F485997
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 929 | 439 | 925 | 92 |
Family's Representative Sequence
| Representative Sequence | 3300021441|Ga0213871_10019515|Ga0213871_100195152 |
| Length | 111 |
| Sequence | MTELLDIALQLPSDARSELASELPAGPPSEFPLGLAQRGYVGRIHRLAAGEAASALSDDELESRLIELGFVEGARVEILHEGILGRDPIAVRVDNVTIAIRRREAMAIIVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 2 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 3 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 9 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 14 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 65 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 66 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 82 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 83 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 84 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 110 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 113 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 114 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 115 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 116 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 117 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 118 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 119 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 120 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 182 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 183 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 184 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 185 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 191 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 192 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 193 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 195 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 196 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 199 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 201 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 203 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 204 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 205 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 206 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 208 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 209 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 212 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 213 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 214 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 216 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 218 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 219 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 220 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 221 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 222 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 223 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 224 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 225 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 226 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 227 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 228 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 234 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 235 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 236 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 237 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 238 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 239 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 240 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 241 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 242 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 243 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 244 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 245 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 246 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 247 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 248 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 249 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 250 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 251 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 252 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 253 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 254 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 328 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 329 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 330 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 331 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 332 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 333 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 335 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 336 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 337 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 338 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 339 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 340 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 341 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 342 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 343 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 344 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 345 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 346 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 347 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 348 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 349 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 350 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 351 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 364 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 365 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 366 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 367 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 368 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 369 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 370 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 371 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 374 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 377 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 380 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 381 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 382 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 383 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 384 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 385 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 386 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 387 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 388 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 389 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 390 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 391 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 392 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 393 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 394 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 395 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 396 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 397 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 398 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 399 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 400 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 401 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 402 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 403 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 404 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 405 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 406 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 407 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 408 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 409 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 410 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 411 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 412 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 413 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 414 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 415 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 416 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 417 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 418 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 419 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 420 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 421 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 422 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 423 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 424 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 425 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 426 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 427 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 428 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 429 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 430 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 431 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 432 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 433 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 434 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 435 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 436 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 437 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 438 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 439 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.35 |
| Metatranscriptomes | 0.22 |
| Isolates | 0.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 21.85 |
| Nodule | 2.26 |
| Rhizoplane | 5.06 |
| Rhizosphere | 60.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10049260 | 3300001979 | Bacteria | 1218 |
| 2 | JGI24737J22298_10200636 | 3300001990 | Bacteria | 589 |
| 3 | JGI25153J46596_10009426 | 3300003215 | Bacteria | 4538 |
| 4 | JGI25153J46596_10009681 | 3300003215 | Bacteria | 4439 |
| 5 | JGI25153J46596_10009764 | 3300003215 | Bacteria | 4412 |
| 6 | JGI25160J50197_1001038 | 3300003354 | Bacteria | 14357 |
| 7 | JGI25160J50197_1002799 | 3300003354 | Bacteria | 7987 |
| 8 | JGI25404J52841_10065243 | 3300003659 | Bacteria | 762 |
| 9 | Ga0055539_1018108 | 3300003752 | Bacteria | 849 |
| 10 | Ga0055542_1006171 | 3300003762 | Bacteria | 2596 |
| 11 | Ga0055526_1036333 | 3300003771 | Bacteria | 1308 |
| 12 | Ga0055526_1083681 | 3300003771 | Bacteria | 616 |
| 13 | Ga0055531_10001452 | 3300003794 | Bacteria | 17483 |
| 14 | JGI25405J52794_10074847 | 3300003911 | Bacteria | 741 |
| 15 | Ga0055543_1007350 | 3300004625 | Bacteria | 2557 |
| 16 | Ga0065165_1009022 | 3300005262 | Bacteria | 4547 |
| 17 | Ga0065165_1009421 | 3300005262 | Bacteria | 4380 |
| 18 | Ga0065165_1032020 | 3300005262 | Bacteria | 1653 |
| 19 | Ga0070683_100017083 | 3300005329 | Bacteria | 6405 |
| 20 | Ga0070683_100287789 | 3300005329 | Bacteria | 1563 |
