230
336 3300009101 Ga0105247_10440915 Ga0105247_104409151 230
337 3300009147 Ga0114129_10497452 Ga0114129_104974522 230
338 3300009148 Ga0105243_10133873 Ga0105243_101338732 230
339 3300009174 Ga0105241_11036203 Ga0105241_110362031 230
340 3300009176 Ga0105242_10533659 Ga0105242_105336591 230
341 3300009177 Ga0105248_10088758 Ga0105248_100887584 230
342 3300009177 Ga0105248_10224430 Ga0105248_102244303 230
343 3300009177 Ga0105248_10783281 Ga0105248_107832812 230
344 3300009177 Ga0105248_10899867 Ga0105248_108998671 230
345 3300009545 Ga0105237_10545918 Ga0105237_105459182 230
346 3300009551 Ga0105238_10347055 Ga0105238_103470552 230
347 3300009551 Ga0105238_10474450 Ga0105238_104744501 230
348 3300009553 Ga0105249_10017103 Ga0105249_100171037 230
349 3300010159 Ga0099796_10016207 Ga0099796_100162072 230
350 3300010159 Ga0099796_10132104 Ga0099796_101321041 230
351 3300010375 Ga0105239_10353329 Ga0105239_103533292 230
352 3300010375 Ga0105239_10397343 Ga0105239_103973432 230
353 3300010375 Ga0105239_10404613 Ga0105239_104046131 230
354 3300010375 Ga0105239_10638672 Ga0105239_106386721 230
355 3300011119 Ga0105246_10028814 Ga0105246_100288144 230
356 3300011119 Ga0105246_10692864 Ga0105246_106928641 230
357 3300013100 Ga0157373_10179078 Ga0157373_101790781 230
358 3300013105 Ga0157369_10017624 Ga0157369_100176248 230
359 3300013296 Ga0157374_10318983 Ga0157374_103189832 230
360 3300013297 Ga0157378_10226692 Ga0157378_102266922 230
361 3300013297 Ga0157378_11023894 Ga0157378_110238941 230
362 3300013306 Ga0163162_10541041 Ga0163162_105410412 230
363 3300013306 Ga0163162_11019948 Ga0163162_110199481 230
364 3300013308 Ga0157375_10163233 Ga0157375_101632332 230
365 3300014325 Ga0163163_10079712 Ga0163163_100797122 230
366 3300014325 Ga0163163_10149491 Ga0163163_101494912 230
367 3300014325 Ga0163163_10153451 Ga0163163_101534512 230
368 3300014326 Ga0157380_10133334 Ga0157380_101333343 230
369 3300014326 Ga0157380_10724492 Ga0157380_107244923 230
370 3300014745 Ga0157377_10095179 Ga0157377_100951793 230
371 3300014968 Ga0157379_10260644 Ga0157379_102606442 230
372 3300014968 Ga0157379_10363672 Ga0157379_103636722 230
373 3300015261 Ga0182006_1082223 Ga0182006_10822232 230
374 3300017792 Ga0163161_10090790 Ga0163161_100907902 230
375 3300021320 Ga0214544_1000072 Ga0214544_100007224 230
376 3300021320 Ga0214544_1026539 Ga0214544_10265392 230
377 3300021321 Ga0214542_1004635 Ga0214542_100463524 230
378 3300021324 Ga0214545_1004199 Ga0214545_10041996 230
379 3300021327 Ga0214543_1019164 Ga0214543_10191642 230
380 3300021384 Ga0213876_10240857 Ga0213876_102408571 230
381 3300025230 Ga0209563_101386 Ga0209563_1013866 230
382 3300025245 Ga0207425_1010124 Ga0207425_10101242 230
383 3300025253 Ga0209677_101289 Ga0209677_1012893 230
384 3300025261 Ga0209233_1029903 Ga0209233_10299032 230
385 3300025273 Ga0209673_1022942 Ga0209673_10229422 230
386 3300025295 Ga0209564_1004992 Ga0209564_10049925 230
387 3300025297 Ga0209758_1000443 Ga0209758_100044316 230
388 3300025297 Ga0209758_1000546 Ga0209758_100054626 230
389 3300025297 Ga0209758_1001177 Ga0209758_10011773 230
390 3300025297 Ga0209758_1004442 Ga0209758_10044425 230
391 3300025297 Ga0209758_1008497 Ga0209758_10084974 230
392 3300025302 Ga0207426_1002219 Ga0207426_10022196 230
393 3300025302 Ga0207426_1015553 Ga0207426_10155533 230
394 3300025304 Ga0209257_1001004 Ga0209257_100100429 230
395 3300025893 Ga0207682_10017946 Ga0207682_100179461 230
396 3300025898 Ga0207692_10004321 Ga0207692_100043213 230
397 3300025898 Ga0207692_10223055 Ga0207692_102230551 230
398 3300025899 Ga0207642_10066135 Ga0207642_100661352 230
399 3300025906 Ga0207699_10013831 Ga0207699_100138313 230
400 3300025906 Ga0207699_10094399 Ga0207699_100943991 230
401 3300025907 Ga0207645_10014781 Ga0207645_100147812 230
402 3300025908 Ga0207643_10177931 Ga0207643_101779311 230
403 3300025911 Ga0207654_10647077 Ga0207654_106470771 230
404 3300025912 Ga0207707_10000100 Ga0207707_1000010079 230
405 3300025912 Ga0207707_10378244 Ga0207707_103782442 230
406 3300025913 Ga0207695_10020001 Ga0207695_100200019 230
407 3300025914 Ga0207671_10164456 Ga0207671_101644561 230
408 3300025915 Ga0207693_10007779 Ga0207693_100077797 230
409 3300025915 Ga0207693_10386539 Ga0207693_103865392 230
410 3300025916 Ga0207663_10004278 Ga0207663_100042786 230
411 3300025916 Ga0207663_10136189 Ga0207663_101361892 230
412 3300025917 Ga0207660_10190724 Ga0207660_101907242 230
413 3300025917 Ga0207660_10624286 Ga0207660_106242861 230
414 3300025918 Ga0207662_10084608 Ga0207662_100846082 230
415 3300025919 Ga0207657_10047437 Ga0207657_100474372 230
416 3300025919 Ga0207657_10066926 Ga0207657_100669264 230
417 3300025919 Ga0207657_10299604 Ga0207657_102996042 230
418 3300025920 Ga0207649_10183535 Ga0207649_101835352 230
419 3300025921 Ga0207652_10014690 Ga0207652_100146907 230
420 3300025924 Ga0207694_10136927 Ga0207694_101369272 230
421 3300025927 Ga0207687_10031619 Ga0207687_100316192 230
422 3300025928 Ga0207700_10464147 Ga0207700_104641471 230
423 3300025929 Ga0207664_10029215 Ga0207664_100292156 230
424 3300025929 Ga0207664_10210219 Ga0207664_102102192 230
425 3300025931 Ga0207644_10007950 Ga0207644_100079503 230
426 3300025933 Ga0207706_10066190 Ga0207706_100661902 230
427 3300025933 Ga0207706_10412869 Ga0207706_104128692 230
