F486020

General Info

Members Datasets Scaffolds Average Seq Length
930 490 1860 268

Family's Representative Sequence

Representative Sequence 3300025927|Ga0207687_10166089|Ga0207687_101660892
Length 304
Sequence MYTGGCVTRSPRLTPGRDLRCPRRRTYTGAEPNVAGVARRRLDAELVRRKLARSREHAGQLIAAGRVTVGKAVATKPATQVETAAAIVVSVDADDPDYVSRGGHKLAGALEAFVPRGLVVKGRRALDAGASTGGFTDVLLRAGAAHVVAVDVGYGQLAWSLQSDERVTVKDRTNVRELTLEAIDGEPVDLVVGDLSFIPLGLVLPALARCTGPDADLVMMVKPQFEVGKERLGSGGVVRSPQLRAEAVRGVAGKAWDLGLGVQGVTASPLPGPSGNVEYFLWLRAGAPVLDPADVDRAVAEGPR

Samples

Sample ID Description Type Environment
1 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
75 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
118 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
122 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
123 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
124 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
138 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
146 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
157 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
160 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
161 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
162 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
163 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
164 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
165 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
166 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
167 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
168 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
169 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
170 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
171 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
172 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
173 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
174 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
175 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
176 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
177 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
178 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
181 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
187 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
195 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
209 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
210 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
211 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
214 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
215 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
219 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
220 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
221 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
222 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
223 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
224 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
225 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
226 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
227 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
228 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
229 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
230 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
231 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
232 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
233 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
234 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
235 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
236 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
239 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
240 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
241 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
242 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
243 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
244 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
245 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
246 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
247 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
248 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
249 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
250 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
258 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
259 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
260 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
261 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
262 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
263 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
264 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
265 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
266 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
267 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
268 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
269 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
270 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
271 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
284 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
285 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
286 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
287 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
288 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
289 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
304 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
305 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
306 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
307 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
308 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
309 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
310 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
311 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
312 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
313 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
314 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
315 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
316 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
317 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
320 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
321 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
322 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
323 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
324 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
325 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
326 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
327 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
328 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
329 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
330 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
331 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
332 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
333 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
334 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
335 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
336 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
337 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
338 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
339 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
340 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
341 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
342 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
343 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
344 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
345 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
346 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
347 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
348 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
349 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
350 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
351 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
352 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
353 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
354 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
355 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
356 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
357 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
358 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
359 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
360 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
361 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
362 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
363 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
364 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
365 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
366 2547132424 Nocardia nova SH22a Isolate Unclassified
367 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
368 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
369 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
370 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
371 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
372 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
373 2643221548 Streptomyces sp. Root55 Isolate Unclassified
374 2643221561 Nocardioides sp. Root151 Isolate Unclassified
375 2643221576 Nocardioides sp. Root614 Isolate Unclassified
376 2643221578 Streptomyces sp. Root63 Isolate Unclassified
377 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
378 2643221590 Nocardioides sp. Root682 Isolate Unclassified
379 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
380 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
381 2643221647 Streptomyces sp. Root369 Isolate Unclassified
382 2643221670 Streptomyces sp. Root431 Isolate Unclassified
383 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
384 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
385 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
386 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
387 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
388 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
389 2643221696 Nocardioides sp. Root140 Isolate Unclassified
390 2643221714 Streptomyces sp. Root264 Isolate Unclassified
391 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
392 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
393 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
394 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
395 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
396 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
397 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
398 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
399 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
400 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
401 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
402 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
403 2808606448 Streptomyces sp. 193411 Isolate Unclassified
404 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
405 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
406 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
407 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
408 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
409 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
410 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
411 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
412 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
413 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
414 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
415 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
416 2862574272 Streptomyces sp. AcE210 Isolate Nodule
417 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
418 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
419 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
420 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
421 2867369537 Streptomyces sp. Z26 Isolate Unclassified
422 2867428634 Streptomyces sp. RP5T Isolate Unclassified
423 2867475112 Streptomyces sp. TM32 Isolate Unclassified
424 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
425 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
426 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
427 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
428 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
429 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
430 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
431 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
432 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
433 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
434 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
435 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
436 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
437 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
438 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
439 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
440 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
441 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
442 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
443 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
444 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
445 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
446 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
447 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
448 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
449 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
450 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
451 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
452 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
453 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
454 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
455 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
456 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
457 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
458 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
459 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
460 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
461 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
462 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
463 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
464 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
465 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
466 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
467 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
468 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
469 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
470 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
471 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
472 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
473 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
474 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
475 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
476 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
477 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
478 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
479 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
480 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
481 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
482 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
483 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
484 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
485 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
486 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
487 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
488 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
489 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
490 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.24
Metatranscriptomes 0.22
Isolates 13.55