| 21 | Ga0068869_100041945 | 3300005334 | Bacteria | 3278 |
| 22 | Ga0070680_100166491 | 3300005336 | Bacteria | 1853 |
| 23 | Ga0070680_100908337 | 3300005336 | Bacteria | 760 |
| 24 | Ga0070682_101890726 | 3300005337 | Bacteria | 523 |
| 25 | Ga0068868_100117188 | 3300005338 | Bacteria | 2170 |
| 26 | Ga0070660_100151355 | 3300005339 | Bacteria | 1865 |
| 27 | Ga0070691_10502212 | 3300005341 | Bacteria | 701 |
| 28 | Ga0070668_100310687 | 3300005347 | Bacteria | 1324 |
| 29 | Ga0070669_101811366 | 3300005353 | Bacteria | 533 |
| 30 | Ga0070671_100016125 | 3300005355 | Bacteria | 6041 |
| 31 | Ga0070674_100985290 | 3300005356 | Bacteria | 739 |
| 32 | Ga0070673_101539322 | 3300005364 | Bacteria | 628 |
| 33 | Ga0070659_100320536 | 3300005366 | Bacteria | 1296 |
| 34 | Ga0070659_100389105 | 3300005366 | Bacteria | 1176 |
| 35 | Ga0070709_10860417 | 3300005434 | Bacteria | 715 |
| 36 | Ga0070709_11537159 | 3300005434 | Bacteria | 541 |
| 37 | Ga0070714_100637769 | 3300005435 | Bacteria | 1025 |
| 38 | Ga0070713_100537895 | 3300005436 | Bacteria | 1105 |
| 39 | Ga0070713_101653565 | 3300005436 | Bacteria | 622 |
| 40 | Ga0070710_10021089 | 3300005437 | Bacteria | 3390 |
| 41 | Ga0070710_10026413 | 3300005437 | Bacteria | 3085 |
| 42 | Ga0070710_10598807 | 3300005437 | Bacteria | 767 |
| 43 | Ga0070710_11417924 | 3300005437 | Bacteria | 520 |
| 44 | Ga0070711_100014236 | 3300005439 | Bacteria | 5009 |
| 45 | Ga0070711_100102906 | 3300005439 | Bacteria | 2080 |
| 46 | Ga0070711_101137207 | 3300005439 | Bacteria | 674 |
| 47 | Ga0070708_101332860 | 3300005445 | Bacteria | 670 |
| 48 | Ga0070663_100669534 | 3300005455 | Bacteria | 879 |
| 49 | Ga0070678_102220964 | 3300005456 | Bacteria | 521 |
| 50 | Ga0070662_101003699 | 3300005457 | Bacteria | 715 |
| 51 | Ga0070662_101407564 | 3300005457 | Bacteria | 601 |
| 52 | Ga0070681_10043341 | 3300005458 | Bacteria | 4508 |
| 53 | Ga0070681_10176986 | 3300005458 | Bacteria | 2055 |
| 54 | Ga0070679_100069743 | 3300005530 | Bacteria | 3506 |
| 55 | Ga0070679_100167183 | 3300005530 | Bacteria | 2172 |
| 56 | Ga0070684_100002379 | 3300005535 | Bacteria | 13868 |
| 57 | Ga0068853_100002707 | 3300005539 | Bacteria | 13370 |
| 58 | Ga0068853_100938869 | 3300005539 | Bacteria | 832 |
| 59 | Ga0070696_100998745 | 3300005546 | Bacteria | 699 |
| 60 | Ga0070693_100253786 | 3300005547 | Bacteria | 1167 |
| 61 | Ga0070665_100488284 | 3300005548 | Bacteria | 1243 |
| 62 | Ga0068855_100078484 | 3300005563 | Bacteria | 3830 |
| 63 | Ga0068855_100096866 | 3300005563 | Bacteria | 3398 |
| 64 | Ga0068855_100214813 | 3300005563 | Bacteria | 2159 |
| 65 | Ga0068855_100269496 | 3300005563 | Bacteria | 1893 |
| 66 | Ga0068855_100335734 | 3300005563 | Bacteria | 1667 |
| 67 | Ga0068855_100678334 | 3300005563 | Bacteria | 1104 |
| 68 | Ga0070664_100354923 | 3300005564 | Bacteria | 1334 |
| 69 | Ga0070664_100756216 | 3300005564 | Bacteria | 907 |
| 70 | Ga0068857_100073827 | 3300005577 | Bacteria | 3039 |
| 71 | Ga0068857_100080405 | 3300005577 | Bacteria | 2910 |
| 72 | Ga0068857_100081384 | 3300005577 | Bacteria | 2892 |
| 73 | Ga0068857_100279812 | 3300005577 | Bacteria | 1535 |
| 74 | Ga0068854_100004699 | 3300005578 | Bacteria | 8607 |
| 75 | Ga0068856_100069412 | 3300005614 | Bacteria | 3484 |
| 76 | Ga0068856_100145909 | 3300005614 | Bacteria | 2374 |
| 77 | Ga0068852_100293128 | 3300005616 | Bacteria | 1572 |
| 78 | Ga0068852_100724871 | 3300005616 | Bacteria | 1005 |
| 79 | Ga0068852_101200886 | 3300005616 | Bacteria | 779 |
| 80 | Ga0068859_100039038 | 3300005617 | Bacteria | 4762 |
| 81 | Ga0068864_100208011 | 3300005618 | Bacteria | 1800 |
| 82 | Ga0068864_101314320 | 3300005618 | Bacteria | 724 |
| 83 | Ga0068866_10770201 | 3300005718 | Bacteria | 666 |
| 84 | Ga0068861_101066536 | 3300005719 | Bacteria | 775 |
| 85 | Ga0068851_10009920 | 3300005834 | Bacteria | 4434 |
| 86 | Ga0068870_11278937 | 3300005840 | Bacteria | 534 |
| 87 | Ga0068863_100586301 | 3300005841 | Bacteria | 1103 |
| 88 | Ga0068863_100621340 | 3300005841 | Bacteria | 1070 |
| 89 | Ga0068858_100141131 | 3300005842 | Bacteria | 2262 |
| 90 | Ga0068858_100185403 | 3300005842 | Bacteria | 1965 |
| 91 | Ga0068858_100317761 | 3300005842 | Bacteria | 1488 |
| 92 | Ga0068858_101973230 | 3300005842 | Bacteria | 577 |
| 93 | Ga0068860_100008166 | 3300005843 | Bacteria | 10422 |
| 94 | Ga0081455_10000714 | 3300005937 | Bacteria | 43138 |
| 95 | Ga0081455_10268126 | 3300005937 | Bacteria | 1240 |
| 96 | Ga0081455_10349109 | 3300005937 | Bacteria | 1044 |
| 97 | Ga0081540_1011827 | 3300005983 | Bacteria | 5799 |
| 98 | Ga0081540_1020849 | 3300005983 | Bacteria | 3926 |
| 99 | Ga0081540_1084051 | 3300005983 | Bacteria | 1422 |
| 100 | Ga0081539_10098447 | 3300005985 | Bacteria | 1496 |
| 101 | Ga0070717_11113479 | 3300006028 | Bacteria | 719 |
| 102 | Ga0075365_10030283 | 3300006038 | Bacteria | 3465 |
| 103 | Ga0075365_10071715 | 3300006038 | Bacteria | 2332 |
| 104 | Ga0075365_10117047 | 3300006038 | Bacteria | 1835 |
| 105 | Ga0075365_10393087 | 3300006038 | Bacteria | 978 |
| 106 | Ga0075365_10802132 | 3300006038 | Bacteria | 664 |
| 107 | Ga0075368_10007220 | 3300006042 | Bacteria | 3916 |
| 108 | Ga0075363_100023549 | 3300006048 | Bacteria | 3122 |
| 109 | Ga0075363_100447620 | 3300006048 | Bacteria | 763 |
| 110 | Ga0075364_10019903 | 3300006051 | Bacteria | 4218 |
| 111 | Ga0075364_10122023 | 3300006051 | Bacteria | 1745 |
| 112 | Ga0075364_10298960 | 3300006051 | Bacteria | 1096 |
| 113 | Ga0075364_10433400 | 3300006051 | Bacteria | 898 |
| 114 | Ga0070715_11010012 | 3300006163 | Bacteria | 519 |
| 115 | Ga0070716_101324785 | 3300006173 | Bacteria | 583 |
| 116 | Ga0070712_100157022 | 3300006175 | Bacteria | 1753 |
| 117 | Ga0075362_10110997 | 3300006177 | Bacteria | 1291 |
| 118 | Ga0075367_10032938 | 3300006178 | Bacteria | 2984 |
| 119 | Ga0075367_10248766 | 3300006178 | Bacteria | 1115 |
| 120 | Ga0075367_10630209 | 3300006178 | Bacteria | 682 |
| 121 | Ga0075369_10007352 | 3300006186 | Bacteria | 4191 |
| 122 | Ga0075369_10030294 | 3300006186 | Bacteria | 2278 |
| 123 | Ga0075369_10036354 | 3300006186 | Bacteria | 2095 |
| 124 | Ga0075369_10245182 | 3300006186 | Bacteria | 832 |
| 125 | Ga0075369_10469816 | 3300006186 | Bacteria | 596 |
| 126 | Ga0075366_10143771 | 3300006195 | Bacteria | 1443 |
| 127 | Ga0075366_10301186 | 3300006195 | Bacteria | 981 |
| 128 | Ga0097621_100456221 | 3300006237 | Bacteria | 1152 |
| 129 | Ga0097621_100523543 | 3300006237 | Bacteria | 1076 |
| 130 | Ga0075370_10052778 | 3300006353 | Bacteria | 2307 |
| 131 | Ga0075370_10133804 | 3300006353 | Bacteria | 1447 |
| 132 | Ga0075370_10168264 | 3300006353 | Bacteria | 1288 |
| 133 | Ga0075370_10244142 | 3300006353 | Bacteria | 1063 |
| 134 | Ga0068871_100096021 | 3300006358 | Bacteria | 2476 |
| 135 | Ga0068871_101792176 | 3300006358 | Unclassified | 583 |
| 136 | Ga0075433_10560537 | 3300006852 | Bacteria | 1004 |
| 137 | Ga0075436_100156972 | 3300006914 | Bacteria | 1603 |
| 138 | Ga0097620_100039039 | 3300006931 | Bacteria | 4762 |
| 139 | Ga0099825_1037844 | 3300006941 | Bacteria | 1570 |
| 140 | Ga0099825_1056720 | 3300006941 | Bacteria | 731 |
| 141 | Ga0099824_1022136 | 3300006942 | Bacteria | 4258 |
| 142 | Ga0099824_1022833 | 3300006942 | Bacteria | 4025 |
| 143 | Ga0099824_1047115 | 3300006942 | Bacteria | 870 |
| 144 | Ga0099822_1000918 | 3300006943 | Bacteria | 31646 |
| 145 | Ga0099822_1054004 | 3300006943 | Bacteria | 1541 |
| 146 | Ga0099823_1071320 | 3300006944 | Bacteria | 1534 |
| 147 | Ga0075435_100550311 | 3300007076 | Bacteria | 999 |
| 148 | Ga0105250_10176126 | 3300009092 | Bacteria | 897 |
| 149 | Ga0105240_10010814 | 3300009093 | Bacteria | 12781 |
| 150 | Ga0105240_10035144 | 3300009093 | Bacteria | 6461 |
| 151 | Ga0105240_10104049 | 3300009093 | Bacteria | 3448 |
| 152 | Ga0105240_10711275 | 3300009093 | Bacteria | 1095 |
| 153 | Ga0105240_12304444 | 3300009093 | Bacteria | 558 |
| 154 | Ga0105245_10123225 | 3300009098 | Bacteria | 2424 |
| 155 | Ga0105245_10147697 | 3300009098 | Bacteria | 2219 |
| 156 | Ga0105247_10053727 | 3300009101 | Bacteria | 2485 |
| 157 | Ga0105247_10059084 | 3300009101 | Bacteria | 2373 |
| 158 | Ga0105247_10106434 | 3300009101 | Bacteria | 1799 |
| 159 | Ga0105247_10471358 | 3300009101 | Bacteria | 909 |
| 160 | Ga0105243_10591683 | 3300009148 | Bacteria | 1067 |
| 161 | Ga0105241_10001768 | 3300009174 | Bacteria | 16393 |
| 162 | Ga0105241_10619548 | 3300009174 | Bacteria | 979 |
| 163 | Ga0105241_10893969 | 3300009174 | Bacteria | 824 |
| 164 | Ga0105241_12060637 | 3300009174 | Bacteria | 563 |
| 165 | Ga0105242_10546253 | 3300009176 | Bacteria | 1110 |
| 166 | Ga0105242_10624182 | 3300009176 | Bacteria | 1044 |
| 167 | Ga0105248_10426959 | 3300009177 | Bacteria | 1493 |
| 168 | Ga0105248_11952372 | 3300009177 | Bacteria | 666 |
| 169 | Ga0105237_10065418 | 3300009545 | Bacteria | 3632 |
| 170 | Ga0105237_10171437 | 3300009545 | Bacteria | 2170 |
| 171 | Ga0105237_10357668 | 3300009545 | Bacteria | 1464 |
| 172 | Ga0105237_10381641 | 3300009545 | Bacteria | 1414 |
| 173 | Ga0105237_10547922 | 3300009545 | Bacteria | 1163 |
| 174 | Ga0105237_10831447 | 3300009545 | Bacteria | 930 |
| 175 | Ga0105237_11282315 | 3300009545 | Bacteria | 739 |
| 176 | Ga0105237_11458796 | 3300009545 | Bacteria | 691 |
| 177 | Ga0105237_11827303 | 3300009545 | Unclassified | 615 |
| 178 | Ga0105237_11845280 | 3300009545 | Bacteria | 612 |
| 179 | Ga0105238_10000897 | 3300009551 | Bacteria | 30590 |
| 180 | Ga0105238_10080247 | 3300009551 | Bacteria | 3252 |
| 181 | Ga0105238_10228238 | 3300009551 | Bacteria | 1839 |
| 182 | Ga0105238_10532976 | 3300009551 | Bacteria | 1177 |
| 183 | Ga0105238_10642873 | 3300009551 | Bacteria | 1070 |
| 184 | Ga0105238_11198731 | 3300009551 | Bacteria | 784 |
| 185 | Ga0105238_11648624 | 3300009551 | Bacteria | 672 |
| 186 | Ga0105249_10667745 | 3300009553 | Bacteria | 1098 |
| 187 | Ga0105239_10011774 | 3300010375 | Bacteria | 9762 |
| 188 | Ga0105239_10048692 | 3300010375 | Bacteria | 4647 |
| 189 | Ga0105239_10088740 | 3300010375 | Bacteria | 3410 |
| 190 | Ga0105239_10207595 | 3300010375 | Bacteria | 2195 |
| 191 | Ga0105239_10354585 | 3300010375 | Bacteria | 1656 |
| 192 | Ga0105239_11811093 | 3300010375 | Bacteria | 707 |
| 193 | Ga0105239_12281620 | 3300010375 | Unclassified | 630 |
| 194 | Ga0105246_10306641 | 3300011119 | Bacteria | 1284 |
| 195 | Ga0105246_10484958 | 3300011119 | Bacteria | 1047 |
| 196 | Ga0157369_10036608 | 3300013105 | Bacteria | 5375 |
| 197 | Ga0157369_10398041 | 3300013105 | Bacteria | 1429 |
| 198 | Ga0157369_11818291 | 3300013105 | Bacteria | 619 |
| 199 | Ga0157374_10931981 | 3300013296 | Bacteria | 887 |
| 200 | Ga0157374_11585957 | 3300013296 | Bacteria | 679 |
| 201 | Ga0157378_10256390 | 3300013297 | Bacteria | 1676 |
| 202 | Ga0157378_10822584 | 3300013297 | Bacteria | 956 |
| 203 | Ga0163162_10428704 | 3300013306 | Bacteria | 1454 |
| 204 | Ga0163162_11590233 | 3300013306 | Bacteria | 745 |
| 205 | Ga0157372_10237069 | 3300013307 | Bacteria | 2116 |
| 206 | Ga0157372_12064595 | 3300013307 | Bacteria | 655 |
| 207 | Ga0157375_10474540 | 3300013308 | Bacteria | 1416 |
| 208 | Ga0157375_11276814 | 3300013308 | Bacteria | 863 |
| 209 | Ga0163163_10054269 | 3300014325 | Bacteria | 3959 |
| 210 | Ga0182008_10241705 | 3300014497 | Bacteria | 929 |
