F486020
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 930 | 490 | 1860 | 268 |
Family's Representative Sequence
| Representative Sequence | 3300025927|Ga0207687_10166089|Ga0207687_101660892 |
| Length | 304 |
| Sequence | MYTGGCVTRSPRLTPGRDLRCPRRRTYTGAEPNVAGVARRRLDAELVRRKLARSREHAGQLIAAGRVTVGKAVATKPATQVETAAAIVVSVDADDPDYVSRGGHKLAGALEAFVPRGLVVKGRRALDAGASTGGFTDVLLRAGAAHVVAVDVGYGQLAWSLQSDERVTVKDRTNVRELTLEAIDGEPVDLVVGDLSFIPLGLVLPALARCTGPDADLVMMVKPQFEVGKERLGSGGVVRSPQLRAEAVRGVAGKAWDLGLGVQGVTASPLPGPSGNVEYFLWLRAGAPVLDPADVDRAVAEGPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 41 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 42 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 43 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 44 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 47 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 48 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 49 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 50 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 53 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 54 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 74 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 75 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 78 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 79 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 115 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 118 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 119 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 120 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 122 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 123 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 124 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 125 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 126 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 127 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 128 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 129 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 130 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 131 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 132 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 133 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 134 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 135 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 136 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 137 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 138 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 139 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 140 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 141 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 142 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 143 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 144 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 145 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 146 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 147 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 148 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 149 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 150 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 151 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 152 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 153 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 154 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 155 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 156 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 157 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 158 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 159 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 160 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 161 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 162 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 163 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 164 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 165 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 166 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 167 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 168 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 169 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 170 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 171 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 172 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 173 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 174 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 175 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 176 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 177 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 178 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 179 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 180 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 181 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 182 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 183 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 184 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 185 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 186 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 187 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 188 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 189 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 190 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 191 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 192 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 193 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 194 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 273 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 274 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 275 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 276 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 279 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 280 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 281 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 282 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 283 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 284 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 285 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 286 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 287 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 321 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 322 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 323 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 324 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 325 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 330 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 334 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 335 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 336 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 337 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 338 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 339 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 341 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 342 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 343 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 344 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 345 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 346 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 347 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 348 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 349 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 350 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 351 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 352 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 353 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 354 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 355 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 356 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 357 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 358 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 359 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 360 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 361 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 362 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 365 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 366 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 367 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 368 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 369 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 370 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 371 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 372 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 373 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 374 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 375 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 376 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 377 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 378 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 379 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 380 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 381 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 382 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 383 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 384 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 385 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 386 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 387 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 388 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 389 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 390 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 391 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 392 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 393 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 394 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 395 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 396 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 397 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 398 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 399 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 400 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 401 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 402 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 403 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 404 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 405 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 406 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 407 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 408 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 409 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 410 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 411 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 412 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 413 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 414 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 415 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 416 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 417 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 418 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 419 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 420 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 421 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 422 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 423 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 424 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 425 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 426 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 427 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 428 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 429 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 430 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 431 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 432 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 433 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 434 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 435 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 436 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 437 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 438 