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 7.42
Nodule 0.54
Rhizoplane 2.15
Rhizosphere 78.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207687_10166089 3300025927 Bacteria 1698
2 JGI24739J22299_10022220 3300001989 Bacteria 2253
3 rootH2_10110037 3300003320 Bacteria 2365
4 rootL2_10058526 3300003322 Bacteria 6981
5 JGI25160J50197_1023978 3300003354 Bacteria 1743
6 Ga0070658_10004786 3300005327 Bacteria 11013
7 Ga0070658_10019038 3300005327 Bacteria 5499
8 Ga0070658_10019185 3300005327 Bacteria 5478
9 Ga0070658_10333849 3300005327 Bacteria 1296
10 Ga0070683_100076530 3300005329 Bacteria 3128
11 Ga0070683_100096840 3300005329 Bacteria 2775
12 Ga0070683_100198804 3300005329 Bacteria 1904
13 Ga0070683_100208306 3300005329 Bacteria 1857
14 Ga0068869_100058820 3300005334 Bacteria 2812
15 Ga0070666_10001373 3300005335 Bacteria 14782
16 Ga0070680_100069970 3300005336 Bacteria 2882
17 Ga0070660_100039257 3300005339 Bacteria 3598
18 Ga0070660_100059690 3300005339 Bacteria 2958
19 Ga0070660_100349072 3300005339 Bacteria 1218
20 Ga0070687_100176882 3300005343 Bacteria 1275
21 Ga0070692_10003768 3300005345 Bacteria 6233
22 Ga0070673_100067851 3300005364 Bacteria 2854
23 Ga0070659_100018542 3300005366 Bacteria 5251
24 Ga0070659_100132882 3300005366 Bacteria 2022
25 Ga0070667_100016726 3300005367 Bacteria 6071
26 Ga0070667_100019526 3300005367 Bacteria 5624
27 Ga0070667_100268494 3300005367 Bacteria 1529
28 Ga0070709_10027548 3300005434 Bacteria 3379
29 Ga0070714_100009162 3300005435 Bacteria 7769
30 Ga0070714_100051156 3300005435 Bacteria 3521
31 Ga0070714_100077103 3300005435 Bacteria 2895
32 Ga0070714_100149140 3300005435 Bacteria 2106
33 Ga0070714_100461657 3300005435 Bacteria 1207
34 Ga0070713_100069159 3300005436 Bacteria 2977
35 Ga0070713_100190552 3300005436 Bacteria 1847
36 Ga0070713_100395109 3300005436 Bacteria 1290
37 Ga0070713_100411485 3300005436 Bacteria 1265
38 Ga0070700_100000408 3300005441 Bacteria 21959
39 Ga0070700_100195888 3300005441 Bacteria 1416
40 Ga0070708_100189052 3300005445 Bacteria 1926
41 Ga0070681_10170931 3300005458 Bacteria 2095
42 Ga0068867_100031690 3300005459 Bacteria 3819
43 Ga0070707_100015699 3300005468 Bacteria 7111
44 Ga0070707_100037910 3300005468 Bacteria 4603
45 Ga0070707_100335295 3300005468 Bacteria 1469
46 Ga0070707_100616481 3300005468 Bacteria 1048
47 Ga0070698_100025711 3300005471 Bacteria 6133
48 Ga0070699_100032683 3300005518 Bacteria 4494
49 Ga0070679_100022810 3300005530 Bacteria 6122
50 Ga0070684_100022539 3300005535 Bacteria 5254
51 Ga0070684_100137966 3300005535 Bacteria 2204
52 Ga0070684_100312198 3300005535 Bacteria 1444
53 Ga0068853_100039723 3300005539 Bacteria 4014
54 Ga0070672_100092616 3300005543 Bacteria 2440
55 Ga0070665_100020384 3300005548 Bacteria 6659
56 Ga0070665_100145958 3300005548 Bacteria 2369
57 Ga0068855_100177354 3300005563 Bacteria 2410
58 Ga0068855_100189364 3300005563 Bacteria 2322
59 Ga0070664_100579261 3300005564 Bacteria 1040
60 Ga0068857_100109588 3300005577 Bacteria 2481
61 Ga0068857_100188638 3300005577 Bacteria 1877
62 Ga0070702_100058104 3300005615 Bacteria 2240
63 Ga0068852_100001881 3300005616 Bacteria 14294
64 Ga0068861_100034165 3300005719 Bacteria 3759
65 Ga0068870_10007529 3300005840 Bacteria 4860
66 Ga0068860_100001151 3300005843 Bacteria 28948
67 Ga0081455_10008029 3300005937 Bacteria 11027
68 Ga0081455_10016327 3300005937 Bacteria 7173
69 Ga0081455_10047275 3300005937 Bacteria 3728
70 Ga0081455_10096417 3300005937 Bacteria 2385
71 Ga0075365_10018547 3300006038 Bacteria 4280
72 Ga0075365_10045571 3300006038 Bacteria 2877
73 Ga0075365_10050637 3300006038 Bacteria 2740
74 Ga0075365_10055635 3300006038 Bacteria 2627
75 Ga0075365_10094154 3300006038 Bacteria 2044
76 Ga0075365_10292186 3300006038 Bacteria 1147
77 Ga0075363_100040548 3300006048 Bacteria 2454
78 Ga0075364_10058153 3300006051 Bacteria 2534
79 Ga0075364_10158981 3300006051 Bacteria 1525
80 Ga0075364_10196366 3300006051 Bacteria 1367
81 Ga0070715_10017085 3300006163 Bacteria 2740
82 Ga0070712_100061476 3300006175 Bacteria 2653
83 Ga0075367_10094587 3300006178 Bacteria 1822
84 Ga0075369_10087242 3300006186 Bacteria 1389
85 Ga0075370_10026355 3300006353 Bacteria 3220
86 Ga0075370_10114564 3300006353 Bacteria 1567
87 Ga0075428_100053118 3300006844 Bacteria 4439
88 Ga0075428_100197335 3300006844 Bacteria 2176
89 Ga0075431_100361911 3300006847 Bacteria 1457
90 Ga0068865_100010214 3300006881 Bacteria 5837
91 Ga0099826_10027257 3300006948 Bacteria 4201
92 Ga0099794_10018564 3300007265 Bacteria 3121
93 Ga0105251_10082743 3300009011 Bacteria 1482
94 Ga0105240_10075361 3300009093 Bacteria 4161
95 Ga0105240_10338250 3300009093 Bacteria 1710
96 Ga0111539_10042635 3300009094 Bacteria 5446
97 Ga0111539_10188004 3300009094 Bacteria 2411
98 Ga0105245_10051944 3300009098 Bacteria 3675
99 Ga0105245_10717786 3300009098 Bacteria 1034
100 Ga0114129_10434596 3300009147 Bacteria 1724
101 Ga0105243_10029585 3300009148 Bacteria 4213
102 Ga0105243_10808091 3300009148 Bacteria 925
103 Ga0105241_10024864 3300009174 Bacteria 4450
104 Ga0105248_10223914 3300009177 Bacteria 2117
105 Ga0105249_10221521 3300009553 Bacteria 1862
106 Ga0105239_10082141 3300010375 Bacteria 3548
107 Ga0105239_10296366 3300010375 Bacteria 1821
108 Ga0157370_10010376 3300013104 Bacteria 9821
109 Ga0157369_10010790 3300013105 Bacteria 10402
110 Ga0157369_10011795 3300013105 Bacteria 9924
111 Ga0157369_10272221 3300013105 Bacteria 1764
112 Ga0157369_10421629 3300013105 Bacteria 1383
113 Ga0157372_10193394 3300013307 Bacteria 2356
114 Ga0157372_10223017 3300013307 Bacteria 2185
115 Ga0157372_10386011 3300013307 Bacteria 1632
116 Ga0157375_10057188 3300013308 Bacteria 3854
117 Ga0163163_10194768 3300014325 Bacteria 2075
118 Ga0157380_10006949 3300014326 Bacteria 8009
119 Ga0157380_10484002 3300014326 Bacteria 1198
120 Ga0157380_10963333 3300014326 Bacteria 884
121 Ga0182008_10002172 3300014497 Bacteria 12480
122 Ga0157379_10319298 3300014968 Bacteria 1418
123 Ga0157376_10443083 3300014969 Bacteria 1265
124 Ga0182007_10000584 3300015262 Bacteria 21416
125 Ga0183367_1010 3300015688 Bacteria 416164
126 Ga0206354_11249830 3300020081 Bacteria 1458
127 Ga0206353_11155499 3300020082 Bacteria 1542
128 Ga0213876_10001814 3300021384 Bacteria 12915
129 Ga0213876_10004136 3300021384 Bacteria 8146
130 Ga0213875_10001014 3300021388 Bacteria 19905
131 Ga0213875_10027455 3300021388 Bacteria 2708
132 Ga0213875_10028241 3300021388 Bacteria 2666
133 Ga0209758_1006719 3300025297 Bacteria 8105
134 Ga0207426_1002890 3300025302 Bacteria 10162
135 Ga0207426_1003860 3300025302 Bacteria 7733
136 Ga0209051_1058879 3300025303 Bacteria 1221
137 Ga0207713_1057810 3300025735 Bacteria 1497
138 Ga0207680_10026739 3300025903 Bacteria 3202
139 Ga0207647_10006160 3300025904 Bacteria 8736
140 Ga0207647_10012813 3300025904 Bacteria 5825
141 Ga0207647_10039485 3300025904 Bacteria 2977
142 Ga0207685_10008631 3300025905 Bacteria 2916
143 Ga0207685_10082175 3300025905 Bacteria 1336
144 Ga0207699_10022900 3300025906 Bacteria 3392
145 Ga0207699_10040860 3300025906 Bacteria 2675
146 Ga0207643_10047075 3300025908 Bacteria 2438
147 Ga0207705_10007324 3300025909 Bacteria 8109
148 Ga0207705_10035356 3300025909 Bacteria 3574
149 Ga0207705_10288721 3300025909 Bacteria 1256
150 Ga0207695_10357678 3300025913 Bacteria 1347
151 Ga0207693_10193332 3300025915 Bacteria 1601
152 Ga0207663_10099838 3300025916 Bacteria 1946
153 Ga0207660_10203661 3300025917 Bacteria 1546
154 Ga0207657_10144888 3300025919 Bacteria 1938
155 Ga0207657_10208208 3300025919 Bacteria 1571
156 Ga0207652_10016037 3300025921 Bacteria 6110
157 Ga0207652_10141399 3300025921 Bacteria 2152
158 Ga0207646_10021681 3300025922 Bacteria 5930
159 Ga0207646_10074354 3300025922 Bacteria 3035
160 Ga0207646_10239154 3300025922 Bacteria 1640
161 Ga0207646_10434920 3300025922 Bacteria 1184
162 Ga0207687_10008234 3300025927 Bacteria 6821
163 Ga0207700_10011641 3300025928 Bacteria 5622
164 Ga0207700_10122430 3300025928 Bacteria 2111
165 Ga0207700_10375610 3300025928 Bacteria 1242
166 Ga0207664_10049622 3300025929 Bacteria 3305
167 Ga0207664_10059283 3300025929 Bacteria 3047
168 Ga0207664_10349323 3300025929 Bacteria 1309
169 Ga0207690_10080716 3300025932 Bacteria 2270
170 Ga0207669_10060794 3300025937 Bacteria 2318
171 Ga0207691_10336576 3300025940 Bacteria 1292
172 Ga0207711_10200278 3300025941 Bacteria 1822
173 Ga0207689_10325500 3300025942 Bacteria 1276
174 Ga0207661_10020817 3300025944 Bacteria 4908
175 Ga0207661_10070518 3300025944 Bacteria 2853
176 Ga0207661_10120688 3300025944 Bacteria 2231
177 Ga0207667_10024866 3300025949 Bacteria 6566
178 Ga0207667_10042854 3300025949 Bacteria 4807
179 Ga0207667_10420420 3300025949 Bacteria 1360
180 Ga0207640_10550581 3300025981 Bacteria 969
181 Ga0207658_10013368 3300025986 Bacteria 5606
182 Ga0207658_10067690 3300025986 Bacteria 2691
183 Ga0207639_10017989 3300026041 Bacteria 5014
184 Ga0207708_10000533 3300026075 Bacteria 29368
185 Ga0207702_10472142 3300026078 Bacteria 1220
186 Ga0207648_10003798 3300026089 Bacteria 15789
187 Ga0207674_10070611 3300026116 Bacteria 3511
188 Ga0207674_10081197 3300026116 Bacteria 3244
189 Ga0207675_100013905 3300026118 Bacteria 7503
190 Ga0207698_10159395 3300026142 Bacteria 1971
191 Ga0207698_10636428 3300026142 Bacteria 1055
192 Ga0207428_10023542 3300027907 Bacteria 5178
193 Ga0268266_10082089 3300028379 Bacteria 2811
194 Ga0268266_10122220 3300028379 Bacteria 2318
195 Ga0268264_10001023 3300028381 Bacteria 28147
196 Ga0265334_10001125 3300028573 Bacteria 13071
197 Ga0307517_10001681 3300028786 Bacteria 36578
198 Ga0307517_10017820 3300028786 Bacteria 9223
199 Ga0307515_10000544 3300028794 Bacteria 88859
200 Ga0307515_10028906 3300028794 Bacteria 9400
201 Ga0307515_10055049 3300028794 Bacteria 5823
202 Ga0265338_10072609 3300028800 Bacteria 2937
203 Ga0307511_10001522 3300030521 Bacteria 24502
204 Ga0307511_10066339 3300030521 Bacteria 2690
205 Ga0307512_10008602 3300030522 Bacteria 9923
206 Ga0307512_10010797 3300030522 Bacteria 8685
207 Ga0307512_10045059 3300030522 Bacteria 3617
208 Ga0307512_10090507 3300030522 Bacteria 2134
209 Ga0316181_1279863 3300030744 Bacteria 1591
210 Ga0265320_10021900 3300031240 Bacteria 3430
211 Ga0265325_10029449 3300031241 Bacteria 2951
212 Ga0265325_10055326 3300031241 Bacteria 2029
213 Ga0265340_10101420 3300031247 Bacteria 1337
214 Ga0265339_10198300 3300031249 Bacteria 991
215 Ga0265316_10324848 3300031344 Bacteria 1117
216 Ga0307513_10000483 3300031456 Bacteria 57234
217 Ga0307513_10006579 3300031456 Bacteria 15174
218 Ga0307513_10025771 3300031456 Bacteria 6801
219 Ga0265313_10008472 3300031595 Bacteria 6822
220 Ga0265313_10046624 3300031595 Bacteria 2103
221 Ga0307508_10003936 3300031616 Bacteria 14738