| 211 | Ga0157379_10608602 | 3300014968 | Bacteria | 1020 |
| 212 | Ga0157376_11380780 | 3300014969 | Bacteria | 736 |
| 213 | Ga0157376_12338680 | 3300014969 | Bacteria | 574 |
| 214 | Ga0182006_1091454 | 3300015261 | Bacteria | 1094 |
| 215 | Ga0182007_10051805 | 3300015262 | Bacteria | 1353 |
| 216 | Ga0163161_10245482 | 3300017792 | Bacteria | 1394 |
| 217 | Ga0163161_10304076 | 3300017792 | Bacteria | 1257 |
| 218 | Ga0214544_1000026 | 3300021320 | Bacteria | 161530 |
| 219 | Ga0214542_1000025 | 3300021321 | Bacteria | 183588 |
| 220 | Ga0214545_1000014 | 3300021324 | Bacteria | 183588 |
| 221 | Ga0214543_1000034 | 3300021327 | Bacteria | 183712 |
| 222 | Ga0213872_10208058 | 3300021361 | Bacteria | 836 |
| 223 | Ga0213874_10032264 | 3300021377 | Bacteria | 1520 |
| 224 | Ga0213874_10251965 | 3300021377 | Bacteria | 651 |
| 225 | Ga0213875_10028728 | 3300021388 | Bacteria | 2639 |
| 226 | Ga0213871_10019515 | 3300021441 | Bacteria | 1670 |
| 227 | Ga0213871_10238265 | 3300021441 | Bacteria | 575 |
| 228 | Ga0209677_100848 | 3300025253 | Bacteria | 15132 |
| 229 | Ga0209148_1000250 | 3300025254 | Bacteria | 85755 |
| 230 | Ga0209148_1032460 | 3300025254 | Bacteria | 768 |
| 231 | Ga0209233_1003352 | 3300025261 | Bacteria | 5666 |
| 232 | Ga0209233_1008106 | 3300025261 | Bacteria | 3279 |
| 233 | Ga0209455_1004562 | 3300025272 | Bacteria | 4494 |
| 234 | Ga0209455_1013630 | 3300025272 | Bacteria | 1877 |
| 235 | Ga0209455_1018916 | 3300025272 | Bacteria | 1403 |
| 236 | Ga0209564_1004440 | 3300025295 | Bacteria | 8581 |
| 237 | Ga0209564_1028543 | 3300025295 | Bacteria | 1781 |
| 238 | Ga0209564_1033620 | 3300025295 | Bacteria | 1521 |
| 239 | Ga0209758_1000141 | 3300025297 | Bacteria | 172481 |
| 240 | Ga0209758_1000324 | 3300025297 | Bacteria | 91475 |
| 241 | Ga0209758_1000476 | 3300025297 | Bacteria | 66180 |
| 242 | Ga0209758_1003329 | 3300025297 | Bacteria | 14791 |
| 243 | Ga0209758_1015424 | 3300025297 | Bacteria | 3956 |
| 244 | Ga0209758_1046709 | 3300025297 | Bacteria | 1557 |
| 245 | Ga0209758_1143950 | 3300025297 | Bacteria | 614 |
| 246 | Ga0209256_1002728 | 3300025299 | Bacteria | 13658 |
| 247 | Ga0209256_1119567 | 3300025299 | Bacteria | 518 |
| 248 | Ga0207426_1000523 | 3300025302 | Bacteria | 55736 |
| 249 | Ga0207426_1000768 | 3300025302 | Bacteria | 35650 |
| 250 | Ga0207426_1026680 | 3300025302 | Bacteria | 1931 |
| 251 | Ga0207426_1075073 | 3300025302 | Bacteria | 931 |
| 252 | Ga0209051_1152598 | 3300025303 | Bacteria | 540 |
| 253 | Ga0209257_1002582 | 3300025304 | Bacteria | 17615 |
| 254 | Ga0209257_1099380 | 3300025304 | Bacteria | 712 |
| 255 | Ga0207656_10013316 | 3300025321 | Bacteria | 3141 |
| 256 | Ga0207656_10218751 | 3300025321 | Bacteria | 925 |
| 257 | Ga0207692_10017859 | 3300025898 | Bacteria | 3172 |
| 258 | Ga0207692_10236359 | 3300025898 | Bacteria | 1089 |
| 259 | Ga0207710_10017337 | 3300025900 | Bacteria | 3054 |
| 260 | Ga0207710_10087928 | 3300025900 | Bacteria | 1450 |
| 261 | Ga0207710_10292309 | 3300025900 | Bacteria | 822 |
| 262 | Ga0207688_10351273 | 3300025901 | Bacteria | 909 |
| 263 | Ga0207680_10158274 | 3300025903 | Bacteria | 1516 |
| 264 | Ga0207680_11047434 | 3300025903 | Bacteria | 584 |
| 265 | Ga0207647_10004820 | 3300025904 | Bacteria | 9980 |
| 266 | Ga0207647_10356072 | 3300025904 | Bacteria | 828 |
| 267 | Ga0207647_10363351 | 3300025904 | Bacteria | 819 |
| 268 | Ga0207647_10604568 | 3300025904 | Bacteria | 605 |
| 269 | Ga0207699_10221205 | 3300025906 | Bacteria | 1292 |
| 270 | Ga0207643_10383008 | 3300025908 | Bacteria | 887 |
| 271 | Ga0207654_10001817 | 3300025911 | Bacteria | 11078 |
| 272 | Ga0207654_10017334 | 3300025911 | Bacteria | 3762 |
| 273 | Ga0207654_10031960 | 3300025911 | Bacteria | 2903 |
| 274 | Ga0207707_10003161 | 3300025912 | Bacteria | 14619 |
| 275 | Ga0207707_10015604 | 3300025912 | Bacteria | 6618 |
| 276 | Ga0207695_10000062 | 3300025913 | Bacteria | 351979 |
| 277 | Ga0207695_10001771 | 3300025913 | Bacteria | 34099 |
| 278 | Ga0207695_10549340 | 3300025913 | Bacteria | 1037 |
| 279 | Ga0207695_10841317 | 3300025913 | Bacteria | 798 |
| 280 | Ga0207695_11445368 | 3300025913 | Bacteria | 568 |
| 281 | Ga0207671_10001205 | 3300025914 | Bacteria | 30737 |
| 282 | Ga0207671_10043199 | 3300025914 | Bacteria | 3333 |
| 283 | Ga0207671_10069940 | 3300025914 | Bacteria | 2616 |
| 284 | Ga0207671_10151099 | 3300025914 | Bacteria | 1794 |
| 285 | Ga0207671_10310269 | 3300025914 | Bacteria | 1247 |
| 286 | Ga0207671_10501126 | 3300025914 | Bacteria | 968 |
| 287 | Ga0207671_10868137 | 3300025914 | Bacteria | 714 |
| 288 | Ga0207693_10180529 | 3300025915 | Bacteria | 1661 |
| 289 | Ga0207663_10031577 | 3300025916 | Bacteria | 3136 |
| 290 | Ga0207663_10103137 | 3300025916 | Bacteria | 1920 |
| 291 | Ga0207663_10493414 | 3300025916 | Bacteria | 950 |
| 292 | Ga0207660_10018435 | 3300025917 | Bacteria | 4652 |
| 293 | Ga0207660_10039296 | 3300025917 | Bacteria | 3307 |
| 294 | Ga0207657_10114414 | 3300025919 | Bacteria | 2225 |
| 295 | Ga0207657_10654947 | 3300025919 | Bacteria | 817 |
| 296 | Ga0207649_11220504 | 3300025920 | Bacteria | 594 |
| 297 | Ga0207649_11464123 | 3300025920 | Bacteria | 541 |
| 298 | Ga0207652_10009942 | 3300025921 | Bacteria | 7658 |
| 299 | Ga0207652_10097768 | 3300025921 | Bacteria | 2588 |
| 300 | Ga0207652_10676717 | 3300025921 | Bacteria | 922 |
| 301 | Ga0207681_11316448 | 3300025923 | Bacteria | 607 |
| 302 | Ga0207694_10000082 | 3300025924 | Bacteria | 109787 |
| 303 | Ga0207694_10248388 | 3300025924 | Bacteria | 1455 |
| 304 | Ga0207694_10251592 | 3300025924 | Bacteria | 1446 |
| 305 | Ga0207694_10809750 | 3300025924 | Bacteria | 791 |
| 306 | Ga0207694_11498117 | 3300025924 | Bacteria | 569 |
| 307 | Ga0207650_10815324 | 3300025925 | Bacteria | 791 |
| 308 | Ga0207659_10278920 | 3300025926 | Bacteria | 1366 |
| 309 | Ga0207687_10135893 | 3300025927 | Bacteria | 1859 |
| 310 | Ga0207687_11427527 | 3300025927 | Bacteria | 595 |
| 311 | Ga0207700_10359036 | 3300025928 | Bacteria | 1270 |
| 312 | Ga0207700_11396031 | 3300025928 | Bacteria | 623 |
| 313 | Ga0207664_10996377 | 3300025929 | Bacteria | 751 |
| 314 | Ga0207644_10034864 | 3300025931 | Bacteria | 3523 |
| 315 | Ga0207644_10070535 | 3300025931 | Bacteria | 2554 |
| 316 | Ga0207644_10492670 | 3300025931 | Bacteria | 1010 |
| 317 | Ga0207690_10313724 | 3300025932 | Bacteria | 1230 |
| 318 | Ga0207690_10383713 | 3300025932 | Bacteria | 1117 |
| 319 | Ga0207706_10176626 | 3300025933 | Bacteria | 1876 |
| 320 | Ga0207686_10518422 | 3300025934 | Bacteria | 927 |
| 321 | Ga0207686_10828071 | 3300025934 | Bacteria | 743 |
| 322 | Ga0207709_10805784 | 3300025935 | Bacteria | 758 |
| 323 | Ga0207670_11165591 | 3300025936 | Bacteria | 652 |
| 324 | Ga0207691_11706453 | 3300025940 | Bacteria | 510 |
| 325 | Ga0207711_10214056 | 3300025941 | Bacteria | 1761 |
| 326 | Ga0207711_10967616 | 3300025941 | Bacteria | 790 |
| 327 | Ga0207711_11124129 | 3300025941 | Bacteria | 727 |
| 328 | Ga0207689_10110262 | 3300025942 | Bacteria | 2261 |
| 329 | Ga0207661_10029201 | 3300025944 | Bacteria | 4232 |
| 330 | Ga0207679_10530099 | 3300025945 | Bacteria | 1054 |
| 331 | Ga0207667_10002113 | 3300025949 | Bacteria | 24906 |
| 332 | Ga0207667_10147910 | 3300025949 | Bacteria | 2418 |
| 333 | Ga0207667_10373483 | 3300025949 | Bacteria | 1453 |
| 334 | Ga0207667_10374749 | 3300025949 | Bacteria | 1450 |
| 335 | Ga0207667_10471976 | 3300025949 | Bacteria | 1274 |
| 336 | Ga0207667_11087428 | 3300025949 | Bacteria | 783 |
| 337 | Ga0207712_10140293 | 3300025961 | Bacteria | 1853 |
| 338 | Ga0207668_10094512 | 3300025972 | Bacteria | 2204 |
| 339 | Ga0207668_10406470 | 3300025972 | Bacteria | 1152 |
| 340 | Ga0207640_10031916 | 3300025981 | Bacteria | 3261 |
| 341 | Ga0207640_11606466 | 3300025981 | Bacteria | 586 |
| 342 | Ga0207658_10252038 | 3300025986 | Bacteria | 1500 |
| 343 | Ga0207658_11272266 | 3300025986 | Bacteria | 673 |
| 344 | Ga0207703_10232211 | 3300026035 | Bacteria | 1654 |
| 345 | Ga0207703_10308243 | 3300026035 | Bacteria | 1446 |
| 346 | Ga0207703_11307722 | 3300026035 | Bacteria | 697 |
| 347 | Ga0207639_10081967 | 3300026041 | Bacteria | 2556 |
| 348 | Ga0207639_10300138 | 3300026041 | Bacteria | 1419 |
| 349 | Ga0207678_10036179 | 3300026067 | Bacteria | 4298 |
| 350 | Ga0207678_10082732 | 3300026067 | Bacteria | 2746 |
| 351 | Ga0207678_10112337 | 3300026067 | Bacteria | 2324 |
| 352 | Ga0207678_10194954 | 3300026067 | Bacteria | 1731 |
| 353 | Ga0207678_11423222 | 3300026067 | Bacteria | 613 |
| 354 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 355 | Ga0207702_10103833 | 3300026078 | Bacteria | 2514 |
| 356 | Ga0207702_10253198 | 3300026078 | Bacteria | 1654 |
| 357 | Ga0207702_10673829 | 3300026078 | Bacteria | 1018 |
| 358 | Ga0207702_11589936 | 3300026078 | Bacteria | 647 |
| 359 | Ga0207641_10456059 | 3300026088 | Bacteria | 1236 |
| 360 | Ga0207648_10552188 | 3300026089 | Bacteria | 1058 |
| 361 | Ga0207676_10198475 | 3300026095 | Bacteria | 1771 |
| 362 | Ga0207676_11288139 | 3300026095 | Bacteria | 725 |
| 363 | Ga0207674_10003760 | 3300026116 | Bacteria | 18518 |
| 364 | Ga0207674_10049361 | 3300026116 | Bacteria | 4304 |
| 365 | Ga0207674_10055434 | 3300026116 | Bacteria | 4030 |
| 366 | Ga0207674_10226429 | 3300026116 | Bacteria | 1818 |
| 367 | Ga0207675_100439246 | 3300026118 | Bacteria | 1291 |
| 368 | Ga0207698_10107708 | 3300026142 | Bacteria | 2327 |
| 369 | Ga0207698_10646257 | 3300026142 | Bacteria | 1047 |
| 370 | Ga0209389_1000004 | 3300027296 | Bacteria | 263759 |
| 371 | Ga0209389_1000023 | 3300027296 | Bacteria | 150730 |
| 372 | Ga0209589_1000010 | 3300027357 | Bacteria | 237657 |
| 373 | Ga0209589_1000035 | 3300027357 | Bacteria | 134091 |
| 374 | Ga0209489_100011 | 3300027361 | Bacteria | 244710 |
| 375 | Ga0209489_100079 | 3300027361 | Bacteria | 134091 |
| 376 | Ga0209489_100295 | 3300027361 | Bacteria | 87273 |
| 377 | Ga0209700_100013 | 3300027363 | Bacteria | 341906 |
| 378 | Ga0209700_100077 | 3300027363 | Bacteria | 134091 |
| 379 | Ga0209179_1081140 | 3300027512 | Bacteria | 715 |
| 380 | Ga0209813_10002937 | 3300027866 | Bacteria | 3946 |
| 381 | Ga0268266_11135739 | 3300028379 | Bacteria | 756 |
| 382 | Ga0268265_11008457 | 3300028380 | Bacteria | 823 |
| 383 | Ga0268264_10000093 | 3300028381 | Bacteria | 232057 |
| 384 | Ga0268264_10341893 | 3300028381 | Bacteria | 1422 |
| 385 | Ga0265337_1033985 | 3300028556 | Bacteria | 1502 |
| 386 | Ga0265319_1009818 | 3300028563 | Bacteria | 4041 |
| 387 | Ga0265323_10013826 | 3300028653 | Bacteria | 3210 |
| 388 | Ga0265336_10000668 | 3300028666 | Bacteria | 18619 |
| 389 | Ga0307517_10163514 | 3300028786 | Bacteria | 1486 |
| 390 | Ga0307515_10119659 | 3300028794 | Bacteria | 2993 |
| 391 | Ga0265338_10000013 | 3300028800 | Bacteria | 379065 |
| 392 | Ga0265324_10035591 | 3300029957 | Bacteria | 1733 |
| 393 | Ga0307511_10225658 | 3300030521 | Bacteria | 934 |
| 394 | Ga0265763_1035790 | 3300030763 | Bacteria | 581 |
| 395 | Ga0265340_10033490 | 3300031247 | Bacteria | 2558 |
| 396 | Ga0265339_10012506 | 3300031249 | Bacteria | 5179 |
| 397 | Ga0307513_10500169 | 3300031456 | Bacteria | 933 |
| 398 | Ga0307513_10631505 | 3300031456 | Bacteria | 779 |
| 399 | Ga0307509_10210400 | 3300031507 | Bacteria | 1770 |
| 400 | Ga0307509_10778182 | 3300031507 | Bacteria | 622 |