428 3300025934 Ga0207686_10103181 Ga0207686_101031812 230
429 3300025934 Ga0207686_10271000 Ga0207686_102710001 230
430 3300025935 Ga0207709_10053072 Ga0207709_100530722 230
431 3300025936 Ga0207670_10012326 Ga0207670_100123265 230
432 3300025936 Ga0207670_10090782 Ga0207670_100907822 230
433 3300025937 Ga0207669_10003549 Ga0207669_100035493 230
434 3300025938 Ga0207704_10081014 Ga0207704_100810142 230
435 3300025939 Ga0207665_10001903 Ga0207665_1000190310 230
436 3300025939 Ga0207665_10031388 Ga0207665_100313885 230
437 3300025939 Ga0207665_10074727 Ga0207665_100747273 230
438 3300025940 Ga0207691_10098258 Ga0207691_100982582 230
439 3300025940 Ga0207691_10309515 Ga0207691_103095152 230
440 3300025941 Ga0207711_10037079 Ga0207711_100370792 230
441 3300025941 Ga0207711_10187783 Ga0207711_101877831 230
442 3300025941 Ga0207711_10376203 Ga0207711_103762032 230
443 3300025942 Ga0207689_10278608 Ga0207689_102786082 230
444 3300025949 Ga0207667_10219874 Ga0207667_102198743 230
445 3300025949 Ga0207667_10440501 Ga0207667_104405012 230
446 3300025949 Ga0207667_10460117 Ga0207667_104601171 230
447 3300025960 Ga0207651_10065494 Ga0207651_100654942 230
448 3300025960 Ga0207651_10356428 Ga0207651_103564282 230
449 3300025972 Ga0207668_10025116 Ga0207668_100251163 230
450 3300025972 Ga0207668_10207757 Ga0207668_102077571 230
451 3300025986 Ga0207658_10094588 Ga0207658_100945882 230
452 3300025986 Ga0207658_10418196 Ga0207658_104181962 230
453 3300026035 Ga0207703_10045609 Ga0207703_100456091 230
454 3300026035 Ga0207703_10493342 Ga0207703_104933421 230
455 3300026041 Ga0207639_10094865 Ga0207639_100948653 230
456 3300026041 Ga0207639_10136190 Ga0207639_101361903 230
457 3300026041 Ga0207639_10555374 Ga0207639_105553742 230
458 3300026067 Ga0207678_10053990 Ga0207678_100539903 230
459 3300026067 Ga0207678_10130549 Ga0207678_101305492 230
460 3300026067 Ga0207678_10150637 Ga0207678_101506373 230
461 3300026067 Ga0207678_10190763 Ga0207678_101907631 230
462 3300026075 Ga0207708_10201193 Ga0207708_102011932 230
463 3300026078 Ga0207702_10035301 Ga0207702_100353014 230
464 3300026078 Ga0207702_10544542 Ga0207702_105445422 230
465 3300026088 Ga0207641_10429029 Ga0207641_104290292 230
466 3300026089 Ga0207648_10131965 Ga0207648_101319652 230
467 3300026095 Ga0207676_10040530 Ga0207676_100405302 230
468 3300026118 Ga0207675_100198795 Ga0207675_1001987952 230
469 3300026118 Ga0207675_100345161 Ga0207675_1003451612 230
470 3300026118 Ga0207675_100484343 Ga0207675_1004843432 230
471 3300026118 Ga0207675_100903991 Ga0207675_1009039911 230
472 3300026121 Ga0207683_10038424 Ga0207683_100384242 230
473 3300026121 Ga0207683_10075531 Ga0207683_100755313 230
474 3300026121 Ga0207683_10088356 Ga0207683_100883561 230
475 3300026121 Ga0207683_10331269 Ga0207683_103312692 230
476 3300026142 Ga0207698_10888859 Ga0207698_108888592 230
477 3300027296 Ga0209389_1000153 Ga0209389_100015336 230
478 3300027296 Ga0209389_1002328 Ga0209389_10023285 230
479 3300027357 Ga0209589_1000032 Ga0209589_1000032135 230
480 3300027361 Ga0209489_100936 Ga0209489_10093631 230
481 3300027361 Ga0209489_102825 Ga0209489_1028255 230
482 3300027363 Ga0209700_100011 Ga0209700_100011120 230
483 3300028379 Ga0268266_10007673 Ga0268266_100076736 230
484 3300028379 Ga0268266_10035191 Ga0268266_100351912 230
485 3300028379 Ga0268266_10092493 Ga0268266_100924933 230
486 3300028379 Ga0268266_10115575 Ga0268266_101155753 230
487 3300028379 Ga0268266_10469143 Ga0268266_104691431 230
488 3300028380 Ga0268265_10096565 Ga0268265_100965653 230
489 3300028380 Ga0268265_10281344 Ga0268265_102813442 230
490 3300028381 Ga0268264_10229252 Ga0268264_102292522 230
491 3300030522 Ga0307512_10291337 Ga0307512_102913371 230
492 3300031239 Ga0265328_10000008 Ga0265328_1000000851 230
493 3300031241 Ga0265325_10000095 Ga0265325_100000956 230
494 3300031241 Ga0265325_10028703 Ga0265325_100287032 230
495 3300031247 Ga0265340_10020052 Ga0265340_100200522 230
496 3300031247 Ga0265340_10022058 Ga0265340_100220582 230
497 3300031249 Ga0265339_10030169 Ga0265339_100301692 230
498 3300031250 Ga0265331_10002096 Ga0265331_1000209610 230
499 3300031344 Ga0265316_10000608 Ga0265316_100006083 230
500 3300031344 Ga0265316_10169113 Ga0265316_101691132 230
501 3300031456 Ga0307513_10390165 Ga0307513_103901652 230
502 3300031507 Ga0307509_10093644 Ga0307509_100936443 230
503 3300031595 Ga0265313_10007848 Ga0265313_100078483 230
504 3300031616 Ga0307508_10219166 Ga0307508_102191662 230
505 3300031649 Ga0307514_10210319 Ga0307514_102103192 230
506 3300031712 Ga0265342_10046498 Ga0265342_100464983 230
507 3300031730 Ga0307516_10052602 Ga0307516_100526025 230
508 3300031731 Ga0307405_10036667 Ga0307405_100366672 230
509 3300031731 Ga0307405_10421616 Ga0307405_104216162 230
510 3300031824 Ga0307413_10121135 Ga0307413_101211352 230
511 3300031852 Ga0307410_10190256 Ga0307410_101902562 230
512 3300031901 Ga0307406_10881950 Ga0307406_108819501 230
513 3300032126 Ga0307415_100073210 Ga0307415_1000732102 230
514 3300032126 Ga0307415_100103527 Ga0307415_1001035272 230
515 3300032126 Ga0307415_100143624 Ga0307415_1001436242 230
516 3300033180 Ga0307510_10003373 Ga0307510_1000337316 230
517 3300033180 Ga0307510_10009621 Ga0307510_100096215 230
518 3300033180 Ga0307510_10082786 Ga0307510_100827862 230
519 3300033180 Ga0307510_10156113 Ga0307510_101561132 230