222 Ga0307508_10004252 3300031616 Bacteria 14054
223 Ga0307508_10014026 3300031616 Bacteria 7312
224 Ga0307508_10203403 3300031616 Bacteria 1581
225 Ga0307514_10005547 3300031649 Bacteria 11208
226 Ga0307514_10025508 3300031649 Bacteria 4781
227 Ga0307514_10082174 3300031649 Bacteria 2378
228 Ga0307514_10131354 3300031649 Bacteria 1723
229 Ga0265314_10047987 3300031711 Bacteria 3001
230 Ga0265314_10106763 3300031711 Bacteria 1788
231 Ga0265342_10021738 3300031712 Bacteria 4091
232 Ga0307516_10006120 3300031730 Bacteria 14184
233 Ga0307516_10024936 3300031730 Bacteria 6100
234 Ga0307413_10102796 3300031824 Bacteria 1893
235 Ga0307413_10126042 3300031824 Bacteria 1744
236 Ga0307518_10256975 3300031838 Bacteria 1104
237 Ga0326468_10002491 3300031889 Bacteria 1537
238 Ga0307407_10147802 3300031903 Bacteria 1524
239 Ga0307412_10031096 3300031911 Bacteria 3368
240 Ga0307409_100113059 3300031995 Bacteria 2281
241 Ga0307416_100287756 3300032002 Bacteria 1625
242 Ga0307414_10199302 3300032004 Bacteria 1627
243 Ga0307415_100002682 3300032126 Bacteria 8886
244 Ga0307507_10065724 3300033179 Bacteria 3332
245 Ga0307510_10047545 3300033180 Bacteria 4595
246 Ga0373953_0011000 3300035117 Bacteria 3163
247 Ga0373956_0002557 3300035119 Bacteria 7396
248 Ga0373956_0062161 3300035119 Bacteria 1692
249 Ga0373933_0101371 3300035724 Bacteria 1786
250 Ga0316584_0407689 3300036712 Bacteria 967
251 Ga0395899_0094360 3300037312 Bacteria 2165
252 Ga0395900_0081496 3300037418 Bacteria 3325
253 Ga0395900_0326157 3300037418 Bacteria 1514
254 Ga0395900_0420530 3300037418 Bacteria 1297
255 Ga0395898_0002252 3300037466 Bacteria 23420
256 Ga0395898_0625350 3300037466 Bacteria 1019
257 Ga0436364_0335584 3300037853 Bacteria 6554
258 Ga0436364_0788334 3300037853 Bacteria 43321
259 Ga0395901_0092628 3300038443 Bacteria 3163
260 Ga0400485_05857 3300038735 Bacteria 29415
261 Ga0400486_31579 3300038742 Bacteria 26402
262 Ga0436365_0763923 3300039437 Bacteria 12918
263 Ga0436365_0810711 3300039437 Bacteria 50192
264 Ga0436360_0998993 3300039438 Bacteria 1034
265 Ga0436363_0925874 3300039450 Bacteria 1751
266 Ga0439436_0001758 3300041404 Bacteria 6360
267 Ga0439436_0007057 3300041404 Bacteria 3456
268 Ga0439439_0001722 3300041406 Bacteria 4458
269 Ga0439439_0027140 3300041406 Bacteria 1446
270 Ga0451791_0052689 3300041451 Bacteria 1186
271 Ga0451791_0442814 3300041451 Bacteria 1647
272 Ga0451791_1935604 3300041451 Bacteria 2015
273 Ga0451837_1111440 3300041494 Bacteria 3220
274 Ga0451841_1140692 3300041498 Bacteria 2497
275 Ga0451853_0979492 3300041512 Bacteria 2613
276 Ga0451853_2641569 3300041512 Bacteria 2819
277 Ga0439433_0002992 3300041999 Bacteria 3623
278 Ga0439442_005345 3300042002 Bacteria 2570
279 Ga0439449_0001015 3300042007 Bacteria 11061
280 Ga0439449_0005711 3300042007 Bacteria 4755
281 Ga0439450_020179 3300042008 Bacteria 1420
282 Ga0439457_000138 3300042014 Bacteria 18420
283 Ga0439457_009297 3300042014 Bacteria 2292
284 Ga0439462_0003088 3300042015 Bacteria 3958
285 Ga0450894_000636 3300042131 Bacteria 5873
286 Ga0450898_000120 3300042134 Bacteria 7525
287 Ga0450899_002728 3300042135 Bacteria 1910
288 Ga0450903_000332 3300042138 Bacteria 10381
289 Ga0450906_004363 3300042145 Bacteria 2966
290 Ga0439458_0001312 3300042157 Bacteria 6282
291 Ga0466969_0014012 3300044656 Bacteria 4218
292 Ga0466972_0000620 3300044658 Bacteria 17311
293 Ga0466972_0050966 3300044658 Bacteria 1997
294 Ga0466972_0068782 3300044658 Bacteria 1691
295 Ga0466965_0007886 3300044683 Bacteria 4910
296 Ga0466965_0027769 3300044683 Bacteria 2747
297 Ga0466965_0029888 3300044683 Bacteria 2653
298 Ga0466965_0049769 3300044683 Bacteria 2077
299 Ga0466966_0000815 3300044684 Bacteria 19873
300 Ga0466966_0001647 3300044684 Bacteria 14406
301 Ga0466966_0003548 3300044684 Bacteria 10299
302 Ga0466966_0030001 3300044684 Bacteria 3535
303 Ga0466966_0030128 3300044684 Bacteria 3525
304 Ga0466966_0039035 3300044684 Bacteria 3058
305 Ga0466966_0048245 3300044684 Bacteria 2712
306 Ga0466966_0073456 3300044684 Bacteria 2139
307 Ga0466961_0001431 3300044693 Bacteria 14807
308 Ga0466961_0004266 3300044693 Bacteria 8947
309 Ga0466961_0009230 3300044693 Bacteria 6280
310 Ga0466961_0043632 3300044693 Bacteria 2871
311 Ga0466961_0050994 3300044693 Bacteria 2643
312 Ga0466961_0051146 3300044693 Bacteria 2639
313 Ga0466961_0062275 3300044693 Bacteria 2371
314 Ga0466961_0065411 3300044693 Bacteria 2310
315 Ga0466961_0131847 3300044693 Bacteria 1566
316 Ga0466963_0001698 3300044694 Bacteria 11997
317 Ga0466963_0007318 3300044694 Bacteria 6579
318 Ga0466963_0025506 3300044694 Bacteria 3771
319 Ga0466963_0049820 3300044694 Bacteria 2771
320 Ga0466963_0171963 3300044694 Bacteria 1510
321 Ga0466963_0183806 3300044694 Bacteria 1460
322 Ga0466963_0390587 3300044694 Bacteria 981
323 Ga0466964_0030433 3300044706 Bacteria 2137
324 Ga0466964_0109334 3300044706 Bacteria 1231
325 Ga0466964_0194801 3300044706 Bacteria 969
326 Ga0466971_0000897 3300044719 Bacteria 12199
327 Ga0466971_0015814 3300044719 Bacteria 3323
328 Ga0466968_0004021 3300044735 Bacteria 5466
329 Ga0466970_0001486 3300044765 Bacteria 11290
330 Ga0466970_0149535 3300044765 Bacteria 1289
331 Ga0466957_0001849 3300044842 Bacteria 11173
332 Ga0466957_0016812 3300044842 Bacteria 4280
333 Ga0466957_0021597 3300044842 Bacteria 3794
334 Ga0466957_0069496 3300044842 Bacteria 2176
335 Ga0466957_0152532 3300044842 Bacteria 1495
336 Ga0466957_0290934 3300044842 Bacteria 1095
337 Ga0466960_0004137 3300044901 Bacteria 5644
338 Ga0466960_0009255 3300044901 Bacteria 4056
339 Ga0466960_0088865 3300044901 Bacteria 1571
340 Ga0466960_0149123 3300044901 Bacteria 1248
341 Ga0466959_0001421 3300045049 Bacteria 14663
342 Ga0466959_0002793 3300045049 Bacteria 11240
343 Ga0466959_0011379 3300045049 Bacteria 6392
344 Ga0466959_0034281 3300045049 Bacteria 3754
345 Ga0466959_0084467 3300045049 Bacteria 2285
346 Ga0466958_0010504 3300045836 Bacteria 5187
347 Ga0466958_0018578 3300045836 Bacteria 4037
348 Ga0466958_0033024 3300045836 Bacteria 3082
349 Ga0466958_0131409 3300045836 Bacteria 1572
350 Ga0466967_0054662 3300045976 Bacteria 3516
351 Ga0466967_0062443 3300045976 Bacteria 3307
352 Ga0466967_0069668 3300045976 Bacteria 3144
353 Ga0466967_0127589 3300045976 Bacteria 2358
354 Ga0466967_0256855 3300045976 Bacteria 1671
355 Ga0466967_0262771 3300045976 Bacteria 1652
356 Ga0466967_0316826 3300045976 Bacteria 1503
357 Ga0466967_0347701 3300045976 Bacteria 1435
358 Ga0466967_0383463 3300045976 Bacteria 1365
359 Ga0466967_0449138 3300045976 Bacteria 1260
360 Ga0466967_0597962 3300045976 Bacteria 1088
361 Ga0466967_0650837 3300045976 Bacteria 1042
362 Ga0466967_0824962 3300045976 Bacteria 921
363 Ga0495617_008927 3300046452 Bacteria 3448
364 Ga0495627_024148 3300046453 Bacteria 1984
365 Ga0495592_0007981 3300046454 Bacteria 7943
366 Ga0495592_0144411 3300046454 Bacteria 1651
367 Ga0495592_0171117 3300046454 Bacteria 1487
368 Ga0495603_0001642 3300046455 Bacteria 13120
369 Ga0495603_0011163 3300046455 Bacteria 5446
370 Ga0495603_0018506 3300046455 Bacteria 4214
371 Ga0495603_0033030 3300046455 Bacteria 3113
372 Ga0495603_0092438 3300046455 Bacteria 1768
373 Ga0495603_0149006 3300046455 Bacteria 1359
374 Ga0495629_0000810 3300046459 Bacteria 25297
375 Ga0495629_0005095 3300046459 Bacteria 9823
376 Ga0495629_0014680 3300046459 Bacteria 5634
377 Ga0495629_0016728 3300046459 Bacteria 5263
378 Ga0495629_0024576 3300046459 Bacteria 4290
379 Ga0495629_0071327 3300046459 Bacteria 2424
380 Ga0495629_0134241 3300046459 Bacteria 1723
381 Ga0495629_0150075 3300046459 Bacteria 1620
382 Ga0495638_0011657 3300046460 Bacteria 6054
383 Ga0495638_0058368 3300046460 Bacteria 2391
384 Ga0495638_0070576 3300046460 Bacteria 2138
385 Ga0495651_0002537 3300046462 Bacteria 14127
386 Ga0495651_0013226 3300046462 Bacteria 6380
387 Ga0495651_0064964 3300046462 Bacteria 2787
388 Ga0495653_0003592 3300046463 Bacteria 12503
389 Ga0495580_0038899 3300046472 Bacteria 3404
390 Ga0495580_0042402 3300046472 Bacteria 3242
391 Ga0495582_0015918 3300046473 Bacteria 4123
392 Ga0495582_0286872 3300046473 Bacteria 945
393 Ga0495605_0034430 3300046474 Bacteria 2564
394 Ga0495639_0012535 3300046475 Bacteria 3657
395 Ga0495662_0001049 3300046476 Bacteria 13572
396 Ga0495662_0006569 3300046476 Bacteria 5806
397 Ga0495662_0033085 3300046476 Bacteria 2498
398 Ga0495664_0001113 3300046477 Bacteria 13913
399 Ga0495664_0022664 3300046477 Bacteria 3642
400 Ga0495664_0042173 3300046477 Bacteria 2701
401 Ga0495585_0032678 3300046492 Bacteria 2947
402 Ga0495585_0044945 3300046492 Bacteria 2466
403 Ga0495594_0002465 3300046499 Bacteria 9631
404 Ga0495594_0026197 3300046499 Bacteria 3136
405 Ga0495594_0109317 3300046499 Bacteria 1558
406 Ga0495594_0287056 3300046499 Bacteria 937
407 Ga0495596_0014601 3300046500 Bacteria 3308
408 Ga0495607_0047232 3300046501 Bacteria 2523
409 Ga0495608_0007055 3300046511 Bacteria 7952
410 Ga0495608_0107964 3300046511 Bacteria 1790
411 Ga0495610_0053249 3300046512 Bacteria 1961
412 Ga0495616_0004531 3300046513 Bacteria 8748
413 Ga0495618_0055454 3300046514 Bacteria 2509
414 Ga0495618_0061910 3300046514 Bacteria 2374
415 Ga0495618_0177780 3300046514 Bacteria 1353
416 Ga0495628_0013957 3300046516 Bacteria 6746
417 Ga0495628_0027874 3300046516 Bacteria 4591
418 Ga0495630_0009521 3300046517 Bacteria 6988
419 Ga0495631_0007513 3300046518 Bacteria 5542
420 Ga0495631_0080960 3300046518 Bacteria 1401
421 Ga0495632_0033911 3300046519 Bacteria 2617
422 Ga0495632_0045823 3300046519 Bacteria 2176
423 Ga0495643_0006749 3300046522 Bacteria 7506
424 Ga0495643_0008295 3300046522 Bacteria 6591
425 Ga0495644_0092798 3300046523 Bacteria 1140
426 Ga0495644_0096394 3300046523 Bacteria 1118
427 Ga0495666_0037488 3300046526 Bacteria 2357
428 Ga0495666_0068714 3300046526 Bacteria 1686
429 Ga0495652_0089443 3300046529 Bacteria 2521
430 Ga0495652_0097310 3300046529 Bacteria 2394
431 Ga0495652_0229244 3300046529 Bacteria 1390
432 Ga0495654_0065383 3300046530 Bacteria 1736
433 Ga0495665_0001604 3300046531 Bacteria 12102
434 Ga0495665_0014335 3300046531 Bacteria 4276
435 Ga0495640_0004357 3300046533 Bacteria 11297
436 Ga0495640_0012773 3300046533 Bacteria 6409
437 Ga0495640_0016853 3300046533 Bacteria 5460
438 Ga0495640_0086913 3300046533 Bacteria 2069
439 Ga0495586_0028878 3300046535 Bacteria 2968
440 Ga0495586_0085574 3300046535 Bacteria 1737
441 Ga0495587_0010445 3300046536 Bacteria 5908
442 Ga0495609_0042369 3300046538 Bacteria 2044
443 Ga0495645_0010817 3300046543 Bacteria 6409
444 Ga0495645_0049271 3300046543 Bacteria 3068
445 Ga0495645_0212642 3300046543 Bacteria 1305
446 Ga0495645_0268993 3300046543 Bacteria 1125
447 Ga0495622_0041059 3300046557 Bacteria 2151
448 Ga0495622_0058759 3300046557 Bacteria 1781
449 Ga0495622_0084879 3300046557 Bacteria 1456