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 439 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 440 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 441 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 442 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 443 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 444 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 445 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 446 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 447 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 448 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 449 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 450 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 451 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 452 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 453 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 454 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 455 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 456 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 457 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 458 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 459 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 460 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 461 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 462 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 463 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 464 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 465 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 466 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 467 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 468 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 469 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 470 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 471 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 472 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 473 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 474 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 475 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 476 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 477 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 478 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 479 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 480 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 481 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 482 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 483 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 484 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 485 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 486 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 487 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 488 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 489 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 490 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.24 |
| Metatranscriptomes | 0.22 |
| Isolates | 13.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.11 |
| Bulb | 0 |
| Endosphere | 7.42 |
| Nodule | 0.54 |
| Rhizoplane | 2.15 |
| Rhizosphere | 78.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207687_10166089 | 3300025927 | Bacteria | 1698 |
| 2 | JGI24739J22299_10022220 | 3300001989 | Bacteria | 2253 |
| 3 | rootH2_10110037 | 3300003320 | Bacteria | 2365 |
| 4 | rootL2_10058526 | 3300003322 | Bacteria | 6981 |
| 5 | JGI25160J50197_1023978 | 3300003354 | Bacteria | 1743 |
| 6 | Ga0070658_10004786 | 3300005327 | Bacteria | 11013 |
| 7 | Ga0070658_10019038 | 3300005327 | Bacteria | 5499 |
| 8 | Ga0070658_10019185 | 3300005327 | Bacteria | 5478 |
| 9 | Ga0070658_10333849 | 3300005327 | Bacteria | 1296 |
| 10 | Ga0070683_100076530 | 3300005329 | Bacteria | 3128 |
| 11 | Ga0070683_100096840 | 3300005329 | Bacteria | 2775 |
| 12 | Ga0070683_100198804 | 3300005329 | Bacteria | 1904 |
| 13 | Ga0070683_100208306 | 3300005329 | Bacteria | 1857 |
| 14 | Ga0068869_100058820 | 3300005334 | Bacteria | 2812 |
| 15 | Ga0070666_10001373 | 3300005335 | Bacteria | 14782 |
| 16 | Ga0070680_100069970 | 3300005336 | Bacteria | 2882 |
| 17 | Ga0070660_100039257 | 3300005339 | Bacteria | 3598 |
| 18 | Ga0070660_100059690 | 3300005339 | Bacteria | 2958 |
| 19 | Ga0070660_100349072 | 3300005339 | Bacteria | 1218 |
| 20 | Ga0070687_100176882 | 3300005343 | Bacteria | 1275 |
| 21 | Ga0070692_10003768 | 3300005345 | Bacteria | 6233 |
| 22 | Ga0070673_100067851 | 3300005364 | Bacteria | 2854 |
| 23 | Ga0070659_100018542 | 3300005366 | Bacteria | 5251 |
| 24 | Ga0070659_100132882 | 3300005366 | Bacteria | 2022 |
| 25 | Ga0070667_100016726 | 3300005367 | Bacteria | 6071 |
| 26 | Ga0070667_100019526 | 3300005367 | Bacteria | 5624 |
| 27 | Ga0070667_100268494 | 3300005367 | Bacteria | 1529 |
| 28 | Ga0070709_10027548 | 3300005434 | Bacteria | 3379 |
| 29 | Ga0070714_100009162 | 3300005435 | Bacteria | 7769 |
| 30 | Ga0070714_100051156 | 3300005435 | Bacteria | 3521 |
| 31 | Ga0070714_100077103 | 3300005435 | Bacteria | 2895 |
| 32 | Ga0070714_100149140 | 3300005435 | Bacteria | 2106 |
| 33 | Ga0070714_100461657 | 3300005435 | Bacteria | 1207 |
| 34 | Ga0070713_100069159 | 3300005436 | Bacteria | 2977 |
| 35 | Ga0070713_100190552 | 3300005436 | Bacteria | 1847 |
| 36 | Ga0070713_100395109 | 3300005436 | Bacteria | 1290 |
| 37 | Ga0070713_100411485 | 3300005436 | Bacteria | 1265 |
| 38 | Ga0070700_100000408 | 3300005441 | Bacteria | 21959 |
| 39 | Ga0070700_100195888 | 3300005441 | Bacteria | 1416 |
| 40 | Ga0070708_100189052 | 3300005445 | Bacteria | 1926 |
| 41 | Ga0070681_10170931 | 3300005458 | Bacteria | 2095 |
| 42 | Ga0068867_100031690 | 3300005459 | Bacteria | 3819 |
| 43 | Ga0070707_100015699 | 3300005468 | Bacteria | 7111 |
| 44 | Ga0070707_100037910 | 3300005468 | Bacteria | 4603 |
| 45 | Ga0070707_100335295 | 3300005468 | Bacteria | 1469 |
| 46 | Ga0070707_100616481 | 3300005468 | Bacteria | 1048 |
| 47 | Ga0070698_100025711 | 3300005471 | Bacteria | 6133 |
| 48 | Ga0070699_100032683 | 3300005518 | Bacteria | 4494 |
| 49 | Ga0070679_100022810 | 3300005530 | Bacteria | 6122 |
| 50 | Ga0070684_100022539 | 3300005535 | Bacteria | 5254 |
| 51 | Ga0070684_100137966 | 3300005535 | Bacteria | 2204 |
| 52 | Ga0070684_100312198 | 3300005535 | Bacteria | 1444 |
| 53 | Ga0068853_100039723 | 3300005539 | Bacteria | 4014 |
| 54 | Ga0070672_100092616 | 3300005543 | Bacteria | 2440 |
| 55 | Ga0070665_100020384 | 3300005548 | Bacteria | 6659 |
| 56 | Ga0070665_100145958 | 3300005548 | Bacteria | 2369 |
| 57 | Ga0068855_100177354 | 3300005563 | Bacteria | 2410 |
| 58 | Ga0068855_100189364 | 3300005563 | Bacteria | 2322 |
| 59 | Ga0070664_100579261 | 3300005564 | Bacteria | 1040 |
| 60 | Ga0068857_100109588 | 3300005577 | Bacteria | 2481 |
| 61 | Ga0068857_100188638 | 3300005577 | Bacteria | 1877 |
| 62 | Ga0070702_100058104 | 3300005615 | Bacteria | 2240 |
| 63 | Ga0068852_100001881 | 3300005616 | Bacteria | 14294 |
| 64 | Ga0068861_100034165 | 3300005719 | Bacteria | 3759 |
| 65 | Ga0068870_10007529 | 3300005840 | Bacteria | 4860 |
| 66 | Ga0068860_100001151 | 3300005843 | Bacteria | 28948 |
| 67 | Ga0081455_10008029 | 3300005937 | Bacteria | 11027 |
| 68 | Ga0081455_10016327 | 3300005937 | Bacteria | 7173 |
| 69 | Ga0081455_10047275 | 3300005937 | Bacteria | 3728 |
| 70 | Ga0081455_10096417 | 3300005937 | Bacteria | 2385 |
| 71 | Ga0075365_10018547 | 3300006038 | Bacteria | 4280 |
| 72 | Ga0075365_10045571 | 3300006038 | Bacteria | 2877 |
| 73 | Ga0075365_10050637 | 3300006038 | Bacteria | 2740 |
| 74 | Ga0075365_10055635 | 3300006038 | Bacteria | 2627 |
| 75 | Ga0075365_10094154 | 3300006038 | Bacteria | 2044 |
| 76 | Ga0075365_10292186 | 3300006038 | Bacteria | 1147 |
| 77 | Ga0075363_100040548 | 3300006048 | Bacteria | 2454 |
| 78 | Ga0075364_10058153 | 3300006051 | Bacteria | 2534 |
| 79 | Ga0075364_10158981 | 3300006051 | Bacteria | 1525 |
| 80 | Ga0075364_10196366 | 3300006051 | Bacteria | 1367 |
| 81 | Ga0070715_10017085 | 3300006163 | Bacteria | 2740 |
| 82 | Ga0070712_100061476 | 3300006175 | Bacteria | 2653 |
| 83 | Ga0075367_10094587 | 3300006178 | Bacteria | 1822 |
| 84 | Ga0075369_10087242 | 3300006186 | Bacteria | 1389 |
| 85 | Ga0075370_10026355 | 3300006353 | Bacteria | 3220 |
| 86 | Ga0075370_10114564 | 3300006353 | Bacteria | 1567 |
| 87 | Ga0075428_100053118 | 3300006844 | Bacteria | 4439 |
| 88 | Ga0075428_100197335 | 3300006844 | Bacteria | 2176 |
| 89 | Ga0075431_100361911 | 3300006847 | Bacteria | 1457 |
| 90 | Ga0068865_100010214 | 3300006881 | Bacteria | 5837 |
| 91 | Ga0099826_10027257 | 3300006948 | Bacteria | 4201 |
| 92 | Ga0099794_10018564 | 3300007265 | Bacteria | 3121 |
| 93 | Ga0105251_10082743 | 3300009011 | Bacteria | 1482 |
| 94 | Ga0105240_10075361 | 3300009093 | Bacteria | 4161 |
| 95 | Ga0105240_10338250 | 3300009093 | Bacteria | 1710 |
| 96 | Ga0111539_10042635 | 3300009094 | Bacteria | 5446 |
| 97 | Ga0111539_10188004 | 3300009094 | Bacteria | 2411 |
| 98 | Ga0105245_10051944 | 3300009098 | Bacteria | 3675 |
| 99 | Ga0105245_10717786 | 3300009098 | Bacteria | 1034 |
| 100 | Ga0114129_10434596 | 3300009147 | Bacteria | 1724 |
| 101 | Ga0105243_10029585 | 3300009148 | Bacteria | 4213 |
| 102 | Ga0105243_10808091 | 3300009148 | Bacteria | 925 |
| 103 | Ga0105241_10024864 | 3300009174 | Bacteria | 4450 |
| 104 | Ga0105248_10223914 | 3300009177 | Bacteria | 2117 |
| 105 | Ga0105249_10221521 | 3300009553 | Bacteria | 1862 |
| 106 | Ga0105239_10082141 | 3300010375 | Bacteria | 3548 |
| 107 | Ga0105239_10296366 | 3300010375 | Bacteria | 1821 |
| 108 | Ga0157370_10010376 | 3300013104 | Bacteria | 9821 |
| 109 | Ga0157369_10010790 | 3300013105 | Bacteria | 10402 |
| 110 | Ga0157369_10011795 | 3300013105 | Bacteria | 9924 |
| 111 | Ga0157369_10272221 | 3300013105 | Bacteria | 1764 |
| 112 | Ga0157369_10421629 | 3300013105 | Bacteria | 1383 |
| 113 | Ga0157372_10193394 | 3300013307 | Bacteria | 2356 |
| 114 | Ga0157372_10223017 | 3300013307 | Bacteria | 2185 |
| 115 | Ga0157372_10386011 | 3300013307 | Bacteria | 1632 |
| 116 | Ga0157375_10057188 | 3300013308 | Bacteria | 3854 |
| 117 | Ga0163163_10194768 | 3300014325 | Bacteria | 2075 |
| 118 | Ga0157380_10006949 | 3300014326 | Bacteria | 8009 |
| 119 | Ga0157380_10484002 | 3300014326 | Bacteria | 1198 |
| 120 | Ga0157380_10963333 | 3300014326 | Bacteria | 884 |
| 121 | Ga0182008_10002172 | 3300014497 | Bacteria | 12480 |
| 122 | Ga0157379_10319298 | 3300014968 | Bacteria | 1418 |
| 123 | Ga0157376_10443083 | 3300014969 | Bacteria | 1265 |
| 124 | Ga0182007_10000584 | 3300015262 | Bacteria | 21416 |
| 125 | Ga0183367_1010 | 3300015688 | Bacteria | 416164 |
| 126 | Ga0206354_11249830 | 3300020081 | Bacteria | 1458 |
| 127 | Ga0206353_11155499 | 3300020082 | Bacteria | 1542 |
| 128 | Ga0213876_10001814 | 3300021384 | Bacteria | 12915 |
| 129 | Ga0213876_10004136 | 3300021384 | Bacteria | 8146 |
| 130 | Ga0213875_10001014 | 3300021388 | Bacteria | 19905 |
| 131 | Ga0213875_10027455 | 3300021388 | Bacteria | 2708 |
| 132 | Ga0213875_10028241 | 3300021388 | Bacteria | 2666 |
| 133 | Ga0209758_1006719 | 3300025297 | Bacteria | 8105 |
| 134 | Ga0207426_1002890 | 3300025302 | Bacteria | 10162 |
| 135 | Ga0207426_1003860 | 3300025302 | Bacteria | 7733 |
| 136 | Ga0209051_1058879 | 3300025303 | Bacteria | 1221 |
| 137 | Ga0207713_1057810 | 3300025735 | Bacteria | 1497 |
| 138 | Ga0207680_10026739 | 3300025903 | Bacteria | 3202 |
| 139 | Ga0207647_10006160 | 3300025904 | Bacteria | 8736 |
| 140 | Ga0207647_10012813 | 3300025904 | Bacteria | 5825 |
| 141 | Ga0207647_10039485 | 3300025904 | Bacteria | 2977 |
| 142 | Ga0207685_10008631 | 3300025905 | Bacteria | 2916 |
| 143 | Ga0207685_10082175 | 3300025905 | Bacteria | 1336 |
| 144 | Ga0207699_10022900 | 3300025906 | Bacteria | 3392 |
| 145 | Ga0207699_10040860 | 3300025906 | Bacteria | 2675 |
| 146 | Ga0207643_10047075 | 3300025908 | Bacteria | 2438 |
| 147 | Ga0207705_10007324 | 3300025909 | Bacteria | 8109 |
| 148 | Ga0207705_10035356 | 3300025909 | Bacteria | 3574 |
| 149 | Ga0207705_10288721 | 3300025909 | Bacteria | 1256 |
| 150 | Ga0207695_10357678 | 3300025913 | Bacteria | 1347 |
| 151 | Ga0207693_10193332 | 3300025915 | Bacteria | 1601 |
| 152 | Ga0207663_10099838 | 3300025916 | Bacteria | 1946 |
| 153 | Ga0207660_10203661 | 3300025917 | Bacteria | 1546 |
| 154 | Ga0207657_10144888 | 3300025919 | Bacteria | 1938 |
| 155 | Ga0207657_10208208 | 3300025919 | Bacteria | 1571 |
| 156 | Ga0207652_10016037 | 3300025921 | Bacteria | 6110 |
| 157 | Ga0207652_10141399 | 3300025921 | Bacteria | 2152 |
| 158 | Ga0207646_10021681 | 3300025922 | Bacteria | 5930 |
| 159 | Ga0207646_10074354 | 3300025922 | Bacteria | 3035 |