520 3300034818 Ga0373950_0026880 Ga0373950_0026880_31_723 230
521 3300034819 Ga0373958_0006826 Ga0373958_0006826_477_1169 230
522 3300035084 Ga0373928_0037988 Ga0373928_0037988_160_852 230
523 3300035088 Ga0373940_0034519 Ga0373940_0034519_235_927 230
524 3300035090 Ga0373949_0008441 Ga0373949_0008441_787_1479 230
525 3300035111 Ga0373923_0137346 Ga0373923_0137346_62_754 230
526 3300035114 Ga0373939_0015610 Ga0373939_0015610_750_1442 230
527 3300035114 Ga0373939_0172121 Ga0373939_0172121_46_738 230
528 3300035115 Ga0373941_0037756 Ga0373941_0037756_755_1447 230
529 3300035117 Ga0373953_0019333 Ga0373953_0019333_1468_2160 230
530 3300035118 Ga0373954_0145854 Ga0373954_0145854_62_754 230
531 3300035119 Ga0373956_0019145 Ga0373956_0019145_1591_2283 230
532 3300035120 Ga0373957_0029071 Ga0373957_0029071_513_1205 230
533 3300035121 Ga0373960_0011827 Ga0373960_0011827_1338_2030 230
534 3300035172 Ga0373955_0004568 Ga0373955_0004568_2739_3431 230
535 3300035410 Ga0373924_0004146 Ga0373924_0004146_2077_2769 230
536 3300035691 Ga0373931_0002622 Ga0373931_0002622_7106_7798 230
537 3300035691 Ga0373931_0004016 Ga0373931_0004016_1949_2641 230
538 3300035692 Ga0373935_0147935 Ga0373935_0147935_507_1199 230
539 3300035695 Ga0373927_0073155 Ga0373927_0073155_153_845 230
540 3300035695 Ga0373927_0336458 Ga0373927_0336458_158_850 230
541 3300035725 Ga0373947_0097246 Ga0373947_0097246_518_1210 230
542 3300035725 Ga0373947_0374760 Ga0373947_0374760_238_930 230
543 3300036401 Ga0373937_0007161 Ga0373937_0007161_5546_6238 230
544 3300036401 Ga0373937_0709029 Ga0373937_0709029_166_858 230
545 3300037068 Ga0373925_0011850 Ga0373925_0011850_4165_4857 230
546 3300037068 Ga0373925_0322123 Ga0373925_0322123_126_818 230
547 3300037312 Ga0395899_0103451 Ga0395899_0103451_718_1410 230
548 3300037312 Ga0395899_0201946 Ga0395899_0201946_68_760 230
549 3300037418 Ga0395900_0000623 Ga0395900_0000623_686_1384 230
550 3300037418 Ga0395900_0013523 Ga0395900_0013523_7119_7811 230
551 3300037418 Ga0395900_0125989 Ga0395900_0125989_1738_2430 230
552 3300037418 Ga0395900_0493107 Ga0395900_0493107_250_942 230
553 3300037466 Ga0395898_0006403 Ga0395898_0006403_7328_8026 230
554 3300037466 Ga0395898_0026676 Ga0395898_0026676_2528_3220 230
555 3300037466 Ga0395898_0092783 Ga0395898_0092783_1969_2661 230
556 3300037466 Ga0395898_0140041 Ga0395898_0140041_705_1397 230
557 3300037466 Ga0395898_0222243 Ga0395898_0222243_829_1521 230
558 3300037471 Ga0395905_0003532 Ga0395905_0003532_2850_3542 230
559 3300037471 Ga0395905_0629228 Ga0395905_0629228_170_862 230
560 3300037853 Ga0436364_0806179 Ga0436364_0806179_381_1073 230
561 3300037853 Ga0436364_1071255 Ga0436364_1071255_4534_5226 230
562 3300038443 Ga0395901_0155181 Ga0395901_0155181_847_1539 230
563 3300038443 Ga0395901_0288666 Ga0395901_0288666_898_1590 230
564 3300039437 Ga0436365_0986794 Ga0436365_0986794_290_982 230
565 3300039437 Ga0436365_1271825 Ga0436365_1271825_1620_2312 230
566 3300039437 Ga0436365_1324461 Ga0436365_1324461_835_1527 230
567 3300039437 Ga0436365_1357054 Ga0436365_1357054_1655_2356 230
568 3300039437 Ga0436365_1744779 Ga0436365_1744779_127_819 230
569 3300039450 Ga0436363_0276125 Ga0436363_0276125_169_861 230
570 3300039450 Ga0436363_1375376 Ga0436363_1375376_490_1182 230
571 3300041456 Ga0451795_1442667 Ga0451795_1442667_55_747 230
572 3300041486 Ga0451807_0943623 Ga0451807_0943623_160_852 230
573 3300042134 Ga0450898_037527 Ga0450898_037527_52_744 230
574 3300042438 Ga0439459_0050520 Ga0439459_0050520_161_853 230
575 3300044658 Ga0466972_0000214 Ga0466972_0000214_24096_24788 230
576 3300044658 Ga0466972_0005666 Ga0466972_0005666_4716_5408 230
577 3300044658 Ga0466972_0201147 Ga0466972_0201147_124_816 230
578 3300044694 Ga0466963_0023549 Ga0466963_0023549_829_1521 230
579 3300044735 Ga0466968_0000951 Ga0466968_0000951_9000_9692 230
580 3300044901 Ga0466960_0025665 Ga0466960_0025665_938_1630 230
581 3300045051 Ga0451576_0301294 Ga0451576_0301294_216_908 230
582 3300045976 Ga0466967_0179255 Ga0466967_0179255_72_764 230
583 3300046454 Ga0495592_0020331 Ga0495592_0020331_3749_4441 230
584 3300046454 Ga0495592_0067098 Ga0495592_0067098_1786_2478 230
585 3300046455 Ga0495603_0023829 Ga0495603_0023829_113_805 230
586 3300046455 Ga0495603_0037954 Ga0495603_0037954_1763_2455 230
587 3300046455 Ga0495603_0071525 Ga0495603_0071525_596_1288 230
588 3300046455 Ga0495603_0173964 Ga0495603_0173964_107_799 230
589 3300046459 Ga0495629_0090351 Ga0495629_0090351_193_885 230
590 3300046460 Ga0495638_0001656 Ga0495638_0001656_2410_3102 230
591 3300046460 Ga0495638_0066248 Ga0495638_0066248_47_739 230
592 3300046462 Ga0495651_0008047 Ga0495651_0008047_798_1490 230
593 3300046462 Ga0495651_0145618 Ga0495651_0145618_812_1504 230
594 3300046462 Ga0495651_0309744 Ga0495651_0309744_48_740 230
595 3300046463 Ga0495653_0132656 Ga0495653_0132656_240_932 230
596 3300046473 Ga0495582_0055364 Ga0495582_0055364_891_1583 230
597 3300046474 Ga0495605_0063860 Ga0495605_0063860_466_1158 230
598 3300046475 Ga0495639_0108454 Ga0495639_0108454_117_809 230
599 3300046476 Ga0495662_0050832 Ga0495662_0050832_888_1580 230
600 3300046477 Ga0495664_0090429 Ga0495664_0090429_667_1359 230
601 3300046477 Ga0495664_0142342 Ga0495664_0142342_522_1214 230
602 3300046491 Ga0495584_0116119 Ga0495584_0116119_538_1230 230
603 3300046492 Ga0495585_0069235 Ga0495585_0069235_997_1689 230