| 401 | Ga0307508_10242819 | 3300031616 | Bacteria | 1398 |
| 402 | Ga0307508_10813867 | 3300031616 | Bacteria | 552 |
| 403 | Ga0307508_10862876 | 3300031616 | Bacteria | 528 |
| 404 | Ga0307514_10443328 | 3300031649 | Bacteria | 642 |
| 405 | Ga0307405_10471950 | 3300031731 | Bacteria | 1000 |
| 406 | Ga0307405_11000753 | 3300031731 | Bacteria | 713 |
| 407 | Ga0307412_10193911 | 3300031911 | Bacteria | 1538 |
| 408 | Ga0307510_10004240 | 3300033180 | Bacteria | 16847 |
| 409 | Ga0307510_10385582 | 3300033180 | Bacteria | 846 |
| 410 | Ga0373954_0486799 | 3300035118 | Bacteria | 611 |
| 411 | Ga0373931_0551856 | 3300035691 | Bacteria | 749 |
| 412 | Ga0373927_0453531 | 3300035695 | Unclassified | 847 |
| 413 | Ga0373933_0000933 | 3300035724 | Bacteria | 17845 |
| 414 | Ga0373947_0152144 | 3300035725 | Bacteria | 1491 |
| 415 | Ga0373937_0597865 | 3300036401 | Bacteria | 1047 |
| 416 | Ga0310109_026010 | 3300036534 | Bacteria | 783 |
| 417 | Ga0373925_0038129 | 3300037068 | Bacteria | 3551 |
| 418 | Ga0395900_0111877 | 3300037418 | Bacteria | 2804 |
| 419 | Ga0395900_0177754 | 3300037418 | Bacteria | 2164 |
| 420 | Ga0395900_0353195 | 3300037418 | Bacteria | 1443 |
| 421 | Ga0395900_1279924 | 3300037418 | Bacteria | 647 |
| 422 | Ga0395898_0186397 | 3300037466 | Bacteria | 1983 |
| 423 | Ga0395898_0245757 | 3300037466 | Bacteria | 1706 |
| 424 | Ga0395898_0321954 | 3300037466 | Bacteria | 1475 |
| 425 | Ga0395898_0431498 | 3300037466 | Bacteria | 1256 |
| 426 | Ga0395898_1656789 | 3300037466 | Bacteria | 563 |
| 427 | Ga0395905_0005922 | 3300037471 | Bacteria | 12395 |
| 428 | Ga0395905_0597083 | 3300037471 | Bacteria | 1006 |
| 429 | Ga0395905_0866028 | 3300037471 | Bacteria | 806 |
| 430 | Ga0395905_1010743 | 3300037471 | Bacteria | 735 |
| 431 | Ga0436364_0525938 | 3300037853 | Bacteria | 3019 |
| 432 | Ga0436364_1001751 | 3300037853 | Bacteria | 2108 |
| 433 | Ga0395901_0106011 | 3300038443 | Bacteria | 2950 |
| 434 | Ga0395901_0173084 | 3300038443 | Bacteria | 2265 |
| 435 | Ga0395901_0263180 | 3300038443 | Bacteria | 1795 |
| 436 | Ga0395901_0379301 | 3300038443 | Bacteria | 1455 |
| 437 | Ga0395901_0450221 | 3300038443 | Bacteria | 1317 |
| 438 | Ga0395901_1565111 | 3300038443 | Bacteria | 613 |
| 439 | Ga0436365_0166945 | 3300039437 | Bacteria | 934 |
| 440 | Ga0436365_0412690 | 3300039437 | Bacteria | 1126 |
| 441 | Ga0436365_1432657 | 3300039437 | Bacteria | 830 |
| 442 | Ga0436360_0391216 | 3300039438 | Bacteria | 866 |
| 443 | Ga0436360_0473736 | 3300039438 | Bacteria | 870 |
| 444 | Ga0436360_0592197 | 3300039438 | Bacteria | 772 |
| 445 | Ga0436361_0064398 | 3300039447 | Bacteria | 1372 |
| 446 | Ga0436361_0639306 | 3300039447 | Bacteria | 5579 |
| 447 | Ga0436361_0859965 | 3300039447 | Bacteria | 945 |
| 448 | Ga0436363_0212376 | 3300039450 | Bacteria | 16030 |
| 449 | Ga0436363_0797948 | 3300039450 | Bacteria | 700 |
| 450 | Ga0436363_0882467 | 3300039450 | Bacteria | 719 |
| 451 | Ga0436363_1261222 | 3300039450 | Bacteria | 1086 |
| 452 | Ga0436363_1470254 | 3300039450 | Bacteria | 2286 |
| 453 | Ga0436362_0487714 | 3300039453 | Bacteria | 2658 |
| 454 | Ga0439465_0109018 | 3300041413 | Bacteria | 962 |
| 455 | Ga0451787_353093 | 3300041441 | Bacteria | 1199 |
| 456 | Ga0451789_0721162 | 3300041443 | Bacteria | 811 |
| 457 | Ga0451793_1933845 | 3300041452 | Bacteria | 1871 |
| 458 | Ga0451797_0462493 | 3300041453 | Bacteria | 1368 |
| 459 | Ga0451795_1213581 | 3300041456 | Bacteria | 2141 |
| 460 | Ga0451833_0104584 | 3300041491 | Bacteria | 1176 |
| 461 | Ga0451845_0603933 | 3300041501 | Bacteria | 827 |
| 462 | Ga0451851_1265619 | 3300041507 | Bacteria | 789 |
| 463 | Ga0451843_1287380 | 3300041509 | Bacteria | 815 |
| 464 | Ga0451855_0754286 | 3300041511 | Bacteria | 1005 |
| 465 | Ga0451853_1726574 | 3300041512 | Bacteria | 1480 |
| 466 | Ga0451853_4033689 | 3300041512 | Bacteria | 949 |
| 467 | Ga0466969_0040734 | 3300044656 | Bacteria | 2327 |
| 468 | Ga0466969_0104323 | 3300044656 | Bacteria | 1332 |
| 469 | Ga0466969_0206966 | 3300044656 | Bacteria | 894 |
| 470 | Ga0466972_0000185 | 3300044658 | Bacteria | 48335 |
| 471 | Ga0466972_0002548 | 3300044658 | Bacteria | 9011 |
| 472 | Ga0466972_0068110 | 3300044658 | Bacteria | 1700 |
| 473 | Ga0466972_0393405 | 3300044658 | Bacteria | 649 |
| 474 | Ga0466972_0596219 | 3300044658 | Bacteria | 522 |
| 475 | Ga0466965_0102633 | 3300044683 | Bacteria | 1464 |
| 476 | Ga0466965_0166157 | 3300044683 | Bacteria | 1159 |
| 477 | Ga0466966_0006716 | 3300044684 | Bacteria | 7622 |
| 478 | Ga0466966_0035021 | 3300044684 | Bacteria | 3245 |
| 479 | Ga0466966_0276665 | 3300044684 | Bacteria | 1010 |
| 480 | Ga0466961_0000020 | 3300044693 | Bacteria | 107610 |
| 481 | Ga0466961_0187725 | 3300044693 | Bacteria | 1282 |
| 482 | Ga0466961_0285810 | 3300044693 | Bacteria | 1009 |
| 483 | Ga0466961_0376621 | 3300044693 | Bacteria | 862 |
| 484 | Ga0466963_0927209 | 3300044694 | Bacteria | 613 |
| 485 | Ga0466964_0189350 | 3300044706 | Bacteria | 981 |
| 486 | Ga0466964_0288861 | 3300044706 | Bacteria | 822 |
| 487 | Ga0466964_0629727 | 3300044706 | Bacteria | 591 |
| 488 | Ga0466971_0126027 | 3300044719 | Bacteria | 1187 |
| 489 | Ga0466971_0682189 | 3300044719 | Bacteria | 516 |
| 490 | Ga0466968_0073859 | 3300044735 | Bacteria | 1488 |
| 491 | Ga0466968_0159590 | 3300044735 | Bacteria | 1040 |
| 492 | Ga0466968_0390116 | 3300044735 | Bacteria | 681 |
| 493 | Ga0466968_0459512 | 3300044735 | Bacteria | 630 |
| 494 | Ga0466970_0131056 | 3300044765 | Bacteria | 1377 |
| 495 | Ga0466970_0170778 | 3300044765 | Bacteria | 1205 |
| 496 | Ga0466970_0331420 | 3300044765 | Bacteria | 862 |
| 497 | Ga0466970_0345255 | 3300044765 | Bacteria | 844 |
| 498 | Ga0466970_0621087 | 3300044765 | Bacteria | 628 |
| 499 | Ga0466970_0934730 | 3300044765 | Bacteria | 510 |
| 500 | Ga0466957_0212111 | 3300044842 | Bacteria | 1275 |
| 501 | Ga0466957_0221501 | 3300044842 | Bacteria | 1249 |
| 502 | Ga0466957_0550325 | 3300044842 | Bacteria | 804 |
| 503 | Ga0466957_0796988 | 3300044842 | Bacteria | 671 |
| 504 | Ga0466960_0035952 | 3300044901 | Bacteria | 2318 |
| 505 | Ga0466960_0059495 | 3300044901 | Bacteria | 1869 |
| 506 | Ga0466960_0247789 | 3300044901 | Bacteria | 989 |
| 507 | Ga0466960_0290644 | 3300044901 | Bacteria | 918 |
| 508 | Ga0466959_0003692 | 3300045049 | Bacteria | 10100 |
| 509 | Ga0466959_0041108 | 3300045049 | Bacteria | 3414 |
| 510 | Ga0466959_0130082 | 3300045049 | Bacteria | 1784 |
| 511 | Ga0466959_0182710 | 3300045049 | Bacteria | 1466 |
| 512 | Ga0466959_0434728 | 3300045049 | Bacteria | 890 |
| 513 | Ga0466959_0513504 | 3300045049 | Bacteria | 809 |
| 514 | Ga0466958_0205203 | 3300045836 | Bacteria | 1255 |
| 515 | Ga0466967_0021975 | 3300045976 | Bacteria | 5195 |
| 516 | Ga0466967_0063971 | 3300045976 | Bacteria | 3271 |
| 517 | Ga0466967_0085926 | 3300045976 | Bacteria | 2849 |
| 518 | Ga0466967_0200302 | 3300045976 | Bacteria | 1891 |
| 519 | Ga0466967_0236600 | 3300045976 | Bacteria | 1741 |
| 520 | Ga0466967_0286512 | 3300045976 | Bacteria | 1581 |
| 521 | Ga0466967_0545508 | 3300045976 | Bacteria | 1141 |
| 522 | Ga0466967_2137728 | 3300045976 | Bacteria | 556 |
| 523 | Ga0466967_2373971 | 3300045976 | Bacteria | 526 |
| 524 | Ga0495592_0203996 | 3300046454 | Bacteria | 1332 |
| 525 | Ga0495592_0247794 | 3300046454 | Bacteria | 1179 |
| 526 | Ga0495603_0045301 | 3300046455 | Bacteria | 2623 |
| 527 | Ga0495603_0136583 | 3300046455 | Bacteria | 1427 |
| 528 | Ga0495590_0199860 | 3300046457 | Bacteria | 734 |
| 529 | Ga0495629_0001285 | 3300046459 | Bacteria | 19732 |
| 530 | Ga0495638_0011802 | 3300046460 | Bacteria | 6013 |
| 531 | Ga0495638_0035083 | 3300046460 | Bacteria | 3198 |
| 532 | Ga0495651_0038466 | 3300046462 | Bacteria | 3725 |
| 533 | Ga0495651_0101866 | 3300046462 | Bacteria | 2136 |
| 534 | Ga0495651_0141007 | 3300046462 | Bacteria | 1748 |
| 535 | Ga0495651_0820338 | 3300046462 | Bacteria | 573 |
| 536 | Ga0495580_0877413 | 3300046472 | Bacteria | 578 |
| 537 | Ga0495582_0191805 | 3300046473 | Bacteria | 1166 |
| 538 | Ga0495605_0081061 | 3300046474 | Bacteria | 1518 |
| 539 | Ga0495664_0056770 | 3300046477 | Bacteria | 2329 |
| 540 | Ga0495664_0311759 | 3300046477 | Bacteria | 949 |
| 541 | Ga0495664_0349210 | 3300046477 | Bacteria | 891 |
| 542 | Ga0495664_0478508 | 3300046477 | Bacteria | 744 |
| 543 | Ga0495596_0085800 | 3300046500 | Bacteria | 1222 |
| 544 | Ga0495607_0091009 | 3300046501 | Bacteria | 1653 |
| 545 | Ga0495607_0390050 | 3300046501 | Bacteria | 635 |
| 546 | Ga0495606_0030986 | 3300046507 | Bacteria | 3724 |
| 547 | Ga0495606_0067180 | 3300046507 | Bacteria | 2271 |
| 548 | Ga0495606_0188110 | 3300046507 | Bacteria | 1185 |
| 549 | Ga0495606_0328816 | 3300046507 | Bacteria | 818 |
| 550 | Ga0495606_0575883 | 3300046507 | Bacteria | 556 |
| 551 | Ga0495608_0060869 | 3300046511 | Bacteria | 2484 |
| 552 | Ga0495608_0062211 | 3300046511 | Bacteria | 2453 |
| 553 | Ga0495610_0049875 | 3300046512 | Bacteria | 2046 |
| 554 | Ga0495610_0070967 | 3300046512 | Bacteria | 1625 |
| 555 | Ga0495610_0318724 | 3300046512 | Bacteria | 594 |
| 556 | Ga0495616_0200975 | 3300046513 | Bacteria | 876 |
| 557 | Ga0495616_0455469 | 3300046513 | Bacteria | 517 |
| 558 | Ga0495618_0072718 | 3300046514 | Bacteria | 2188 |
| 559 | Ga0495618_0488045 | 3300046514 | Bacteria | 744 |
| 560 | Ga0495620_0060288 | 3300046515 | Bacteria | 1582 |
| 561 | Ga0495620_0253694 | 3300046515 | Bacteria | 670 |
| 562 | Ga0495628_0132421 | 3300046516 | Bacteria | 1906 |
| 563 | Ga0495630_0986379 | 3300046517 | Bacteria | 640 |
| 564 | Ga0495631_0068084 | 3300046518 | Bacteria | 1540 |
| 565 | Ga0495631_0284250 | 3300046518 | Bacteria | 704 |
| 566 | Ga0495632_0146312 | 3300046519 | Bacteria | 1094 |
| 567 | Ga0495637_0141801 | 3300046520 | Bacteria | 911 |
| 568 | Ga0495643_0028133 | 3300046522 | Bacteria | 3154 |
| 569 | Ga0495643_0075593 | 3300046522 | Bacteria | 1762 |
| 570 | Ga0495648_0050585 | 3300046524 | Bacteria | 2537 |
| 571 | Ga0495648_0064052 | 3300046524 | Bacteria | 2167 |
| 572 | Ga0495648_0237437 | 3300046524 | Bacteria | 888 |
| 573 | Ga0495648_0258598 | 3300046524 | Bacteria | 836 |
| 574 | Ga0495666_0363793 | 3300046526 | Bacteria | 651 |
| 575 | Ga0495652_0053762 | 3300046529 | Bacteria | 3432 |
| 576 | Ga0495652_0469601 | 3300046529 | Bacteria | 877 |
| 577 | Ga0495654_0095952 | 3300046530 | Bacteria | 1370 |
| 578 | Ga0495654_0452613 | 3300046530 | Bacteria | 505 |
| 579 | Ga0495640_0057207 | 3300046533 | Bacteria | 2662 |
| 580 | Ga0495640_0140324 | 3300046533 | Bacteria | 1558 |
| 581 | Ga0495587_0021616 | 3300046536 | Bacteria | 3969 |
| 582 | Ga0495587_0245417 | 3300046536 | Bacteria | 1007 |
| 583 | Ga0495609_0031800 | 3300046538 | Bacteria | 2398 |
| 584 | Ga0495609_0133495 | 3300046538 | Bacteria | 1062 |
| 585 | Ga0495597_0199933 | 3300046542 | Bacteria | 801 |
| 586 | Ga0495597_0386445 | 3300046542 | Bacteria | 533 |
| 587 | Ga0495645_0111168 | 3300046543 | Bacteria | 1938 |
| 588 | Ga0495645_0112784 | 3300046543 | Bacteria | 1922 |
| 589 | Ga0495622_0009981 | 3300046557 | Bacteria | 4392 |
| 590 | Ga0495622_0040118 | 3300046557 | Bacteria | 2179 |
| 591 | Ga0495622_0052370 | 3300046557 | Bacteria | 1893 |
| 592 | Ga0495622_0290350 | 3300046557 | Bacteria | 714 |
| 593 | Ga0495667_0053258 | 3300046559 | Bacteria | 2665 |