| 160 | Ga0207646_10239154 | 3300025922 | Bacteria | 1640 |
| 161 | Ga0207646_10434920 | 3300025922 | Bacteria | 1184 |
| 162 | Ga0207687_10008234 | 3300025927 | Bacteria | 6821 |
| 163 | Ga0207700_10011641 | 3300025928 | Bacteria | 5622 |
| 164 | Ga0207700_10122430 | 3300025928 | Bacteria | 2111 |
| 165 | Ga0207700_10375610 | 3300025928 | Bacteria | 1242 |
| 166 | Ga0207664_10049622 | 3300025929 | Bacteria | 3305 |
| 167 | Ga0207664_10059283 | 3300025929 | Bacteria | 3047 |
| 168 | Ga0207664_10349323 | 3300025929 | Bacteria | 1309 |
| 169 | Ga0207690_10080716 | 3300025932 | Bacteria | 2270 |
| 170 | Ga0207669_10060794 | 3300025937 | Bacteria | 2318 |
| 171 | Ga0207691_10336576 | 3300025940 | Bacteria | 1292 |
| 172 | Ga0207711_10200278 | 3300025941 | Bacteria | 1822 |
| 173 | Ga0207689_10325500 | 3300025942 | Bacteria | 1276 |
| 174 | Ga0207661_10020817 | 3300025944 | Bacteria | 4908 |
| 175 | Ga0207661_10070518 | 3300025944 | Bacteria | 2853 |
| 176 | Ga0207661_10120688 | 3300025944 | Bacteria | 2231 |
| 177 | Ga0207667_10024866 | 3300025949 | Bacteria | 6566 |
| 178 | Ga0207667_10042854 | 3300025949 | Bacteria | 4807 |
| 179 | Ga0207667_10420420 | 3300025949 | Bacteria | 1360 |
| 180 | Ga0207640_10550581 | 3300025981 | Bacteria | 969 |
| 181 | Ga0207658_10013368 | 3300025986 | Bacteria | 5606 |
| 182 | Ga0207658_10067690 | 3300025986 | Bacteria | 2691 |
| 183 | Ga0207639_10017989 | 3300026041 | Bacteria | 5014 |
| 184 | Ga0207708_10000533 | 3300026075 | Bacteria | 29368 |
| 185 | Ga0207702_10472142 | 3300026078 | Bacteria | 1220 |
| 186 | Ga0207648_10003798 | 3300026089 | Bacteria | 15789 |
| 187 | Ga0207674_10070611 | 3300026116 | Bacteria | 3511 |
| 188 | Ga0207674_10081197 | 3300026116 | Bacteria | 3244 |
| 189 | Ga0207675_100013905 | 3300026118 | Bacteria | 7503 |
| 190 | Ga0207698_10159395 | 3300026142 | Bacteria | 1971 |
| 191 | Ga0207698_10636428 | 3300026142 | Bacteria | 1055 |
| 192 | Ga0207428_10023542 | 3300027907 | Bacteria | 5178 |
| 193 | Ga0268266_10082089 | 3300028379 | Bacteria | 2811 |
| 194 | Ga0268266_10122220 | 3300028379 | Bacteria | 2318 |
| 195 | Ga0268264_10001023 | 3300028381 | Bacteria | 28147 |
| 196 | Ga0265334_10001125 | 3300028573 | Bacteria | 13071 |
| 197 | Ga0307517_10001681 | 3300028786 | Bacteria | 36578 |
| 198 | Ga0307517_10017820 | 3300028786 | Bacteria | 9223 |
| 199 | Ga0307515_10000544 | 3300028794 | Bacteria | 88859 |
| 200 | Ga0307515_10028906 | 3300028794 | Bacteria | 9400 |
| 201 | Ga0307515_10055049 | 3300028794 | Bacteria | 5823 |
| 202 | Ga0265338_10072609 | 3300028800 | Bacteria | 2937 |
| 203 | Ga0307511_10001522 | 3300030521 | Bacteria | 24502 |
| 204 | Ga0307511_10066339 | 3300030521 | Bacteria | 2690 |
| 205 | Ga0307512_10008602 | 3300030522 | Bacteria | 9923 |
| 206 | Ga0307512_10010797 | 3300030522 | Bacteria | 8685 |
| 207 | Ga0307512_10045059 | 3300030522 | Bacteria | 3617 |
| 208 | Ga0307512_10090507 | 3300030522 | Bacteria | 2134 |
| 209 | Ga0316181_1279863 | 3300030744 | Bacteria | 1591 |
| 210 | Ga0265320_10021900 | 3300031240 | Bacteria | 3430 |
| 211 | Ga0265325_10029449 | 3300031241 | Bacteria | 2951 |
| 212 | Ga0265325_10055326 | 3300031241 | Bacteria | 2029 |
| 213 | Ga0265340_10101420 | 3300031247 | Bacteria | 1337 |
| 214 | Ga0265339_10198300 | 3300031249 | Bacteria | 991 |
| 215 | Ga0265316_10324848 | 3300031344 | Bacteria | 1117 |
| 216 | Ga0307513_10000483 | 3300031456 | Bacteria | 57234 |
| 217 | Ga0307513_10006579 | 3300031456 | Bacteria | 15174 |
| 218 | Ga0307513_10025771 | 3300031456 | Bacteria | 6801 |
| 219 | Ga0265313_10008472 | 3300031595 | Bacteria | 6822 |
| 220 | Ga0265313_10046624 | 3300031595 | Bacteria | 2103 |
| 221 | Ga0307508_10003936 | 3300031616 | Bacteria | 14738 |
| 222 | Ga0307508_10004252 | 3300031616 | Bacteria | 14054 |
| 223 | Ga0307508_10014026 | 3300031616 | Bacteria | 7312 |
| 224 | Ga0307508_10203403 | 3300031616 | Bacteria | 1581 |
| 225 | Ga0307514_10005547 | 3300031649 | Bacteria | 11208 |
| 226 | Ga0307514_10025508 | 3300031649 | Bacteria | 4781 |
| 227 | Ga0307514_10082174 | 3300031649 | Bacteria | 2378 |
| 228 | Ga0307514_10131354 | 3300031649 | Bacteria | 1723 |
| 229 | Ga0265314_10047987 | 3300031711 | Bacteria | 3001 |
| 230 | Ga0265314_10106763 | 3300031711 | Bacteria | 1788 |
| 231 | Ga0265342_10021738 | 3300031712 | Bacteria | 4091 |
| 232 | Ga0307516_10006120 | 3300031730 | Bacteria | 14184 |
| 233 | Ga0307516_10024936 | 3300031730 | Bacteria | 6100 |
| 234 | Ga0307413_10102796 | 3300031824 | Bacteria | 1893 |
| 235 | Ga0307413_10126042 | 3300031824 | Bacteria | 1744 |
| 236 | Ga0307518_10256975 | 3300031838 | Bacteria | 1104 |
| 237 | Ga0326468_10002491 | 3300031889 | Bacteria | 1537 |
| 238 | Ga0307407_10147802 | 3300031903 | Bacteria | 1524 |
| 239 | Ga0307412_10031096 | 3300031911 | Bacteria | 3368 |
| 240 | Ga0307409_100113059 | 3300031995 | Bacteria | 2281 |
| 241 | Ga0307416_100287756 | 3300032002 | Bacteria | 1625 |
| 242 | Ga0307414_10199302 | 3300032004 | Bacteria | 1627 |
| 243 | Ga0307415_100002682 | 3300032126 | Bacteria | 8886 |
| 244 | Ga0307507_10065724 | 3300033179 | Bacteria | 3332 |
| 245 | Ga0307510_10047545 | 3300033180 | Bacteria | 4595 |
| 246 | Ga0373953_0011000 | 3300035117 | Bacteria | 3163 |
| 247 | Ga0373956_0002557 | 3300035119 | Bacteria | 7396 |
| 248 | Ga0373956_0062161 | 3300035119 | Bacteria | 1692 |
| 249 | Ga0373933_0101371 | 3300035724 | Bacteria | 1786 |
| 250 | Ga0316584_0407689 | 3300036712 | Bacteria | 967 |
| 251 | Ga0395899_0094360 | 3300037312 | Bacteria | 2165 |
| 252 | Ga0395900_0081496 | 3300037418 | Bacteria | 3325 |
| 253 | Ga0395900_0326157 | 3300037418 | Bacteria | 1514 |
| 254 | Ga0395900_0420530 | 3300037418 | Bacteria | 1297 |
| 255 | Ga0395898_0002252 | 3300037466 | Bacteria | 23420 |
| 256 | Ga0395898_0625350 | 3300037466 | Bacteria | 1019 |
| 257 | Ga0436364_0335584 | 3300037853 | Bacteria | 6554 |
| 258 | Ga0436364_0788334 | 3300037853 | Bacteria | 43321 |
| 259 | Ga0395901_0092628 | 3300038443 | Bacteria | 3163 |
| 260 | Ga0400485_05857 | 3300038735 | Bacteria | 29415 |
| 261 | Ga0400486_31579 | 3300038742 | Bacteria | 26402 |
| 262 | Ga0436365_0763923 | 3300039437 | Bacteria | 12918 |
| 263 | Ga0436365_0810711 | 3300039437 | Bacteria | 50192 |
| 264 | Ga0436360_0998993 | 3300039438 | Bacteria | 1034 |
| 265 | Ga0436363_0925874 | 3300039450 | Bacteria | 1751 |
| 266 | Ga0439436_0001758 | 3300041404 | Bacteria | 6360 |
| 267 | Ga0439436_0007057 | 3300041404 | Bacteria | 3456 |
| 268 | Ga0439439_0001722 | 3300041406 | Bacteria | 4458 |
| 269 | Ga0439439_0027140 | 3300041406 | Bacteria | 1446 |
| 270 | Ga0451791_0052689 | 3300041451 | Bacteria | 1186 |
| 271 | Ga0451791_0442814 | 3300041451 | Bacteria | 1647 |
| 272 | Ga0451791_1935604 | 3300041451 | Bacteria | 2015 |
| 273 | Ga0451837_1111440 | 3300041494 | Bacteria | 3220 |
| 274 | Ga0451841_1140692 | 3300041498 | Bacteria | 2497 |
| 275 | Ga0451853_0979492 | 3300041512 | Bacteria | 2613 |
| 276 | Ga0451853_2641569 | 3300041512 | Bacteria | 2819 |
| 277 | Ga0439433_0002992 | 3300041999 | Bacteria | 3623 |
| 278 | Ga0439442_005345 | 3300042002 | Bacteria | 2570 |
| 279 | Ga0439449_0001015 | 3300042007 | Bacteria | 11061 |
| 280 | Ga0439449_0005711 | 3300042007 | Bacteria | 4755 |
| 281 | Ga0439450_020179 | 3300042008 | Bacteria | 1420 |
| 282 | Ga0439457_000138 | 3300042014 | Bacteria | 18420 |
| 283 | Ga0439457_009297 | 3300042014 | Bacteria | 2292 |
| 284 | Ga0439462_0003088 | 3300042015 | Bacteria | 3958 |
| 285 | Ga0450894_000636 | 3300042131 | Bacteria | 5873 |
| 286 | Ga0450898_000120 | 3300042134 | Bacteria | 7525 |
| 287 | Ga0450899_002728 | 3300042135 | Bacteria | 1910 |
| 288 | Ga0450903_000332 | 3300042138 | Bacteria | 10381 |
| 289 | Ga0450906_004363 | 3300042145 | Bacteria | 2966 |
| 290 | Ga0439458_0001312 | 3300042157 | Bacteria | 6282 |
| 291 | Ga0466969_0014012 | 3300044656 | Bacteria | 4218 |
| 292 | Ga0466972_0000620 | 3300044658 | Bacteria | 17311 |
| 293 | Ga0466972_0050966 | 3300044658 | Bacteria | 1997 |
| 294 | Ga0466972_0068782 | 3300044658 | Bacteria | 1691 |
| 295 | Ga0466965_0007886 | 3300044683 | Bacteria | 4910 |
| 296 | Ga0466965_0027769 | 3300044683 | Bacteria | 2747 |
| 297 | Ga0466965_0029888 | 3300044683 | Bacteria | 2653 |
| 298 | Ga0466965_0049769 | 3300044683 | Bacteria | 2077 |
| 299 | Ga0466966_0000815 | 3300044684 | Bacteria | 19873 |
| 300 | Ga0466966_0001647 | 3300044684 | Bacteria | 14406 |
| 301 | Ga0466966_0003548 | 3300044684 | Bacteria | 10299 |
| 302 | Ga0466966_0030001 | 3300044684 | Bacteria | 3535 |
| 303 | Ga0466966_0030128 | 3300044684 | Bacteria | 3525 |
| 304 | Ga0466966_0039035 | 3300044684 | Bacteria | 3058 |
| 305 | Ga0466966_0048245 | 3300044684 | Bacteria | 2712 |
| 306 | Ga0466966_0073456 | 3300044684 | Bacteria | 2139 |
| 307 | Ga0466961_0001431 | 3300044693 | Bacteria | 14807 |
| 308 | Ga0466961_0004266 | 3300044693 | Bacteria | 8947 |
| 309 | Ga0466961_0009230 | 3300044693 | Bacteria | 6280 |
| 310 | Ga0466961_0043632 | 3300044693 | Bacteria | 2871 |
| 311 | Ga0466961_0050994 | 3300044693 | Bacteria | 2643 |
| 312 | Ga0466961_0051146 | 3300044693 | Bacteria | 2639 |
| 313 | Ga0466961_0062275 | 3300044693 | Bacteria | 2371 |
| 314 | Ga0466961_0065411 | 3300044693 | Bacteria | 2310 |
| 315 | Ga0466961_0131847 | 3300044693 | Bacteria | 1566 |
| 316 | Ga0466963_0001698 | 3300044694 | Bacteria | 11997 |
| 317 | Ga0466963_0007318 | 3300044694 | Bacteria | 6579 |
| 318 | Ga0466963_0025506 | 3300044694 | Bacteria | 3771 |
| 319 | Ga0466963_0049820 | 3300044694 | Bacteria | 2771 |
| 320 | Ga0466963_0171963 | 3300044694 | Bacteria | 1510 |
| 321 | Ga0466963_0183806 | 3300044694 | Bacteria | 1460 |
| 322 | Ga0466963_0390587 | 3300044694 | Bacteria | 981 |
| 323 | Ga0466964_0030433 | 3300044706 | Bacteria | 2137 |
| 324 | Ga0466964_0109334 | 3300044706 | Bacteria | 1231 |
| 325 | Ga0466964_0194801 | 3300044706 | Bacteria | 969 |
| 326 | Ga0466971_0000897 | 3300044719 | Bacteria | 12199 |
| 327 | Ga0466971_0015814 | 3300044719 | Bacteria | 3323 |
| 328 | Ga0466968_0004021 | 3300044735 | Bacteria | 5466 |
| 329 | Ga0466970_0001486 | 3300044765 | Bacteria | 11290 |
| 330 | Ga0466970_0149535 | 3300044765 | Bacteria | 1289 |
| 331 | Ga0466957_0001849 | 3300044842 | Bacteria | 11173 |
| 332 | Ga0466957_0016812 | 3300044842 | Bacteria | 4280 |
| 333 | Ga0466957_0021597 | 3300044842 | Bacteria | 3794 |
| 334 | Ga0466957_0069496 | 3300044842 | Bacteria | 2176 |
| 335 | Ga0466957_0152532 | 3300044842 | Bacteria | 1495 |
| 336 | Ga0466957_0290934 | 3300044842 | Bacteria | 1095 |
| 337 | Ga0466960_0004137 | 3300044901 | Bacteria | 5644 |
| 338 | Ga0466960_0009255 | 3300044901 | Bacteria | 4056 |
| 339 | Ga0466960_0088865 | 3300044901 | Bacteria | 1571 |
| 340 | Ga0466960_0149123 | 3300044901 | Bacteria | 1248 |
| 341 | Ga0466959_0001421 | 3300045049 | Bacteria | 14663 |
| 342 | Ga0466959_0002793 | 3300045049 | Bacteria | 11240 |
| 343 | Ga0466959_0011379 | 3300045049 | Bacteria | 6392 |
| 344 | Ga0466959_0034281 | 3300045049 | Bacteria | 3754 |
| 345 | Ga0466959_0084467 | 3300045049 | Bacteria | 2285 |
| 346 | Ga0466958_0010504 | 3300045836 | Bacteria | 5187 |
| 347 | Ga0466958_0018578 | 3300045836 | Bacteria | 4037 |
| 348 | Ga0466958_0033024 | 3300045836 | Bacteria | 3082 |
| 349 | Ga0466958_0131409 | 3300045836 | Bacteria | 1572 |
| 350 | Ga0466967_0054662 | 3300045976 | Bacteria | 3516 |
| 351 | Ga0466967_0062443 | 3300045976 | Bacteria | 3307 |
| 352 | Ga0466967_0069668 | 3300045976 | Bacteria | 3144 |
| 353 | Ga0466967_0127589 | 3300045976 | Bacteria | 2358 |
| 354 | Ga0466967_0256855 | 3300045976 | Bacteria | 1671 |
| 355 | Ga0466967_0262771 | 3300045976 | Bacteria | 1652 |
| 356 | Ga0466967_0316826 | 3300045976 | Bacteria | 1503 |
| 357 | Ga0466967_0347701 | 3300045976 | Bacteria | 1435 |
| 358 | Ga0466967_0383463 | 3300045976 | Bacteria | 1365 |
| 359 | Ga0466967_0449138 | 3300045976 | Bacteria | 1260 |
| 360 | Ga0466967_0597962 | 3300045976 | Bacteria | 1088 |
| 361 | Ga0466967_0650837 | 3300045976 | Bacteria | 1042 |
| 362 | Ga0466967_0824962 | 3300045976 | Bacteria | 921 |
| 363 | Ga0495617_008927 | 3300046452 | Bacteria | 3448 |
| 364 | Ga0495627_024148 | 3300046453 | Bacteria | 1984 |
| 365 | Ga0495592_0007981 | 3300046454 | Bacteria | 7943 |
| 366 | Ga0495592_0144411 | 3300046454 | Bacteria | 1651 |
| 367 | Ga0495592_0171117 | 3300046454 | Bacteria | 1487 |
| 368 | Ga0495603_0001642 | 3300046455 | Bacteria | 13120 |
| 369 | Ga0495603_0011163 | 3300046455 | Bacteria | 5446 |
| 370 | Ga0495603_0018506 | 3300046455 | Bacteria | 4214 |
| 371 | Ga0495603_0033030 | 3300046455 | Bacteria | 3113 |
| 372 | Ga0495603_0092438 | 3300046455 | Bacteria | 1768 |
| 373 | Ga0495603_0149006 | 3300046455 | Bacteria | 1359 |
| 374 | Ga0495629_0000810 | 3300046459 | Bacteria | 25297 |
| 375 | Ga0495629_0005095 | 3300046459 | Bacteria | 9823 |