604 3300046499 Ga0495594_0032422 Ga0495594_0032422_360_1052 230
605 3300046507 Ga0495606_0032339 Ga0495606_0032339_1152_1844 230
606 3300046511 Ga0495608_0012281 Ga0495608_0012281_5245_5937 230
607 3300046511 Ga0495608_0017571 Ga0495608_0017571_1143_1835 230
608 3300046511 Ga0495608_0218939 Ga0495608_0218939_194_886 230
609 3300046513 Ga0495616_0042811 Ga0495616_0042811_443_1135 230
610 3300046514 Ga0495618_0134523 Ga0495618_0134523_507_1199 230
611 3300046516 Ga0495628_0001017 Ga0495628_0001017_9042_9734 230
612 3300046517 Ga0495630_0281388 Ga0495630_0281388_244_936 230
613 3300046518 Ga0495631_0061101 Ga0495631_0061101_546_1238 230
614 3300046518 Ga0495631_0139798 Ga0495631_0139798_318_1010 230
615 3300046519 Ga0495632_0084208 Ga0495632_0084208_96_788 230
616 3300046524 Ga0495648_0007591 Ga0495648_0007591_3990_4682 230
617 3300046524 Ga0495648_0087070 Ga0495648_0087070_224_916 230
618 3300046525 Ga0495663_0037310 Ga0495663_0037310_146_838 230
619 3300046529 Ga0495652_0017324 Ga0495652_0017324_3551_4243 230
620 3300046530 Ga0495654_0140876 Ga0495654_0140876_36_728 230
621 3300046533 Ga0495640_0034260 Ga0495640_0034260_730_1422 230
622 3300046536 Ga0495587_0079491 Ga0495587_0079491_202_894 230
623 3300046543 Ga0495645_0062580 Ga0495645_0062580_512_1204 230
624 3300046543 Ga0495645_0288432 Ga0495645_0288432_138_830 230
625 3300046557 Ga0495622_0057179 Ga0495622_0057179_289_981 230
626 3300046557 Ga0495622_0110561 Ga0495622_0110561_532_1224 230
627 3300046557 Ga0495622_0192042 Ga0495622_0192042_51_743 230
628 3300046559 Ga0495667_0003759 Ga0495667_0003759_8851_9543 230
629 3300046615 Ga0495656_0079351 Ga0495656_0079351_293_985 230
630 3300046616 Ga0495668_0073804 Ga0495668_0073804_527_1219 230
631 3300046616 Ga0495668_0134082 Ga0495668_0134082_211_903 230
632 3300046616 Ga0495668_0206190 Ga0495668_0206190_176_868 230
633 3300046642 Ga0495634_0022629 Ga0495634_0022629_2888_3580 230
634 3300046648 Ga0495611_0053437 Ga0495611_0053437_1112_1804 230
635 3300046660 Ga0495625_0069181 Ga0495625_0069181_573_1265 230
636 3300046660 Ga0495625_0198107 Ga0495625_0198107_542_1234 230
637 3300046663 Ga0495635_0008534 Ga0495635_0008534_3622_4314 230
638 3300046663 Ga0495635_0020625 Ga0495635_0020625_3195_3887 230
639 3300046674 Ga0495588_0009691 Ga0495588_0009691_1773_2465 230
640 3300046675 Ga0495657_0008309 Ga0495657_0008309_6171_6863 230
641 3300046675 Ga0495657_0054517 Ga0495657_0054517_1950_2642 230
642 3300046678 Ga0495599_0014581 Ga0495599_0014581_765_1457 230
643 3300046678 Ga0495599_0046413 Ga0495599_0046413_1125_1817 230
644 3300046678 Ga0495599_0385951 Ga0495599_0385951_47_739 230
645 3300046679 Ga0495623_0003900 Ga0495623_0003900_6199_6891 230
646 3300046680 Ga0495646_0099690 Ga0495646_0099690_724_1416 230
647 3300046680 Ga0495646_0156883 Ga0495646_0156883_349_1041 230
648 3300046684 Ga0495669_0227461 Ga0495669_0227461_183_875 230
649 3300046684 Ga0495669_0237151 Ga0495669_0237151_25_717 230
650 3300046689 Ga0495613_0111436 Ga0495613_0111436_79_771 230
651 3300046689 Ga0495613_0272332 Ga0495613_0272332_14_706 230
652 3300046691 Ga0495670_0276018 Ga0495670_0276018_135_827 230
653 3300046692 Ga0495671_0082552 Ga0495671_0082552_196_888 230
654 3300046694 Ga0495649_0141716 Ga0495649_0141716_241_933 230
655 3300046809 Ga0495600_0012269 Ga0495600_0012269_1981_2673 230
656 3300046809 Ga0495600_0018591 Ga0495600_0018591_1973_2665 230
657 3300046809 Ga0495600_0024592 Ga0495600_0024592_529_1221 230
658 3300047317 Ga0495604_0001877 Ga0495604_0001877_13447_14139 230
659 3300047317 Ga0495604_0016427 Ga0495604_0016427_2401_3093 230
660 3300047317 Ga0495604_0102094 Ga0495604_0102094_188_880 230
661 3300047319 Ga0495674_0024696 Ga0495674_0024696_2804_3496 230
662 3300047319 Ga0495674_0051300 Ga0495674_0051300_961_1653 230
663 3300047320 Ga0495672_0104768 Ga0495672_0104768_603_1295 230
664 3300047321 Ga0495676_0067366 Ga0495676_0067366_448_1140 230
665 3300047321 Ga0495676_0506836 Ga0495676_0506836_88_780 230
666 3300047322 Ga0495680_0009331 Ga0495680_0009331_7030_7722 230
667 3300047322 Ga0495680_0014667 Ga0495680_0014667_2157_2849 230
668 3300047323 Ga0495683_0115128 Ga0495683_0115128_348_1040 230
669 3300047323 Ga0495683_0136383 Ga0495683_0136383_17_709 230
670 3300047443 Ga0495687_011173 Ga0495687_011173_1683_2375 230
671 3300047444 Ga0495675_0002868 Ga0495675_0002868_6974_7666 230
672 3300047445 Ga0495677_0016874 Ga0495677_0016874_393_1085 230
673 3300047469 Ga0495673_0100057 Ga0495673_0100057_418_1110 230
674 3300047471 Ga0495684_0062545 Ga0495684_0062545_1198_1890 230
675 3300047471 Ga0495684_0364304 Ga0495684_0364304_205_897 230
676 3300047472 Ga0495686_0046645 Ga0495686_0046645_1752_2444 230
677 3300047472 Ga0495686_0133476 Ga0495686_0133476_700_1392 230
678 3300047673 Ga0495593_0184274 Ga0495593_0184274_247_939 230
679 3300048088 Ga0495602_0004680 Ga0495602_0004680_4396_5088 230
680 3300048088 Ga0495602_0006250 Ga0495602_0006250_7959_8651 230
681 3300048088 Ga0495602_0036752 Ga0495602_0036752_1888_2580 230
682 3300048903 Ga0496100_0008700 Ga0496100_0008700_1755_2450 230
683 3300048903 Ga0496100_0177266 Ga0496100_0177266_516_1208 230
684 3300048903 Ga0496100_0508904 Ga0496100_0508904_126_818 230
685 3300048904 Ga0496101_0016346 Ga0496101_0016346_836_1531 230
686 3300048904 Ga0496101_0089074 Ga0496101_0089074_841_1533 230