450 Ga0495622_0117794 3300046557 Bacteria 1214
451 Ga0495633_0024423 3300046558 Bacteria 2987
452 Ga0495667_0003580 3300046559 Bacteria 10448
453 Ga0495667_0049065 3300046559 Bacteria 2787
454 Ga0495667_0067094 3300046559 Bacteria 2345
455 Ga0495667_0184090 3300046559 Bacteria 1339
456 Ga0495668_0019323 3300046616 Bacteria 3928
457 Ga0495634_0002881 3300046642 Bacteria 14112
458 Ga0495634_0021543 3300046642 Bacteria 4553
459 Ga0495634_0025755 3300046642 Bacteria 4108
460 Ga0495634_0039774 3300046642 Bacteria 3200
461 Ga0495625_0062104 3300046660 Bacteria 2641
462 Ga0495625_0067019 3300046660 Bacteria 2527
463 Ga0495635_0003658 3300046663 Bacteria 10664
464 Ga0495635_0123121 3300046663 Bacteria 1768
465 Ga0495635_0187343 3300046663 Bacteria 1405
466 Ga0495635_0373409 3300046663 Bacteria 949
467 Ga0495661_0032032 3300046665 Bacteria 3327
468 Ga0495588_0062857 3300046674 Bacteria 1924
469 Ga0495588_0064953 3300046674 Bacteria 1893
470 Ga0495588_0106138 3300046674 Bacteria 1478
471 Ga0495657_0000839 3300046675 Bacteria 27194
472 Ga0495657_0001015 3300046675 Bacteria 24750
473 Ga0495657_0019939 3300046675 Bacteria 4831
474 Ga0495657_0028824 3300046675 Bacteria 3899
475 Ga0495657_0206722 3300046675 Bacteria 1194
476 Ga0495599_0060503 3300046678 Bacteria 2368
477 Ga0495599_0131987 3300046678 Bacteria 1551
478 Ga0495623_0025113 3300046679 Bacteria 3839
479 Ga0495646_0046856 3300046680 Bacteria 2634
480 Ga0495646_0081618 3300046680 Bacteria 1883
481 Ga0495646_0164390 3300046680 Bacteria 1226
482 Ga0495658_0009238 3300046683 Bacteria 4903
483 Ga0495658_0140966 3300046683 Bacteria 1474
484 Ga0495613_0003597 3300046689 Bacteria 11612
485 Ga0495613_0004706 3300046689 Bacteria 10241
486 Ga0495613_0006172 3300046689 Bacteria 8973
487 Ga0495613_0111832 3300046689 Bacteria 1967
488 Ga0495613_0296174 3300046689 Bacteria 1120
489 Ga0495624_0219304 3300046690 Bacteria 1153
490 Ga0495670_0016186 3300046691 Bacteria 3666
491 Ga0495670_0044382 3300046691 Bacteria 2219
492 Ga0495670_0196658 3300046691 Bacteria 1067
493 Ga0495671_0074590 3300046692 Bacteria 1664
494 Ga0495649_0111387 3300046694 Bacteria 1451
495 Ga0495589_0018950 3300046794 Bacteria 3529
496 Ga0495589_0029443 3300046794 Bacteria 2768
497 Ga0495589_0121469 3300046794 Bacteria 1257
498 Ga0495600_0011305 3300046809 Bacteria 5561
499 Ga0495600_0077813 3300046809 Bacteria 2166
500 Ga0495600_0078558 3300046809 Bacteria 2155
501 Ga0495600_0111373 3300046809 Bacteria 1782
502 Ga0495660_0024245 3300046810 Bacteria 3456
503 Ga0495660_0066709 3300046810 Bacteria 1918
504 Ga0495581_0000797 3300047315 Bacteria 16733
505 Ga0495581_0012811 3300047315 Bacteria 4857
506 Ga0495581_0098370 3300047315 Bacteria 1699
507 Ga0495604_0000467 3300047317 Bacteria 35655
508 Ga0495604_0000583 3300047317 Bacteria 31859
509 Ga0495604_0016953 3300047317 Bacteria 5825
510 Ga0495604_0042322 3300047317 Bacteria 3570
511 Ga0495636_0054362 3300047318 Bacteria 1682
512 Ga0495674_0010994 3300047319 Bacteria 8549
513 Ga0495674_0032547 3300047319 Bacteria 4729
514 Ga0495672_0019696 3300047320 Bacteria 4445
515 Ga0495676_0006226 3300047321 Bacteria 10978
516 Ga0495676_0007150 3300047321 Bacteria 10244
517 Ga0495676_0014530 3300047321 Bacteria 7044
518 Ga0495676_0016170 3300047321 Bacteria 6628
519 Ga0495676_0033626 3300047321 Bacteria 4315
520 Ga0495676_0126581 3300047321 Bacteria 1850
521 Ga0495676_0368427 3300047321 Bacteria 958
522 Ga0495680_0022458 3300047322 Bacteria 5256
523 Ga0495680_0065254 3300047322 Bacteria 2788
524 Ga0495683_0029516 3300047323 Bacteria 2802
525 Ga0495687_001974 3300047443 Bacteria 17491
526 Ga0495687_004066 3300047443 Bacteria 10136
527 Ga0495687_019444 3300047443 Bacteria 3333
528 Ga0495687_035541 3300047443 Bacteria 2239
529 Ga0495675_0031005 3300047444 Bacteria 3412
530 Ga0495675_0032649 3300047444 Bacteria 3322
531 Ga0495675_0037918 3300047444 Bacteria 3069
532 Ga0495675_0056437 3300047444 Bacteria 2490
533 Ga0495675_0062601 3300047444 Bacteria 2355
534 Ga0495675_0117113 3300047444 Bacteria 1661
535 Ga0495677_0111001 3300047445 Bacteria 1042
536 Ga0495685_000165 3300047447 Bacteria 22203
537 Ga0495685_001173 3300047447 Bacteria 8005
538 Ga0495685_006749 3300047447 Bacteria 3771
539 Ga0495685_010075 3300047447 Bacteria 3166
540 Ga0495685_087924 3300047447 Bacteria 1031
541 Ga0495681_0003307 3300047470 Bacteria 11230
542 Ga0495681_0006276 3300047470 Bacteria 7829
543 Ga0495681_0038156 3300047470 Bacteria 2358
544 Ga0495681_0096751 3300047470 Bacteria 1296
545 Ga0495684_0112458 3300047471 Bacteria 2053
546 Ga0495684_0148622 3300047471 Bacteria 1753
547 Ga0495686_0008778 3300047472 Bacteria 7366
548 Ga0495686_0012594 3300047472 Bacteria 5912
549 Ga0495593_0000836 3300047673 Bacteria 17924
550 Ga0495593_0011347 3300047673 Bacteria 5119
551 Ga0495593_0019076 3300047673 Bacteria 3849
552 Ga0495602_0201889 3300048088 Bacteria 1516
553 Ga0495614_0000600 3300048089 Bacteria 15075
554 Ga0495614_0002419 3300048089 Bacteria 8287
555 Ga0495626_0019334 3300048091 Bacteria 3408
556 Ga0496102_0168276 3300048905 Bacteria 2063
557 Ga0496104_0058873 3300048907 Bacteria 3637
558 Ga0496104_0132755 3300048907 Bacteria 2392
559 Ga0496104_0298658 3300048907 Bacteria 1523
560 Ga0496105_0061261 3300048908 Bacteria 3105
561 Ga0496106_0328835 3300048909 Bacteria 1227
562 Ga0496108_0282213 3300048911 Bacteria 1446
563 Ga0496108_0330790 3300048911 Bacteria 1329
564 Ga0496109_0172385 3300048912 Bacteria 2030
565 Ga0496110_0369383 3300048913 Bacteria 1307
566 Ga0496110_0455942 3300048913 Bacteria 1165
567 Ga0496112_0005256 3300048915 Bacteria 11151
568 Ga0496112_0189547 3300048915 Bacteria 2019
569 Ga0496113_0142022 3300048916 Bacteria 1890
570 Ga0496114_0071696 3300048917 Bacteria 2912
571 Ga0496115_0202645 3300048918 Bacteria 1639
572 Ga0496118_0003704 3300048921 Bacteria 18936
573 Ga0496119_0000960 3300048922 Bacteria 37110
574 Ga0496124_0147615 3300048927 Bacteria 1849
575 Ga0496125_0059564 3300048928 Bacteria 3076
576 Ga0495678_032887 3300049459 Bacteria 2145
577 Ga0495682_0070290 3300049460 Bacteria 1260
578 Ga0501031_0008165 3300049568 Bacteria 6813
579 Ga0501031_0012077 3300049568 Bacteria 5630
580 Ga0501031_0013950 3300049568 Bacteria 5233
581 Ga0501031_0027226 3300049568 Bacteria 3728
582 Ga0501031_0134643 3300049568 Bacteria 1614
583 Ga0501031_0162625 3300049568 Bacteria 1459
584 Ga0501031_0287559 3300049568 Bacteria 1066
585 Ga0501032_0011807 3300049569 Bacteria 6259
586 Ga0501032_0017347 3300049569 Bacteria 5055
587 Ga0501032_0020149 3300049569 Bacteria 4649
588 Ga0501032_0023199 3300049569 Bacteria 4293
589 Ga0501032_0025678 3300049569 Bacteria 4059
590 Ga0501032_0038073 3300049569 Bacteria 3277
591 Ga0501032_0085238 3300049569 Bacteria 2100
592 Ga0501032_0176825 3300049569 Bacteria 1398
593 Ga0501033_0002591 3300049570 Bacteria 15240
594 Ga0501033_0003079 3300049570 Bacteria 13858
595 Ga0501033_0004904 3300049570 Bacteria 10648
596 Ga0501033_0008070 3300049570 Bacteria 8154
597 Ga0501033_0009080 3300049570 Bacteria 7670
598 Ga0501033_0034373 3300049570 Bacteria 3803
599 Ga0501033_0097593 3300049570 Bacteria 2146
600 Ga0501033_0290865 3300049570 Bacteria 1152
601 Ga0501034_0007133 3300049571 Bacteria 11921
602 Ga0501034_0009230 3300049571 Bacteria 10338
603 Ga0501034_0038643 3300049571 Bacteria 4833
604 Ga0501034_0041523 3300049571 Bacteria 4654
605 Ga0501034_0045394 3300049571 Bacteria 4440
606 Ga0501034_0059339 3300049571 Bacteria 3843
607 Ga0501034_0060516 3300049571 Bacteria 3803
608 Ga0501034_0088472 3300049571 Bacteria 3095
609 Ga0501034_0213715 3300049571 Bacteria 1883
610 Ga0501034_0629041 3300049571 Bacteria 977
611 Ga0501036_0012084 3300049572 Bacteria 7156
612 Ga0501036_0018185 3300049572 Bacteria 5886
613 Ga0501036_0036881 3300049572 Bacteria 4136
614 Ga0501036_0048842 3300049572 Bacteria 3582
615 Ga0501036_0064216 3300049572 Bacteria 3107
616 Ga0501036_0140740 3300049572 Bacteria 2036
617 Ga0501036_0163857 3300049572 Bacteria 1874
618 Ga0501036_0188738 3300049572 Bacteria 1734
619 Ga0501036_0310246 3300049572 Bacteria 1319
620 Ga0501036_0318648 3300049572 Bacteria 1299
621 Ga0501036_0413767 3300049572 Bacteria 1124
622 Ga0501037_0031860 3300049573 Bacteria 3892
623 Ga0501037_0050127 3300049573 Bacteria 3056
624 Ga0501038_0000677 3300049574 Bacteria 30374
625 Ga0501038_0001761 3300049574 Bacteria 20128
626 Ga0501038_0025359 3300049574 Bacteria 5286
627 Ga0501038_0042215 3300049574 Bacteria 3972
628 Ga0501038_0120334 3300049574 Bacteria 2166
629 Ga0501038_0146260 3300049574 Bacteria 1929
630 Ga0501038_0146553 3300049574 Bacteria 1927
631 Ga0501038_0150802 3300049574 Bacteria 1895
632 Ga0501038_0169403 3300049574 Bacteria 1769
633 Ga0501039_0018851 3300049575 Bacteria 5296
634 Ga0501039_0030196 3300049575 Bacteria 4177
635 Ga0501039_0069074 3300049575 Bacteria 2743
636 Ga0501040_0024426 3300049576 Bacteria 4056
637 Ga0501040_0029854 3300049576 Bacteria 3680
638 Ga0501040_0067936 3300049576 Bacteria 2457
639 Ga0501040_0075509 3300049576 Bacteria 2329
640 Ga0501042_0004332 3300049578 Bacteria 9048
641 Ga0501042_0016002 3300049578 Bacteria 5145
642 Ga0501042_0023813 3300049578 Bacteria 4288
643 Ga0501042_0329866 3300049578 Bacteria 1103
644 Ga0501043_0001400 3300049579 Bacteria 21063
645 Ga0501043_0007642 3300049579 Bacteria 8565
646 Ga0501043_0017764 3300049579 Bacteria 5577
647 Ga0501043_0023946 3300049579 Bacteria 4790
648 Ga0501043_0024194 3300049579 Bacteria 4765
649 Ga0501043_0034380 3300049579 Bacteria 3986
650 Ga0501043_0044527 3300049579 Bacteria 3489
651 Ga0501043_0112447 3300049579 Bacteria 2138
652 Ga0501043_0158924 3300049579 Bacteria 1766
653 Ga0501046_0000337 3300049580 Bacteria 47376
654 Ga0501046_0038515 3300049580 Bacteria 3835
655 Ga0501046_0051336 3300049580 Bacteria 3254
656 Ga0501047_0000284 3300049581 Bacteria 58364
657 Ga0501047_0017912 3300049581 Bacteria 6788
658 Ga0501047_0032454 3300049581 Bacteria 5040
659 Ga0501047_0054498 3300049581 Bacteria 3868
660 Ga0501047_0069619 3300049581 Bacteria 3388
661 Ga0501047_0083165 3300049581 Bacteria 3076
662 Ga0501047_0136367 3300049581 Bacteria 2334
663 Ga0501047_0156225 3300049581 Bacteria 2154
664 Ga0501047_0168901 3300049581 Bacteria 2057
665 Ga0501047_0197550 3300049581 Bacteria 1873
666 Ga0501047_0200165 3300049581 Bacteria 1858
667 Ga0501047_0214886 3300049581 Bacteria 1780
668 Ga0501048_0020734 3300049582 Bacteria 4817
669 Ga0501048_0022888 3300049582 Bacteria 4568
670 Ga0501048_0109186 3300049582 Bacteria 1953
671 Ga0501048_0305089 3300049582 Bacteria 1133
672 Ga0501067_0015169 3300049583 Bacteria 4264
673 Ga0501067_0037539 3300049583 Bacteria 2691
674 Ga0501067_0067507 3300049583 Bacteria 1980
675 Ga0501067_0126184 3300049583 Bacteria 1424
676 Ga0501068_0016332 3300049584 Bacteria 4277
677 Ga0501069_0016682 3300049585 Bacteria 3946