| 376 | Ga0495629_0014680 | 3300046459 | Bacteria | 5634 |
| 377 | Ga0495629_0016728 | 3300046459 | Bacteria | 5263 |
| 378 | Ga0495629_0024576 | 3300046459 | Bacteria | 4290 |
| 379 | Ga0495629_0071327 | 3300046459 | Bacteria | 2424 |
| 380 | Ga0495629_0134241 | 3300046459 | Bacteria | 1723 |
| 381 | Ga0495629_0150075 | 3300046459 | Bacteria | 1620 |
| 382 | Ga0495638_0011657 | 3300046460 | Bacteria | 6054 |
| 383 | Ga0495638_0058368 | 3300046460 | Bacteria | 2391 |
| 384 | Ga0495638_0070576 | 3300046460 | Bacteria | 2138 |
| 385 | Ga0495651_0002537 | 3300046462 | Bacteria | 14127 |
| 386 | Ga0495651_0013226 | 3300046462 | Bacteria | 6380 |
| 387 | Ga0495651_0064964 | 3300046462 | Bacteria | 2787 |
| 388 | Ga0495653_0003592 | 3300046463 | Bacteria | 12503 |
| 389 | Ga0495580_0038899 | 3300046472 | Bacteria | 3404 |
| 390 | Ga0495580_0042402 | 3300046472 | Bacteria | 3242 |
| 391 | Ga0495582_0015918 | 3300046473 | Bacteria | 4123 |
| 392 | Ga0495582_0286872 | 3300046473 | Bacteria | 945 |
| 393 | Ga0495605_0034430 | 3300046474 | Bacteria | 2564 |
| 394 | Ga0495639_0012535 | 3300046475 | Bacteria | 3657 |
| 395 | Ga0495662_0001049 | 3300046476 | Bacteria | 13572 |
| 396 | Ga0495662_0006569 | 3300046476 | Bacteria | 5806 |
| 397 | Ga0495662_0033085 | 3300046476 | Bacteria | 2498 |
| 398 | Ga0495664_0001113 | 3300046477 | Bacteria | 13913 |
| 399 | Ga0495664_0022664 | 3300046477 | Bacteria | 3642 |
| 400 | Ga0495664_0042173 | 3300046477 | Bacteria | 2701 |
| 401 | Ga0495585_0032678 | 3300046492 | Bacteria | 2947 |
| 402 | Ga0495585_0044945 | 3300046492 | Bacteria | 2466 |
| 403 | Ga0495594_0002465 | 3300046499 | Bacteria | 9631 |
| 404 | Ga0495594_0026197 | 3300046499 | Bacteria | 3136 |
| 405 | Ga0495594_0109317 | 3300046499 | Bacteria | 1558 |
| 406 | Ga0495594_0287056 | 3300046499 | Bacteria | 937 |
| 407 | Ga0495596_0014601 | 3300046500 | Bacteria | 3308 |
| 408 | Ga0495607_0047232 | 3300046501 | Bacteria | 2523 |
| 409 | Ga0495608_0007055 | 3300046511 | Bacteria | 7952 |
| 410 | Ga0495608_0107964 | 3300046511 | Bacteria | 1790 |
| 411 | Ga0495610_0053249 | 3300046512 | Bacteria | 1961 |
| 412 | Ga0495616_0004531 | 3300046513 | Bacteria | 8748 |
| 413 | Ga0495618_0055454 | 3300046514 | Bacteria | 2509 |
| 414 | Ga0495618_0061910 | 3300046514 | Bacteria | 2374 |
| 415 | Ga0495618_0177780 | 3300046514 | Bacteria | 1353 |
| 416 | Ga0495628_0013957 | 3300046516 | Bacteria | 6746 |
| 417 | Ga0495628_0027874 | 3300046516 | Bacteria | 4591 |
| 418 | Ga0495630_0009521 | 3300046517 | Bacteria | 6988 |
| 419 | Ga0495631_0007513 | 3300046518 | Bacteria | 5542 |
| 420 | Ga0495631_0080960 | 3300046518 | Bacteria | 1401 |
| 421 | Ga0495632_0033911 | 3300046519 | Bacteria | 2617 |
| 422 | Ga0495632_0045823 | 3300046519 | Bacteria | 2176 |
| 423 | Ga0495643_0006749 | 3300046522 | Bacteria | 7506 |
| 424 | Ga0495643_0008295 | 3300046522 | Bacteria | 6591 |
| 425 | Ga0495644_0092798 | 3300046523 | Bacteria | 1140 |
| 426 | Ga0495644_0096394 | 3300046523 | Bacteria | 1118 |
| 427 | Ga0495666_0037488 | 3300046526 | Bacteria | 2357 |
| 428 | Ga0495666_0068714 | 3300046526 | Bacteria | 1686 |
| 429 | Ga0495652_0089443 | 3300046529 | Bacteria | 2521 |
| 430 | Ga0495652_0097310 | 3300046529 | Bacteria | 2394 |
| 431 | Ga0495652_0229244 | 3300046529 | Bacteria | 1390 |
| 432 | Ga0495654_0065383 | 3300046530 | Bacteria | 1736 |
| 433 | Ga0495665_0001604 | 3300046531 | Bacteria | 12102 |
| 434 | Ga0495665_0014335 | 3300046531 | Bacteria | 4276 |
| 435 | Ga0495640_0004357 | 3300046533 | Bacteria | 11297 |
| 436 | Ga0495640_0012773 | 3300046533 | Bacteria | 6409 |
| 437 | Ga0495640_0016853 | 3300046533 | Bacteria | 5460 |
| 438 | Ga0495640_0086913 | 3300046533 | Bacteria | 2069 |
| 439 | Ga0495586_0028878 | 3300046535 | Bacteria | 2968 |
| 440 | Ga0495586_0085574 | 3300046535 | Bacteria | 1737 |
| 441 | Ga0495587_0010445 | 3300046536 | Bacteria | 5908 |
| 442 | Ga0495609_0042369 | 3300046538 | Bacteria | 2044 |
| 443 | Ga0495645_0010817 | 3300046543 | Bacteria | 6409 |
| 444 | Ga0495645_0049271 | 3300046543 | Bacteria | 3068 |
| 445 | Ga0495645_0212642 | 3300046543 | Bacteria | 1305 |
| 446 | Ga0495645_0268993 | 3300046543 | Bacteria | 1125 |
| 447 | Ga0495622_0041059 | 3300046557 | Bacteria | 2151 |
| 448 | Ga0495622_0058759 | 3300046557 | Bacteria | 1781 |
| 449 | Ga0495622_0084879 | 3300046557 | Bacteria | 1456 |
| 450 | Ga0495622_0117794 | 3300046557 | Bacteria | 1214 |
| 451 | Ga0495633_0024423 | 3300046558 | Bacteria | 2987 |
| 452 | Ga0495667_0003580 | 3300046559 | Bacteria | 10448 |
| 453 | Ga0495667_0049065 | 3300046559 | Bacteria | 2787 |
| 454 | Ga0495667_0067094 | 3300046559 | Bacteria | 2345 |
| 455 | Ga0495667_0184090 | 3300046559 | Bacteria | 1339 |
| 456 | Ga0495668_0019323 | 3300046616 | Bacteria | 3928 |
| 457 | Ga0495634_0002881 | 3300046642 | Bacteria | 14112 |
| 458 | Ga0495634_0021543 | 3300046642 | Bacteria | 4553 |
| 459 | Ga0495634_0025755 | 3300046642 | Bacteria | 4108 |
| 460 | Ga0495634_0039774 | 3300046642 | Bacteria | 3200 |
| 461 | Ga0495625_0062104 | 3300046660 | Bacteria | 2641 |
| 462 | Ga0495625_0067019 | 3300046660 | Bacteria | 2527 |
| 463 | Ga0495635_0003658 | 3300046663 | Bacteria | 10664 |
| 464 | Ga0495635_0123121 | 3300046663 | Bacteria | 1768 |
| 465 | Ga0495635_0187343 | 3300046663 | Bacteria | 1405 |
| 466 | Ga0495635_0373409 | 3300046663 | Bacteria | 949 |
| 467 | Ga0495661_0032032 | 3300046665 | Bacteria | 3327 |
| 468 | Ga0495588_0062857 | 3300046674 | Bacteria | 1924 |
| 469 | Ga0495588_0064953 | 3300046674 | Bacteria | 1893 |
| 470 | Ga0495588_0106138 | 3300046674 | Bacteria | 1478 |
| 471 | Ga0495657_0000839 | 3300046675 | Bacteria | 27194 |
| 472 | Ga0495657_0001015 | 3300046675 | Bacteria | 24750 |
| 473 | Ga0495657_0019939 | 3300046675 | Bacteria | 4831 |
| 474 | Ga0495657_0028824 | 3300046675 | Bacteria | 3899 |
| 475 | Ga0495657_0206722 | 3300046675 | Bacteria | 1194 |
| 476 | Ga0495599_0060503 | 3300046678 | Bacteria | 2368 |
| 477 | Ga0495599_0131987 | 3300046678 | Bacteria | 1551 |
| 478 | Ga0495623_0025113 | 3300046679 | Bacteria | 3839 |
| 479 | Ga0495646_0046856 | 3300046680 | Bacteria | 2634 |
| 480 | Ga0495646_0081618 | 3300046680 | Bacteria | 1883 |
| 481 | Ga0495646_0164390 | 3300046680 | Bacteria | 1226 |
| 482 | Ga0495658_0009238 | 3300046683 | Bacteria | 4903 |
| 483 | Ga0495658_0140966 | 3300046683 | Bacteria | 1474 |
| 484 | Ga0495613_0003597 | 3300046689 | Bacteria | 11612 |
| 485 | Ga0495613_0004706 | 3300046689 | Bacteria | 10241 |
| 486 | Ga0495613_0006172 | 3300046689 | Bacteria | 8973 |
| 487 | Ga0495613_0111832 | 3300046689 | Bacteria | 1967 |
| 488 | Ga0495613_0296174 | 3300046689 | Bacteria | 1120 |
| 489 | Ga0495624_0219304 | 3300046690 | Bacteria | 1153 |
| 490 | Ga0495670_0016186 | 3300046691 | Bacteria | 3666 |
| 491 | Ga0495670_0044382 | 3300046691 | Bacteria | 2219 |
| 492 | Ga0495670_0196658 | 3300046691 | Bacteria | 1067 |
| 493 | Ga0495671_0074590 | 3300046692 | Bacteria | 1664 |
| 494 | Ga0495649_0111387 | 3300046694 | Bacteria | 1451 |
| 495 | Ga0495589_0018950 | 3300046794 | Bacteria | 3529 |
| 496 | Ga0495589_0029443 | 3300046794 | Bacteria | 2768 |
| 497 | Ga0495589_0121469 | 3300046794 | Bacteria | 1257 |
| 498 | Ga0495600_0011305 | 3300046809 | Bacteria | 5561 |
| 499 | Ga0495600_0077813 | 3300046809 | Bacteria | 2166 |
| 500 | Ga0495600_0078558 | 3300046809 | Bacteria | 2155 |
| 501 | Ga0495600_0111373 | 3300046809 | Bacteria | 1782 |
| 502 | Ga0495660_0024245 | 3300046810 | Bacteria | 3456 |
| 503 | Ga0495660_0066709 | 3300046810 | Bacteria | 1918 |
| 504 | Ga0495581_0000797 | 3300047315 | Bacteria | 16733 |
| 505 | Ga0495581_0012811 | 3300047315 | Bacteria | 4857 |
| 506 | Ga0495581_0098370 | 3300047315 | Bacteria | 1699 |
| 507 | Ga0495604_0000467 | 3300047317 | Bacteria | 35655 |
| 508 | Ga0495604_0000583 | 3300047317 | Bacteria | 31859 |
| 509 | Ga0495604_0016953 | 3300047317 | Bacteria | 5825 |
| 510 | Ga0495604_0042322 | 3300047317 | Bacteria | 3570 |
| 511 | Ga0495636_0054362 | 3300047318 | Bacteria | 1682 |
| 512 | Ga0495674_0010994 | 3300047319 | Bacteria | 8549 |
| 513 | Ga0495674_0032547 | 3300047319 | Bacteria | 4729 |
| 514 | Ga0495672_0019696 | 3300047320 | Bacteria | 4445 |
| 515 | Ga0495676_0006226 | 3300047321 | Bacteria | 10978 |
| 516 | Ga0495676_0007150 | 3300047321 | Bacteria | 10244 |
| 517 | Ga0495676_0014530 | 3300047321 | Bacteria | 7044 |
| 518 | Ga0495676_0016170 | 3300047321 | Bacteria | 6628 |
| 519 | Ga0495676_0033626 | 3300047321 | Bacteria | 4315 |
| 520 | Ga0495676_0126581 | 3300047321 | Bacteria | 1850 |
| 521 | Ga0495676_0368427 | 3300047321 | Bacteria | 958 |
| 522 | Ga0495680_0022458 | 3300047322 | Bacteria | 5256 |
| 523 | Ga0495680_0065254 | 3300047322 | Bacteria | 2788 |
| 524 | Ga0495683_0029516 | 3300047323 | Bacteria | 2802 |
| 525 | Ga0495687_001974 | 3300047443 | Bacteria | 17491 |
| 526 | Ga0495687_004066 | 3300047443 | Bacteria | 10136 |
| 527 | Ga0495687_019444 | 3300047443 | Bacteria | 3333 |
| 528 | Ga0495687_035541 | 3300047443 | Bacteria | 2239 |
| 529 | Ga0495675_0031005 | 3300047444 | Bacteria | 3412 |
| 530 | Ga0495675_0032649 | 3300047444 | Bacteria | 3322 |
| 531 | Ga0495675_0037918 | 3300047444 | Bacteria | 3069 |
| 532 | Ga0495675_0056437 | 3300047444 | Bacteria | 2490 |
| 533 | Ga0495675_0062601 | 3300047444 | Bacteria | 2355 |
| 534 | Ga0495675_0117113 | 3300047444 | Bacteria | 1661 |
| 535 | Ga0495677_0111001 | 3300047445 | Bacteria | 1042 |
| 536 | Ga0495685_000165 | 3300047447 | Bacteria | 22203 |
| 537 | Ga0495685_001173 | 3300047447 | Bacteria | 8005 |
| 538 | Ga0495685_006749 | 3300047447 | Bacteria | 3771 |
| 539 | Ga0495685_010075 | 3300047447 | Bacteria | 3166 |
| 540 | Ga0495685_087924 | 3300047447 | Bacteria | 1031 |
| 541 | Ga0495681_0003307 | 3300047470 | Bacteria | 11230 |
| 542 | Ga0495681_0006276 | 3300047470 | Bacteria | 7829 |
| 543 | Ga0495681_0038156 | 3300047470 | Bacteria | 2358 |
| 544 | Ga0495681_0096751 | 3300047470 | Bacteria | 1296 |
| 545 | Ga0495684_0112458 | 3300047471 | Bacteria | 2053 |
| 546 | Ga0495684_0148622 | 3300047471 | Bacteria | 1753 |
| 547 | Ga0495686_0008778 | 3300047472 | Bacteria | 7366 |
| 548 | Ga0495686_0012594 | 3300047472 | Bacteria | 5912 |
| 549 | Ga0495593_0000836 | 3300047673 | Bacteria | 17924 |
| 550 | Ga0495593_0011347 | 3300047673 | Bacteria | 5119 |
| 551 | Ga0495593_0019076 | 3300047673 | Bacteria | 3849 |
| 552 | Ga0495602_0201889 | 3300048088 | Bacteria | 1516 |
| 553 | Ga0495614_0000600 | 3300048089 | Bacteria | 15075 |
| 554 | Ga0495614_0002419 | 3300048089 | Bacteria | 8287 |
| 555 | Ga0495626_0019334 | 3300048091 | Bacteria | 3408 |
| 556 | Ga0496102_0168276 | 3300048905 | Bacteria | 2063 |
| 557 | Ga0496104_0058873 | 3300048907 | Bacteria | 3637 |
| 558 | Ga0496104_0132755 | 3300048907 | Bacteria | 2392 |
| 559 | Ga0496104_0298658 | 3300048907 | Bacteria | 1523 |
| 560 | Ga0496105_0061261 | 3300048908 | Bacteria | 3105 |
| 561 | Ga0496106_0328835 | 3300048909 | Bacteria | 1227 |
| 562 | Ga0496108_0282213 | 3300048911 | Bacteria | 1446 |
| 563 | Ga0496108_0330790 | 3300048911 | Bacteria | 1329 |
| 564 | Ga0496109_0172385 | 3300048912 | Bacteria | 2030 |
| 565 | Ga0496110_0369383 | 3300048913 | Bacteria | 1307 |
| 566 | Ga0496110_0455942 | 3300048913 | Bacteria | 1165 |
| 567 | Ga0496112_0005256 | 3300048915 | Bacteria | 11151 |
| 568 | Ga0496112_0189547 | 3300048915 | Bacteria | 2019 |
| 569 | Ga0496113_0142022 | 3300048916 | Bacteria | 1890 |
| 570 | Ga0496114_0071696 | 3300048917 | Bacteria | 2912 |
| 571 | Ga0496115_0202645 | 3300048918 | Bacteria | 1639 |
| 572 | Ga0496118_0003704 | 3300048921 | Bacteria | 18936 |
| 573 | Ga0496119_0000960 | 3300048922 | Bacteria | 37110 |
| 574 | Ga0496124_0147615 | 3300048927 | Bacteria | 1849 |
| 575 | Ga0496125_0059564 | 3300048928 | Bacteria | 3076 |
| 576 | Ga0495678_032887 | 3300049459 | Bacteria | 2145 |
| 577 | Ga0495682_0070290 | 3300049460 | Bacteria | 1260 |
| 578 | Ga0501031_0008165 | 3300049568 | Bacteria | 6813 |
| 579 | Ga0501031_0012077 | 3300049568 | Bacteria | 5630 |
| 580 | Ga0501031_0013950 | 3300049568 | Bacteria | 5233 |
| 581 | Ga0501031_0027226 | 3300049568 | Bacteria | 3728 |
| 582 | Ga0501031_0134643 | 3300049568 | Bacteria | 1614 |
| 583 | Ga0501031_0162625 | 3300049568 | Bacteria | 1459 |
| 584 | Ga0501031_0287559 | 3300049568 | Bacteria | 1066 |
| 585 | Ga0501032_0011807 | 3300049569 | Bacteria | 6259 |
| 586 | Ga0501032_0017347 | 3300049569 | Bacteria | 5055 |
| 587 | Ga0501032_0020149 | 3300049569 | Bacteria | 4649 |
| 588 | Ga0501032_0023199 | 3300049569 | Bacteria | 4293 |
| 589 | Ga0501032_0025678 | 3300049569 | Bacteria | 4059 |
| 590 | Ga0501032_0038073 | 3300049569 | Bacteria | 3277 |
| 591 | Ga0501032_0085238 | 3300049569 | Bacteria | 2100 |
| 592 | Ga0501032_0176825 | 3300049569 | Bacteria | 1398 |