687 3300048904 Ga0496101_0118741 Ga0496101_0118741_612_1304 230
688 3300048904 Ga0496101_0159518 Ga0496101_0159518_247_939 230
689 3300048905 Ga0496102_0067020 Ga0496102_0067020_1118_1813 230
690 3300048905 Ga0496102_0127950 Ga0496102_0127950_1003_1695 230
691 3300048905 Ga0496102_0317535 Ga0496102_0317535_577_1269 230
692 3300048905 Ga0496102_0516074 Ga0496102_0516074_370_1062 230
693 3300048906 Ga0496103_0007790 Ga0496103_0007790_1315_2007 230
694 3300048906 Ga0496103_0045362 Ga0496103_0045362_381_1073 230
695 3300048906 Ga0496103_0050935 Ga0496103_0050935_912_1607 230
696 3300048907 Ga0496104_0000232 Ga0496104_0000232_46194_46886 230
697 3300048907 Ga0496104_0013139 Ga0496104_0013139_1886_2581 230
698 3300048907 Ga0496104_0187994 Ga0496104_0187994_193_885 230
699 3300048907 Ga0496104_0206690 Ga0496104_0206690_312_1004 230
700 3300048907 Ga0496104_0305064 Ga0496104_0305064_557_1249 230
701 3300048907 Ga0496104_0440117 Ga0496104_0440117_263_955 230
702 3300048908 Ga0496105_0000238 Ga0496105_0000238_24796_25488 230
703 3300048908 Ga0496105_0008712 Ga0496105_0008712_269_961 230
704 3300048908 Ga0496105_0044558 Ga0496105_0044558_493_1185 230
705 3300048908 Ga0496105_0048375 Ga0496105_0048375_146_838 230
706 3300048908 Ga0496105_0086081 Ga0496105_0086081_76_771 230
707 3300048908 Ga0496105_0273293 Ga0496105_0273293_515_1207 230
708 3300048909 Ga0496106_0009906 Ga0496106_0009906_2310_3005 230
709 3300048909 Ga0496106_0192226 Ga0496106_0192226_127_819 230
710 3300048909 Ga0496106_0239591 Ga0496106_0239591_548_1240 230
711 3300048909 Ga0496106_0364135 Ga0496106_0364135_289_981 230
712 3300048909 Ga0496106_0602729 Ga0496106_0602729_31_723 230
713 3300048910 Ga0496107_0035135 Ga0496107_0035135_2002_2697 230
714 3300048910 Ga0496107_0060201 Ga0496107_0060201_1848_2540 230
715 3300048911 Ga0496108_0016193 Ga0496108_0016193_905_1600 230
716 3300048911 Ga0496108_0226693 Ga0496108_0226693_879_1571 230
717 3300048911 Ga0496108_0269097 Ga0496108_0269097_313_1005 230
718 3300048912 Ga0496109_0148075 Ga0496109_0148075_1038_1730 230
719 3300048912 Ga0496109_0152390 Ga0496109_0152390_541_1236 230
720 3300048912 Ga0496109_0327027 Ga0496109_0327027_68_760 230
721 3300048912 Ga0496109_0414022 Ga0496109_0414022_437_1132 230
722 3300048912 Ga0496109_0627225 Ga0496109_0627225_309_1001 230
723 3300048913 Ga0496110_0020628 Ga0496110_0020628_3631_4326 230
724 3300048913 Ga0496110_0032461 Ga0496110_0032461_444_1139 230
725 3300048913 Ga0496110_0254196 Ga0496110_0254196_250_942 230
726 3300048914 Ga0496111_0075304 Ga0496111_0075304_1259_1951 230
727 3300048914 Ga0496111_0479754 Ga0496111_0479754_177_869 230
728 3300048915 Ga0496112_0020629 Ga0496112_0020629_2788_3480 230
729 3300048915 Ga0496112_0071411 Ga0496112_0071411_1408_2100 230
730 3300048915 Ga0496112_0172254 Ga0496112_0172254_186_878 230
731 3300048915 Ga0496112_0394209 Ga0496112_0394209_324_1016 230
732 3300048915 Ga0496112_0995748 Ga0496112_0995748_45_737 230
733 3300048916 Ga0496113_0193063 Ga0496113_0193063_459_1151 230
734 3300048916 Ga0496113_0651469 Ga0496113_0651469_73_765 230
735 3300048917 Ga0496114_0030000 Ga0496114_0030000_3071_3763 230
736 3300048917 Ga0496114_0033513 Ga0496114_0033513_1113_1808 230
737 3300048917 Ga0496114_0499357 Ga0496114_0499357_190_882 230
738 3300048918 Ga0496115_0010118 Ga0496115_0010118_1977_2669 230
739 3300048918 Ga0496115_0015521 Ga0496115_0015521_4010_4705 230
740 3300048918 Ga0496115_0111143 Ga0496115_0111143_744_1436 230
741 3300048920 Ga0496117_0154711 Ga0496117_0154711_590_1282 230
742 3300048920 Ga0496117_0180425 Ga0496117_0180425_91_783 230
743 3300048921 Ga0496118_0069270 Ga0496118_0069270_1787_2479 230
744 3300048922 Ga0496119_0096702 Ga0496119_0096702_34_726 230
745 3300048922 Ga0496119_0123296 Ga0496119_0123296_54_746 230
746 3300048923 Ga0496120_0276056 Ga0496120_0276056_76_768 230
747 3300048924 Ga0496121_0047043 Ga0496121_0047043_1677_2369 230
748 3300048924 Ga0496121_0050170 Ga0496121_0050170_1294_1986 230
749 3300048924 Ga0496121_0142915 Ga0496121_0142915_110_802 230
750 3300048924 Ga0496121_0451251 Ga0496121_0451251_85_777 230
751 3300048927 Ga0496124_0059172 Ga0496124_0059172_2034_2726 230
752 3300048927 Ga0496124_0264627 Ga0496124_0264627_81_773 230
753 3300048928 Ga0496125_0216562 Ga0496125_0216562_32_724 230
754 3300048929 Ga0496126_0014106 Ga0496126_0014106_5493_6185 230
755 3300048929 Ga0496126_0059143 Ga0496126_0059143_223_915 230
756 3300049460 Ga0495682_0055885 Ga0495682_0055885_11_703 230
757 3300049568 Ga0501031_0003455 Ga0501031_0003455_141_833 230
758 3300049568 Ga0501031_0013770 Ga0501031_0013770_80_772 230
759 3300049568 Ga0501031_0026876 Ga0501031_0026876_767_1459 230
760 3300049569 Ga0501032_0003450 Ga0501032_0003450_4014_4706 230
761 3300049569 Ga0501032_0025553 Ga0501032_0025553_2825_3517 230
762 3300049570 Ga0501033_0005832 Ga0501033_0005832_217_909 230
763 3300049570 Ga0501033_0021947 Ga0501033_0021947_2596_3288 230
764 3300049570 Ga0501033_0032049 Ga0501033_0032049_247_939 230
765 3300049570 Ga0501033_0034617 Ga0501033_0034617_1152_1844 230
766 3300049571 Ga0501034_0131878 Ga0501034_0131878_829_1521 230
767 3300049571 Ga0501034_0299466 Ga0501034_0299466_601_1293 230
768 3300049571 Ga0501034_0520696 Ga0501034_0520696_355_1047 230
769 3300049571 Ga0501034_0804590 Ga0501034_0804590_94_786 230