| 594 | Ga0495667_0200209 | 3300046559 | Bacteria | 1278 |
| 595 | Ga0495668_0048350 | 3300046616 | Bacteria | 2360 |
| 596 | Ga0495668_0225914 | 3300046616 | Bacteria | 1025 |
| 597 | Ga0495668_0241109 | 3300046616 | Bacteria | 990 |
| 598 | Ga0495668_0331889 | 3300046616 | Bacteria | 834 |
| 599 | Ga0495634_0040997 | 3300046642 | Bacteria | 3146 |
| 600 | Ga0495634_0177656 | 3300046642 | Bacteria | 1335 |
| 601 | Ga0495611_0249773 | 3300046648 | Bacteria | 822 |
| 602 | Ga0495625_0030766 | 3300046660 | Bacteria | 4000 |
| 603 | Ga0495625_0038858 | 3300046660 | Bacteria | 3479 |
| 604 | Ga0495625_0198951 | 3300046660 | Bacteria | 1324 |
| 605 | Ga0495625_0583290 | 3300046660 | Bacteria | 673 |
| 606 | Ga0495635_0023671 | 3300046663 | Bacteria | 4277 |
| 607 | Ga0495635_0031388 | 3300046663 | Bacteria | 3689 |
| 608 | Ga0495661_0098074 | 3300046665 | Bacteria | 1655 |
| 609 | Ga0495661_0126378 | 3300046665 | Bacteria | 1406 |
| 610 | Ga0495661_0279441 | 3300046665 | Bacteria | 842 |
| 611 | Ga0495588_0055901 | 3300046674 | Bacteria | 2037 |
| 612 | Ga0495657_0016485 | 3300046675 | Bacteria | 5383 |
| 613 | Ga0495657_0055404 | 3300046675 | Bacteria | 2644 |
| 614 | Ga0495599_0035925 | 3300046678 | Bacteria | 3110 |
| 615 | Ga0495623_0041891 | 3300046679 | Bacteria | 2918 |
| 616 | Ga0495669_0406910 | 3300046684 | Bacteria | 660 |
| 617 | Ga0495613_0079714 | 3300046689 | Bacteria | 2381 |
| 618 | Ga0495613_0636937 | 3300046689 | Bacteria | 706 |
| 619 | Ga0495624_0580529 | 3300046690 | Bacteria | 668 |
| 620 | Ga0495670_0026163 | 3300046691 | Bacteria | 2888 |
| 621 | Ga0495671_0043264 | 3300046692 | Bacteria | 2261 |
| 622 | Ga0495671_0480141 | 3300046692 | Bacteria | 593 |
| 623 | Ga0495649_0040446 | 3300046694 | Bacteria | 2553 |
| 624 | Ga0495649_0042895 | 3300046694 | Bacteria | 2470 |
| 625 | Ga0495649_0359144 | 3300046694 | Bacteria | 735 |
| 626 | Ga0495600_0129859 | 3300046809 | Bacteria | 1638 |
| 627 | Ga0495600_0203778 | 3300046809 | Bacteria | 1269 |
| 628 | Ga0495660_0051426 | 3300046810 | Bacteria | 2242 |
| 629 | Ga0495660_0360464 | 3300046810 | Bacteria | 645 |
| 630 | Ga0495581_0128299 | 3300047315 | Bacteria | 1477 |
| 631 | Ga0495581_0149248 | 3300047315 | Bacteria | 1365 |
| 632 | Ga0495581_0812326 | 3300047315 | Bacteria | 536 |
| 633 | Ga0495604_0003054 | 3300047317 | Bacteria | 13376 |
| 634 | Ga0495604_0041708 | 3300047317 | Bacteria | 3598 |
| 635 | Ga0495604_0217471 | 3300047317 | Bacteria | 1317 |
| 636 | Ga0495674_0415602 | 3300047319 | Bacteria | 1084 |
| 637 | Ga0495672_0036011 | 3300047320 | Bacteria | 3042 |
| 638 | Ga0495676_0626363 | 3300047321 | Bacteria | 699 |
| 639 | Ga0495680_0009821 | 3300047322 | Bacteria | 8580 |
| 640 | Ga0495680_0759034 | 3300047322 | Bacteria | 636 |
| 641 | Ga0495683_0033555 | 3300047323 | Bacteria | 2611 |
| 642 | Ga0495683_0094088 | 3300047323 | Bacteria | 1448 |
| 643 | Ga0495683_0191404 | 3300047323 | Bacteria | 928 |
| 644 | Ga0495687_050393 | 3300047443 | Bacteria | 1774 |
| 645 | Ga0495675_0013853 | 3300047444 | Bacteria | 5097 |
| 646 | Ga0495679_049956 | 3300047446 | Bacteria | 1260 |
| 647 | Ga0495673_0080196 | 3300047469 | Bacteria | 1353 |
| 648 | Ga0495673_0101115 | 3300047469 | Bacteria | 1165 |
| 649 | Ga0495681_0152685 | 3300047470 | Bacteria | 968 |
| 650 | Ga0495684_0635979 | 3300047471 | Bacteria | 715 |
| 651 | Ga0495686_0119194 | 3300047472 | Bacteria | 1575 |
| 652 | Ga0495686_0168208 | 3300047472 | Bacteria | 1276 |
| 653 | Ga0495686_0339242 | 3300047472 | Bacteria | 819 |
| 654 | Ga0495686_0394564 | 3300047472 | Bacteria | 744 |
| 655 | Ga0495593_0028504 | 3300047673 | Bacteria | 3066 |
| 656 | Ga0495593_0246960 | 3300047673 | Bacteria | 894 |
| 657 | Ga0495593_0436123 | 3300047673 | Bacteria | 655 |
| 658 | Ga0495602_0052424 | 3300048088 | Bacteria | 3623 |
| 659 | Ga0495602_0297797 | 3300048088 | Bacteria | 1181 |
| 660 | Ga0495602_0975344 | 3300048088 | Bacteria | 560 |
| 661 | Ga0495614_0104954 | 3300048089 | Bacteria | 1238 |
| 662 | Ga0495614_0120350 | 3300048089 | Bacteria | 1157 |
| 663 | Ga0495626_0064892 | 3300048091 | Bacteria | 1653 |
| 664 | Ga0495626_0266394 | 3300048091 | Bacteria | 684 |
| 665 | Ga0496100_0093485 | 3300048903 | Bacteria | 2057 |
| 666 | Ga0496100_0178283 | 3300048903 | Bacteria | 1535 |
| 667 | Ga0496100_0722340 | 3300048903 | Bacteria | 778 |
| 668 | Ga0496101_0065722 | 3300048904 | Bacteria | 2644 |
| 669 | Ga0496101_0328503 | 3300048904 | Bacteria | 1200 |
| 670 | Ga0496101_1391190 | 3300048904 | Bacteria | 547 |
| 671 | Ga0496102_0116763 | 3300048905 | Bacteria | 2490 |
| 672 | Ga0496102_0140116 | 3300048905 | Bacteria | 2267 |
| 673 | Ga0496102_0474575 | 3300048905 | Bacteria | 1172 |
| 674 | Ga0496102_1126269 | 3300048905 | Bacteria | 704 |
| 675 | Ga0496103_0008146 | 3300048906 | Bacteria | 6223 |
| 676 | Ga0496103_0551670 | 3300048906 | Bacteria | 736 |
| 677 | Ga0496104_0038487 | 3300048907 | Bacteria | 4475 |
| 678 | Ga0496104_0044409 | 3300048907 | Bacteria | 4175 |
| 679 | Ga0496104_0133123 | 3300048907 | Bacteria | 2388 |
| 680 | Ga0496105_0032381 | 3300048908 | Bacteria | 4289 |
| 681 | Ga0496105_0062791 | 3300048908 | Bacteria | 3065 |
| 682 | Ga0496105_0063630 | 3300048908 | Bacteria | 3043 |
| 683 | Ga0496106_0041714 | 3300048909 | Bacteria | 3439 |
| 684 | Ga0496106_0217335 | 3300048909 | Bacteria | 1523 |
| 685 | Ga0496106_0288897 | 3300048909 | Bacteria | 1314 |
| 686 | Ga0496106_0471014 | 3300048909 | Bacteria | 1009 |
| 687 | Ga0496106_1136216 | 3300048909 | Bacteria | 611 |
| 688 | Ga0496107_0034315 | 3300048910 | Bacteria | 3634 |
| 689 | Ga0496107_0151834 | 3300048910 | Bacteria | 1714 |
| 690 | Ga0496107_0861897 | 3300048910 | Bacteria | 661 |
| 691 | Ga0496108_0016881 | 3300048911 | Bacteria | 5967 |
| 692 | Ga0496108_0421798 | 3300048911 | Bacteria | 1165 |
| 693 | Ga0496108_0536819 | 3300048911 | Bacteria | 1021 |
| 694 | Ga0496110_0034199 | 3300048913 | Bacteria | 4401 |
| 695 | Ga0496110_0425015 | 3300048913 | Bacteria | 1211 |
| 696 | Ga0496111_0156108 | 3300048914 | Bacteria | 1693 |
| 697 | Ga0496111_0412822 | 3300048914 | Bacteria | 997 |
| 698 | Ga0496112_0027577 | 3300048915 | Bacteria | 5476 |
| 699 | Ga0496113_0051590 | 3300048916 | Bacteria | 3070 |
| 700 | Ga0496113_0291175 | 3300048916 | Bacteria | 1306 |
| 701 | Ga0496113_0295533 | 3300048916 | Bacteria | 1296 |
| 702 | Ga0496114_0032966 | 3300048917 | Bacteria | 4266 |
| 703 | Ga0496114_0215451 | 3300048917 | Bacteria | 1685 |
| 704 | Ga0496115_0176298 | 3300048918 | Bacteria | 1768 |
| 705 | Ga0496115_0690340 | 3300048918 | Bacteria | 803 |
| 706 | Ga0496116_0001906 | 3300048919 | Bacteria | 22482 |
| 707 | Ga0496116_0085259 | 3300048919 | Bacteria | 1942 |
| 708 | Ga0496116_0380962 | 3300048919 | Bacteria | 632 |
| 709 | Ga0496117_0015840 | 3300048920 | Bacteria | 6395 |
| 710 | Ga0496117_0086903 | 3300048920 | Bacteria | 2029 |
| 711 | Ga0496117_0134615 | 3300048920 | Bacteria | 1491 |
| 712 | Ga0496117_0306801 | 3300048920 | Bacteria | 838 |
| 713 | Ga0496117_0314808 | 3300048920 | Bacteria | 823 |
| 714 | Ga0496118_0034657 | 3300048921 | Bacteria | 4113 |
| 715 | Ga0496118_0151060 | 3300048921 | Bacteria | 1454 |
| 716 | Ga0496118_0156238 | 3300048921 | Bacteria | 1418 |
| 717 | Ga0496118_0160430 | 3300048921 | Bacteria | 1391 |
| 718 | Ga0496118_0165431 | 3300048921 | Bacteria | 1360 |
| 719 | Ga0496118_0571919 | 3300048921 | Bacteria | 546 |
| 720 | Ga0496119_0018797 | 3300048922 | Bacteria | 5123 |
| 721 | Ga0496119_0035827 | 3300048922 | Bacteria | 3246 |
| 722 | Ga0496119_0045469 | 3300048922 | Bacteria | 2752 |
| 723 | Ga0496119_0097375 | 3300048922 | Bacteria | 1658 |
| 724 | Ga0496119_0313779 | 3300048922 | Bacteria | 769 |
| 725 | Ga0496120_0029078 | 3300048923 | Bacteria | 3377 |
| 726 | Ga0496120_0072474 | 3300048923 | Bacteria | 1887 |
| 727 | Ga0496120_0095303 | 3300048923 | Bacteria | 1582 |
| 728 | Ga0496120_0177773 | 3300048923 | Bacteria | 1047 |
| 729 | Ga0496120_0222969 | 3300048923 | Bacteria | 900 |
| 730 | Ga0496120_0287462 | 3300048923 | Bacteria | 758 |
| 731 | Ga0496120_0298228 | 3300048923 | Bacteria | 739 |
| 732 | Ga0496121_0009004 | 3300048924 | Bacteria | 11575 |
| 733 | Ga0496121_0018129 | 3300048924 | Bacteria | 7121 |
| 734 | Ga0496121_0048015 | 3300048924 | Bacteria | 3637 |
| 735 | Ga0496121_0061856 | 3300048924 | Bacteria | 3070 |
| 736 | Ga0496121_0118304 | 3300048924 | Bacteria | 2006 |
| 737 | Ga0496121_0121261 | 3300048924 | Bacteria | 1974 |
| 738 | Ga0496121_0206266 | 3300048924 | Bacteria | 1396 |
| 739 | Ga0496121_0492157 | 3300048924 | Bacteria | 780 |
| 740 | Ga0496121_0776870 | 3300048924 | Bacteria | 566 |
| 741 | Ga0496122_0015242 | 3300048925 | Bacteria | 7356 |
| 742 | Ga0496122_0125615 | 3300048925 | Bacteria | 1643 |
| 743 | Ga0496122_0416039 | 3300048925 | Bacteria | 677 |
| 744 | Ga0496123_0006942 | 3300048926 | Bacteria | 10813 |
| 745 | Ga0496124_0065496 | 3300048927 | Bacteria | 3029 |
| 746 | Ga0496124_0073104 | 3300048927 | Bacteria | 2838 |
| 747 | Ga0496124_0126514 | 3300048927 | Bacteria | 2035 |
| 748 | Ga0496124_0634846 | 3300048927 | Bacteria | 688 |
| 749 | Ga0496124_0812105 | 3300048927 | Bacteria | 578 |
| 750 | Ga0496125_0008019 | 3300048928 | Bacteria | 11150 |
| 751 | Ga0496125_0034920 | 3300048928 | Bacteria | 4422 |
| 752 | Ga0496125_0040757 | 3300048928 | Bacteria | 3979 |
| 753 | Ga0496125_0082484 | 3300048928 | Bacteria | 2451 |
| 754 | Ga0496125_0133841 | 3300048928 | Bacteria | 1738 |
| 755 | Ga0496126_0009236 | 3300048929 | Bacteria | 10511 |
| 756 | Ga0496126_0019391 | 3300048929 | Bacteria | 6698 |
| 757 | Ga0496126_0050913 | 3300048929 | Bacteria | 3773 |
| 758 | Ga0496126_0061206 | 3300048929 | Bacteria | 3382 |
| 759 | Ga0496126_0092565 | 3300048929 | Bacteria | 2656 |
| 760 | Ga0496126_0118740 | 3300048929 | Bacteria | 2295 |
| 761 | Ga0496126_0156146 | 3300048929 | Bacteria | 1952 |
| 762 | Ga0496126_0158694 | 3300048929 | Bacteria | 1934 |
| 763 | Ga0496126_0248505 | 3300048929 | Bacteria | 1483 |
| 764 | Ga0496126_0666681 | 3300048929 | Bacteria | 812 |
| 765 | Ga0496126_1202423 | 3300048929 | Bacteria | 557 |
| 766 | Ga0496126_1316172 | 3300048929 | Bacteria | 525 |
| 767 | Ga0495678_069694 | 3300049459 | Bacteria | 1293 |
| 768 | Ga0495682_0009626 | 3300049460 | Bacteria | 3767 |
| 769 | Ga0501046_0015227 | 3300049580 | Bacteria | 6467 |
| 770 | Ga0501047_0059550 | 3300049581 | Bacteria | 3686 |
| 771 | Ga0501047_0196339 | 3300049581 | Bacteria | 1880 |
| 772 | Ga0501067_0256177 | 3300049583 | Bacteria | 974 |
| 773 | Ga0501070_0046583 | 3300049586 | Bacteria | 3605 |
| 774 | Ga0501073_0041052 | 3300049589 | Bacteria | 3270 |
| 775 | Ga0501074_0008985 | 3300049590 | Bacteria | 7251 |
| 776 | Ga0501079_0568949 | 3300049741 | Bacteria | 891 |
| 777 | Ga0501080_0094062 | 3300049742 | Bacteria | 2783 |
| 778 | Ga0501035_0276557 | 3300049822 | Bacteria | 1420 |
| 779 | Ga0501035_0479586 | 3300049822 | Bacteria | 1026 |
| 780 | Ga0501044_0104264 | 3300049823 | Bacteria | 2850 |
| 781 | Ga0501044_1000360 | 3300049823 | Bacteria | 708 |
| 782 | nmdc:mga03683_549237_c1 | 3300050489 | Bacteria | 562 |
| 783 | nmdc:mga03n38_11183_c1 | 3300050490 | Bacteria | 3335 |
| 784 | nmdc:mga03n38_776574_c1 | 3300050490 | Bacteria | 556 |
| 785 | nmdc:mga00v17_102408_c1 | 3300050491 | Bacteria | 1809 |