| 593 | Ga0501033_0002591 | 3300049570 | Bacteria | 15240 |
| 594 | Ga0501033_0003079 | 3300049570 | Bacteria | 13858 |
| 595 | Ga0501033_0004904 | 3300049570 | Bacteria | 10648 |
| 596 | Ga0501033_0008070 | 3300049570 | Bacteria | 8154 |
| 597 | Ga0501033_0009080 | 3300049570 | Bacteria | 7670 |
| 598 | Ga0501033_0034373 | 3300049570 | Bacteria | 3803 |
| 599 | Ga0501033_0097593 | 3300049570 | Bacteria | 2146 |
| 600 | Ga0501033_0290865 | 3300049570 | Bacteria | 1152 |
| 601 | Ga0501034_0007133 | 3300049571 | Bacteria | 11921 |
| 602 | Ga0501034_0009230 | 3300049571 | Bacteria | 10338 |
| 603 | Ga0501034_0038643 | 3300049571 | Bacteria | 4833 |
| 604 | Ga0501034_0041523 | 3300049571 | Bacteria | 4654 |
| 605 | Ga0501034_0045394 | 3300049571 | Bacteria | 4440 |
| 606 | Ga0501034_0059339 | 3300049571 | Bacteria | 3843 |
| 607 | Ga0501034_0060516 | 3300049571 | Bacteria | 3803 |
| 608 | Ga0501034_0088472 | 3300049571 | Bacteria | 3095 |
| 609 | Ga0501034_0213715 | 3300049571 | Bacteria | 1883 |
| 610 | Ga0501034_0629041 | 3300049571 | Bacteria | 977 |
| 611 | Ga0501036_0012084 | 3300049572 | Bacteria | 7156 |
| 612 | Ga0501036_0018185 | 3300049572 | Bacteria | 5886 |
| 613 | Ga0501036_0036881 | 3300049572 | Bacteria | 4136 |
| 614 | Ga0501036_0048842 | 3300049572 | Bacteria | 3582 |
| 615 | Ga0501036_0064216 | 3300049572 | Bacteria | 3107 |
| 616 | Ga0501036_0140740 | 3300049572 | Bacteria | 2036 |
| 617 | Ga0501036_0163857 | 3300049572 | Bacteria | 1874 |
| 618 | Ga0501036_0188738 | 3300049572 | Bacteria | 1734 |
| 619 | Ga0501036_0310246 | 3300049572 | Bacteria | 1319 |
| 620 | Ga0501036_0318648 | 3300049572 | Bacteria | 1299 |
| 621 | Ga0501036_0413767 | 3300049572 | Bacteria | 1124 |
| 622 | Ga0501037_0031860 | 3300049573 | Bacteria | 3892 |
| 623 | Ga0501037_0050127 | 3300049573 | Bacteria | 3056 |
| 624 | Ga0501038_0000677 | 3300049574 | Bacteria | 30374 |
| 625 | Ga0501038_0001761 | 3300049574 | Bacteria | 20128 |
| 626 | Ga0501038_0025359 | 3300049574 | Bacteria | 5286 |
| 627 | Ga0501038_0042215 | 3300049574 | Bacteria | 3972 |
| 628 | Ga0501038_0120334 | 3300049574 | Bacteria | 2166 |
| 629 | Ga0501038_0146260 | 3300049574 | Bacteria | 1929 |
| 630 | Ga0501038_0146553 | 3300049574 | Bacteria | 1927 |
| 631 | Ga0501038_0150802 | 3300049574 | Bacteria | 1895 |
| 632 | Ga0501038_0169403 | 3300049574 | Bacteria | 1769 |
| 633 | Ga0501039_0018851 | 3300049575 | Bacteria | 5296 |
| 634 | Ga0501039_0030196 | 3300049575 | Bacteria | 4177 |
| 635 | Ga0501039_0069074 | 3300049575 | Bacteria | 2743 |
| 636 | Ga0501040_0024426 | 3300049576 | Bacteria | 4056 |
| 637 | Ga0501040_0029854 | 3300049576 | Bacteria | 3680 |
| 638 | Ga0501040_0067936 | 3300049576 | Bacteria | 2457 |
| 639 | Ga0501040_0075509 | 3300049576 | Bacteria | 2329 |
| 640 | Ga0501042_0004332 | 3300049578 | Bacteria | 9048 |
| 641 | Ga0501042_0016002 | 3300049578 | Bacteria | 5145 |
| 642 | Ga0501042_0023813 | 3300049578 | Bacteria | 4288 |
| 643 | Ga0501042_0329866 | 3300049578 | Bacteria | 1103 |
| 644 | Ga0501043_0001400 | 3300049579 | Bacteria | 21063 |
| 645 | Ga0501043_0007642 | 3300049579 | Bacteria | 8565 |
| 646 | Ga0501043_0017764 | 3300049579 | Bacteria | 5577 |
| 647 | Ga0501043_0023946 | 3300049579 | Bacteria | 4790 |
| 648 | Ga0501043_0024194 | 3300049579 | Bacteria | 4765 |
| 649 | Ga0501043_0034380 | 3300049579 | Bacteria | 3986 |
| 650 | Ga0501043_0044527 | 3300049579 | Bacteria | 3489 |
| 651 | Ga0501043_0112447 | 3300049579 | Bacteria | 2138 |
| 652 | Ga0501043_0158924 | 3300049579 | Bacteria | 1766 |
| 653 | Ga0501046_0000337 | 3300049580 | Bacteria | 47376 |
| 654 | Ga0501046_0038515 | 3300049580 | Bacteria | 3835 |
| 655 | Ga0501046_0051336 | 3300049580 | Bacteria | 3254 |
| 656 | Ga0501047_0000284 | 3300049581 | Bacteria | 58364 |
| 657 | Ga0501047_0017912 | 3300049581 | Bacteria | 6788 |
| 658 | Ga0501047_0032454 | 3300049581 | Bacteria | 5040 |
| 659 | Ga0501047_0054498 | 3300049581 | Bacteria | 3868 |
| 660 | Ga0501047_0069619 | 3300049581 | Bacteria | 3388 |
| 661 | Ga0501047_0083165 | 3300049581 | Bacteria | 3076 |
| 662 | Ga0501047_0136367 | 3300049581 | Bacteria | 2334 |
| 663 | Ga0501047_0156225 | 3300049581 | Bacteria | 2154 |
| 664 | Ga0501047_0168901 | 3300049581 | Bacteria | 2057 |
| 665 | Ga0501047_0197550 | 3300049581 | Bacteria | 1873 |
| 666 | Ga0501047_0200165 | 3300049581 | Bacteria | 1858 |
| 667 | Ga0501047_0214886 | 3300049581 | Bacteria | 1780 |
| 668 | Ga0501048_0020734 | 3300049582 | Bacteria | 4817 |
| 669 | Ga0501048_0022888 | 3300049582 | Bacteria | 4568 |
| 670 | Ga0501048_0109186 | 3300049582 | Bacteria | 1953 |
| 671 | Ga0501048_0305089 | 3300049582 | Bacteria | 1133 |
| 672 | Ga0501067_0015169 | 3300049583 | Bacteria | 4264 |
| 673 | Ga0501067_0037539 | 3300049583 | Bacteria | 2691 |
| 674 | Ga0501067_0067507 | 3300049583 | Bacteria | 1980 |
| 675 | Ga0501067_0126184 | 3300049583 | Bacteria | 1424 |
| 676 | Ga0501068_0016332 | 3300049584 | Bacteria | 4277 |
| 677 | Ga0501069_0016682 | 3300049585 | Bacteria | 3946 |
| 678 | Ga0501069_0024842 | 3300049585 | Bacteria | 3271 |
| 679 | Ga0501069_0162064 | 3300049585 | Bacteria | 1288 |
| 680 | Ga0501069_0237160 | 3300049585 | Bacteria | 1063 |
| 681 | Ga0501070_0000421 | 3300049586 | Bacteria | 38478 |
| 682 | Ga0501070_0011303 | 3300049586 | Bacteria | 7542 |
| 683 | Ga0501070_0038087 | 3300049586 | Bacteria | 4012 |
| 684 | Ga0501070_0040790 | 3300049586 | Bacteria | 3870 |
| 685 | Ga0501070_0219403 | 3300049586 | Bacteria | 1560 |
| 686 | Ga0501070_0351430 | 3300049586 | Bacteria | 1196 |
| 687 | Ga0501070_0429780 | 3300049586 | Bacteria | 1066 |
| 688 | Ga0501071_0002288 | 3300049587 | Bacteria | 11550 |
| 689 | Ga0501071_0026514 | 3300049587 | Bacteria | 4069 |
| 690 | Ga0501072_0018639 | 3300049588 | Bacteria | 5349 |
| 691 | Ga0501073_0028158 | 3300049589 | Bacteria | 4014 |
| 692 | Ga0501073_0125554 | 3300049589 | Bacteria | 1779 |
| 693 | Ga0501073_0470502 | 3300049589 | Bacteria | 869 |
| 694 | Ga0501074_0005429 | 3300049590 | Bacteria | 9167 |
| 695 | Ga0501074_0011894 | 3300049590 | Bacteria | 6328 |
| 696 | Ga0501074_0069539 | 3300049590 | Bacteria | 2531 |
| 697 | Ga0501074_0282943 | 3300049590 | Bacteria | 1179 |
| 698 | Ga0501076_0006642 | 3300049592 | Bacteria | 8389 |
| 699 | Ga0501076_0120852 | 3300049592 | Bacteria | 2121 |
| 700 | Ga0501076_0237138 | 3300049592 | Bacteria | 1492 |
| 701 | Ga0501077_0191705 | 3300049593 | Bacteria | 1298 |
| 702 | Ga0501079_0020984 | 3300049741 | Bacteria | 4993 |
| 703 | Ga0501080_0028504 | 3300049742 | Bacteria | 5195 |
| 704 | Ga0501080_0354473 | 3300049742 | Bacteria | 1324 |
| 705 | Ga0501080_0699923 | 3300049742 | Bacteria | 894 |
| 706 | Ga0501081_0346596 | 3300049743 | Bacteria | 1094 |
| 707 | Ga0501083_0014806 | 3300049744 | Bacteria | 5454 |
| 708 | Ga0501083_0017533 | 3300049744 | Bacteria | 4992 |
| 709 | Ga0501035_0003041 | 3300049822 | Bacteria | 16087 |
| 710 | Ga0501035_0007230 | 3300049822 | Bacteria | 10386 |
| 711 | Ga0501035_0025316 | 3300049822 | Bacteria | 5440 |
| 712 | Ga0501035_0030788 | 3300049822 | Bacteria | 4891 |
| 713 | Ga0501035_0041702 | 3300049822 | Bacteria | 4143 |
| 714 | Ga0501035_0047649 | 3300049822 | Bacteria | 3845 |
| 715 | Ga0501035_0070923 | 3300049822 | Bacteria | 3085 |
| 716 | Ga0501035_0081236 | 3300049822 | Bacteria | 2861 |
| 717 | Ga0501035_0121911 | 3300049822 | Bacteria | 2278 |
| 718 | Ga0501044_0005278 | 3300049823 | Bacteria | 14369 |
| 719 | Ga0501044_0009863 | 3300049823 | Bacteria | 10381 |
| 720 | Ga0501044_0025423 | 3300049823 | Bacteria | 6275 |
| 721 | Ga0501044_0025533 | 3300049823 | Bacteria | 6263 |
| 722 | Ga0501044_0066953 | 3300049823 | Bacteria | 3660 |
| 723 | Ga0501044_0123324 | 3300049823 | Bacteria | 2590 |
| 724 | Ga0501044_0127116 | 3300049823 | Bacteria | 2545 |
| 725 | Ga0501044_0130034 | 3300049823 | Bacteria | 2512 |
| 726 | Ga0501044_0178256 | 3300049823 | Bacteria | 2093 |
| 727 | Ga0501044_0220337 | 3300049823 | Bacteria | 1848 |
| 728 | Ga0501044_0245730 | 3300049823 | Bacteria | 1732 |
| 729 | Ga0501044_0527725 | 3300049823 | Bacteria | 1080 |
| 730 | Ga0501045_0028265 | 3300049824 | Bacteria | 4044 |
| 731 | Ga0501045_0149521 | 3300049824 | Bacteria | 1737 |
| 732 | Ga0501045_0184371 | 3300049824 | Bacteria | 1555 |
| 733 | Ga0501045_0387017 | 3300049824 | Bacteria | 1041 |
| 734 | nmdc:mga03n38_31165_c1 | 3300050490 | Bacteria | 2248 |
| 735 | nmdc:mga00v17_34608_c1 | 3300050491 | Bacteria | 3002 |
| 736 | nmdc:mga0yw44_23172_c1 | 3300050492 | Bacteria | 3494 |
| 737 | nmdc:mga0yw44_40538_c1 | 3300050492 | Bacteria | 2767 |
| 738 | nmdc:mga0yw44_97670_c1 | 3300050492 | Bacteria | 1866 |
| 739 | nmdc:mga06z11_70086_c1 | 3300050494 | Bacteria | 1853 |
| 740 | nmdc:mga06z11_8525_c1 | 3300050494 | Bacteria | 4282 |
| 741 | nmdc:mga07m45_83309_c1 | 3300050496 | Bacteria | 1827 |
| 742 | nmdc:mga05p37_290976_c1 | 3300050507 | Bacteria | 1944 |
| 743 | nmdc:mga05p37_400560_c1 | 3300050507 | Bacteria | 1602 |
| 744 | nmdc:mga09592_40600_c1 | 3300050508 | Bacteria | 3909 |
| 745 | nmdc:mga06r32_107770_c1 | 3300050510 | Bacteria | 2738 |
| 746 | nmdc:mga08y16_16503_c1 | 3300050511 | Bacteria | 7768 |
| 747 | nmdc:mga0sz30_16899_c1 | 3300050516 | Bacteria | 2903 |
| 748 | nmdc:mga0sz30_41517_c1 | 3300050516 | Bacteria | 1934 |
| 749 | Ga0495601_0032169 | 3300053077 | Bacteria | 3264 |
| 750 | Ga0495601_0109521 | 3300053077 | Bacteria | 1788 |
| 751 | Ga0495612_0046640 | 3300053078 | Bacteria | 1775 |
| 752 | Ga0495612_0055760 | 3300053078 | Bacteria | 1630 |
| 753 | Ga0495619_0037073 | 3300053085 | Bacteria | 3176 |
| 754 | Ga0500578_0022714 | 3300053086 | Bacteria | 4028 |
| 755 | Ga0500643_004469 | 3300053087 | Bacteria | 6319 |
| 756 | Ga0500643_052095 | 3300053087 | Bacteria | 1167 |
| 757 | Ga0500644_0017567 | 3300053088 | Bacteria | 2080 |
| 758 | Ga0500644_0033356 | 3300053088 | Bacteria | 1652 |
| 759 | Ga0500583_0077932 | 3300053092 | Bacteria | 1597 |
| 760 | Ga0500566_0108555 | 3300053094 | Bacteria | 1511 |
| 761 | Ga0500640_004082 | 3300053095 | Bacteria | 5246 |
| 762 | Ga0500654_048658 | 3300053099 | Bacteria | 2311 |
| 763 | Ga0500553_098594 | 3300053101 | Bacteria | 1264 |
| 764 | Ga0500553_114327 | 3300053101 | Bacteria | 1127 |
| 765 | Ga0500556_0000584 | 3300053104 | Bacteria | 24042 |
| 766 | Ga0500560_001904 | 3300053107 | Bacteria | 3815 |
| 767 | Ga0500569_001296 | 3300053109 | Bacteria | 4671 |
| 768 | Ga0500593_000787 | 3300053117 | Bacteria | 11829 |
| 769 | Ga0500608_136352 | 3300053122 | Bacteria | 1094 |
| 770 | Ga0500628_000801 | 3300053129 | Bacteria | 5577 |
| 771 | Ga0500652_004677 | 3300053131 | Bacteria | 4255 |
| 772 | Ga0500658_0005267 | 3300053134 | Bacteria | 4810 |
| 773 | Ga0500561_0001903 | 3300053137 | Bacteria | 3449 |
| 774 | Ga0500573_0004664 | 3300053140 | Bacteria | 7255 |
| 775 | Ga0500573_0026286 | 3300053140 | Bacteria | 3346 |
| 776 | Ga0500573_0029205 | 3300053140 | Bacteria | 3179 |
| 777 | Ga0500573_0035807 | 3300053140 | Bacteria | 2865 |
| 778 | Ga0500573_0154986 | 3300053140 | Bacteria | 1251 |
| 779 | Ga0500579_082248 | 3300053143 | Bacteria | 1793 |
| 780 | Ga0500600_0014814 | 3300053149 | Bacteria | 4738 |
| 781 | Ga0500600_0092269 | 3300053149 | Bacteria | 1614 |
| 782 | Ga0500616_0009781 | 3300053153 | Bacteria | 5786 |
| 783 | Ga0500616_0013224 | 3300053153 | Bacteria | 4803 |
| 784 | Ga0500616_0039283 | 3300053153 | Bacteria | 2552 |
| 785 | Ga0500624_003523 | 3300053157 | Bacteria | 2052 |
| 786 | Ga0500627_0028076 | 3300053158 | Bacteria | 2334 |
| 787 | Ga0500633_0034664 | 3300053160 | Bacteria | 1656 |
| 788 | Ga0500634_0016886 | 3300053161 | Bacteria | 3901 |
| 789 | Ga0500645_000006 | 3300053730 | Bacteria | 276677 |
| 790 | Ga0500645_041256 | 3300053730 | Bacteria | 1363 |
| 791 | Ga0500656_005102 | 3300053732 | Bacteria | 1286 |
| 792 | Ga0500565_004323 | 3300053734 | Bacteria | 1194 |
| 793 | Ga0500587_002322 | 3300053739 | Bacteria | 2705 |
| 794 | Ga0501084_0023928 | 3300054114 | Bacteria | 5095 |
| 795 | Ga0501084_0088410 | 3300054114 | Bacteria | 2601 |
| 796 | Ga0501084_0282112 | 3300054114 | Bacteria | 1403 |
| 797 | Ga0501084_0304779 | 3300054114 | Bacteria | 1345 |
| 798 | Ga0501084_0338609 | 3300054114 | Bacteria | 1271 |
| 799 | Ga0501082_0009188 | 3300060353 | Bacteria | 8524 |
| 800 | Ga0501082_0087718 | 3300060353 | Bacteria | 2684 |
| 801 | Ga0501082_0431530 | 3300060353 | Bacteria | 1151 |
| 802 | Ga0466962_0000087 | 3300061719 | Bacteria | 37548 |
| 803 | Ga0466962_0010087 | 3300061719 | Bacteria | 4532 |
| 804 | Ga0466962_0018196 | 3300061719 | Bacteria | 3380 |
| 805 | 2547406826 | 2547132111 | Bacteria | 8013147 |
| 806 | 2548694853 | 2547132424 | Bacteria | 8348532 |
| 807 | 2554259265 | 2554235005 | Bacteria | 6457341 |
| 808 | 2585296668 | 2582581312 | Bacteria | 7308206 |
| 809 | 2585303925 | 2582581313 | Bacteria | 10042643 |