770 3300049572 Ga0501036_0031362 Ga0501036_0031362_10_702 230
771 3300049572 Ga0501036_0048960 Ga0501036_0048960_1159_1851 230
772 3300049572 Ga0501036_0786153 Ga0501036_0786153_43_735 230
773 3300049572 Ga0501036_0854100 Ga0501036_0854100_22_714 230
774 3300049573 Ga0501037_0006333 Ga0501037_0006333_4535_5227 230
775 3300049573 Ga0501037_0018072 Ga0501037_0018072_2105_2797 230
776 3300049574 Ga0501038_0006913 Ga0501038_0006913_96_788 230
777 3300049574 Ga0501038_0017332 Ga0501038_0017332_1944_2636 230
778 3300049574 Ga0501038_0027677 Ga0501038_0027677_297_989 230
779 3300049574 Ga0501038_0175676 Ga0501038_0175676_213_905 230
780 3300049575 Ga0501039_0022198 Ga0501039_0022198_2865_3557 230
781 3300049575 Ga0501039_0039097 Ga0501039_0039097_2678_3370 230
782 3300049575 Ga0501039_0305679 Ga0501039_0305679_424_1116 230
783 3300049575 Ga0501039_0329705 Ga0501039_0329705_291_983 230
784 3300049576 Ga0501040_0267485 Ga0501040_0267485_92_784 230
785 3300049577 Ga0501041_0236177 Ga0501041_0236177_46_738 230
786 3300049577 Ga0501041_0377852 Ga0501041_0377852_64_756 230
787 3300049578 Ga0501042_0054993 Ga0501042_0054993_698_1390 230
788 3300049578 Ga0501042_0082387 Ga0501042_0082387_626_1318 230
789 3300049578 Ga0501042_0260340 Ga0501042_0260340_291_983 230
790 3300049579 Ga0501043_0002883 Ga0501043_0002883_2204_2896 230
791 3300049579 Ga0501043_0012233 Ga0501043_0012233_2121_2813 230
792 3300049579 Ga0501043_0132217 Ga0501043_0132217_952_1644 230
793 3300049579 Ga0501043_0150999 Ga0501043_0150999_1064_1756 230
794 3300049580 Ga0501046_0175530 Ga0501046_0175530_239_931 230
795 3300049581 Ga0501047_0020718 Ga0501047_0020718_1944_2636 230
796 3300049581 Ga0501047_0023538 Ga0501047_0023538_3247_3939 230
797 3300049581 Ga0501047_0076403 Ga0501047_0076403_1373_2065 230
798 3300049581 Ga0501047_0082386 Ga0501047_0082386_703_1395 230
799 3300049581 Ga0501047_0575813 Ga0501047_0575813_85_777 230
800 3300049582 Ga0501048_0001786 Ga0501048_0001786_5253_5945 230
801 3300049582 Ga0501048_0094821 Ga0501048_0094821_816_1508 230
802 3300049582 Ga0501048_0217328 Ga0501048_0217328_235_927 230
803 3300049583 Ga0501067_0011871 Ga0501067_0011871_1396_2088 230
804 3300049583 Ga0501067_0312615 Ga0501067_0312615_152_844 230
805 3300049584 Ga0501068_0028302 Ga0501068_0028302_2397_3089 230
806 3300049584 Ga0501068_0054545 Ga0501068_0054545_1640_2332 230
807 3300049585 Ga0501069_0004000 Ga0501069_0004000_2219_2911 230
808 3300049587 Ga0501071_0005716 Ga0501071_0005716_3904_4596 230
809 3300049587 Ga0501071_0155995 Ga0501071_0155995_493_1185 230
810 3300049588 Ga0501072_0045413 Ga0501072_0045413_1964_2656 230
811 3300049588 Ga0501072_0265596 Ga0501072_0265596_339_1031 230
812 3300049589 Ga0501073_0002379 Ga0501073_0002379_11452_12144 230
813 3300049589 Ga0501073_0208694 Ga0501073_0208694_228_920 230
814 3300049590 Ga0501074_0016822 Ga0501074_0016822_2220_2912 230
815 3300049591 Ga0501075_0028753 Ga0501075_0028753_892_1584 230
816 3300049592 Ga0501076_0273553 Ga0501076_0273553_58_750 230
817 3300049592 Ga0501076_0372062 Ga0501076_0372062_266_958 230
818 3300049593 Ga0501077_0065210 Ga0501077_0065210_874_1566 230
819 3300049741 Ga0501079_0061565 Ga0501079_0061565_1829_2521 230
820 3300049741 Ga0501079_0260517 Ga0501079_0260517_615_1307 230
821 3300049742 Ga0501080_0121169 Ga0501080_0121169_14_706 230
822 3300049742 Ga0501080_0649698 Ga0501080_0649698_129_821 230
823 3300049744 Ga0501083_0002606 Ga0501083_0002606_2440_3132 230
824 3300049744 Ga0501083_0031690 Ga0501083_0031690_729_1421 230
825 3300049822 Ga0501035_0006045 Ga0501035_0006045_3714_4406 230
826 3300049822 Ga0501035_0016145 Ga0501035_0016145_2323_3015 230
827 3300049822 Ga0501035_0077949 Ga0501035_0077949_166_858 230
828 3300049822 Ga0501035_0366391 Ga0501035_0366391_453_1145 230
829 3300049823 Ga0501044_0019836 Ga0501044_0019836_3876_4568 230
830 3300049823 Ga0501044_0032579 Ga0501044_0032579_416_1108 230
831 3300049823 Ga0501044_0042033 Ga0501044_0042033_3322_4014 230
832 3300049823 Ga0501044_0047827 Ga0501044_0047827_2387_3079 230
833 3300049823 Ga0501044_0380142 Ga0501044_0380142_75_767 230
834 3300049823 Ga0501044_0389126 Ga0501044_0389126_421_1113 230
835 3300049824 Ga0501045_0227568 Ga0501045_0227568_638_1330 230
836 3300049824 Ga0501045_0276297 Ga0501045_0276297_112_804 230
837 3300050489 nmdc:mga03683_17476_c1 nmdc:mga03683_17476_c1_466_1158 230
838 3300050489 nmdc:mga03683_65874_c1 nmdc:mga03683_65874_c1_492_1184 230
839 3300050490 nmdc:mga03n38_3488_c1 nmdc:mga03n38_3488_c1_3186_3878 230
840 3300050490 nmdc:mga03n38_51216_c1 nmdc:mga03n38_51216_c1_495_1187 230
841 3300050490 nmdc:mga03n38_9077_c1 nmdc:mga03n38_9077_c1_1741_2433 230
842 3300050490 nmdc:mga03n38_91720_c1 nmdc:mga03n38_91720_c1_669_1361 230
843 3300050491 nmdc:mga00v17_156450_c1 nmdc:mga00v17_156450_c1_182_874 230
844 3300050491 nmdc:mga00v17_201652_c1 nmdc:mga00v17_201652_c1_37_729 230
845 3300050491 nmdc:mga00v17_38559_c1 nmdc:mga00v17_38559_c1_612_1304 230
846 3300050491 nmdc:mga00v17_395882_c1 nmdc:mga00v17_395882_c1_108_800 230
847 3300050492 nmdc:mga0yw44_106686_c1 nmdc:mga0yw44_106686_c1_930_1622 230
848 3300050492 nmdc:mga0yw44_119710_c1 nmdc:mga0yw44_119710_c1_54_746 230
849 3300050492 nmdc:mga0yw44_128386_c1 nmdc:mga0yw44_128386_c1_812_1504 230
850 3300050493 nmdc:mga0k408_116490_c1 nmdc:mga0k408_116490_c1_180_872 230