| 786 | nmdc:mga00v17_238788_c1 | 3300050491 | Bacteria | 1178 |
| 787 | nmdc:mga00v17_259155_c1 | 3300050491 | Bacteria | 1128 |
| 788 | nmdc:mga00v17_64421_c2 | 3300050491 | Bacteria | 881 |
| 789 | nmdc:mga00v17_919030_c1 | 3300050491 | Bacteria | 553 |
| 790 | nmdc:mga0yw44_103399_c1 | 3300050492 | Bacteria | 1817 |
| 791 | nmdc:mga0yw44_13689_c1 | 3300050492 | Bacteria | 4280 |
| 792 | nmdc:mga0yw44_165223_c1 | 3300050492 | Bacteria | 1451 |
| 793 | nmdc:mga0yw44_221506_c1 | 3300050492 | Bacteria | 1254 |
| 794 | nmdc:mga0yw44_401444_c1 | 3300050492 | Bacteria | 927 |
| 795 | nmdc:mga0yw44_42973_c1 | 3300050492 | Bacteria | 2697 |
| 796 | nmdc:mga0yw44_598720_c1 | 3300050492 | Bacteria | 749 |
| 797 | nmdc:mga0k408_143494_c1 | 3300050493 | Bacteria | 1421 |
| 798 | nmdc:mga0k408_28971_c1 | 3300050493 | Bacteria | 2633 |
| 799 | nmdc:mga06z11_2094_c1 | 3300050494 | Bacteria | 7575 |
| 800 | nmdc:mga06z11_456721_c1 | 3300050494 | Bacteria | 772 |
| 801 | nmdc:mga06z11_610461_c1 | 3300050494 | Bacteria | 664 |
| 802 | nmdc:mga04h51_1146_c1 | 3300050495 | Bacteria | 6124 |
| 803 | nmdc:mga07m45_22861_c1 | 3300050496 | Bacteria | 3415 |
| 804 | nmdc:mga07m45_363215_c1 | 3300050496 | Bacteria | 841 |
| 805 | nmdc:mga07m45_457164_c1 | 3300050496 | Bacteria | 740 |
| 806 | nmdc:mga07m45_467920_c1 | 3300050496 | Bacteria | 731 |
| 807 | nmdc:mga07m45_90366_c1 | 3300050496 | Bacteria | 1754 |
| 808 | nmdc:mga0rr50_303449_c1 | 3300050513 | Bacteria | 1336 |
| 809 | nmdc:mga08x19_99481_c1 | 3300050514 | Bacteria | 1928 |
| 810 | nmdc:mga0sz30_19652_c1 | 3300050516 | Bacteria | 2718 |
| 811 | nmdc:mga0sz30_484400_c1 | 3300050516 | Bacteria | 556 |
| 812 | nmdc:mga0sz30_6876_c1 | 3300050516 | Bacteria | 4247 |
| 813 | nmdc:mga0sz30_76137_c1 | 3300050516 | Bacteria | 1449 |
| 814 | Ga0495601_0068670 | 3300053077 | Bacteria | 2259 |
| 815 | Ga0495612_0369496 | 3300053078 | Bacteria | 649 |
| 816 | Ga0495612_0621939 | 3300053078 | Bacteria | 500 |
| 817 | Ga0500635_0015349 | 3300053080 | Bacteria | 2261 |
| 818 | Ga0495655_0014862 | 3300053083 | Bacteria | 1642 |
| 819 | Ga0495655_0023385 | 3300053083 | Bacteria | 1424 |
| 820 | Ga0495655_0232483 | 3300053083 | Bacteria | 614 |
| 821 | Ga0495619_0266401 | 3300053085 | Bacteria | 1187 |
| 822 | Ga0500578_0124755 | 3300053086 | Bacteria | 1617 |
| 823 | Ga0500578_0245251 | 3300053086 | Bacteria | 1081 |
| 824 | Ga0500578_0311758 | 3300053086 | Bacteria | 930 |
| 825 | Ga0500578_0438975 | 3300053086 | Bacteria | 745 |
| 826 | Ga0500578_0547239 | 3300053086 | Bacteria | 644 |
| 827 | Ga0500643_000197 | 3300053087 | Bacteria | 57531 |
| 828 | Ga0500643_027764 | 3300053087 | Bacteria | 1756 |
| 829 | Ga0500646_0204960 | 3300053090 | Bacteria | 678 |
| 830 | Ga0500583_0009378 | 3300053092 | Bacteria | 3574 |
| 831 | Ga0500583_0541466 | 3300053092 | Bacteria | 542 |
| 832 | Ga0500651_0019621 | 3300053093 | Bacteria | 4203 |
| 833 | Ga0500651_0185099 | 3300053093 | Bacteria | 1235 |
| 834 | Ga0500566_0000102 | 3300053094 | Bacteria | 43512 |
| 835 | Ga0500566_0002448 | 3300053094 | Bacteria | 11013 |
| 836 | Ga0500640_035152 | 3300053095 | Bacteria | 2202 |
| 837 | Ga0500648_043660 | 3300053097 | Bacteria | 2545 |
| 838 | Ga0500650_0354334 | 3300053098 | Bacteria | 641 |
| 839 | Ga0500650_0502924 | 3300053098 | Bacteria | 515 |
| 840 | Ga0500554_003722 | 3300053102 | Bacteria | 3150 |
| 841 | Ga0500554_114961 | 3300053102 | Bacteria | 906 |
| 842 | Ga0500555_010096 | 3300053103 | Bacteria | 2703 |
| 843 | Ga0500555_091693 | 3300053103 | Bacteria | 780 |
| 844 | Ga0500556_0000005 | 3300053104 | Bacteria | 581135 |
| 845 | Ga0500556_0036258 | 3300053104 | Bacteria | 1709 |
| 846 | Ga0500557_249117 | 3300053105 | Bacteria | 556 |
| 847 | Ga0500562_030251 | 3300053108 | Bacteria | 1426 |
| 848 | Ga0500562_049547 | 3300053108 | Bacteria | 1122 |
| 849 | Ga0500569_000840 | 3300053109 | Bacteria | 5448 |
| 850 | Ga0500569_009325 | 3300053109 | Bacteria | 2277 |
| 851 | Ga0500569_311000 | 3300053109 | Bacteria | 529 |
| 852 | Ga0500572_000793 | 3300053111 | Bacteria | 10109 |
| 853 | Ga0500593_240400 | 3300053117 | Bacteria | 621 |
| 854 | Ga0500594_0088556 | 3300053118 | Bacteria | 936 |
| 855 | Ga0500595_031991 | 3300053119 | Bacteria | 1760 |
| 856 | Ga0500608_000388 | 3300053122 | Bacteria | 16893 |
| 857 | Ga0500608_041848 | 3300053122 | Bacteria | 2198 |
| 858 | Ga0500608_080533 | 3300053122 | Bacteria | 1537 |
| 859 | Ga0500608_361337 | 3300053122 | Bacteria | 510 |
| 860 | Ga0500614_079792 | 3300053123 | Bacteria | 913 |
| 861 | Ga0500618_003834 | 3300053125 | Bacteria | 5017 |
| 862 | Ga0500621_208643 | 3300053126 | Bacteria | 686 |
| 863 | Ga0500626_346135 | 3300053128 | Bacteria | 501 |
| 864 | Ga0500642_0000009 | 3300053130 | Bacteria | 286829 |
| 865 | Ga0500642_0000439 | 3300053130 | Bacteria | 13378 |
| 866 | Ga0500642_0023472 | 3300053130 | Bacteria | 2477 |
| 867 | Ga0500652_000453 | 3300053131 | Bacteria | 14542 |
| 868 | Ga0500652_077104 | 3300053131 | Bacteria | 1386 |
| 869 | Ga0500655_084591 | 3300053133 | Bacteria | 655 |
| 870 | Ga0500658_0111513 | 3300053134 | Bacteria | 1204 |
| 871 | Ga0500559_0000586 | 3300053136 | Bacteria | 24993 |
| 872 | Ga0500559_0000957 | 3300053136 | Bacteria | 18135 |
| 873 | Ga0500559_0019024 | 3300053136 | Bacteria | 2902 |
| 874 | Ga0500559_0175117 | 3300053136 | Bacteria | 1009 |
| 875 | Ga0500564_181559 | 3300053138 | Unclassified | 877 |
| 876 | Ga0500564_197302 | 3300053138 | Bacteria | 829 |
| 877 | Ga0500568_0000637 | 3300053139 | Bacteria | 25280 |
| 878 | Ga0500568_0047809 | 3300053139 | Bacteria | 1693 |
| 879 | Ga0500573_0095639 | 3300053140 | Bacteria | 1674 |
| 880 | Ga0500577_0165179 | 3300053142 | Bacteria | 944 |
| 881 | Ga0500577_0256846 | 3300053142 | Bacteria | 760 |
| 882 | Ga0500588_0159073 | 3300053146 | Bacteria | 821 |
| 883 | Ga0500590_001186 | 3300053148 | Bacteria | 10342 |
| 884 | Ga0500590_165775 | 3300053148 | Bacteria | 978 |
| 885 | Ga0500590_361233 | 3300053148 | Bacteria | 514 |
| 886 | Ga0500603_000257 | 3300053150 | Bacteria | 13994 |
| 887 | Ga0500616_0000035 | 3300053153 | Bacteria | 394242 |
| 888 | Ga0500616_0123607 | 3300053153 | Bacteria | 1232 |
| 889 | Ga0500619_000798 | 3300053154 | Bacteria | 5377 |
| 890 | Ga0500619_173863 | 3300053154 | Bacteria | 729 |
| 891 | Ga0500619_254927 | 3300053154 | Bacteria | 577 |
| 892 | Ga0500620_248540 | 3300053155 | Bacteria | 592 |
| 893 | Ga0500622_0005661 | 3300053156 | Bacteria | 7435 |
| 894 | Ga0500624_014925 | 3300053157 | Bacteria | 1182 |
| 895 | Ga0500627_0003471 | 3300053158 | Bacteria | 4878 |
| 896 | Ga0500633_0053212 | 3300053160 | Bacteria | 1403 |
| 897 | Ga0500634_0036599 | 3300053161 | Bacteria | 2672 |
| 898 | Ga0500634_0177245 | 3300053161 | Bacteria | 964 |
| 899 | Ga0500638_175255 | 3300053162 | Bacteria | 930 |
| 900 | Ga0500638_272255 | 3300053162 | Bacteria | 669 |
| 901 | Ga0500639_017885 | 3300053163 | Bacteria | 3739 |
| 902 | Ga0500639_198796 | 3300053163 | Bacteria | 864 |
| 903 | Ga0500636_0003056 | 3300053177 | Bacteria | 9377 |
| 904 | Ga0500636_0123188 | 3300053177 | Bacteria | 1452 |
| 905 | Ga0500636_0198700 | 3300053177 | Unclassified | 1062 |
| 906 | Ga0500636_0280932 | 3300053177 | Bacteria | 831 |
| 907 | Ga0500636_0370467 | 3300053177 | Bacteria | 676 |
| 908 | Ga0500636_0478097 | 3300053177 | Bacteria | 556 |
| 909 | Ga0500637_0016076 | 3300053178 | Bacteria | 3983 |
| 910 | Ga0500637_0300241 | 3300053178 | Bacteria | 876 |
| 911 | Ga0500649_190022 | 3300053722 | Bacteria | 680 |
| 912 | Ga0500570_091002 | 3300053724 | Bacteria | 1328 |
| 913 | Ga0500576_192761 | 3300053725 | Bacteria | 704 |
| 914 | Ga0500625_010749 | 3300053729 | Bacteria | 4131 |
| 915 | Ga0500645_118861 | 3300053730 | Bacteria | 738 |
| 916 | Ga0500645_170189 | 3300053730 | Bacteria | 595 |
| 917 | Ga0500609_001617 | 3300053731 | Bacteria | 3280 |
| 918 | Ga0500552_004298 | 3300053733 | Bacteria | 1493 |
| 919 | Ga0500596_000109 | 3300053735 | Bacteria | 11573 |
| 920 | Ga0500596_011502 | 3300053735 | Bacteria | 1353 |
| 921 | Ga0500596_015690 | 3300053735 | Bacteria | 1137 |
| 922 | Ga0500599_008872 | 3300053736 | Bacteria | 1310 |
| 923 | Ga0500601_000397 | 3300053737 | Bacteria | 7498 |
| 924 | Ga0500661_011097 | 3300055283 | Bacteria | 1633 |
| 925 | Ga0466962_0097390 | 3300061719 | Bacteria | 1411 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009093 | Ga0105240_10711275 | Ga0105240_107112752 | 82 |
| 2 | 3300009545 | Ga0105237_10171437 | Ga0105237_101714373 | 82 |
| 3 | 3300025914 | Ga0207671_10151099 | Ga0207671_101510992 | 82 |
| 4 | 3300037418 | Ga0395900_0177754 | Ga0395900_0177754_300_578 | 84 |
| 5 | 3300037466 | Ga0395898_0245757 | Ga0395898_0245757_951_1229 | 84 |
| 6 | 3300038443 | Ga0395901_0379301 | Ga0395901_0379301_658_936 | 84 |
| 7 | 3300049823 | Ga0501044_1000360 | Ga0501044_1000360_147_425 | 84 |
| 8 | 3300003771 | Ga0055526_1083681 | Ga0055526_10836811 | 87 |
| 9 | 3300006038 | Ga0075365_10117047 | Ga0075365_101170472 | 87 |
| 10 | 3300006051 | Ga0075364_10019903 | Ga0075364_100199032 | 87 |
| 11 | 3300006186 | Ga0075369_10469816 | Ga0075369_104698162 | 87 |
| 12 | 3300006353 | Ga0075370_10168264 | Ga0075370_101682642 | 87 |
| 13 | 3300025295 | Ga0209564_1033620 | Ga0209564_10336202 | 87 |
| 14 | 3300048909 | Ga0496106_0471014 | Ga0496106_0471014_114_398 | 87 |
| 15 | 3300048919 | Ga0496116_0001906 | Ga0496116_0001906_2933_3217 | 87 |
| 16 | 3300048920 | Ga0496117_0015840 | Ga0496117_0015840_5567_5851 | 87 |
| 17 | 3300048921 | Ga0496118_0160430 | Ga0496118_0160430_193_477 | 87 |
| 18 | 3300048927 | Ga0496124_0126514 | Ga0496124_0126514_944_1228 | 87 |
| 19 | 3300048928 | Ga0496125_0034920 | Ga0496125_0034920_3936_4220 | 87 |
| 20 | 3300050491 | nmdc:mga00v17_64421_c2 | nmdc:mga00v17_64421_c2_393_677 | 87 |
| 21 | 3300050496 | nmdc:mga07m45_363215_c1 | nmdc:mga07m45_363215_c1_275_559 | 87 |
| 22 | 3300050516 | nmdc:mga0sz30_19652_c1 | nmdc:mga0sz30_19652_c1_1389_1673 | 87 |
| 23 | iso_pu_bacteria | 2602042107 | 2603858020 | 87 |
| 24 | iso_pu_bacteria | 8006926726 | 8006930497 | 87 |
| 25 | 3300005718 | Ga0068866_10770201 | Ga0068866_107702011 | 88 |
| 26 | 3300006941 | Ga0099825_1037844 | Ga0099825_10378442 | 88 |
| 27 | 3300006942 | Ga0099824_1022833 | Ga0099824_10228332 | 88 |
| 28 | 3300006943 | Ga0099822_1000918 | Ga0099822_10009182 | 88 |
| 29 | 3300026067 | Ga0207678_10036179 | Ga0207678_100361792 | 88 |
| 30 | 3300027357 | Ga0209589_1000035 | Ga0209589_1000035127 | 88 |
| 31 | 3300027361 | Ga0209489_100079 | Ga0209489_100079127 | 88 |
| 32 | 3300027363 | Ga0209700_100077 | Ga0209700_100077127 | 88 |
| 33 | 3300028794 | Ga0307515_10119659 | Ga0307515_101196592 | 88 |
| 34 | 3300031456 | Ga0307513_10631505 | Ga0307513_106315052 | 88 |
| 35 | 3300031731 | Ga0307405_11000753 | Ga0307405_110007532 | 88 |
| 36 | 3300031911 | Ga0307412_10193911 | Ga0307412_101939112 | 88 |
| 37 | 3300037471 | Ga0395905_0597083 | Ga0395905_0597083_181_492 | 88 |
| 38 | 3300046460 | Ga0495638_0011802 | Ga0495638_0011802_985_1272 | 88 |
| 39 | 3300046501 | Ga0495607_0390050 | Ga0495607_0390050_165_452 | 88 |
| 40 | 3300046507 | Ga0495606_0188110 | Ga0495606_0188110_93_380 | 88 |
| 41 | 3300046512 | Ga0495610_0049875 | Ga0495610_0049875_1465_1752 | 88 |
| 42 | 3300046513 | Ga0495616_0455469 | Ga0495616_0455469_122_409 | 88 |