678 Ga0501069_0024842 3300049585 Bacteria 3271
679 Ga0501069_0162064 3300049585 Bacteria 1288
680 Ga0501069_0237160 3300049585 Bacteria 1063
681 Ga0501070_0000421 3300049586 Bacteria 38478
682 Ga0501070_0011303 3300049586 Bacteria 7542
683 Ga0501070_0038087 3300049586 Bacteria 4012
684 Ga0501070_0040790 3300049586 Bacteria 3870
685 Ga0501070_0219403 3300049586 Bacteria 1560
686 Ga0501070_0351430 3300049586 Bacteria 1196
687 Ga0501070_0429780 3300049586 Bacteria 1066
688 Ga0501071_0002288 3300049587 Bacteria 11550
689 Ga0501071_0026514 3300049587 Bacteria 4069
690 Ga0501072_0018639 3300049588 Bacteria 5349
691 Ga0501073_0028158 3300049589 Bacteria 4014
692 Ga0501073_0125554 3300049589 Bacteria 1779
693 Ga0501073_0470502 3300049589 Bacteria 869
694 Ga0501074_0005429 3300049590 Bacteria 9167
695 Ga0501074_0011894 3300049590 Bacteria 6328
696 Ga0501074_0069539 3300049590 Bacteria 2531
697 Ga0501074_0282943 3300049590 Bacteria 1179
698 Ga0501076_0006642 3300049592 Bacteria 8389
699 Ga0501076_0120852 3300049592 Bacteria 2121
700 Ga0501076_0237138 3300049592 Bacteria 1492
701 Ga0501077_0191705 3300049593 Bacteria 1298
702 Ga0501079_0020984 3300049741 Bacteria 4993
703 Ga0501080_0028504 3300049742 Bacteria 5195
704 Ga0501080_0354473 3300049742 Bacteria 1324
705 Ga0501080_0699923 3300049742 Bacteria 894
706 Ga0501081_0346596 3300049743 Bacteria 1094
707 Ga0501083_0014806 3300049744 Bacteria 5454
708 Ga0501083_0017533 3300049744 Bacteria 4992
709 Ga0501035_0003041 3300049822 Bacteria 16087
710 Ga0501035_0007230 3300049822 Bacteria 10386
711 Ga0501035_0025316 3300049822 Bacteria 5440
712 Ga0501035_0030788 3300049822 Bacteria 4891
713 Ga0501035_0041702 3300049822 Bacteria 4143
714 Ga0501035_0047649 3300049822 Bacteria 3845
715 Ga0501035_0070923 3300049822 Bacteria 3085
716 Ga0501035_0081236 3300049822 Bacteria 2861
717 Ga0501035_0121911 3300049822 Bacteria 2278
718 Ga0501044_0005278 3300049823 Bacteria 14369
719 Ga0501044_0009863 3300049823 Bacteria 10381
720 Ga0501044_0025423 3300049823 Bacteria 6275
721 Ga0501044_0025533 3300049823 Bacteria 6263
722 Ga0501044_0066953 3300049823 Bacteria 3660
723 Ga0501044_0123324 3300049823 Bacteria 2590
724 Ga0501044_0127116 3300049823 Bacteria 2545
725 Ga0501044_0130034 3300049823 Bacteria 2512
726 Ga0501044_0178256 3300049823 Bacteria 2093
727 Ga0501044_0220337 3300049823 Bacteria 1848
728 Ga0501044_0245730 3300049823 Bacteria 1732
729 Ga0501044_0527725 3300049823 Bacteria 1080
730 Ga0501045_0028265 3300049824 Bacteria 4044
731 Ga0501045_0149521 3300049824 Bacteria 1737
732 Ga0501045_0184371 3300049824 Bacteria 1555
733 Ga0501045_0387017 3300049824 Bacteria 1041
734 nmdc:mga03n38_31165_c1 3300050490 Bacteria 2248
735 nmdc:mga00v17_34608_c1 3300050491 Bacteria 3002
736 nmdc:mga0yw44_23172_c1 3300050492 Bacteria 3494
737 nmdc:mga0yw44_40538_c1 3300050492 Bacteria 2767
738 nmdc:mga0yw44_97670_c1 3300050492 Bacteria 1866
739 nmdc:mga06z11_70086_c1 3300050494 Bacteria 1853
740 nmdc:mga06z11_8525_c1 3300050494 Bacteria 4282
741 nmdc:mga07m45_83309_c1 3300050496 Bacteria 1827
742 nmdc:mga05p37_290976_c1 3300050507 Bacteria 1944
743 nmdc:mga05p37_400560_c1 3300050507 Bacteria 1602
744 nmdc:mga09592_40600_c1 3300050508 Bacteria 3909
745 nmdc:mga06r32_107770_c1 3300050510 Bacteria 2738
746 nmdc:mga08y16_16503_c1 3300050511 Bacteria 7768
747 nmdc:mga0sz30_16899_c1 3300050516 Bacteria 2903
748 nmdc:mga0sz30_41517_c1 3300050516 Bacteria 1934
749 Ga0495601_0032169 3300053077 Bacteria 3264
750 Ga0495601_0109521 3300053077 Bacteria 1788
751 Ga0495612_0046640 3300053078 Bacteria 1775
752 Ga0495612_0055760 3300053078 Bacteria 1630
753 Ga0495619_0037073 3300053085 Bacteria 3176
754 Ga0500578_0022714 3300053086 Bacteria 4028
755 Ga0500643_004469 3300053087 Bacteria 6319
756 Ga0500643_052095 3300053087 Bacteria 1167
757 Ga0500644_0017567 3300053088 Bacteria 2080
758 Ga0500644_0033356 3300053088 Bacteria 1652
759 Ga0500583_0077932 3300053092 Bacteria 1597
760 Ga0500566_0108555 3300053094 Bacteria 1511
761 Ga0500640_004082 3300053095 Bacteria 5246
762 Ga0500654_048658 3300053099 Bacteria 2311
763 Ga0500553_098594 3300053101 Bacteria 1264
764 Ga0500553_114327 3300053101 Bacteria 1127
765 Ga0500556_0000584 3300053104 Bacteria 24042
766 Ga0500560_001904 3300053107 Bacteria 3815
767 Ga0500569_001296 3300053109 Bacteria 4671
768 Ga0500593_000787 3300053117 Bacteria 11829
769 Ga0500608_136352 3300053122 Bacteria 1094
770 Ga0500628_000801 3300053129 Bacteria 5577
771 Ga0500652_004677 3300053131 Bacteria 4255
772 Ga0500658_0005267 3300053134 Bacteria 4810
773 Ga0500561_0001903 3300053137 Bacteria 3449
774 Ga0500573_0004664 3300053140 Bacteria 7255
775 Ga0500573_0026286 3300053140 Bacteria 3346
776 Ga0500573_0029205 3300053140 Bacteria 3179
777 Ga0500573_0035807 3300053140 Bacteria 2865
778 Ga0500573_0154986 3300053140 Bacteria 1251
779 Ga0500579_082248 3300053143 Bacteria 1793
780 Ga0500600_0014814 3300053149 Bacteria 4738
781 Ga0500600_0092269 3300053149 Bacteria 1614
782 Ga0500616_0009781 3300053153 Bacteria 5786
783 Ga0500616_0013224 3300053153 Bacteria 4803
784 Ga0500616_0039283 3300053153 Bacteria 2552
785 Ga0500624_003523 3300053157 Bacteria 2052
786 Ga0500627_0028076 3300053158 Bacteria 2334
787 Ga0500633_0034664 3300053160 Bacteria 1656
788 Ga0500634_0016886 3300053161 Bacteria 3901
789 Ga0500645_000006 3300053730 Bacteria 276677
790 Ga0500645_041256 3300053730 Bacteria 1363
791 Ga0500656_005102 3300053732 Bacteria 1286
792 Ga0500565_004323 3300053734 Bacteria 1194
793 Ga0500587_002322 3300053739 Bacteria 2705
794 Ga0501084_0023928 3300054114 Bacteria 5095
795 Ga0501084_0088410 3300054114 Bacteria 2601
796 Ga0501084_0282112 3300054114 Bacteria 1403
797 Ga0501084_0304779 3300054114 Bacteria 1345
798 Ga0501084_0338609 3300054114 Bacteria 1271
799 Ga0501082_0009188 3300060353 Bacteria 8524
800 Ga0501082_0087718 3300060353 Bacteria 2684
801 Ga0501082_0431530 3300060353 Bacteria 1151
802 Ga0466962_0000087 3300061719 Bacteria 37548
803 Ga0466962_0010087 3300061719 Bacteria 4532
804 Ga0466962_0018196 3300061719 Bacteria 3380
805 2547406826 2547132111 Bacteria 8013147
806 2548694853 2547132424 Bacteria 8348532
807 2554259265 2554235005 Bacteria 6457341
808 2585296668 2582581312 Bacteria 7308206
809 2585303925 2582581313 Bacteria 10042643
810 2585315394 2582581314 Bacteria 11452267
811 2616695989 2616644814 Bacteria 11555299
812 2616900478 2616644941 Bacteria 8510691
813 2643759866 2643221548 Bacteria 8053412
814 2643828206 2643221561 Bacteria 4984412
815 2643893726 2643221576 Bacteria 5214352
816 2643904797 2643221578 Bacteria 9213798
817 2643944112 2643221587 Bacteria 7586415
818 2643957810 2643221590 Bacteria 5214697
819 2644015845 2643221601 Bacteria 7493239
820 2644175038 2643221631 Bacteria 8168043
821 2644268401 2643221647 Bacteria 10741251
822 2644389435 2643221670 Bacteria 6497041
823 2644405937 2643221673 Bacteria 9196637
824 2644430960 2643221677 Bacteria 7584031
825 2644438369 2643221678 Bacteria 9540101
826 2644460437 2643221682 Bacteria 6743283
827 2644504264 2643221690 Bacteria 4654705
828 2644526662 2643221694 Bacteria 4392972
829 2644535020 2643221696 Bacteria 5431823
830 2644629341 2643221714 Bacteria 9015452
831 2644670596 2643221722 Bacteria 4247614
832 2738890431 2738541308 Bacteria 7020677
833 2739367378 2738543034 Bacteria 6084756
834 2768645043 2767802112 Bacteria 6465194
835 2784587032 2784132148 Bacteria 8627943
836 2785345383 2784746763 Bacteria 9783172
837 2785367502 2784746768 Bacteria 10036182
838 2786668563 2786546132 Bacteria 10419719
839 2799186527 2799112218 Bacteria 4315149
840 2804844104 2802429296 Bacteria 7227771
841 2808847992 2808606359 Bacteria 9866990
842 2808918751 2808606375 Bacteria 9466072
843 2809230593 2808606448 Bacteria 8656184
844 2811847270 2808606982 Bacteria 7791042
845 2812359999 2811994879 Bacteria 9313447
846 2812482071 2811994917 Bacteria 7761064
847 2816426726 2816332119 Bacteria 8120218
848 2819696727 2818991463 Bacteria 7948711
849 2837270104 2837268691 Bacteria 7850704
850 2852638031 2852635781 Bacteria 8251373
851 2857482081 2857481737 Bacteria 4761446
852 2862180366 2862178590 Bacteria 8583590
853 2862289287 2862281513 Bacteria 9621493
854 2862391004 2862382967 Bacteria 10317375
855 2862512997 2862507626 Bacteria 9425308
856 2862583358 2862574272 Bacteria 10567477
857 2862710662 2862705112 Bacteria 6563286
858 2863406646 2863404153 Bacteria 9672205
859 2867307513 2867302475 Bacteria 7087181
860 2867352663 2867346516 Bacteria 7608576
861 2867370297 2867369537 Bacteria 6501581
862 2867432545 2867428634 Bacteria 9590268
863 2867479109 2867475112 Bacteria 6909112
864 2868093135 2868088558 Bacteria 7609351
865 2873157375 2873151551 Bacteria 8625867
866 2875392994 2875391855 Bacteria 7600475
867 2877683041 2877676314 Bacteria 9512378
868 2902804642 2902799365 Bacteria 5419524
869 2904770214 2904765812 Bacteria 5369154
870 2904771631 2904770941 Bacteria 5580202
871 2908812421 2908811453 Bacteria 5478616
872 2912722048 2912715099 Bacteria 9460473
873 2912725812 2912723979 Bacteria 8557534
874 2912759165 2912757875 Bacteria 7940295
875 2918502850 2918501144 Bacteria 8668083
876 2919422871 2919420072 Bacteria 5390363
877 2919435479 2919432681 Bacteria 5390474
878 2919473576 2919468124 Bacteria 9133025
879 2929215672 2929212328 Bacteria 7708288
880 2935396367 2935390628 Bacteria 7043367
881 2946051708 2946045630 Bacteria 8527308
882 2946065895 2946064051 Bacteria 8957905
883 2946074223 2946072368 Bacteria 8999607
884 2947231508 2947224130 Bacteria 9938529
885 2954010719 2954002825 Bacteria 9173742
886 2954388262 2954380949 Bacteria 10050426
887 2954674839 2954673503 Bacteria 9685905
888 2954689294 2954682443 Bacteria 9862841
889 2954699066 2954691527 Bacteria 10720516
890 2954703153 2954701450 Bacteria 10834262
891 2954718021 2954711539 Bacteria 10867210
892 2954727988 2954721474 Bacteria 10456478
893 2954733816 2954731030 Bacteria 10243860
894 2954746885 2954740390 Bacteria 10229294
895 2954752701 2954749733 Bacteria 10366972
896 2954765999 2954759201 Bacteria 9358192
897 2966604071 2966598605 Bacteria 7676064
898 2990047080 2990044586 Bacteria 6603797
899 2990065382 2990059506 Bacteria 9321252
900 2990094272 2990088156 Bacteria 6657676
901 2990258873 2990256926 Bacteria 4252839
902 2995464816 2995463766 Bacteria 8577691
903 2997454012 2997451912 Bacteria 8492419
904 3003009588 3002998708 Bacteria 11715108
905 3006326055 3006321560 Bacteria 8247479
906 3006399802 3006393351 Bacteria 6615579
907 3006430451 3006425503 Bacteria 6491253
908 3006493090 3006486233 Bacteria 8157040
909 3006495345 3006493962 Bacteria 8825450
910 8008489204 8008485437 Bacteria 7198341
911 8008561674 8008558824 Bacteria 10610750
912 8008580449 8008574985 Bacteria 7815457
913 8023624426 8023623736 Bacteria 8593882
914 8025415036 8025413630 Bacteria 7014048