851 3300050493 nmdc:mga0k408_17198_c1 nmdc:mga0k408_17198_c1_641_1333 230
852 3300050493 nmdc:mga0k408_2007_c1 nmdc:mga0k408_2007_c1_2711_3403 230
853 3300050493 nmdc:mga0k408_223595_c1 nmdc:mga0k408_223595_c1_397_1089 230
854 3300050493 nmdc:mga0k408_49151_c1 nmdc:mga0k408_49151_c1_534_1226 230
855 3300050493 nmdc:mga0k408_97954_c1 nmdc:mga0k408_97954_c1_750_1442 230
856 3300050494 nmdc:mga06z11_147176_c1 nmdc:mga06z11_147176_c1_465_1157 230
857 3300050494 nmdc:mga06z11_33638_c1 nmdc:mga06z11_33638_c1_493_1185 230
858 3300050494 nmdc:mga06z11_51906_c1 nmdc:mga06z11_51906_c1_876_1568 230
859 3300050494 nmdc:mga06z11_67997_c1 nmdc:mga06z11_67997_c1_555_1247 230
860 3300050495 nmdc:mga04h51_24466_c1 nmdc:mga04h51_24466_c1_794_1486 230
861 3300050495 nmdc:mga04h51_97501_c1 nmdc:mga04h51_97501_c1_358_1050 230
862 3300050496 nmdc:mga07m45_159419_c2 nmdc:mga07m45_159419_c2_24_716 230
863 3300050496 nmdc:mga07m45_317078_c1 nmdc:mga07m45_317078_c1_109_801 230
864 3300050496 nmdc:mga07m45_43658_c1 nmdc:mga07m45_43658_c1_685_1377 230
865 3300050496 nmdc:mga07m45_48277_c1 nmdc:mga07m45_48277_c1_1036_1728 230
866 3300050507 nmdc:mga05p37_474227_c1 nmdc:mga05p37_474227_c1_501_1193 230
867 3300050507 nmdc:mga05p37_85370_c1 nmdc:mga05p37_85370_c1_1903_2595 230
868 3300050508 nmdc:mga09592_277634_c1 nmdc:mga09592_277634_c1_683_1375 230
869 3300050508 nmdc:mga09592_8496_c1 nmdc:mga09592_8496_c1_7267_7959 230
870 3300050509 nmdc:mga0qj67_191_c1 nmdc:mga0qj67_191_c1_29699_30391 230
871 3300050510 nmdc:mga06r32_29634_c1 nmdc:mga06r32_29634_c1_2677_3369 230
872 3300050510 nmdc:mga06r32_963729_c1 nmdc:mga06r32_963729_c1_54_746 230
873 3300050512 nmdc:mga0n895_332176_c1 nmdc:mga0n895_332176_c1_97_792 230
874 3300050512 nmdc:mga0n895_85190_c1 nmdc:mga0n895_85190_c1_223_915 230
875 3300050516 nmdc:mga0sz30_139037_c1 nmdc:mga0sz30_139037_c1_63_755 230
876 3300053077 Ga0495601_0000114 Ga0495601_0000114_3196_3888 230
877 3300053077 Ga0495601_0127122 Ga0495601_0127122_929_1621 230
878 3300053078 Ga0495612_0001726 Ga0495612_0001726_7718_8410 230
879 3300053083 Ga0495655_0008684 Ga0495655_0008684_324_1016 230
880 3300053083 Ga0495655_0150116 Ga0495655_0150116_20_712 230
881 3300053084 Ga0495595_0033375 Ga0495595_0033375_156_848 230
882 3300053085 Ga0495619_0064629 Ga0495619_0064629_1697_2389 230
883 3300053085 Ga0495619_0149801 Ga0495619_0149801_227_919 230
884 3300053085 Ga0495619_0272379 Ga0495619_0272379_77_769 230
885 3300053085 Ga0495619_0441042 Ga0495619_0441042_63_818 230
886 3300053086 Ga0500578_0181605 Ga0500578_0181605_556_1248 230
887 3300053087 Ga0500643_036479 Ga0500643_036479_184_876 230
888 3300053091 Ga0500647_0084083 Ga0500647_0084083_109_801 230
889 3300053094 Ga0500566_0001036 Ga0500566_0001036_9293_9985 230
890 3300053102 Ga0500554_000779 Ga0500554_000779_4943_5635 230
891 3300053103 Ga0500555_022030 Ga0500555_022030_669_1361 230
892 3300053104 Ga0500556_0024828 Ga0500556_0024828_1032_1724 230
893 3300053105 Ga0500557_000113 Ga0500557_000113_9657_10349 230
894 3300053116 Ga0500592_005874 Ga0500592_005874_125_817 230
895 3300053119 Ga0500595_030325 Ga0500595_030325_843_1535 230
896 3300053119 Ga0500595_096393 Ga0500595_096393_75_767 230
897 3300053123 Ga0500614_017337 Ga0500614_017337_410_1102 230
898 3300053130 Ga0500642_0000056 Ga0500642_0000056_33826_34518 230
899 3300053130 Ga0500642_0014704 Ga0500642_0014704_657_1349 230
900 3300053130 Ga0500642_0082111 Ga0500642_0082111_53_745 230
901 3300053134 Ga0500658_0116803 Ga0500658_0116803_159_851 230
902 3300053136 Ga0500559_0095969 Ga0500559_0095969_423_1115 230
903 3300053139 Ga0500568_0010093 Ga0500568_0010093_3010_3780 230
904 3300053139 Ga0500568_0074591 Ga0500568_0074591_480_1172 230
905 3300053142 Ga0500577_0145790 Ga0500577_0145790_297_989 230
906 3300053147 Ga0500589_115963 Ga0500589_115963_38_730 230
907 3300053148 Ga0500590_067495 Ga0500590_067495_647_1339 230
908 3300053148 Ga0500590_081376 Ga0500590_081376_839_1531 230
909 3300053150 Ga0500603_001192 Ga0500603_001192_1311_2003 230
910 3300053153 Ga0500616_0015698 Ga0500616_0015698_2333_3025 230
911 3300053154 Ga0500619_011336 Ga0500619_011336_686_1378 230
912 3300053155 Ga0500620_020184 Ga0500620_020184_1124_1816 230
913 3300053156 Ga0500622_0003747 Ga0500622_0003747_36_728 230
914 3300053161 Ga0500634_0059925 Ga0500634_0059925_1001_1693 230
915 3300053161 Ga0500634_0130045 Ga0500634_0130045_95_787 230
916 3300053177 Ga0500636_0002161 Ga0500636_0002161_4431_5123 230
917 3300053178 Ga0500637_0000360 Ga0500637_0000360_15147_15839 230
918 3300053727 Ga0500611_057717 Ga0500611_057717_194_886 230
919 3300053729 Ga0500625_000216 Ga0500625_000216_7257_7949 230
920 3300053730 Ga0500645_042173 Ga0500645_042173_446_1138 230
921 3300053736 Ga0500599_003632 Ga0500599_003632_1173_1865 230
922 3300053737 Ga0500601_000047 Ga0500601_000047_16712_17404 230
923 3300054114 Ga0501084_0054483 Ga0501084_0054483_441_1133 230
924 3300054114 Ga0501084_0066065 Ga0501084_0066065_1724_2416 230
925 3300060353 Ga0501082_0000028 Ga0501082_0000028_2892_3584 230
926 3300060353 Ga0501082_0009479 Ga0501082_0009479_4639_5331 230
927 3300060353 Ga0501082_0095532 Ga0501082_0095532_225_917 230
928 3300060353 Ga0501082_0299697 Ga0501082_0299697_585_1277 230
929 3300061734 Ga0530510_0009803 Ga0530510_0009803_3526_4218 230
930 3300061734 Ga0530510_0152702 Ga0530510_0152702_81_773 230