| 43 | 3300046515 | Ga0495620_0060288 | Ga0495620_0060288_153_440 | 88 |
| 44 | 3300046518 | Ga0495631_0068084 | Ga0495631_0068084_1005_1292 | 88 |
| 45 | 3300046520 | Ga0495637_0141801 | Ga0495637_0141801_176_463 | 88 |
| 46 | 3300046524 | Ga0495648_0258598 | Ga0495648_0258598_237_524 | 88 |
| 47 | 3300046530 | Ga0495654_0095952 | Ga0495654_0095952_240_527 | 88 |
| 48 | 3300046542 | Ga0495597_0386445 | Ga0495597_0386445_37_324 | 88 |
| 49 | 3300046557 | Ga0495622_0040118 | Ga0495622_0040118_886_1173 | 88 |
| 50 | 3300046616 | Ga0495668_0225914 | Ga0495668_0225914_480_767 | 88 |
| 51 | 3300046660 | Ga0495625_0030766 | Ga0495625_0030766_2545_2832 | 88 |
| 52 | 3300046660 | Ga0495625_0198951 | Ga0495625_0198951_68_352 | 88 |
| 53 | 3300046665 | Ga0495661_0126378 | Ga0495661_0126378_778_1065 | 88 |
| 54 | 3300046691 | Ga0495670_0026163 | Ga0495670_0026163_1747_2034 | 88 |
| 55 | 3300046692 | Ga0495671_0480141 | Ga0495671_0480141_37_324 | 88 |
| 56 | 3300046810 | Ga0495660_0051426 | Ga0495660_0051426_1153_1440 | 88 |
| 57 | 3300047317 | Ga0495604_0217471 | Ga0495604_0217471_123_410 | 88 |
| 58 | 3300047320 | Ga0495672_0036011 | Ga0495672_0036011_296_571 | 88 |
| 59 | 3300047321 | Ga0495676_0626363 | Ga0495676_0626363_261_548 | 88 |
| 60 | 3300047323 | Ga0495683_0191404 | Ga0495683_0191404_430_717 | 88 |
| 61 | 3300047470 | Ga0495681_0152685 | Ga0495681_0152685_186_473 | 88 |
| 62 | 3300047472 | Ga0495686_0168208 | Ga0495686_0168208_469_756 | 88 |
| 63 | 3300047673 | Ga0495593_0246960 | Ga0495593_0246960_586_873 | 88 |
| 64 | 3300048919 | Ga0496116_0380962 | Ga0496116_0380962_27_314 | 88 |
| 65 | 3300048920 | Ga0496117_0134615 | Ga0496117_0134615_183_470 | 88 |
| 66 | 3300048923 | Ga0496120_0029078 | Ga0496120_0029078_587_874 | 88 |
| 67 | 3300048923 | Ga0496120_0287462 | Ga0496120_0287462_82_366 | 88 |
| 68 | 3300048924 | Ga0496121_0009004 | Ga0496121_0009004_5711_5998 | 88 |
| 69 | 3300048924 | Ga0496121_0118304 | Ga0496121_0118304_202_507 | 88 |
| 70 | 3300048925 | Ga0496122_0416039 | Ga0496122_0416039_138_425 | 88 |
| 71 | 3300048926 | Ga0496123_0006942 | Ga0496123_0006942_2920_3207 | 88 |
| 72 | 3300048928 | Ga0496125_0008019 | Ga0496125_0008019_1407_1694 | 88 |
| 73 | 3300048929 | Ga0496126_0118740 | Ga0496126_0118740_1637_1924 | 88 |
| 74 | 3300049459 | Ga0495678_069694 | Ga0495678_069694_472_759 | 88 |
| 75 | 3300050492 | nmdc:mga0yw44_165223_c1 | nmdc:mga0yw44_165223_c1_780_1067 | 88 |
| 76 | 3300053086 | Ga0500578_0311758 | Ga0500578_0311758_161_448 | 88 |
| 77 | 3300053087 | Ga0500643_027764 | Ga0500643_027764_630_917 | 88 |
| 78 | 3300053090 | Ga0500646_0204960 | Ga0500646_0204960_129_416 | 88 |
| 79 | 3300053093 | Ga0500651_0019621 | Ga0500651_0019621_981_1268 | 88 |
| 80 | 3300053094 | Ga0500566_0002448 | Ga0500566_0002448_3980_4267 | 88 |
| 81 | 3300053102 | Ga0500554_114961 | Ga0500554_114961_50_337 | 88 |
| 82 | 3300053103 | Ga0500555_091693 | Ga0500555_091693_201_488 | 88 |
| 83 | 3300053104 | Ga0500556_0000005 | Ga0500556_0000005_416681_416968 | 88 |
| 84 | 3300053108 | Ga0500562_049547 | Ga0500562_049547_17_304 | 88 |
| 85 | 3300053109 | Ga0500569_009325 | Ga0500569_009325_1221_1508 | 88 |
| 86 | 3300053117 | Ga0500593_240400 | Ga0500593_240400_309_596 | 88 |
| 87 | 3300053122 | Ga0500608_000388 | Ga0500608_000388_6907_7194 | 88 |
| 88 | 3300053125 | Ga0500618_003834 | Ga0500618_003834_4532_4819 | 88 |
| 89 | 3300053126 | Ga0500621_208643 | Ga0500621_208643_200_487 | 88 |
| 90 | 3300053130 | Ga0500642_0000009 | Ga0500642_0000009_183341_183628 | 88 |
| 91 | 3300053131 | Ga0500652_000453 | Ga0500652_000453_7962_8249 | 88 |
| 92 | 3300053136 | Ga0500559_0000957 | Ga0500559_0000957_3849_4136 | 88 |
| 93 | 3300053138 | Ga0500564_197302 | Ga0500564_197302_333_620 | 88 |
| 94 | 3300053139 | Ga0500568_0000637 | Ga0500568_0000637_16098_16385 | 88 |
| 95 | 3300053142 | Ga0500577_0256846 | Ga0500577_0256846_93_380 | 88 |
| 96 | 3300053148 | Ga0500590_001186 | Ga0500590_001186_3633_3920 | 88 |
| 97 | 3300053153 | Ga0500616_0000035 | Ga0500616_0000035_5367_5654 | 88 |
| 98 | 3300053154 | Ga0500619_254927 | Ga0500619_254927_64_351 | 88 |
| 99 | 3300053157 | Ga0500624_014925 | Ga0500624_014925_41_328 | 88 |
| 100 | 3300053160 | Ga0500633_0053212 | Ga0500633_0053212_152_439 | 88 |
| 101 | 3300053161 | Ga0500634_0177245 | Ga0500634_0177245_377_664 | 88 |
| 102 | 3300053177 | Ga0500636_0003056 | Ga0500636_0003056_4091_4378 | 88 |
| 103 | 3300053724 | Ga0500570_091002 | Ga0500570_091002_980_1267 | 88 |
| 104 | 3300053730 | Ga0500645_170189 | Ga0500645_170189_200_487 | 88 |
| 105 | 3300053735 | Ga0500596_015690 | Ga0500596_015690_375_662 | 88 |
| 106 | iso_pu_bacteria | 2857524615 | 2857527402 | 88 |
| 107 | iso_pu_bacteria | 2893066018 | 2893071940 | 88 |
| 108 | 3300003911 | JGI25405J52794_10074847 | JGI25405J52794_100748472 | 89 |
| 109 | 3300005937 | Ga0081455_10000714 | Ga0081455_1000071427 | 89 |
| 110 | 3300047469 | Ga0495673_0101115 | Ga0495673_0101115_19_321 | 89 |
| 111 | 3300006028 | Ga0070717_11113479 | Ga0070717_111134792 | 90 |
| 112 | 3300031616 | Ga0307508_10813867 | Ga0307508_108138671 | 90 |
| 113 | 3300033180 | Ga0307510_10004240 | Ga0307510_1000424018 | 90 |
| 114 | 3300035118 | Ga0373954_0486799 | Ga0373954_0486799_185_466 | 90 |
| 115 | 3300036401 | Ga0373937_0597865 | Ga0373937_0597865_228_509 | 90 |
| 116 | 3300038443 | Ga0395901_0173084 | Ga0395901_0173084_927_1199 | 90 |
| 117 | 3300039450 | Ga0436363_0882467 | Ga0436363_0882467_49_321 | 90 |
| 118 | 3300039453 | Ga0436362_0487714 | Ga0436362_0487714_1262_1621 | 90 |
| 119 | 3300044656 | Ga0466969_0206966 | Ga0466969_0206966_69_350 | 90 |
| 120 | 3300044684 | Ga0466966_0035021 | Ga0466966_0035021_702_983 | 90 |
| 121 | 3300044765 | Ga0466970_0131056 | Ga0466970_0131056_774_1055 | 90 |
| 122 | 3300045049 | Ga0466959_0130082 | Ga0466959_0130082_177_458 | 90 |
| 123 | 3300046460 | Ga0495638_0035083 | Ga0495638_0035083_1092_1367 | 90 |
| 124 | 3300046462 | Ga0495651_0141007 | Ga0495651_0141007_674_955 | 90 |
| 125 | 3300046524 | Ga0495648_0050585 | Ga0495648_0050585_36_311 | 90 |
| 126 | 3300046530 | Ga0495654_0452613 | Ga0495654_0452613_35_310 | 90 |
| 127 | 3300046648 | Ga0495611_0249773 | Ga0495611_0249773_13_288 | 90 |
| 128 | 3300046660 | Ga0495625_0583290 | Ga0495625_0583290_118_393 | 90 |
| 129 | 3300046665 | Ga0495661_0098074 | Ga0495661_0098074_56_331 | 90 |
| 130 | 3300046694 | Ga0495649_0359144 | Ga0495649_0359144_314_589 | 90 |
| 131 | 3300046810 | Ga0495660_0360464 | Ga0495660_0360464_56_331 | 90 |
| 132 | 3300047322 | Ga0495680_0759034 | Ga0495680_0759034_46_327 | 90 |
| 133 | 3300047446 | Ga0495679_049956 | Ga0495679_049956_270_545 | 90 |
| 134 | 3300047472 | Ga0495686_0394564 | Ga0495686_0394564_294_569 | 90 |
| 135 | 3300048088 | Ga0495602_0975344 | Ga0495602_0975344_236_517 | 90 |
| 136 | 3300048091 | Ga0495626_0266394 | Ga0495626_0266394_351_626 | 90 |
| 137 | 3300048922 | Ga0496119_0313779 | Ga0496119_0313779_333_608 | 90 |
| 138 | 3300048923 | Ga0496120_0177773 | Ga0496120_0177773_576_851 | 90 |
| 139 | 3300048924 | Ga0496121_0492157 | Ga0496121_0492157_422_697 | 90 |
| 140 | 3300048927 | Ga0496124_0812105 | Ga0496124_0812105_31_309 | 90 |
| 141 | 3300053086 | Ga0500578_0438975 | Ga0500578_0438975_148_423 | 90 |
| 142 | 3300053087 | Ga0500643_000197 | Ga0500643_000197_680_955 | 90 |
| 143 | 3300053092 | Ga0500583_0009378 | Ga0500583_0009378_1377_1652 | 90 |
| 144 | 3300053098 | Ga0500650_0354334 | Ga0500650_0354334_115_390 | 90 |
| 145 | 3300053103 | Ga0500555_010096 | Ga0500555_010096_2362_2637 | 90 |
| 146 | 3300053104 | Ga0500556_0036258 | Ga0500556_0036258_555_830 | 90 |
| 147 | 3300053108 | Ga0500562_030251 | Ga0500562_030251_430_705 | 90 |
| 148 | 3300053118 | Ga0500594_0088556 | Ga0500594_0088556_646_921 | 90 |
| 149 | 3300053130 | Ga0500642_0023472 | Ga0500642_0023472_1471_1746 | 90 |
| 150 | 3300053131 | Ga0500652_077104 | Ga0500652_077104_708_983 | 90 |
| 151 | 3300053133 | Ga0500655_084591 | Ga0500655_084591_53_328 | 90 |
| 152 | 3300053134 | Ga0500658_0111513 | Ga0500658_0111513_53_328 | 90 |
| 153 | 3300053139 | Ga0500568_0047809 | Ga0500568_0047809_327_602 | 90 |
| 154 | 3300053142 | Ga0500577_0165179 | Ga0500577_0165179_261_536 | 90 |
| 155 | 3300053146 | Ga0500588_0159073 | Ga0500588_0159073_359_634 | 90 |
| 156 | 3300053153 | Ga0500616_0123607 | Ga0500616_0123607_927_1202 | 90 |
| 157 | 3300053156 | Ga0500622_0005661 | Ga0500622_0005661_867_1142 | 90 |
| 158 | 3300053158 | Ga0500627_0003471 | Ga0500627_0003471_3738_4013 | 90 |
| 159 | 3300053161 | Ga0500634_0036599 | Ga0500634_0036599_462_737 | 90 |
| 160 | 3300053730 | Ga0500645_118861 | Ga0500645_118861_342_617 | 90 |
| 161 | 3300053736 | Ga0500599_008872 | Ga0500599_008872_767_1042 | 90 |
| 162 | 3300055283 | Ga0500661_011097 | Ga0500661_011097_342_617 | 90 |
| 163 | 3300061719 | Ga0466962_0097390 | Ga0466962_0097390_222_503 | 90 |
| 164 | 3300001990 | JGI24737J22298_10200636 | JGI24737J22298_102006361 | 91 |
| 165 | 3300003215 | JGI25153J46596_10009426 | JGI25153J46596_100094262 | 91 |
| 166 | 3300003215 | JGI25153J46596_10009681 | JGI25153J46596_100096815 | 91 |
| 167 | 3300003215 | JGI25153J46596_10009764 | JGI25153J46596_100097645 | 91 |
| 168 | 3300003354 | JGI25160J50197_1001038 | JGI25160J50197_10010385 | 91 |
| 169 | 3300003354 | JGI25160J50197_1002799 | JGI25160J50197_10027992 | 91 |
| 170 | 3300003659 | JGI25404J52841_10065243 | JGI25404J52841_100652432 | 91 |
| 171 | 3300003752 | Ga0055539_1018108 | Ga0055539_10181082 | 91 |
| 172 | 3300003762 | Ga0055542_1006171 | Ga0055542_10061714 | 91 |
| 173 | 3300003771 | Ga0055526_1036333 | Ga0055526_10363331 | 91 |
| 174 | 3300003794 | Ga0055531_10001452 | Ga0055531_100014524 | 91 |
| 175 | 3300004625 | Ga0055543_1007350 | Ga0055543_10073502 | 91 |
| 176 | 3300005262 | Ga0065165_1009022 | Ga0065165_10090226 | 91 |
| 177 | 3300005262 | Ga0065165_1009421 | Ga0065165_10094215 | 91 |
| 178 | 3300005262 | Ga0065165_1032020 | Ga0065165_10320203 | 91 |
| 179 | 3300005329 | Ga0070683_100017083 | Ga0070683_1000170836 | 91 |
| 180 | 3300005329 | Ga0070683_100287789 | Ga0070683_1002877893 | 91 |
| 181 | 3300005334 | Ga0068869_100041945 | Ga0068869_1000419452 | 91 |
| 182 | 3300005336 | Ga0070680_100166491 | Ga0070680_1001664912 | 91 |
| 183 | 3300005336 | Ga0070680_100908337 | Ga0070680_1009083372 | 91 |
| 184 | 3300005337 | Ga0070682_101890726 | Ga0070682_1018907261 | 91 |
| 185 | 3300005338 | Ga0068868_100117188 | Ga0068868_1001171881 | 91 |
| 186 | 3300005339 | Ga0070660_100151355 | Ga0070660_1001513552 | 91 |
| 187 | 3300005347 | Ga0070668_100310687 | Ga0070668_1003106873 | 91 |
| 188 | 3300005353 | Ga0070669_101811366 | Ga0070669_1018113661 | 91 |
| 189 | 3300005355 | Ga0070671_100016125 | Ga0070671_1000161252 | 91 |
| 190 | 3300005356 | Ga0070674_100985290 | Ga0070674_1009852901 | 91 |
| 191 | 3300005364 | Ga0070673_101539322 | Ga0070673_1015393222 | 91 |
| 192 | 3300005366 | Ga0070659_100320536 | Ga0070659_1003205361 | 91 |
| 193 | 3300005366 | Ga0070659_100389105 | Ga0070659_1003891052 | 91 |
| 194 | 3300005434 | Ga0070709_10860417 | Ga0070709_108604172 | 91 |
| 195 | 3300005434 | Ga0070709_11537159 | Ga0070709_115371591 | 91 |
| 196 | 3300005435 | Ga0070714_100637769 | Ga0070714_1006377692 | 91 |
| 197 | 3300005436 | Ga0070713_100537895 | Ga0070713_1005378952 | 91 |
| 198 | 3300005436 | Ga0070713_101653565 | Ga0070713_1016535651 | 91 |