915 8025483251 8025478263 Bacteria 8209203
916 8025527645 8025524527 Bacteria 7197316
917 8025536943 8025530807 Bacteria 8495698
918 8047899937 8047893842 Bacteria 11723082
919 8048132856 8048127548 Bacteria 11053136
920 8048358992 8048356638 Bacteria 11044339
921 8048376886 8048369669 Bacteria 11666822
922 8048385939 8048379754 Bacteria 11877923
923 8048411995 8048406513 Bacteria 8936924
924 8053954041 8053945823 Bacteria 8962862
925 8054167212 8054160619 Bacteria 7783213
926 8054611460 8054609563 Bacteria 5170090
927 8056066642 8056060235 Bacteria 7259403
928 8056450344 8056447290 Bacteria 7680491
929 8056668993 8056667051 Bacteria 6953971
930 8056835378 8056829672 Bacteria 9045328
931 Ga0207687_10166089
932 JGI24739J22299_10022220
933 rootH2_10110037
934 rootL2_10058526
935 JGI25160J50197_1023978
936 Ga0070658_10004786
937 Ga0070658_10019038
938 Ga0070658_10019185
939 Ga0070658_10333849
940 Ga0070683_100076530
941 Ga0070683_100096840
942 Ga0070683_100198804
943 Ga0070683_100208306
944 Ga0068869_100058820
945 Ga0070666_10001373
946 Ga0070680_100069970
947 Ga0070660_100039257
948 Ga0070660_100059690
949 Ga0070660_100349072
950 Ga0070687_100176882
951 Ga0070692_10003768
952 Ga0070673_100067851
953 Ga0070659_100018542
954 Ga0070659_100132882
955 Ga0070667_100016726
956 Ga0070667_100019526
957 Ga0070667_100268494
958 Ga0070709_10027548
959 Ga0070714_100009162
960 Ga0070714_100051156
961 Ga0070714_100077103
962 Ga0070714_100149140
963 Ga0070714_100461657
964 Ga0070713_100069159
965 Ga0070713_100190552
966 Ga0070713_100395109
967 Ga0070713_100411485
968 Ga0070700_100000408
969 Ga0070700_100195888
970 Ga0070708_100189052
971 Ga0070681_10170931
972 Ga0068867_100031690
973 Ga0070707_100015699
974 Ga0070707_100037910
975 Ga0070707_100335295
976 Ga0070707_100616481
977 Ga0070698_100025711
978 Ga0070699_100032683
979 Ga0070679_100022810
980 Ga0070684_100022539
981 Ga0070684_100137966
982 Ga0070684_100312198
983 Ga0068853_100039723
984 Ga0070672_100092616
985 Ga0070665_100020384
986 Ga0070665_100145958
987 Ga0068855_100177354
988 Ga0068855_100189364
989 Ga0070664_100579261
990 Ga0068857_100109588
991 Ga0068857_100188638
992 Ga0070702_100058104
993 Ga0068852_100001881
994 Ga0068861_100034165
995 Ga0068870_10007529
996 Ga0068860_100001151
997 Ga0081455_10008029
998 Ga0081455_10016327
999 Ga0081455_10047275
1000 Ga0081455_10096417
1001 Ga0075365_10018547
1002 Ga0075365_10045571
1003 Ga0075365_10050637
1004 Ga0075365_10055635
1005 Ga0075365_10094154
1006 Ga0075365_10292186
1007 Ga0075363_100040548
1008 Ga0075364_10058153
1009 Ga0075364_10158981
1010 Ga0075364_10196366
1011 Ga0070715_10017085
1012 Ga0070712_100061476
1013 Ga0075367_10094587
1014 Ga0075369_10087242
1015 Ga0075370_10026355
1016 Ga0075370_10114564
1017 Ga0075428_100053118
1018 Ga0075428_100197335
1019 Ga0075431_100361911
1020 Ga0068865_100010214
1021 Ga0099826_10027257
1022 Ga0099794_10018564
1023 Ga0105251_10082743
1024 Ga0105240_10075361
1025 Ga0105240_10338250
1026 Ga0111539_10042635
1027 Ga0111539_10188004
1028 Ga0105245_10051944
1029 Ga0105245_10717786
1030 Ga0114129_10434596
1031 Ga0105243_10029585
1032 Ga0105243_10808091
1033 Ga0105241_10024864
1034 Ga0105248_10223914
1035 Ga0105249_10221521
1036 Ga0105239_10082141
1037 Ga0105239_10296366
1038 Ga0157370_10010376
1039 Ga0157369_10010790
1040 Ga0157369_10011795
1041 Ga0157369_10272221
1042 Ga0157369_10421629
1043 Ga0157372_10193394
1044 Ga0157372_10223017
1045 Ga0157372_10386011
1046 Ga0157375_10057188
1047 Ga0163163_10194768
1048 Ga0157380_10006949
1049 Ga0157380_10484002
1050 Ga0157380_10963333
1051 Ga0182008_10002172
1052 Ga0157379_10319298
1053 Ga0157376_10443083
1054 Ga0182007_10000584
1055 Ga0183367_1010
1056 Ga0206354_11249830
1057 Ga0206353_11155499
1058 Ga0213876_10001814
1059 Ga0213876_10004136
1060 Ga0213875_10001014
1061 Ga0213875_10027455
1062 Ga0213875_10028241
1063 Ga0209758_1006719
1064 Ga0207426_1002890
1065 Ga0207426_1003860
1066 Ga0209051_1058879
1067 Ga0207713_1057810
1068 Ga0207680_10026739
1069 Ga0207647_10006160
1070 Ga0207647_10012813
1071 Ga0207647_10039485
1072 Ga0207685_10008631
1073 Ga0207685_10082175
1074 Ga0207699_10022900
1075 Ga0207699_10040860
1076 Ga0207643_10047075
1077 Ga0207705_10007324
1078 Ga0207705_10035356
1079 Ga0207705_10288721
1080 Ga0207695_10357678
1081 Ga0207693_10193332
1082 Ga0207663_10099838
1083 Ga0207660_10203661
1084 Ga0207657_10144888
1085 Ga0207657_10208208
1086 Ga0207652_10016037
1087 Ga0207652_10141399
1088 Ga0207646_10021681
1089 Ga0207646_10074354
1090 Ga0207646_10239154
1091 Ga0207646_10434920
1092 Ga0207687_10008234
1093 Ga0207700_10011641
1094 Ga0207700_10122430
1095 Ga0207700_10375610
1096 Ga0207664_10049622
1097 Ga0207664_10059283
1098 Ga0207664_10349323
1099 Ga0207690_10080716
1100 Ga0207669_10060794
1101 Ga0207691_10336576
1102 Ga0207711_10200278
1103 Ga0207689_10325500
1104 Ga0207661_10020817
1105 Ga0207661_10070518
1106 Ga0207661_10120688
1107 Ga0207667_10024866
1108 Ga0207667_10042854
1109 Ga0207667_10420420
1110 Ga0207640_10550581
1111 Ga0207658_10013368
1112 Ga0207658_10067690
1113 Ga0207639_10017989
1114 Ga0207708_10000533
1115 Ga0207702_10472142
1116 Ga0207648_10003798
1117 Ga0207674_10070611
1118 Ga0207674_10081197
1119 Ga0207675_100013905
1120 Ga0207698_10159395
1121 Ga0207698_10636428
1122 Ga0207428_10023542
1123 Ga0268266_10082089
1124 Ga0268266_10122220
1125 Ga0268264_10001023
1126 Ga0265334_10001125
1127 Ga0307517_10001681
1128 Ga0307517_10017820
1129 Ga0307515_10000544
1130 Ga0307515_10028906
1131 Ga0307515_10055049
1132 Ga0265338_10072609
1133 Ga0307511_10001522
1134 Ga0307511_10066339
1135 Ga0307512_10008602
1136 Ga0307512_10010797
1137 Ga0307512_10045059
1138 Ga0307512_10090507
1139 Ga0316181_1279863
1140 Ga0265320_10021900
1141 Ga0265325_10029449
1142 Ga0265325_10055326
1143 Ga0265340_10101420
1144 Ga0265339_10198300
1145 Ga0265316_10324848
1146 Ga0307513_10000483
1147 Ga0307513_10006579
1148 Ga0307513_10025771
1149 Ga0265313_10008472
1150 Ga0265313_10046624
1151 Ga0307508_10003936
1152 Ga0307508_10004252
1153 Ga0307508_10014026
1154 Ga0307508_10203403
1155 Ga0307514_10005547
1156 Ga0307514_10025508
1157 Ga0307514_10082174
1158 Ga0307514_10131354
1159 Ga0265314_10047987
1160 Ga0265314_10106763
1161 Ga0265342_10021738
1162 Ga0307516_10006120
1163 Ga0307516_10024936
1164 Ga0307413_10102796
1165 Ga0307413_10126042
1166 Ga0307518_10256975
1167 Ga0326468_10002491
1168 Ga0307407_10147802
1169 Ga0307412_10031096
1170 Ga0307409_100113059
1171 Ga0307416_100287756
1172 Ga0307414_10199302
1173 Ga0307415_100002682
1174 Ga0307507_10065724
1175 Ga0307510_10047545
1176 Ga0373953_0011000
1177 Ga0373956_0002557
1178 Ga0373956_0062161
1179 Ga0373933_0101371
1180 Ga0316584_0407689
1181 Ga0395899_0094360
1182 Ga0395900_0081496
1183 Ga0395900_0326157
1184 Ga0395900_0420530
1185 Ga0395898_0002252
1186 Ga0395898_0625350
1187 Ga0436364_0335584
1188 Ga0436364_0788334
1189 Ga0395901_0092628
1190 Ga0400485_05857
1191 Ga0400486_31579
1192 Ga0436365_0763923
1193 Ga0436365_0810711
1194 Ga0436360_0998993
1195 Ga0436363_0925874
1196 Ga0439436_0001758
1197 Ga0439436_0007057
1198 Ga0439439_0001722
1199 Ga0439439_0027140
1200 Ga0451791_0052689
1201 Ga0451791_0442814
1202 Ga0451791_1935604
1203 Ga0451837_1111440
1204 Ga0451841_1140692
1205 Ga0451853_0979492
1206 Ga0451853_2641569
1207 Ga0439433_0002992
1208 Ga0439442_005345
1209 Ga0439449_0001015
1210 Ga0439449_0005711
1211 Ga0439450_020179
1212 Ga0439457_000138
1213 Ga0439457_009297
1214 Ga0439462_0003088
1215 Ga0450894_000636
1216 Ga0450898_000120
1217 Ga0450899_002728
1218 Ga0450903_000332
1219 Ga0450906_004363
1220 Ga0439458_0001312
1221 Ga0466969_0014012
1222 Ga0466972_0000620
1223 Ga0466972_0050966
1224 Ga0466972_0068782
1225 Ga0466965_0007886
1226 Ga0466965_0027769
1227 Ga0466965_0029888
1228 Ga0466965_0049769
1229 Ga0466966_0000815
1230 Ga0466966_0001647
1231 Ga0466966_0003548
1232 Ga0466966_0030001
1233 Ga0466966_0030128
1234 Ga0466966_0039035
1235 Ga0466966_0048245
1236 Ga0466966_0073456
1237 Ga0466961_0001431
1238 Ga0466961_0004266
1239 Ga0466961_0009230
1240 Ga0466961_0043632
1241 Ga0466961_0050994
1242 Ga0466961_0051146
1243 Ga0466961_0062275
1244 Ga0466961_0065411
1245 Ga0466961_0131847
1246 Ga0466963_0001698
1247 Ga0466963_0007318
1248 Ga0466963_0025506
1249 Ga0466963_0049820
1250 Ga0466963_0171963
1251 Ga0466963_0183806
1252 Ga0466963_0390587
1253 Ga0466964_0030433
1254 Ga0466964_0109334
1255 Ga0466964_0194801
1256 Ga0466971_0000897
1257 Ga0466971_0015814
1258 Ga0466968_0004021
1259 Ga0466970_0001486
1260 Ga0466970_0149535
1261 Ga0466957_0001849
1262 Ga0466957_0016812
1263 Ga0466957_0021597
1264 Ga0466957_0069496
1265 Ga0466957_0152532
1266 Ga0466957_0290934
1267 Ga0466960_0004137
1268 Ga0466960_0009255
1269 Ga0466960_0088865
1270 Ga0466960_0149123
1271 Ga0466959_0001421
1272 Ga0466959_0002793
1273 Ga0466959_0011379
1274 Ga0466959_0034281
1275 Ga0466959_0084467
1276 Ga0466958_0010504
1277 Ga0466958_0018578
1278 Ga0466958_0033024
1279 Ga0466958_0131409
1280 Ga0466967_0054662
1281 Ga0466967_0062443
1282 Ga0466967_0069668
1283 Ga0466967_0127589
1284 Ga0466967_0256855
1285 Ga0466967_0262771
1286 Ga0466967_0316826
1287 Ga0466967_0347701
1288 Ga0466967_0383463
1289 Ga0466967_0449138
1290 Ga0466967_0597962
1291 Ga0466967_0650837
1292 Ga0466967_0824962
1293 Ga0495617_008927
1294 Ga0495627_024148
1295 Ga0495592_0007981
1296 Ga0495592_0144411
1297 Ga0495592_0171117
1298 Ga0495603_0001642
1299 Ga0495603_0011163
1300 Ga0495603_0018506
1301 Ga0495603_0033030
1302 Ga0495603_0092438
1303 Ga0495603_0149006
1304 Ga0495629_0000810
1305 Ga0495629_0005095
1306 Ga0495629_0014680
1307 Ga0495629_0016728
1308 Ga0495629_0024576
1309 Ga0495629_0071327
1310 Ga0495629_0134241
1311 Ga0495629_0150075
1312 Ga0495638_0011657
1313 Ga0495638_0058368
1314 Ga0495638_0070576
1315 Ga0495651_0002537
1316 Ga0495651_0013226
1317 Ga0495651_0064964
1318 Ga0495653_0003592
1319 Ga0495580_0038899
1320 Ga0495580_0042402
1321 Ga0495582_0015918
1322 Ga0495582_0286872
1323 Ga0495605_0034430
1324 Ga0495639_0012535
1325 Ga0495662_0001049
1326 Ga0495662_0006569
1327 Ga0495662_0033085
1328 Ga0495664_0001113
1329 Ga0495664_0022664
1330 Ga0495664_0042173
1331 Ga0495585_0032678
1332 Ga0495585_0044945
1333 Ga0495594_0002465
1334 Ga0495594_0026197
1335 Ga0495594_0109317
1336 Ga0495594_0287056
1337 Ga0495596_0014601
1338 Ga0495607_0047232
1339 Ga0495608_0007055
1340 Ga0495608_0107964
1341 Ga0495610_0053249
1342 Ga0495616_0004531
1343 Ga0495618_0055454
1344 Ga0495618_0061910
1345 Ga0495618_0177780
1346 Ga0495628_0013957
1347 Ga0495628_0027874
1348 Ga0495630_0009521
1349 Ga0495631_0007513
1350 Ga0495631_0080960
1351 Ga0495632_0033911
1352 Ga0495632_0045823
1353 Ga0495643_0006749
1354 Ga0495643_0008295
1355 Ga0495644_0092798
1356 Ga0495644_0096394
1357 Ga0495666_0037488