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

58

133

0.94

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

63

128

0.93

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

55

127

0.89

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

167

251

0.87

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

163

262

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mdc-assembly1.cif.gz_A crystal structure of glutathione s-transferase from sinorhizobium meliloti 1021, nysgrc target 021389 0.9718 1 230
4mdc-assembly1.cif.gz_A crystal structure of glutathione s-transferase from sinorhizobium meliloti 1021, nysgrc target 021389 0.9676 1 230
4o7h-assembly1.cif.gz_A crystal structure of a glutathione s-transferase from rhodospirillum rubrum f11, target efi-507460 0.9481 1 230
4o7h-assembly1.cif.gz_A crystal structure of a glutathione s-transferase from rhodospirillum rubrum f11, target efi-507460 0.944 1 230
4o7h-assembly1.cif.gz_B crystal structure of a glutathione s-transferase from rhodospirillum rubrum f11, target efi-507460 0.9426 1 230
ID Description Score Start End Superfamily
4o7hB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9582 84 205 1.20.1050.10
4mdcB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9519 84 205 1.20.1050.10
af_A0A0B5EC52_24_99_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9346 5 75 3.40.30.10
4o7hB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9346 84 205 1.20.1050.10
af_O45352_10_98_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.9345 2 72 3.80.10.10
ID Description Score Start End GO Terms
AF-A0A258E090-F1-model_v4 Glutathione S-transferase 0.9917 3 89 GO:0016740
AF-A0A537RY69-F1-model_v4 Glutathione S-transferase family protein 0.9875 1 230 GO:0004364
GO:0006749
AF-A7IGB0-F1-model_v4 Glutathione S-transferase domain 0.987 1 230 GO:0004364
GO:0006749
AF-A0A537L746-F1-model_v4 Glutathione S-transferase family protein 0.9854 1 230 GO:0004364
GO:0006749
AF-A0A537RY69-F1-model_v4 Glutathione S-transferase family protein 0.9833 1 230 GO:0004364
GO:0006749

Feature Viewer

pLDDT pTM Quality
95.11 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map