| 810 | 2585315394 | 2582581314 | Bacteria | 11452267 |
| 811 | 2616695989 | 2616644814 | Bacteria | 11555299 |
| 812 | 2616900478 | 2616644941 | Bacteria | 8510691 |
| 813 | 2643759866 | 2643221548 | Bacteria | 8053412 |
| 814 | 2643828206 | 2643221561 | Bacteria | 4984412 |
| 815 | 2643893726 | 2643221576 | Bacteria | 5214352 |
| 816 | 2643904797 | 2643221578 | Bacteria | 9213798 |
| 817 | 2643944112 | 2643221587 | Bacteria | 7586415 |
| 818 | 2643957810 | 2643221590 | Bacteria | 5214697 |
| 819 | 2644015845 | 2643221601 | Bacteria | 7493239 |
| 820 | 2644175038 | 2643221631 | Bacteria | 8168043 |
| 821 | 2644268401 | 2643221647 | Bacteria | 10741251 |
| 822 | 2644389435 | 2643221670 | Bacteria | 6497041 |
| 823 | 2644405937 | 2643221673 | Bacteria | 9196637 |
| 824 | 2644430960 | 2643221677 | Bacteria | 7584031 |
| 825 | 2644438369 | 2643221678 | Bacteria | 9540101 |
| 826 | 2644460437 | 2643221682 | Bacteria | 6743283 |
| 827 | 2644504264 | 2643221690 | Bacteria | 4654705 |
| 828 | 2644526662 | 2643221694 | Bacteria | 4392972 |
| 829 | 2644535020 | 2643221696 | Bacteria | 5431823 |
| 830 | 2644629341 | 2643221714 | Bacteria | 9015452 |
| 831 | 2644670596 | 2643221722 | Bacteria | 4247614 |
| 832 | 2738890431 | 2738541308 | Bacteria | 7020677 |
| 833 | 2739367378 | 2738543034 | Bacteria | 6084756 |
| 834 | 2768645043 | 2767802112 | Bacteria | 6465194 |
| 835 | 2784587032 | 2784132148 | Bacteria | 8627943 |
| 836 | 2785345383 | 2784746763 | Bacteria | 9783172 |
| 837 | 2785367502 | 2784746768 | Bacteria | 10036182 |
| 838 | 2786668563 | 2786546132 | Bacteria | 10419719 |
| 839 | 2799186527 | 2799112218 | Bacteria | 4315149 |
| 840 | 2804844104 | 2802429296 | Bacteria | 7227771 |
| 841 | 2808847992 | 2808606359 | Bacteria | 9866990 |
| 842 | 2808918751 | 2808606375 | Bacteria | 9466072 |
| 843 | 2809230593 | 2808606448 | Bacteria | 8656184 |
| 844 | 2811847270 | 2808606982 | Bacteria | 7791042 |
| 845 | 2812359999 | 2811994879 | Bacteria | 9313447 |
| 846 | 2812482071 | 2811994917 | Bacteria | 7761064 |
| 847 | 2816426726 | 2816332119 | Bacteria | 8120218 |
| 848 | 2819696727 | 2818991463 | Bacteria | 7948711 |
| 849 | 2837270104 | 2837268691 | Bacteria | 7850704 |
| 850 | 2852638031 | 2852635781 | Bacteria | 8251373 |
| 851 | 2857482081 | 2857481737 | Bacteria | 4761446 |
| 852 | 2862180366 | 2862178590 | Bacteria | 8583590 |
| 853 | 2862289287 | 2862281513 | Bacteria | 9621493 |
| 854 | 2862391004 | 2862382967 | Bacteria | 10317375 |
| 855 | 2862512997 | 2862507626 | Bacteria | 9425308 |
| 856 | 2862583358 | 2862574272 | Bacteria | 10567477 |
| 857 | 2862710662 | 2862705112 | Bacteria | 6563286 |
| 858 | 2863406646 | 2863404153 | Bacteria | 9672205 |
| 859 | 2867307513 | 2867302475 | Bacteria | 7087181 |
| 860 | 2867352663 | 2867346516 | Bacteria | 7608576 |
| 861 | 2867370297 | 2867369537 | Bacteria | 6501581 |
| 862 | 2867432545 | 2867428634 | Bacteria | 9590268 |
| 863 | 2867479109 | 2867475112 | Bacteria | 6909112 |
| 864 | 2868093135 | 2868088558 | Bacteria | 7609351 |
| 865 | 2873157375 | 2873151551 | Bacteria | 8625867 |
| 866 | 2875392994 | 2875391855 | Bacteria | 7600475 |
| 867 | 2877683041 | 2877676314 | Bacteria | 9512378 |
| 868 | 2902804642 | 2902799365 | Bacteria | 5419524 |
| 869 | 2904770214 | 2904765812 | Bacteria | 5369154 |
| 870 | 2904771631 | 2904770941 | Bacteria | 5580202 |
| 871 | 2908812421 | 2908811453 | Bacteria | 5478616 |
| 872 | 2912722048 | 2912715099 | Bacteria | 9460473 |
| 873 | 2912725812 | 2912723979 | Bacteria | 8557534 |
| 874 | 2912759165 | 2912757875 | Bacteria | 7940295 |
| 875 | 2918502850 | 2918501144 | Bacteria | 8668083 |
| 876 | 2919422871 | 2919420072 | Bacteria | 5390363 |
| 877 | 2919435479 | 2919432681 | Bacteria | 5390474 |
| 878 | 2919473576 | 2919468124 | Bacteria | 9133025 |
| 879 | 2929215672 | 2929212328 | Bacteria | 7708288 |
| 880 | 2935396367 | 2935390628 | Bacteria | 7043367 |
| 881 | 2946051708 | 2946045630 | Bacteria | 8527308 |
| 882 | 2946065895 | 2946064051 | Bacteria | 8957905 |
| 883 | 2946074223 | 2946072368 | Bacteria | 8999607 |
| 884 | 2947231508 | 2947224130 | Bacteria | 9938529 |
| 885 | 2954010719 | 2954002825 | Bacteria | 9173742 |
| 886 | 2954388262 | 2954380949 | Bacteria | 10050426 |
| 887 | 2954674839 | 2954673503 | Bacteria | 9685905 |
| 888 | 2954689294 | 2954682443 | Bacteria | 9862841 |
| 889 | 2954699066 | 2954691527 | Bacteria | 10720516 |
| 890 | 2954703153 | 2954701450 | Bacteria | 10834262 |
| 891 | 2954718021 | 2954711539 | Bacteria | 10867210 |
| 892 | 2954727988 | 2954721474 | Bacteria | 10456478 |
| 893 | 2954733816 | 2954731030 | Bacteria | 10243860 |
| 894 | 2954746885 | 2954740390 | Bacteria | 10229294 |
| 895 | 2954752701 | 2954749733 | Bacteria | 10366972 |
| 896 | 2954765999 | 2954759201 | Bacteria | 9358192 |
| 897 | 2966604071 | 2966598605 | Bacteria | 7676064 |
| 898 | 2990047080 | 2990044586 | Bacteria | 6603797 |
| 899 | 2990065382 | 2990059506 | Bacteria | 9321252 |
| 900 | 2990094272 | 2990088156 | Bacteria | 6657676 |
| 901 | 2990258873 | 2990256926 | Bacteria | 4252839 |
| 902 | 2995464816 | 2995463766 | Bacteria | 8577691 |
| 903 | 2997454012 | 2997451912 | Bacteria | 8492419 |
| 904 | 3003009588 | 3002998708 | Bacteria | 11715108 |
| 905 | 3006326055 | 3006321560 | Bacteria | 8247479 |
| 906 | 3006399802 | 3006393351 | Bacteria | 6615579 |
| 907 | 3006430451 | 3006425503 | Bacteria | 6491253 |
| 908 | 3006493090 | 3006486233 | Bacteria | 8157040 |
| 909 | 3006495345 | 3006493962 | Bacteria | 8825450 |
| 910 | 8008489204 | 8008485437 | Bacteria | 7198341 |
| 911 | 8008561674 | 8008558824 | Bacteria | 10610750 |
| 912 | 8008580449 | 8008574985 | Bacteria | 7815457 |
| 913 | 8023624426 | 8023623736 | Bacteria | 8593882 |
| 914 | 8025415036 | 8025413630 | Bacteria | 7014048 |
| 915 | 8025483251 | 8025478263 | Bacteria | 8209203 |
| 916 | 8025527645 | 8025524527 | Bacteria | 7197316 |
| 917 | 8025536943 | 8025530807 | Bacteria | 8495698 |
| 918 | 8047899937 | 8047893842 | Bacteria | 11723082 |
| 919 | 8048132856 | 8048127548 | Bacteria | 11053136 |
| 920 | 8048358992 | 8048356638 | Bacteria | 11044339 |
| 921 | 8048376886 | 8048369669 | Bacteria | 11666822 |
| 922 | 8048385939 | 8048379754 | Bacteria | 11877923 |
| 923 | 8048411995 | 8048406513 | Bacteria | 8936924 |
| 924 | 8053954041 | 8053945823 | Bacteria | 8962862 |
| 925 | 8054167212 | 8054160619 | Bacteria | 7783213 |
| 926 | 8054611460 | 8054609563 | Bacteria | 5170090 |
| 927 | 8056066642 | 8056060235 | Bacteria | 7259403 |
| 928 | 8056450344 | 8056447290 | Bacteria | 7680491 |
| 929 | 8056668993 | 8056667051 | Bacteria | 6953971 |
| 930 | 8056835378 | 8056829672 | Bacteria | 9045328 |
| 931 | Ga0207687_10166089 | |||
| 932 | JGI24739J22299_10022220 | |||
| 933 | rootH2_10110037 | |||
| 934 | rootL2_10058526 | |||
| 935 | JGI25160J50197_1023978 | |||
| 936 | Ga0070658_10004786 | |||
| 937 | Ga0070658_10019038 | |||
| 938 | Ga0070658_10019185 | |||
| 939 | Ga0070658_10333849 | |||
| 940 | Ga0070683_100076530 | |||
| 941 | Ga0070683_100096840 | |||
| 942 | Ga0070683_100198804 | |||
| 943 | Ga0070683_100208306 | |||
| 944 | Ga0068869_100058820 | |||
| 945 | Ga0070666_10001373 | |||
| 946 | Ga0070680_100069970 | |||
| 947 | Ga0070660_100039257 | |||
| 948 | Ga0070660_100059690 | |||
| 949 | Ga0070660_100349072 | |||
| 950 | Ga0070687_100176882 | |||
| 951 | Ga0070692_10003768 | |||
| 952 | Ga0070673_100067851 | |||
| 953 | Ga0070659_100018542 | |||
| 954 | Ga0070659_100132882 | |||
| 955 | Ga0070667_100016726 | |||
| 956 | Ga0070667_100019526 | |||
| 957 | Ga0070667_100268494 | |||
| 958 | Ga0070709_10027548 | |||
| 959 | Ga0070714_100009162 | |||
| 960 | Ga0070714_100051156 | |||
| 961 | Ga0070714_100077103 | |||
| 962 | Ga0070714_100149140 | |||
| 963 | Ga0070714_100461657 | |||
| 964 | Ga0070713_100069159 | |||
| 965 | Ga0070713_100190552 | |||
| 966 | Ga0070713_100395109 | |||
| 967 | Ga0070713_100411485 | |||
| 968 | Ga0070700_100000408 | |||
| 969 | Ga0070700_100195888 | |||
| 970 | Ga0070708_100189052 | |||
| 971 | Ga0070681_10170931 | |||
| 972 | Ga0068867_100031690 | |||
| 973 | Ga0070707_100015699 | |||
| 974 | Ga0070707_100037910 | |||
| 975 | Ga0070707_100335295 | |||
| 976 | Ga0070707_100616481 | |||
| 977 | Ga0070698_100025711 | |||
| 978 | Ga0070699_100032683 | |||
| 979 | Ga0070679_100022810 | |||
| 980 | Ga0070684_100022539 | |||
| 981 | Ga0070684_100137966 | |||
| 982 | Ga0070684_100312198 | |||
| 983 | Ga0068853_100039723 | |||
| 984 | Ga0070672_100092616 | |||
| 985 | Ga0070665_100020384 | |||
| 986 | Ga0070665_100145958 | |||
| 987 | Ga0068855_100177354 | |||
| 988 | Ga0068855_100189364 | |||
| 989 | Ga0070664_100579261 | |||
| 990 | Ga0068857_100109588 | |||
| 991 | Ga0068857_100188638 | |||
| 992 | Ga0070702_100058104 | |||
| 993 | Ga0068852_100001881 | |||
| 994 | Ga0068861_100034165 | |||
| 995 | Ga0068870_10007529 | |||
| 996 | Ga0068860_100001151 | |||
| 997 | Ga0081455_10008029 | |||
| 998 | Ga0081455_10016327 | |||
| 999 | Ga0081455_10047275 | |||
| 1000 | Ga0081455_10096417 | |||
| 1001 | Ga0075365_10018547 | |||
| 1002 | Ga0075365_10045571 | |||
| 1003 | Ga0075365_10050637 | |||
| 1004 | Ga0075365_10055635 | |||
| 1005 | Ga0075365_10094154 | |||
| 1006 | Ga0075365_10292186 | |||
| 1007 | Ga0075363_100040548 | |||
| 1008 | Ga0075364_10058153 | |||
| 1009 | Ga0075364_10158981 | |||
| 1010 | Ga0075364_10196366 | |||
| 1011 | Ga0070715_10017085 | |||
| 1012 | Ga0070712_100061476 | |||
| 1013 | Ga0075367_10094587 | |||
| 1014 | Ga0075369_10087242 | |||
| 1015 | Ga0075370_10026355 | |||
| 1016 | Ga0075370_10114564 | |||
| 1017 | Ga0075428_100053118 | |||
| 1018 | Ga0075428_100197335 | |||
| 1019 | Ga0075431_100361911 | |||
| 1020 | Ga0068865_100010214 | |||
| 1021 | Ga0099826_10027257 | |||
| 1022 | Ga0099794_10018564 | |||
| 1023 | Ga0105251_10082743 | |||
| 1024 | Ga0105240_10075361 | |||
| 1025 | Ga0105240_10338250 | |||
| 1026 | Ga0111539_10042635 | |||
| 1027 | Ga0111539_10188004 | |||
| 1028 | Ga0105245_10051944 | |||
| 1029 | Ga0105245_10717786 | |||
| 1030 | Ga0114129_10434596 | |||
| 1031 | Ga0105243_10029585 | |||
| 1032 | Ga0105243_10808091 | |||
| 1033 | Ga0105241_10024864 | |||
| 1034 | Ga0105248_10223914 | |||
| 1035 | Ga0105249_10221521 | |||
| 1036 | Ga0105239_10082141 | |||
| 1037 | Ga0105239_10296366 | |||
| 1038 | Ga0157370_10010376 | |||
| 1039 | Ga0157369_10010790 | |||
| 1040 | Ga0157369_10011795 | |||
| 1041 | Ga0157369_10272221 | |||
| 1042 | Ga0157369_10421629 | |||
| 1043 | Ga0157372_10193394 | |||
| 1044 | Ga0157372_10223017 | |||
| 1045 | Ga0157372_10386011 | |||
| 1046 | Ga0157375_10057188 | |||
| 1047 | Ga0163163_10194768 | |||
| 1048 | Ga0157380_10006949 | |||
| 1049 | Ga0157380_10484002 | |||
| 1050 | Ga0157380_10963333 | |||
| 1051 | Ga0182008_10002172 | |||
| 1052 | Ga0157379_10319298 | |||
| 1053 | Ga0157376_10443083 | |||
| 1054 | Ga0182007_10000584 | |||
| 1055 | Ga0183367_1010 | |||
| 1056 | Ga0206354_11249830 | |||
| 1057 | Ga0206353_11155499 | |||
| 1058 | Ga0213876_10001814 | |||
| 1059 | Ga0213876_10004136 | |||
| 1060 | Ga0213875_10001014 | |||
| 1061 | Ga0213875_10027455 | |||
| 1062 | Ga0213875_10028241 | |||
| 1063 | Ga0209758_1006719 | |||
| 1064 | Ga0207426_1002890 | |||
| 1065 | Ga0207426_1003860 | |||
| 1066 | Ga0209051_1058879 | |||
| 1067 | Ga0207713_1057810 | |||
| 1068 | Ga0207680_10026739 | |||
| 1069 | Ga0207647_10006160 | |||
| 1070 | Ga0207647_10012813 | |||
| 1071 | Ga0207647_10039485 | |||
| 1072 | Ga0207685_10008631 | |||
| 1073 | Ga0207685_10082175 | |||
| 1074 | Ga0207699_10022900 | |||
| 1075 | Ga0207699_10040860 | |||
| 1076 | Ga0207643_10047075 | |||
| 1077 | Ga0207705_10007324 | |||
| 1078 | Ga0207705_10035356 | |||
| 1079 | Ga0207705_10288721 | |||
| 1080 | Ga0207695_10357678 | |||
| 1081 | Ga0207693_10193332 | |||
| 1082 | Ga0207663_10099838 | |||
| 1083 | Ga0207660_10203661 | |||
| 1084 | Ga0207657_10144888 | |||
| 1085 | Ga0207657_10208208 | |||
| 1086 | Ga0207652_10016037 | |||
| 1087 | Ga0207652_10141399 | |||
| 1088 | Ga0207646_10021681 | |||
| 1089 | Ga0207646_10074354 | |||
| 1090 | Ga0207646_10239154 | |||
| 1091 | Ga0207646_10434920 | |||
| 1092 | Ga0207687_10008234 | |||
| 1093 | Ga0207700_10011641 | |||
| 1094 | Ga0207700_10122430 | |||
| 1095 | Ga0207700_10375610 | |||
| 1096 | Ga0207664_10049622 | |||
| 1097 | Ga0207664_10059283 | |||
| 1098 | Ga0207664_10349323 | |||
| 1099 | Ga0207690_10080716 | |||
| 1100 | Ga0207669_10060794 | |||
| 1101 | Ga0207691_10336576 | |||
| 1102 | Ga0207711_10200278 | |||
| 1103 | Ga0207689_10325500 | |||
| 1104 | Ga0207661_10020817 | |||
| 1105 | Ga0207661_10070518 | |||
| 1106 | Ga0207661_10120688 | |||
| 1107 | Ga0207667_10024866 | |||
| 1108 | Ga0207667_10042854 | |||
| 1109 | Ga0207667_10420420 | |||
| 1110 | Ga0207640_10550581 | |||
| 1111 | Ga0207658_10013368 | |||