1358 Ga0495666_0068714
1359 Ga0495652_0089443
1360 Ga0495652_0097310
1361 Ga0495652_0229244
1362 Ga0495654_0065383
1363 Ga0495665_0001604
1364 Ga0495665_0014335
1365 Ga0495640_0004357
1366 Ga0495640_0012773
1367 Ga0495640_0016853
1368 Ga0495640_0086913
1369 Ga0495586_0028878
1370 Ga0495586_0085574
1371 Ga0495587_0010445
1372 Ga0495609_0042369
1373 Ga0495645_0010817
1374 Ga0495645_0049271
1375 Ga0495645_0212642
1376 Ga0495645_0268993
1377 Ga0495622_0041059
1378 Ga0495622_0058759
1379 Ga0495622_0084879
1380 Ga0495622_0117794
1381 Ga0495633_0024423
1382 Ga0495667_0003580
1383 Ga0495667_0049065
1384 Ga0495667_0067094
1385 Ga0495667_0184090
1386 Ga0495668_0019323
1387 Ga0495634_0002881
1388 Ga0495634_0021543
1389 Ga0495634_0025755
1390 Ga0495634_0039774
1391 Ga0495625_0062104
1392 Ga0495625_0067019
1393 Ga0495635_0003658
1394 Ga0495635_0123121
1395 Ga0495635_0187343
1396 Ga0495635_0373409
1397 Ga0495661_0032032
1398 Ga0495588_0062857
1399 Ga0495588_0064953
1400 Ga0495588_0106138
1401 Ga0495657_0000839
1402 Ga0495657_0001015
1403 Ga0495657_0019939
1404 Ga0495657_0028824
1405 Ga0495657_0206722
1406 Ga0495599_0060503
1407 Ga0495599_0131987
1408 Ga0495623_0025113
1409 Ga0495646_0046856
1410 Ga0495646_0081618
1411 Ga0495646_0164390
1412 Ga0495658_0009238
1413 Ga0495658_0140966
1414 Ga0495613_0003597
1415 Ga0495613_0004706
1416 Ga0495613_0006172
1417 Ga0495613_0111832
1418 Ga0495613_0296174
1419 Ga0495624_0219304
1420 Ga0495670_0016186
1421 Ga0495670_0044382
1422 Ga0495670_0196658
1423 Ga0495671_0074590
1424 Ga0495649_0111387
1425 Ga0495589_0018950
1426 Ga0495589_0029443
1427 Ga0495589_0121469
1428 Ga0495600_0011305
1429 Ga0495600_0077813
1430 Ga0495600_0078558
1431 Ga0495600_0111373
1432 Ga0495660_0024245
1433 Ga0495660_0066709
1434 Ga0495581_0000797
1435 Ga0495581_0012811
1436 Ga0495581_0098370
1437 Ga0495604_0000467
1438 Ga0495604_0000583
1439 Ga0495604_0016953
1440 Ga0495604_0042322
1441 Ga0495636_0054362
1442 Ga0495674_0010994
1443 Ga0495674_0032547
1444 Ga0495672_0019696
1445 Ga0495676_0006226
1446 Ga0495676_0007150
1447 Ga0495676_0014530
1448 Ga0495676_0016170
1449 Ga0495676_0033626
1450 Ga0495676_0126581
1451 Ga0495676_0368427
1452 Ga0495680_0022458
1453 Ga0495680_0065254
1454 Ga0495683_0029516
1455 Ga0495687_001974
1456 Ga0495687_004066
1457 Ga0495687_019444
1458 Ga0495687_035541
1459 Ga0495675_0031005
1460 Ga0495675_0032649
1461 Ga0495675_0037918
1462 Ga0495675_0056437
1463 Ga0495675_0062601
1464 Ga0495675_0117113
1465 Ga0495677_0111001
1466 Ga0495685_000165
1467 Ga0495685_001173
1468 Ga0495685_006749
1469 Ga0495685_010075
1470 Ga0495685_087924
1471 Ga0495681_0003307
1472 Ga0495681_0006276
1473 Ga0495681_0038156
1474 Ga0495681_0096751
1475 Ga0495684_0112458
1476 Ga0495684_0148622
1477 Ga0495686_0008778
1478 Ga0495686_0012594
1479 Ga0495593_0000836
1480 Ga0495593_0011347
1481 Ga0495593_0019076
1482 Ga0495602_0201889
1483 Ga0495614_0000600
1484 Ga0495614_0002419
1485 Ga0495626_0019334
1486 Ga0496102_0168276
1487 Ga0496104_0058873
1488 Ga0496104_0132755
1489 Ga0496104_0298658
1490 Ga0496105_0061261
1491 Ga0496106_0328835
1492 Ga0496108_0282213
1493 Ga0496108_0330790
1494 Ga0496109_0172385
1495 Ga0496110_0369383
1496 Ga0496110_0455942
1497 Ga0496112_0005256
1498 Ga0496112_0189547
1499 Ga0496113_0142022
1500 Ga0496114_0071696
1501 Ga0496115_0202645
1502 Ga0496118_0003704
1503 Ga0496119_0000960
1504 Ga0496124_0147615
1505 Ga0496125_0059564
1506 Ga0495678_032887
1507 Ga0495682_0070290
1508 Ga0501031_0008165
1509 Ga0501031_0012077
1510 Ga0501031_0013950
1511 Ga0501031_0027226
1512 Ga0501031_0134643
1513 Ga0501031_0162625
1514 Ga0501031_0287559
1515 Ga0501032_0011807
1516 Ga0501032_0017347
1517 Ga0501032_0020149
1518 Ga0501032_0023199
1519 Ga0501032_0025678
1520 Ga0501032_0038073
1521 Ga0501032_0085238
1522 Ga0501032_0176825
1523 Ga0501033_0002591
1524 Ga0501033_0003079
1525 Ga0501033_0004904
1526 Ga0501033_0008070
1527 Ga0501033_0009080
1528 Ga0501033_0034373
1529 Ga0501033_0097593
1530 Ga0501033_0290865
1531 Ga0501034_0007133
1532 Ga0501034_0009230
1533 Ga0501034_0038643
1534 Ga0501034_0041523
1535 Ga0501034_0045394
1536 Ga0501034_0059339
1537 Ga0501034_0060516
1538 Ga0501034_0088472
1539 Ga0501034_0213715
1540 Ga0501034_0629041
1541 Ga0501036_0012084
1542 Ga0501036_0018185
1543 Ga0501036_0036881
1544 Ga0501036_0048842
1545 Ga0501036_0064216
1546 Ga0501036_0140740
1547 Ga0501036_0163857
1548 Ga0501036_0188738
1549 Ga0501036_0310246
1550 Ga0501036_0318648
1551 Ga0501036_0413767
1552 Ga0501037_0031860
1553 Ga0501037_0050127
1554 Ga0501038_0000677
1555 Ga0501038_0001761
1556 Ga0501038_0025359
1557 Ga0501038_0042215
1558 Ga0501038_0120334
1559 Ga0501038_0146260
1560 Ga0501038_0146553
1561 Ga0501038_0150802
1562 Ga0501038_0169403
1563 Ga0501039_0018851
1564 Ga0501039_0030196
1565 Ga0501039_0069074
1566 Ga0501040_0024426
1567 Ga0501040_0029854
1568 Ga0501040_0067936
1569 Ga0501040_0075509
1570 Ga0501042_0004332
1571 Ga0501042_0016002
1572 Ga0501042_0023813
1573 Ga0501042_0329866
1574 Ga0501043_0001400
1575 Ga0501043_0007642
1576 Ga0501043_0017764
1577 Ga0501043_0023946
1578 Ga0501043_0024194
1579 Ga0501043_0034380
1580 Ga0501043_0044527
1581 Ga0501043_0112447
1582 Ga0501043_0158924
1583 Ga0501046_0000337
1584 Ga0501046_0038515
1585 Ga0501046_0051336
1586 Ga0501047_0000284
1587 Ga0501047_0017912
1588 Ga0501047_0032454
1589 Ga0501047_0054498
1590 Ga0501047_0069619
1591 Ga0501047_0083165
1592 Ga0501047_0136367
1593 Ga0501047_0156225
1594 Ga0501047_0168901
1595 Ga0501047_0197550
1596 Ga0501047_0200165
1597 Ga0501047_0214886
1598 Ga0501048_0020734
1599 Ga0501048_0022888
1600 Ga0501048_0109186
1601 Ga0501048_0305089
1602 Ga0501067_0015169
1603 Ga0501067_0037539
1604 Ga0501067_0067507
1605 Ga0501067_0126184
1606 Ga0501068_0016332
1607 Ga0501069_0016682
1608 Ga0501069_0024842
1609 Ga0501069_0162064
1610 Ga0501069_0237160
1611 Ga0501070_0000421
1612 Ga0501070_0011303
1613 Ga0501070_0038087
1614 Ga0501070_0040790
1615 Ga0501070_0219403
1616 Ga0501070_0351430
1617 Ga0501070_0429780
1618 Ga0501071_0002288
1619 Ga0501071_0026514
1620 Ga0501072_0018639
1621 Ga0501073_0028158
1622 Ga0501073_0125554
1623 Ga0501073_0470502
1624 Ga0501074_0005429
1625 Ga0501074_0011894
1626 Ga0501074_0069539
1627 Ga0501074_0282943
1628 Ga0501076_0006642
1629 Ga0501076_0120852
1630 Ga0501076_0237138
1631 Ga0501077_0191705
1632 Ga0501079_0020984
1633 Ga0501080_0028504
1634 Ga0501080_0354473
1635 Ga0501080_0699923
1636 Ga0501081_0346596
1637 Ga0501083_0014806
1638 Ga0501083_0017533
1639 Ga0501035_0003041
1640 Ga0501035_0007230
1641 Ga0501035_0025316
1642 Ga0501035_0030788
1643 Ga0501035_0041702
1644 Ga0501035_0047649
1645 Ga0501035_0070923
1646 Ga0501035_0081236
1647 Ga0501035_0121911
1648 Ga0501044_0005278
1649 Ga0501044_0009863
1650 Ga0501044_0025423
1651 Ga0501044_0025533
1652 Ga0501044_0066953
1653 Ga0501044_0123324
1654 Ga0501044_0127116
1655 Ga0501044_0130034
1656 Ga0501044_0178256
1657 Ga0501044_0220337
1658 Ga0501044_0245730
1659 Ga0501044_0527725
1660 Ga0501045_0028265
1661 Ga0501045_0149521
1662 Ga0501045_0184371
1663 Ga0501045_0387017
1664 nmdc:mga03n38_31165_c1
1665 nmdc:mga00v17_34608_c1
1666 nmdc:mga0yw44_23172_c1
1667 nmdc:mga0yw44_40538_c1
1668 nmdc:mga0yw44_97670_c1
1669 nmdc:mga06z11_70086_c1
1670 nmdc:mga06z11_8525_c1
1671 nmdc:mga07m45_83309_c1
1672 nmdc:mga05p37_290976_c1
1673 nmdc:mga05p37_400560_c1
1674 nmdc:mga09592_40600_c1
1675 nmdc:mga06r32_107770_c1
1676 nmdc:mga08y16_16503_c1
1677 nmdc:mga0sz30_16899_c1
1678 nmdc:mga0sz30_41517_c1
1679 Ga0495601_0032169
1680 Ga0495601_0109521
1681 Ga0495612_0046640
1682 Ga0495612_0055760
1683 Ga0495619_0037073
1684 Ga0500578_0022714
1685 Ga0500643_004469
1686 Ga0500643_052095
1687 Ga0500644_0017567
1688 Ga0500644_0033356
1689 Ga0500583_0077932
1690 Ga0500566_0108555
1691 Ga0500640_004082
1692 Ga0500654_048658
1693 Ga0500553_098594
1694 Ga0500553_114327
1695 Ga0500556_0000584
1696 Ga0500560_001904
1697 Ga0500569_001296
1698 Ga0500593_000787
1699 Ga0500608_136352
1700 Ga0500628_000801
1701 Ga0500652_004677
1702 Ga0500658_0005267
1703 Ga0500561_0001903
1704 Ga0500573_0004664
1705 Ga0500573_0026286
1706 Ga0500573_0029205
1707 Ga0500573_0035807
1708 Ga0500573_0154986
1709 Ga0500579_082248
1710 Ga0500600_0014814
1711 Ga0500600_0092269
1712 Ga0500616_0009781
1713 Ga0500616_0013224
1714 Ga0500616_0039283
1715 Ga0500624_003523
1716 Ga0500627_0028076
1717 Ga0500633_0034664
1718 Ga0500634_0016886
1719 Ga0500645_000006
1720 Ga0500645_041256
1721 Ga0500656_005102
1722 Ga0500565_004323
1723 Ga0500587_002322
1724 Ga0501084_0023928
1725 Ga0501084_0088410
1726 Ga0501084_0282112
1727 Ga0501084_0304779
1728 Ga0501084_0338609
1729 Ga0501082_0009188
1730 Ga0501082_0087718
1731 Ga0501082_0431530
1732 Ga0466962_0000087
1733 Ga0466962_0010087
1734 Ga0466962_0018196
1735 2547406826
1736 2548694853
1737 2554259265
1738 2585296668
1739 2585303925
1740 2585315394
1741 2616695989
1742 2616900478
1743 2643759866
1744 2643828206
1745 2643893726
1746 2643904797
1747 2643944112
1748 2643957810
1749 2644015845
1750 2644175038
1751 2644268401
1752 2644389435
1753 2644405937
1754 2644430960
1755 2644438369
1756 2644460437
1757 2644504264
1758 2644526662
1759 2644535020
1760 2644629341
1761 2644670596
1762 2738890431
1763 2739367378
1764 2768645043
1765 2784587032
1766 2785345383
1767 2785367502
1768 2786668563
1769 2799186527
1770 2804844104
1771 2808847992
1772 2808918751
1773 2809230593
1774 2811847270
1775 2812359999
1776 2812482071
1777 2816426726
1778 2819696727
1779 2837270104
1780 2852638031
1781 2857482081
1782 2862180366
1783 2862289287
1784 2862391004
1785 2862512997
1786 2862583358
1787 2862710662
1788 2863406646
1789 2867307513
1790 2867352663
1791 2867370297
1792 2867432545
1793 2867479109
1794 2868093135
1795 2873157375
1796 2875392994
1797 2877683041
1798 2902804642
1799 2904770214
1800 2904771631
1801 2908812421
1802 2912722048
1803 2912725812
1804 2912759165
1805 2918502850
1806 2919422871
1807 2919435479
1808 2919473576
1809 2929215672
1810 2935396367
1811 2946051708
1812 2946065895
1813 2946074223
1814 2947231508
1815 2954010719
1816 2954388262
1817 2954674839
1818 2954689294
1819 2954699066
1820 2954703153
1821 2954718021
1822 2954727988
1823 2954733816
1824 2954746885
1825 2954752701
1826 2954765999
1827 2966604071
1828 2990047080
1829 2990065382
1830 2990094272
1831 2990258873
1832 2995464816
1833 2997454012
1834 3003009588
1835 3006326055
1836 3006399802
1837 3006430451
1838 3006493090
1839 3006495345
1840 8008489204
1841 8008561674
1842 8008580449
1843 8023624426
1844 8025415036
1845 8025483251
1846 8025527645
1847 8025536943
1848 8047899937
1849 8048132856
1850 8048358992
1851 8048376886
1852 8048385939
1853 8048411995
1854 8053954041
1855 8054167212
1856 8054611460
1857 8056066642
1858 8056450344
1859 8056668993
1860 8056835378