| 1112 | Ga0207658_10067690 | |||
| 1113 | Ga0207639_10017989 | |||
| 1114 | Ga0207708_10000533 | |||
| 1115 | Ga0207702_10472142 | |||
| 1116 | Ga0207648_10003798 | |||
| 1117 | Ga0207674_10070611 | |||
| 1118 | Ga0207674_10081197 | |||
| 1119 | Ga0207675_100013905 | |||
| 1120 | Ga0207698_10159395 | |||
| 1121 | Ga0207698_10636428 | |||
| 1122 | Ga0207428_10023542 | |||
| 1123 | Ga0268266_10082089 | |||
| 1124 | Ga0268266_10122220 | |||
| 1125 | Ga0268264_10001023 | |||
| 1126 | Ga0265334_10001125 | |||
| 1127 | Ga0307517_10001681 | |||
| 1128 | Ga0307517_10017820 | |||
| 1129 | Ga0307515_10000544 | |||
| 1130 | Ga0307515_10028906 | |||
| 1131 | Ga0307515_10055049 | |||
| 1132 | Ga0265338_10072609 | |||
| 1133 | Ga0307511_10001522 | |||
| 1134 | Ga0307511_10066339 | |||
| 1135 | Ga0307512_10008602 | |||
| 1136 | Ga0307512_10010797 | |||
| 1137 | Ga0307512_10045059 | |||
| 1138 | Ga0307512_10090507 | |||
| 1139 | Ga0316181_1279863 | |||
| 1140 | Ga0265320_10021900 | |||
| 1141 | Ga0265325_10029449 | |||
| 1142 | Ga0265325_10055326 | |||
| 1143 | Ga0265340_10101420 | |||
| 1144 | Ga0265339_10198300 | |||
| 1145 | Ga0265316_10324848 | |||
| 1146 | Ga0307513_10000483 | |||
| 1147 | Ga0307513_10006579 | |||
| 1148 | Ga0307513_10025771 | |||
| 1149 | Ga0265313_10008472 | |||
| 1150 | Ga0265313_10046624 | |||
| 1151 | Ga0307508_10003936 | |||
| 1152 | Ga0307508_10004252 | |||
| 1153 | Ga0307508_10014026 | |||
| 1154 | Ga0307508_10203403 | |||
| 1155 | Ga0307514_10005547 | |||
| 1156 | Ga0307514_10025508 | |||
| 1157 | Ga0307514_10082174 | |||
| 1158 | Ga0307514_10131354 | |||
| 1159 | Ga0265314_10047987 | |||
| 1160 | Ga0265314_10106763 | |||
| 1161 | Ga0265342_10021738 | |||
| 1162 | Ga0307516_10006120 | |||
| 1163 | Ga0307516_10024936 | |||
| 1164 | Ga0307413_10102796 | |||
| 1165 | Ga0307413_10126042 | |||
| 1166 | Ga0307518_10256975 | |||
| 1167 | Ga0326468_10002491 | |||
| 1168 | Ga0307407_10147802 | |||
| 1169 | Ga0307412_10031096 | |||
| 1170 | Ga0307409_100113059 | |||
| 1171 | Ga0307416_100287756 | |||
| 1172 | Ga0307414_10199302 | |||
| 1173 | Ga0307415_100002682 | |||
| 1174 | Ga0307507_10065724 | |||
| 1175 | Ga0307510_10047545 | |||
| 1176 | Ga0373953_0011000 | |||
| 1177 | Ga0373956_0002557 | |||
| 1178 | Ga0373956_0062161 | |||
| 1179 | Ga0373933_0101371 | |||
| 1180 | Ga0316584_0407689 | |||
| 1181 | Ga0395899_0094360 | |||
| 1182 | Ga0395900_0081496 | |||
| 1183 | Ga0395900_0326157 | |||
| 1184 | Ga0395900_0420530 | |||
| 1185 | Ga0395898_0002252 | |||
| 1186 | Ga0395898_0625350 | |||
| 1187 | Ga0436364_0335584 | |||
| 1188 | Ga0436364_0788334 | |||
| 1189 | Ga0395901_0092628 | |||
| 1190 | Ga0400485_05857 | |||
| 1191 | Ga0400486_31579 | |||
| 1192 | Ga0436365_0763923 | |||
| 1193 | Ga0436365_0810711 | |||
| 1194 | Ga0436360_0998993 | |||
| 1195 | Ga0436363_0925874 | |||
| 1196 | Ga0439436_0001758 | |||
| 1197 | Ga0439436_0007057 | |||
| 1198 | Ga0439439_0001722 | |||
| 1199 | Ga0439439_0027140 | |||
| 1200 | Ga0451791_0052689 | |||
| 1201 | Ga0451791_0442814 | |||
| 1202 | Ga0451791_1935604 | |||
| 1203 | Ga0451837_1111440 | |||
| 1204 | Ga0451841_1140692 | |||
| 1205 | Ga0451853_0979492 | |||
| 1206 | Ga0451853_2641569 | |||
| 1207 | Ga0439433_0002992 | |||
| 1208 | Ga0439442_005345 | |||
| 1209 | Ga0439449_0001015 | |||
| 1210 | Ga0439449_0005711 | |||
| 1211 | Ga0439450_020179 | |||
| 1212 | Ga0439457_000138 | |||
| 1213 | Ga0439457_009297 | |||
| 1214 | Ga0439462_0003088 | |||
| 1215 | Ga0450894_000636 | |||
| 1216 | Ga0450898_000120 | |||
| 1217 | Ga0450899_002728 | |||
| 1218 | Ga0450903_000332 | |||
| 1219 | Ga0450906_004363 | |||
| 1220 | Ga0439458_0001312 | |||
| 1221 | Ga0466969_0014012 | |||
| 1222 | Ga0466972_0000620 | |||
| 1223 | Ga0466972_0050966 | |||
| 1224 | Ga0466972_0068782 | |||
| 1225 | Ga0466965_0007886 | |||
| 1226 | Ga0466965_0027769 | |||
| 1227 | Ga0466965_0029888 | |||
| 1228 | Ga0466965_0049769 | |||
| 1229 | Ga0466966_0000815 | |||
| 1230 | Ga0466966_0001647 | |||
| 1231 | Ga0466966_0003548 | |||
| 1232 | Ga0466966_0030001 | |||
| 1233 | Ga0466966_0030128 | |||
| 1234 | Ga0466966_0039035 | |||
| 1235 | Ga0466966_0048245 | |||
| 1236 | Ga0466966_0073456 | |||
| 1237 | Ga0466961_0001431 | |||
| 1238 | Ga0466961_0004266 | |||
| 1239 | Ga0466961_0009230 | |||
| 1240 | Ga0466961_0043632 | |||
| 1241 | Ga0466961_0050994 | |||
| 1242 | Ga0466961_0051146 | |||
| 1243 | Ga0466961_0062275 | |||
| 1244 | Ga0466961_0065411 | |||
| 1245 | Ga0466961_0131847 | |||
| 1246 | Ga0466963_0001698 | |||
| 1247 | Ga0466963_0007318 | |||
| 1248 | Ga0466963_0025506 | |||
| 1249 | Ga0466963_0049820 | |||
| 1250 | Ga0466963_0171963 | |||
| 1251 | Ga0466963_0183806 | |||
| 1252 | Ga0466963_0390587 | |||
| 1253 | Ga0466964_0030433 | |||
| 1254 | Ga0466964_0109334 | |||
| 1255 | Ga0466964_0194801 | |||
| 1256 | Ga0466971_0000897 | |||
| 1257 | Ga0466971_0015814 | |||
| 1258 | Ga0466968_0004021 | |||
| 1259 | Ga0466970_0001486 | |||
| 1260 | Ga0466970_0149535 | |||
| 1261 | Ga0466957_0001849 | |||
| 1262 | Ga0466957_0016812 | |||
| 1263 | Ga0466957_0021597 | |||
| 1264 | Ga0466957_0069496 | |||
| 1265 | Ga0466957_0152532 | |||
| 1266 | Ga0466957_0290934 | |||
| 1267 | Ga0466960_0004137 | |||
| 1268 | Ga0466960_0009255 | |||
| 1269 | Ga0466960_0088865 | |||
| 1270 | Ga0466960_0149123 | |||
| 1271 | Ga0466959_0001421 | |||
| 1272 | Ga0466959_0002793 | |||
| 1273 | Ga0466959_0011379 | |||
| 1274 | Ga0466959_0034281 | |||
| 1275 | Ga0466959_0084467 | |||
| 1276 | Ga0466958_0010504 | |||
| 1277 | Ga0466958_0018578 | |||
| 1278 | Ga0466958_0033024 | |||
| 1279 | Ga0466958_0131409 | |||
| 1280 | Ga0466967_0054662 | |||
| 1281 | Ga0466967_0062443 | |||
| 1282 | Ga0466967_0069668 | |||
| 1283 | Ga0466967_0127589 | |||
| 1284 | Ga0466967_0256855 | |||
| 1285 | Ga0466967_0262771 | |||
| 1286 | Ga0466967_0316826 | |||
| 1287 | Ga0466967_0347701 | |||
| 1288 | Ga0466967_0383463 | |||
| 1289 | Ga0466967_0449138 | |||
| 1290 | Ga0466967_0597962 | |||
| 1291 | Ga0466967_0650837 | |||
| 1292 | Ga0466967_0824962 | |||
| 1293 | Ga0495617_008927 | |||
| 1294 | Ga0495627_024148 | |||
| 1295 | Ga0495592_0007981 | |||
| 1296 | Ga0495592_0144411 | |||
| 1297 | Ga0495592_0171117 | |||
| 1298 | Ga0495603_0001642 | |||
| 1299 | Ga0495603_0011163 | |||
| 1300 | Ga0495603_0018506 | |||
| 1301 | Ga0495603_0033030 | |||
| 1302 | Ga0495603_0092438 | |||
| 1303 | Ga0495603_0149006 | |||
| 1304 | Ga0495629_0000810 | |||
| 1305 | Ga0495629_0005095 | |||
| 1306 | Ga0495629_0014680 | |||
| 1307 | Ga0495629_0016728 | |||
| 1308 | Ga0495629_0024576 | |||
| 1309 | Ga0495629_0071327 | |||
| 1310 | Ga0495629_0134241 | |||
| 1311 | Ga0495629_0150075 | |||
| 1312 | Ga0495638_0011657 | |||
| 1313 | Ga0495638_0058368 | |||
| 1314 | Ga0495638_0070576 | |||
| 1315 | Ga0495651_0002537 | |||
| 1316 | Ga0495651_0013226 | |||
| 1317 | Ga0495651_0064964 | |||
| 1318 | Ga0495653_0003592 | |||
| 1319 | Ga0495580_0038899 | |||
| 1320 | Ga0495580_0042402 | |||
| 1321 | Ga0495582_0015918 | |||
| 1322 | Ga0495582_0286872 | |||
| 1323 | Ga0495605_0034430 | |||
| 1324 | Ga0495639_0012535 | |||
| 1325 | Ga0495662_0001049 | |||
| 1326 | Ga0495662_0006569 | |||
| 1327 | Ga0495662_0033085 | |||
| 1328 | Ga0495664_0001113 | |||
| 1329 | Ga0495664_0022664 | |||
| 1330 | Ga0495664_0042173 | |||
| 1331 | Ga0495585_0032678 | |||
| 1332 | Ga0495585_0044945 | |||
| 1333 | Ga0495594_0002465 | |||
| 1334 | Ga0495594_0026197 | |||
| 1335 | Ga0495594_0109317 | |||
| 1336 | Ga0495594_0287056 | |||
| 1337 | Ga0495596_0014601 | |||
| 1338 | Ga0495607_0047232 | |||
| 1339 | Ga0495608_0007055 | |||
| 1340 | Ga0495608_0107964 | |||
| 1341 | Ga0495610_0053249 | |||
| 1342 | Ga0495616_0004531 | |||
| 1343 | Ga0495618_0055454 | |||
| 1344 | Ga0495618_0061910 | |||
| 1345 | Ga0495618_0177780 | |||
| 1346 | Ga0495628_0013957 | |||
| 1347 | Ga0495628_0027874 | |||
| 1348 | Ga0495630_0009521 | |||
| 1349 | Ga0495631_0007513 | |||
| 1350 | Ga0495631_0080960 | |||
| 1351 | Ga0495632_0033911 | |||
| 1352 | Ga0495632_0045823 | |||
| 1353 | Ga0495643_0006749 | |||
| 1354 | Ga0495643_0008295 | |||
| 1355 | Ga0495644_0092798 | |||
| 1356 | Ga0495644_0096394 | |||
| 1357 | Ga0495666_0037488 | |||
| 1358 | Ga0495666_0068714 | |||
| 1359 | Ga0495652_0089443 | |||
| 1360 | Ga0495652_0097310 | |||
| 1361 | Ga0495652_0229244 | |||
| 1362 | Ga0495654_0065383 | |||
| 1363 | Ga0495665_0001604 | |||
| 1364 | Ga0495665_0014335 | |||
| 1365 | Ga0495640_0004357 | |||
| 1366 | Ga0495640_0012773 | |||
| 1367 | Ga0495640_0016853 | |||
| 1368 | Ga0495640_0086913 | |||
| 1369 | Ga0495586_0028878 | |||
| 1370 | Ga0495586_0085574 | |||
| 1371 | Ga0495587_0010445 | |||
| 1372 | Ga0495609_0042369 | |||
| 1373 | Ga0495645_0010817 | |||
| 1374 | Ga0495645_0049271 | |||
| 1375 | Ga0495645_0212642 | |||
| 1376 | Ga0495645_0268993 | |||
| 1377 | Ga0495622_0041059 | |||
| 1378 | Ga0495622_0058759 | |||
| 1379 | Ga0495622_0084879 | |||
| 1380 | Ga0495622_0117794 | |||
| 1381 | Ga0495633_0024423 | |||
| 1382 | Ga0495667_0003580 | |||
| 1383 | Ga0495667_0049065 | |||
| 1384 | Ga0495667_0067094 | |||
| 1385 | Ga0495667_0184090 | |||
| 1386 | Ga0495668_0019323 | |||
| 1387 | Ga0495634_0002881 | |||
| 1388 | Ga0495634_0021543 | |||
| 1389 | Ga0495634_0025755 | |||
| 1390 | Ga0495634_0039774 | |||
| 1391 | Ga0495625_0062104 | |||
| 1392 | Ga0495625_0067019 | |||
| 1393 | Ga0495635_0003658 | |||
| 1394 | Ga0495635_0123121 | |||
| 1395 | Ga0495635_0187343 | |||
| 1396 | Ga0495635_0373409 | |||
| 1397 | Ga0495661_0032032 | |||
| 1398 | Ga0495588_0062857 | |||
| 1399 | Ga0495588_0064953 | |||
| 1400 | Ga0495588_0106138 | |||
| 1401 | Ga0495657_0000839 | |||
| 1402 | Ga0495657_0001015 | |||
| 1403 | Ga0495657_0019939 | |||
| 1404 | Ga0495657_0028824 | |||
| 1405 | Ga0495657_0206722 | |||
| 1406 | Ga0495599_0060503 | |||
| 1407 | Ga0495599_0131987 | |||
| 1408 | Ga0495623_0025113 | |||
| 1409 | Ga0495646_0046856 | |||
| 1410 | Ga0495646_0081618 | |||
| 1411 | Ga0495646_0164390 | |||
| 1412 | Ga0495658_0009238 | |||
| 1413 | Ga0495658_0140966 | |||
| 1414 | Ga0495613_0003597 | |||
| 1415 | Ga0495613_0004706 | |||
| 1416 | Ga0495613_0006172 | |||
| 1417 | Ga0495613_0111832 | |||
| 1418 | Ga0495613_0296174 | |||
| 1419 | Ga0495624_0219304 | |||
| 1420 | Ga0495670_0016186 | |||
| 1421 | Ga0495670_0044382 | |||
| 1422 | Ga0495670_0196658 | |||
| 1423 | Ga0495671_0074590 | |||
| 1424 | Ga0495649_0111387 | |||
| 1425 | Ga0495589_0018950 | |||
| 1426 | Ga0495589_0029443 | |||
| 1427 | Ga0495589_0121469 | |||
| 1428 | Ga0495600_0011305 | |||
| 1429 | Ga0495600_0077813 | |||
| 1430 | Ga0495600_0078558 | |||
| 1431 | Ga0495600_0111373 | |||
| 1432 | Ga0495660_0024245 | |||
| 1433 | Ga0495660_0066709 | |||
| 1434 | Ga0495581_0000797 | |||
| 1435 | Ga0495581_0012811 | |||
| 1436 | Ga0495581_0098370 | |||
| 1437 | Ga0495604_0000467 | |||
| 1438 | Ga0495604_0000583 | |||
| 1439 | Ga0495604_0016953 | |||
| 1440 | Ga0495604_0042322 | |||
| 1441 | Ga0495636_0054362 | |||
| 1442 | Ga0495674_0010994 | |||
| 1443 | Ga0495674_0032547 | |||
| 1444 | Ga0495672_0019696 | |||
| 1445 | Ga0495676_0006226 | |||
| 1446 | Ga0495676_0007150 | |||
| 1447 | Ga0495676_0014530 | |||
| 1448 | Ga0495676_0016170 | |||
| 1449 | Ga0495676_0033626 | |||
| 1450 | Ga0495676_0126581 | |||
| 1451 | Ga0495676_0368427 | |||
| 1452 | Ga0495680_0022458 | |||
| 1453 | Ga0495680_0065254 | |||
| 1454 | Ga0495683_0029516 | |||
| 1455 | Ga0495687_001974 | |||
| 1456 | Ga0495687_004066 | |||
| 1457 | Ga0495687_019444 | |||
| 1458 | Ga0495687_035541 | |||
| 1459 | Ga0495675_0031005 | |||
| 1460 | Ga0495675_0032649 | |||
| 1461 | Ga0495675_0037918 | |||
| 1462 | Ga0495675_0056437 | |||
| 1463 | Ga0495675_0062601 | |||
| 1464 | Ga0495675_0117113 | |||
| 1465 | Ga0495677_0111001 | |||
| 1466 | Ga0495685_000165 | |||
| 1467 | Ga0495685_001173 | |||
| 1468 | Ga0495685_006749 | |||
| 1469 | Ga0495685_010075 | |||
| 1470 | Ga0495685_087924 | |||
| 1471 | Ga0495681_0003307 | |||
| 1472 | Ga0495681_0006276 | |||
| 1473 | Ga0495681_0038156 | |||
| 1474 | Ga0495681_0096751 | |||
| 1475 | Ga0495684_0112458 | |||
| 1476 | Ga0495684_0148622 | |||
| 1477 | Ga0495686_0008778 | |||
| 1478 | Ga0495686_0012594 | |||
| 1479 | Ga0495593_0000836 | |||
| 1480 | Ga0495593_0011347 | |||
| 1481 | Ga0495593_0019076 | |||
| 1482 | Ga0495602_0201889 | |||
| 1483 | Ga0495614_0000600 | |||
| 1484 | Ga0495614_0002419 | |||
| 1485 | Ga0495626_0019334 | |||
| 1486 | Ga0496102_0168276 | |||
| 1487 | Ga0496104_0058873 | |||
| 1488 | Ga0496104_0132755 | |||
| 1489 | Ga0496104_0298658 | |||
| 1490 | Ga0496105_0061261 | |||
| 1491 | Ga0496106_0328835 | |||
| 1492 | Ga0496108_0282213 | |||
| 1493 | Ga0496108_0330790 | |||
| 1494 | Ga0496109_0172385 | |||
| 1495 | Ga0496110_0369383 | |||
| 1496 | Ga0496110_0455942 | |||
| 1497 | Ga0496112_0005256 | |||
| 1498 | Ga0496112_0189547 | |||