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01479

S4

S4 domain

40

87

0.96

PF01728

FtsJ

FtsJ-like methyltransferase

98

285

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5eov-assembly1.cif.gz_A c-terminal domain of the 16s/23s rrna (cytidine-2'-o)-methyltransferase tlya. 0.9425 67 270
3opn-assembly1.cif.gz_A the crystal structure of a putative hemolysin from lactococcus lactis 0.9419 62 268
5eov-assembly1.cif.gz_A c-terminal domain of the 16s/23s rrna (cytidine-2'-o)-methyltransferase tlya. 0.9336 67 270
3opn-assembly1.cif.gz_A the crystal structure of a putative hemolysin from lactococcus lactis 0.9244 62 268
2jan-assembly2.cif.gz_C tyrosyl-trna synthetase from mycobacterium tuberculosis in unliganded state 0.9228 9 49
ID Description Score Start End Superfamily
af_C0P590_106_292_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9584 72 252 3.40.50.150
af_A0A144A2N8_107_181_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9583 7 49 3.10.290.10
5eovA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9425 67 270 3.40.50.150
3opnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9408 62 268 3.40.50.150
5eovA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9336 67 270 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6B3EDS3-F1-model_v4 16S/23S rRNA (Cytidine-2'-O)-methyltransferase 1.005 188 271 GO:0008168
GO:0032259
AF-A0A6J6YGW6-F1-model_v4 Unannotated protein 0.9962 158 271 GO:0008168
GO:0032259
AF-V6U6Y3-F1-model_v4 deleted 0.9958 82 271
AF-A0A6A8MZ48-F1-model_v4 deleted 0.9953 72 271
AF-A0A1C4QRZ1-F1-model_v4 23S rRNA (Cytidine1920-2'-O)/16S rRNA (Cytidine1409-2'-O)-methyltransferase 0.9945 82 271 GO:0008168
GO:0032259

Map