| 1499 | Ga0496113_0142022 | |||
| 1500 | Ga0496114_0071696 | |||
| 1501 | Ga0496115_0202645 | |||
| 1502 | Ga0496118_0003704 | |||
| 1503 | Ga0496119_0000960 | |||
| 1504 | Ga0496124_0147615 | |||
| 1505 | Ga0496125_0059564 | |||
| 1506 | Ga0495678_032887 | |||
| 1507 | Ga0495682_0070290 | |||
| 1508 | Ga0501031_0008165 | |||
| 1509 | Ga0501031_0012077 | |||
| 1510 | Ga0501031_0013950 | |||
| 1511 | Ga0501031_0027226 | |||
| 1512 | Ga0501031_0134643 | |||
| 1513 | Ga0501031_0162625 | |||
| 1514 | Ga0501031_0287559 | |||
| 1515 | Ga0501032_0011807 | |||
| 1516 | Ga0501032_0017347 | |||
| 1517 | Ga0501032_0020149 | |||
| 1518 | Ga0501032_0023199 | |||
| 1519 | Ga0501032_0025678 | |||
| 1520 | Ga0501032_0038073 | |||
| 1521 | Ga0501032_0085238 | |||
| 1522 | Ga0501032_0176825 | |||
| 1523 | Ga0501033_0002591 | |||
| 1524 | Ga0501033_0003079 | |||
| 1525 | Ga0501033_0004904 | |||
| 1526 | Ga0501033_0008070 | |||
| 1527 | Ga0501033_0009080 | |||
| 1528 | Ga0501033_0034373 | |||
| 1529 | Ga0501033_0097593 | |||
| 1530 | Ga0501033_0290865 | |||
| 1531 | Ga0501034_0007133 | |||
| 1532 | Ga0501034_0009230 | |||
| 1533 | Ga0501034_0038643 | |||
| 1534 | Ga0501034_0041523 | |||
| 1535 | Ga0501034_0045394 | |||
| 1536 | Ga0501034_0059339 | |||
| 1537 | Ga0501034_0060516 | |||
| 1538 | Ga0501034_0088472 | |||
| 1539 | Ga0501034_0213715 | |||
| 1540 | Ga0501034_0629041 | |||
| 1541 | Ga0501036_0012084 | |||
| 1542 | Ga0501036_0018185 | |||
| 1543 | Ga0501036_0036881 | |||
| 1544 | Ga0501036_0048842 | |||
| 1545 | Ga0501036_0064216 | |||
| 1546 | Ga0501036_0140740 | |||
| 1547 | Ga0501036_0163857 | |||
| 1548 | Ga0501036_0188738 | |||
| 1549 | Ga0501036_0310246 | |||
| 1550 | Ga0501036_0318648 | |||
| 1551 | Ga0501036_0413767 | |||
| 1552 | Ga0501037_0031860 | |||
| 1553 | Ga0501037_0050127 | |||
| 1554 | Ga0501038_0000677 | |||
| 1555 | Ga0501038_0001761 | |||
| 1556 | Ga0501038_0025359 | |||
| 1557 | Ga0501038_0042215 | |||
| 1558 | Ga0501038_0120334 | |||
| 1559 | Ga0501038_0146260 | |||
| 1560 | Ga0501038_0146553 | |||
| 1561 | Ga0501038_0150802 | |||
| 1562 | Ga0501038_0169403 | |||
| 1563 | Ga0501039_0018851 | |||
| 1564 | Ga0501039_0030196 | |||
| 1565 | Ga0501039_0069074 | |||
| 1566 | Ga0501040_0024426 | |||
| 1567 | Ga0501040_0029854 | |||
| 1568 | Ga0501040_0067936 | |||
| 1569 | Ga0501040_0075509 | |||
| 1570 | Ga0501042_0004332 | |||
| 1571 | Ga0501042_0016002 | |||
| 1572 | Ga0501042_0023813 | |||
| 1573 | Ga0501042_0329866 | |||
| 1574 | Ga0501043_0001400 | |||
| 1575 | Ga0501043_0007642 | |||
| 1576 | Ga0501043_0017764 | |||
| 1577 | Ga0501043_0023946 | |||
| 1578 | Ga0501043_0024194 | |||
| 1579 | Ga0501043_0034380 | |||
| 1580 | Ga0501043_0044527 | |||
| 1581 | Ga0501043_0112447 | |||
| 1582 | Ga0501043_0158924 | |||
| 1583 | Ga0501046_0000337 | |||
| 1584 | Ga0501046_0038515 | |||
| 1585 | Ga0501046_0051336 | |||
| 1586 | Ga0501047_0000284 | |||
| 1587 | Ga0501047_0017912 | |||
| 1588 | Ga0501047_0032454 | |||
| 1589 | Ga0501047_0054498 | |||
| 1590 | Ga0501047_0069619 | |||
| 1591 | Ga0501047_0083165 | |||
| 1592 | Ga0501047_0136367 | |||
| 1593 | Ga0501047_0156225 | |||
| 1594 | Ga0501047_0168901 | |||
| 1595 | Ga0501047_0197550 | |||
| 1596 | Ga0501047_0200165 | |||
| 1597 | Ga0501047_0214886 | |||
| 1598 | Ga0501048_0020734 | |||
| 1599 | Ga0501048_0022888 | |||
| 1600 | Ga0501048_0109186 | |||
| 1601 | Ga0501048_0305089 | |||
| 1602 | Ga0501067_0015169 | |||
| 1603 | Ga0501067_0037539 | |||
| 1604 | Ga0501067_0067507 | |||
| 1605 | Ga0501067_0126184 | |||
| 1606 | Ga0501068_0016332 | |||
| 1607 | Ga0501069_0016682 | |||
| 1608 | Ga0501069_0024842 | |||
| 1609 | Ga0501069_0162064 | |||
| 1610 | Ga0501069_0237160 | |||
| 1611 | Ga0501070_0000421 | |||
| 1612 | Ga0501070_0011303 | |||
| 1613 | Ga0501070_0038087 | |||
| 1614 | Ga0501070_0040790 | |||
| 1615 | Ga0501070_0219403 | |||
| 1616 | Ga0501070_0351430 | |||
| 1617 | Ga0501070_0429780 | |||
| 1618 | Ga0501071_0002288 | |||
| 1619 | Ga0501071_0026514 | |||
| 1620 | Ga0501072_0018639 | |||
| 1621 | Ga0501073_0028158 | |||
| 1622 | Ga0501073_0125554 | |||
| 1623 | Ga0501073_0470502 | |||
| 1624 | Ga0501074_0005429 | |||
| 1625 | Ga0501074_0011894 | |||
| 1626 | Ga0501074_0069539 | |||
| 1627 | Ga0501074_0282943 | |||
| 1628 | Ga0501076_0006642 | |||
| 1629 | Ga0501076_0120852 | |||
| 1630 | Ga0501076_0237138 | |||
| 1631 | Ga0501077_0191705 | |||
| 1632 | Ga0501079_0020984 | |||
| 1633 | Ga0501080_0028504 | |||
| 1634 | Ga0501080_0354473 | |||
| 1635 | Ga0501080_0699923 | |||
| 1636 | Ga0501081_0346596 | |||
| 1637 | Ga0501083_0014806 | |||
| 1638 | Ga0501083_0017533 | |||
| 1639 | Ga0501035_0003041 | |||
| 1640 | Ga0501035_0007230 | |||
| 1641 | Ga0501035_0025316 | |||
| 1642 | Ga0501035_0030788 | |||
| 1643 | Ga0501035_0041702 | |||
| 1644 | Ga0501035_0047649 | |||
| 1645 | Ga0501035_0070923 | |||
| 1646 | Ga0501035_0081236 | |||
| 1647 | Ga0501035_0121911 | |||
| 1648 | Ga0501044_0005278 | |||
| 1649 | Ga0501044_0009863 | |||
| 1650 | Ga0501044_0025423 | |||
| 1651 | Ga0501044_0025533 | |||
| 1652 | Ga0501044_0066953 | |||
| 1653 | Ga0501044_0123324 | |||
| 1654 | Ga0501044_0127116 | |||
| 1655 | Ga0501044_0130034 | |||
| 1656 | Ga0501044_0178256 | |||
| 1657 | Ga0501044_0220337 | |||
| 1658 | Ga0501044_0245730 | |||
| 1659 | Ga0501044_0527725 | |||
| 1660 | Ga0501045_0028265 | |||
| 1661 | Ga0501045_0149521 | |||
| 1662 | Ga0501045_0184371 | |||
| 1663 | Ga0501045_0387017 | |||
| 1664 | nmdc:mga03n38_31165_c1 | |||
| 1665 | nmdc:mga00v17_34608_c1 | |||
| 1666 | nmdc:mga0yw44_23172_c1 | |||
| 1667 | nmdc:mga0yw44_40538_c1 | |||
| 1668 | nmdc:mga0yw44_97670_c1 | |||
| 1669 | nmdc:mga06z11_70086_c1 | |||
| 1670 | nmdc:mga06z11_8525_c1 | |||
| 1671 | nmdc:mga07m45_83309_c1 | |||
| 1672 | nmdc:mga05p37_290976_c1 | |||
| 1673 | nmdc:mga05p37_400560_c1 | |||
| 1674 | nmdc:mga09592_40600_c1 | |||
| 1675 | nmdc:mga06r32_107770_c1 | |||
| 1676 | nmdc:mga08y16_16503_c1 | |||
| 1677 | nmdc:mga0sz30_16899_c1 | |||
| 1678 | nmdc:mga0sz30_41517_c1 | |||
| 1679 | Ga0495601_0032169 | |||
| 1680 | Ga0495601_0109521 | |||
| 1681 | Ga0495612_0046640 | |||
| 1682 | Ga0495612_0055760 | |||
| 1683 | Ga0495619_0037073 | |||
| 1684 | Ga0500578_0022714 | |||
| 1685 | Ga0500643_004469 | |||
| 1686 | Ga0500643_052095 | |||
| 1687 | Ga0500644_0017567 | |||
| 1688 | Ga0500644_0033356 | |||
| 1689 | Ga0500583_0077932 | |||
| 1690 | Ga0500566_0108555 | |||
| 1691 | Ga0500640_004082 | |||
| 1692 | Ga0500654_048658 | |||
| 1693 | Ga0500553_098594 | |||
| 1694 | Ga0500553_114327 | |||
| 1695 | Ga0500556_0000584 | |||
| 1696 | Ga0500560_001904 | |||
| 1697 | Ga0500569_001296 | |||
| 1698 | Ga0500593_000787 | |||
| 1699 | Ga0500608_136352 | |||
| 1700 | Ga0500628_000801 | |||
| 1701 | Ga0500652_004677 | |||
| 1702 | Ga0500658_0005267 | |||
| 1703 | Ga0500561_0001903 | |||
| 1704 | Ga0500573_0004664 | |||
| 1705 | Ga0500573_0026286 | |||
| 1706 | Ga0500573_0029205 | |||
| 1707 | Ga0500573_0035807 | |||
| 1708 | Ga0500573_0154986 | |||
| 1709 | Ga0500579_082248 | |||
| 1710 | Ga0500600_0014814 | |||
| 1711 | Ga0500600_0092269 | |||
| 1712 | Ga0500616_0009781 | |||
| 1713 | Ga0500616_0013224 | |||
| 1714 | Ga0500616_0039283 | |||
| 1715 | Ga0500624_003523 | |||
| 1716 | Ga0500627_0028076 | |||
| 1717 | Ga0500633_0034664 | |||
| 1718 | Ga0500634_0016886 | |||
| 1719 | Ga0500645_000006 | |||
| 1720 | Ga0500645_041256 | |||
| 1721 | Ga0500656_005102 | |||
| 1722 | Ga0500565_004323 | |||
| 1723 | Ga0500587_002322 | |||
| 1724 | Ga0501084_0023928 | |||
| 1725 | Ga0501084_0088410 | |||
| 1726 | Ga0501084_0282112 | |||
| 1727 | Ga0501084_0304779 | |||
| 1728 | Ga0501084_0338609 | |||
| 1729 | Ga0501082_0009188 | |||
| 1730 | Ga0501082_0087718 | |||
| 1731 | Ga0501082_0431530 | |||
| 1732 | Ga0466962_0000087 | |||
| 1733 | Ga0466962_0010087 | |||
| 1734 | Ga0466962_0018196 | |||
| 1735 | 2547406826 | |||
| 1736 | 2548694853 | |||
| 1737 | 2554259265 | |||
| 1738 | 2585296668 | |||
| 1739 | 2585303925 | |||
| 1740 | 2585315394 | |||
| 1741 | 2616695989 | |||
| 1742 | 2616900478 | |||
| 1743 | 2643759866 | |||
| 1744 | 2643828206 | |||
| 1745 | 2643893726 | |||
| 1746 | 2643904797 | |||
| 1747 | 2643944112 | |||
| 1748 | 2643957810 | |||
| 1749 | 2644015845 | |||
| 1750 | 2644175038 | |||
| 1751 | 2644268401 | |||
| 1752 | 2644389435 | |||
| 1753 | 2644405937 | |||
| 1754 | 2644430960 | |||
| 1755 | 2644438369 | |||
| 1756 | 2644460437 | |||
| 1757 | 2644504264 | |||
| 1758 | 2644526662 | |||
| 1759 | 2644535020 | |||
| 1760 | 2644629341 | |||
| 1761 | 2644670596 | |||
| 1762 | 2738890431 | |||
| 1763 | 2739367378 | |||
| 1764 | 2768645043 | |||
| 1765 | 2784587032 | |||
| 1766 | 2785345383 | |||
| 1767 | 2785367502 | |||
| 1768 | 2786668563 | |||
| 1769 | 2799186527 | |||
| 1770 | 2804844104 | |||
| 1771 | 2808847992 | |||
| 1772 | 2808918751 | |||
| 1773 | 2809230593 | |||
| 1774 | 2811847270 | |||
| 1775 | 2812359999 | |||
| 1776 | 2812482071 | |||
| 1777 | 2816426726 | |||
| 1778 | 2819696727 | |||
| 1779 | 2837270104 | |||
| 1780 | 2852638031 | |||
| 1781 | 2857482081 | |||
| 1782 | 2862180366 | |||
| 1783 | 2862289287 | |||
| 1784 | 2862391004 | |||
| 1785 | 2862512997 | |||
| 1786 | 2862583358 | |||
| 1787 | 2862710662 | |||
| 1788 | 2863406646 | |||
| 1789 | 2867307513 | |||
| 1790 | 2867352663 | |||
| 1791 | 2867370297 | |||
| 1792 | 2867432545 | |||
| 1793 | 2867479109 | |||
| 1794 | 2868093135 | |||
| 1795 | 2873157375 | |||
| 1796 | 2875392994 | |||
| 1797 | 2877683041 | |||
| 1798 | 2902804642 | |||
| 1799 | 2904770214 | |||
| 1800 | 2904771631 | |||
| 1801 | 2908812421 | |||
| 1802 | 2912722048 | |||
| 1803 | 2912725812 | |||
| 1804 | 2912759165 | |||
| 1805 | 2918502850 | |||
| 1806 | 2919422871 | |||
| 1807 | 2919435479 | |||
| 1808 | 2919473576 | |||
| 1809 | 2929215672 | |||
| 1810 | 2935396367 | |||
| 1811 | 2946051708 | |||
| 1812 | 2946065895 | |||
| 1813 | 2946074223 | |||
| 1814 | 2947231508 | |||
| 1815 | 2954010719 | |||
| 1816 | 2954388262 | |||
| 1817 | 2954674839 | |||
| 1818 | 2954689294 | |||
| 1819 | 2954699066 | |||
| 1820 | 2954703153 | |||
| 1821 | 2954718021 | |||
| 1822 | 2954727988 | |||
| 1823 | 2954733816 | |||
| 1824 | 2954746885 | |||
| 1825 | 2954752701 | |||
| 1826 | 2954765999 | |||
| 1827 | 2966604071 | |||
| 1828 | 2990047080 | |||
| 1829 | 2990065382 | |||
| 1830 | 2990094272 | |||
| 1831 | 2990258873 | |||
| 1832 | 2995464816 | |||
| 1833 | 2997454012 | |||
| 1834 | 3003009588 | |||
| 1835 | 3006326055 | |||
| 1836 | 3006399802 | |||
| 1837 | 3006430451 | |||
| 1838 | 3006493090 | |||
| 1839 | 3006495345 | |||
| 1840 | 8008489204 | |||
| 1841 | 8008561674 | |||
| 1842 | 8008580449 | |||
| 1843 | 8023624426 | |||
| 1844 | 8025415036 | |||
| 1845 | 8025483251 | |||
| 1846 | 8025527645 | |||
| 1847 | 8025536943 | |||
| 1848 | 8047899937 | |||
| 1849 | 8048132856 | |||
| 1850 | 8048358992 | |||
| 1851 | 8048376886 | |||
| 1852 | 8048385939 | |||
| 1853 | 8048411995 | |||
| 1854 | 8053954041 | |||
| 1855 | 8054167212 | |||
| 1856 | 8054611460 | |||
| 1857 | 8056066642 | |||
| 1858 | 8056450344 | |||
| 1859 | 8056668993 | |||
| 1860 | 8056835378 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5eov-assembly1.cif.gz_A | c-terminal domain of the 16s/23s rrna (cytidine-2'-o)-methyltransferase tlya. | 0.9425 | 67 | 270 |
| 3opn-assembly1.cif.gz_A | the crystal structure of a putative hemolysin from lactococcus lactis | 0.9419 | 62 | 268 |
| 5eov-assembly1.cif.gz_A | c-terminal domain of the 16s/23s rrna (cytidine-2'-o)-methyltransferase tlya. | 0.9336 | 67 | 270 |
| 3opn-assembly1.cif.gz_A | the crystal structure of a putative hemolysin from lactococcus lactis | 0.9244 | 62 | 268 |
| 2jan-assembly2.cif.gz_C | tyrosyl-trna synthetase from mycobacterium tuberculosis in unliganded state | 0.9228 | 9 | 49 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C0P590_106_292_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9584 | 72 | 252 | 3.40.50.150 |
| af_A0A144A2N8_107_181_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9583 | 7 | 49 | 3.10.290.10 |
| 5eovA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9425 | 67 | 270 | 3.40.50.150 |
| 3opnA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9408 | 62 | 268 | 3.40.50.150 |
| 5eovA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9336 | 67 | 270 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B3EDS3-F1-model_v4 | 16S/23S rRNA (Cytidine-2'-O)-methyltransferase | 1.005 | 188 | 271 |
GO:0008168
GO:0032259 |
| AF-A0A6J6YGW6-F1-model_v4 | Unannotated protein | 0.9962 | 158 | 271 |
GO:0008168
GO:0032259 |
| AF-V6U6Y3-F1-model_v4 | deleted | 0.9958 | 82 | 271 |
|
| AF-A0A6A8MZ48-F1-model_v4 | deleted | 0.9953 | 72 | 271 |
|
| AF-A0A1C4QRZ1-F1-model_v4 | 23S rRNA (Cytidine1920-2'-O)/16S rRNA (Cytidine1409-2'-O)-methyltransferase | 0.9945 | 82 | 271 |
GO:0008168
GO:0032259 |