| 199 | 3300005437 | Ga0070710_10021089 | Ga0070710_100210893 | 91 |
| 200 | 3300005437 | Ga0070710_10026413 | Ga0070710_100264135 | 91 |
| 201 | 3300005437 | Ga0070710_10598807 | Ga0070710_105988071 | 91 |
| 202 | 3300005437 | Ga0070710_11417924 | Ga0070710_114179241 | 91 |
| 203 | 3300005439 | Ga0070711_100014236 | Ga0070711_1000142365 | 91 |
| 204 | 3300005439 | Ga0070711_100102906 | Ga0070711_1001029063 | 91 |
| 205 | 3300005439 | Ga0070711_101137207 | Ga0070711_1011372071 | 91 |
| 206 | 3300005445 | Ga0070708_101332860 | Ga0070708_1013328601 | 91 |
| 207 | 3300005455 | Ga0070663_100669534 | Ga0070663_1006695342 | 91 |
| 208 | 3300005456 | Ga0070678_102220964 | Ga0070678_1022209641 | 91 |
| 209 | 3300005457 | Ga0070662_101003699 | Ga0070662_1010036992 | 91 |
| 210 | 3300005457 | Ga0070662_101407564 | Ga0070662_1014075642 | 91 |
| 211 | 3300005458 | Ga0070681_10043341 | Ga0070681_100433415 | 91 |
| 212 | 3300005458 | Ga0070681_10176986 | Ga0070681_101769862 | 91 |
| 213 | 3300005530 | Ga0070679_100069743 | Ga0070679_1000697436 | 91 |
| 214 | 3300005530 | Ga0070679_100167183 | Ga0070679_1001671833 | 91 |
| 215 | 3300005535 | Ga0070684_100002379 | Ga0070684_10000237910 | 91 |
| 216 | 3300005539 | Ga0068853_100938869 | Ga0068853_1009388691 | 91 |
| 217 | 3300005546 | Ga0070696_100998745 | Ga0070696_1009987451 | 91 |
| 218 | 3300005547 | Ga0070693_100253786 | Ga0070693_1002537862 | 91 |
| 219 | 3300005548 | Ga0070665_100488284 | Ga0070665_1004882842 | 91 |
| 220 | 3300005563 | Ga0068855_100078484 | Ga0068855_1000784846 | 91 |
| 221 | 3300005563 | Ga0068855_100214813 | Ga0068855_1002148132 | 91 |
| 222 | 3300005563 | Ga0068855_100269496 | Ga0068855_1002694963 | 91 |
| 223 | 3300005563 | Ga0068855_100335734 | Ga0068855_1003357342 | 91 |
| 224 | 3300005563 | Ga0068855_100678334 | Ga0068855_1006783341 | 91 |
| 225 | 3300005564 | Ga0070664_100354923 | Ga0070664_1003549232 | 91 |
| 226 | 3300005564 | Ga0070664_100756216 | Ga0070664_1007562162 | 91 |
| 227 | 3300005577 | Ga0068857_100073827 | Ga0068857_1000738275 | 91 |
| 228 | 3300005577 | Ga0068857_100081384 | Ga0068857_1000813842 | 91 |
| 229 | 3300005577 | Ga0068857_100279812 | Ga0068857_1002798124 | 91 |
| 230 | 3300005614 | Ga0068856_100069412 | Ga0068856_1000694122 | 91 |
| 231 | 3300005616 | Ga0068852_100724871 | Ga0068852_1007248712 | 91 |
| 232 | 3300005616 | Ga0068852_101200886 | Ga0068852_1012008861 | 91 |
| 233 | 3300005617 | Ga0068859_100039038 | Ga0068859_1000390384 | 91 |
| 234 | 3300005618 | Ga0068864_100208011 | Ga0068864_1002080112 | 91 |
| 235 | 3300005618 | Ga0068864_101314320 | Ga0068864_1013143202 | 91 |
| 236 | 3300005719 | Ga0068861_101066536 | Ga0068861_1010665362 | 91 |
| 237 | 3300005840 | Ga0068870_11278937 | Ga0068870_112789371 | 91 |
| 238 | 3300005841 | Ga0068863_100586301 | Ga0068863_1005863012 | 91 |
| 239 | 3300005841 | Ga0068863_100621340 | Ga0068863_1006213402 | 91 |
| 240 | 3300005842 | Ga0068858_100141131 | Ga0068858_1001411314 | 91 |
| 241 | 3300005842 | Ga0068858_100185403 | Ga0068858_1001854032 | 91 |
| 242 | 3300005842 | Ga0068858_100317761 | Ga0068858_1003177612 | 91 |
| 243 | 3300005842 | Ga0068858_101973230 | Ga0068858_1019732302 | 91 |
| 244 | 3300005843 | Ga0068860_100008166 | Ga0068860_1000081665 | 91 |
| 245 | 3300005937 | Ga0081455_10268126 | Ga0081455_102681263 | 91 |
| 246 | 3300005937 | Ga0081455_10349109 | Ga0081455_103491092 | 91 |
| 247 | 3300005983 | Ga0081540_1011827 | Ga0081540_10118276 | 91 |
| 248 | 3300005983 | Ga0081540_1020849 | Ga0081540_10208494 | 91 |
| 249 | 3300005983 | Ga0081540_1084051 | Ga0081540_10840512 | 91 |
| 250 | 3300005985 | Ga0081539_10098447 | Ga0081539_100984473 | 91 |
| 251 | 3300006038 | Ga0075365_10030283 | Ga0075365_100302834 | 91 |
| 252 | 3300006038 | Ga0075365_10071715 | Ga0075365_100717152 | 91 |
| 253 | 3300006038 | Ga0075365_10393087 | Ga0075365_103930872 | 91 |
| 254 | 3300006038 | Ga0075365_10802132 | Ga0075365_108021322 | 91 |
| 255 | 3300006042 | Ga0075368_10007220 | Ga0075368_100072205 | 91 |
| 256 | 3300006048 | Ga0075363_100023549 | Ga0075363_1000235492 | 91 |
| 257 | 3300006048 | Ga0075363_100447620 | Ga0075363_1004476201 | 91 |
| 258 | 3300006051 | Ga0075364_10122023 | Ga0075364_101220234 | 91 |
| 259 | 3300006051 | Ga0075364_10298960 | Ga0075364_102989602 | 91 |
| 260 | 3300006051 | Ga0075364_10433400 | Ga0075364_104334002 | 91 |
| 261 | 3300006163 | Ga0070715_11010012 | Ga0070715_110100122 | 91 |
| 262 | 3300006173 | Ga0070716_101324785 | Ga0070716_1013247852 | 91 |
| 263 | 3300006175 | Ga0070712_100157022 | Ga0070712_1001570224 | 91 |
| 264 | 3300006177 | Ga0075362_10110997 | Ga0075362_101109972 | 91 |
| 265 | 3300006178 | Ga0075367_10032938 | Ga0075367_100329382 | 91 |
| 266 | 3300006178 | Ga0075367_10248766 | Ga0075367_102487663 | 91 |
| 267 | 3300006178 | Ga0075367_10630209 | Ga0075367_106302091 | 91 |
| 268 | 3300006186 | Ga0075369_10007352 | Ga0075369_100073522 | 91 |
| 269 | 3300006186 | Ga0075369_10030294 | Ga0075369_100302941 | 91 |
| 270 | 3300006186 | Ga0075369_10036354 | Ga0075369_100363542 | 91 |
| 271 | 3300006186 | Ga0075369_10245182 | Ga0075369_102451822 | 91 |
| 272 | 3300006195 | Ga0075366_10143771 | Ga0075366_101437712 | 91 |
| 273 | 3300006195 | Ga0075366_10301186 | Ga0075366_103011862 | 91 |
| 274 | 3300006237 | Ga0097621_100456221 | Ga0097621_1004562212 | 91 |
| 275 | 3300006237 | Ga0097621_100523543 | Ga0097621_1005235432 | 91 |
| 276 | 3300006353 | Ga0075370_10052778 | Ga0075370_100527784 | 91 |
| 277 | 3300006353 | Ga0075370_10133804 | Ga0075370_101338042 | 91 |
| 278 | 3300006353 | Ga0075370_10244142 | Ga0075370_102441423 | 91 |
| 279 | 3300006358 | Ga0068871_100096021 | Ga0068871_1000960212 | 91 |
| 280 | 3300006358 | Ga0068871_101792176 | Ga0068871_1017921761 | 91 |
| 281 | 3300006852 | Ga0075433_10560537 | Ga0075433_105605373 | 91 |
| 282 | 3300006914 | Ga0075436_100156972 | Ga0075436_1001569722 | 91 |
| 283 | 3300006931 | Ga0097620_100039039 | Ga0097620_1000390394 | 91 |
| 284 | 3300006941 | Ga0099825_1056720 | Ga0099825_10567202 | 91 |
| 285 | 3300006942 | Ga0099824_1022136 | Ga0099824_10221362 | 91 |
| 286 | 3300006942 | Ga0099824_1047115 | Ga0099824_10471152 | 91 |
| 287 | 3300006943 | Ga0099822_1054004 | Ga0099822_10540043 | 91 |
| 288 | 3300006944 | Ga0099823_1071320 | Ga0099823_10713203 | 91 |
| 289 | 3300007076 | Ga0075435_100550311 | Ga0075435_1005503112 | 91 |
| 290 | 3300009092 | Ga0105250_10176126 | Ga0105250_101761262 | 91 |
| 291 | 3300009093 | Ga0105240_10035144 | Ga0105240_100351442 | 91 |
| 292 | 3300009093 | Ga0105240_10104049 | Ga0105240_101040496 | 91 |
| 293 | 3300009093 | Ga0105240_12304444 | Ga0105240_123044441 | 91 |
| 294 | 3300009098 | Ga0105245_10123225 | Ga0105245_101232252 | 91 |
| 295 | 3300009098 | Ga0105245_10147697 | Ga0105245_101476972 | 91 |
| 296 | 3300009101 | Ga0105247_10053727 | Ga0105247_100537274 | 91 |
| 297 | 3300009101 | Ga0105247_10059084 | Ga0105247_100590842 | 91 |
| 298 | 3300009101 | Ga0105247_10106434 | Ga0105247_101064342 | 91 |
| 299 | 3300009101 | Ga0105247_10471358 | Ga0105247_104713582 | 91 |
| 300 | 3300009148 | Ga0105243_10591683 | Ga0105243_105916832 | 91 |
| 301 | 3300009174 | Ga0105241_10619548 | Ga0105241_106195481 | 91 |
| 302 | 3300009174 | Ga0105241_10893969 | Ga0105241_108939692 | 91 |
| 303 | 3300009174 | Ga0105241_12060637 | Ga0105241_120606372 | 91 |
| 304 | 3300009176 | Ga0105242_10546253 | Ga0105242_105462532 | 91 |
| 305 | 3300009176 | Ga0105242_10624182 | Ga0105242_106241821 | 91 |
| 306 | 3300009177 | Ga0105248_10426959 | Ga0105248_104269591 | 91 |
| 307 | 3300009177 | Ga0105248_11952372 | Ga0105248_119523722 | 91 |
| 308 | 3300009545 | Ga0105237_10065418 | Ga0105237_100654184 | 91 |
| 309 | 3300009545 | Ga0105237_10357668 | Ga0105237_103576682 | 91 |
| 310 | 3300009545 | Ga0105237_10381641 | Ga0105237_103816412 | 91 |
| 311 | 3300009545 | Ga0105237_10547922 | Ga0105237_105479222 | 91 |
| 312 | 3300009545 | Ga0105237_10831447 | Ga0105237_108314473 | 91 |
| 313 | 3300009545 | Ga0105237_11282315 | Ga0105237_112823152 | 91 |
| 314 | 3300009545 | Ga0105237_11458796 | Ga0105237_114587961 | 91 |
| 315 | 3300009551 | Ga0105238_10080247 | Ga0105238_100802474 | 91 |
| 316 | 3300009551 | Ga0105238_10228238 | Ga0105238_102282384 | 91 |
| 317 | 3300009551 | Ga0105238_10532976 | Ga0105238_105329762 | 91 |
| 318 | 3300009551 | Ga0105238_10642873 | Ga0105238_106428731 | 91 |
| 319 | 3300009551 | Ga0105238_11198731 | Ga0105238_111987311 | 91 |
| 320 | 3300009551 | Ga0105238_11648624 | Ga0105238_116486242 | 91 |
| 321 | 3300009553 | Ga0105249_10667745 | Ga0105249_106677451 | 91 |
| 322 | 3300010375 | Ga0105239_10011774 | Ga0105239_100117742 | 91 |
| 323 | 3300010375 | Ga0105239_10088740 | Ga0105239_100887402 | 91 |
| 324 | 3300010375 | Ga0105239_10207595 | Ga0105239_102075952 | 91 |
| 325 | 3300010375 | Ga0105239_10354585 | Ga0105239_103545854 | 91 |
| 326 | 3300010375 | Ga0105239_11811093 | Ga0105239_118110932 | 91 |
| 327 | 3300010375 | Ga0105239_12281620 | Ga0105239_122816201 | 91 |
| 328 | 3300011119 | Ga0105246_10306641 | Ga0105246_103066413 | 91 |
| 329 | 3300011119 | Ga0105246_10484958 | Ga0105246_104849582 | 91 |
| 330 | 3300013105 | Ga0157369_10036608 | Ga0157369_100366082 | 91 |
| 331 | 3300013105 | Ga0157369_10398041 | Ga0157369_103980413 | 91 |
| 332 | 3300013105 | Ga0157369_11818291 | Ga0157369_118182912 | 91 |
| 333 | 3300013296 | Ga0157374_10931981 | Ga0157374_109319812 | 91 |
| 334 | 3300013296 | Ga0157374_11585957 | Ga0157374_115859572 | 91 |
| 335 | 3300013297 | Ga0157378_10256390 | Ga0157378_102563901 | 91 |
| 336 | 3300013297 | Ga0157378_10822584 | Ga0157378_108225842 | 91 |
| 337 | 3300013306 | Ga0163162_10428704 | Ga0163162_104287042 | 91 |
| 338 | 3300013306 | Ga0163162_11590233 | Ga0163162_115902332 | 91 |
| 339 | 3300013307 | Ga0157372_10237069 | Ga0157372_102370695 | 91 |
| 340 | 3300013307 | Ga0157372_12064595 | Ga0157372_120645952 | 91 |
| 341 | 3300013308 | Ga0157375_10474540 | Ga0157375_104745402 | 91 |
| 342 | 3300013308 | Ga0157375_11276814 | Ga0157375_112768143 | 91 |
| 343 | 3300014325 | Ga0163163_10054269 | Ga0163163_100542695 | 91 |
| 344 | 3300014497 | Ga0182008_10241705 | Ga0182008_102417051 | 91 |
| 345 | 3300014968 | Ga0157379_10608602 | Ga0157379_106086021 | 91 |
| 346 | 3300014969 | Ga0157376_11380780 | Ga0157376_113807801 | 91 |
| 347 | 3300014969 | Ga0157376_12338680 | Ga0157376_123386802 | 91 |
| 348 | 3300015261 | Ga0182006_1091454 | Ga0182006_10914542 | 91 |
| 349 | 3300015262 | Ga0182007_10051805 | Ga0182007_100518052 | 91 |
| 350 | 3300017792 | Ga0163161_10245482 | Ga0163161_102454823 | 91 |
| 351 | 3300017792 | Ga0163161_10304076 | Ga0163161_103040762 | 91 |
| 352 | 3300021320 | Ga0214544_1000026 | Ga0214544_100002667 | 91 |
| 353 | 3300021321 | Ga0214542_1000025 | Ga0214542_100002594 | 91 |
| 354 | 3300021324 | Ga0214545_1000014 | Ga0214545_100001484 | 91 |
| 355 | 3300021327 | Ga0214543_1000034 | Ga0214543_100003493 | 91 |
| 356 | 3300021361 | Ga0213872_10208058 | Ga0213872_102080582 | 91 |
| 357 | 3300021377 | Ga0213874_10032264 | Ga0213874_100322642 | 91 |
| 358 | 3300021377 | Ga0213874_10251965 | Ga0213874_102519652 | 91 |
| 359 | 3300021388 | Ga0213875_10028728 | Ga0213875_100287284 | 91 |
| 360 | 3300021441 | Ga0213871_10019515 | Ga0213871_100195152 | 91 |
| 361 | 3300021441 | Ga0213871_10238265 | Ga0213871_102382652 | 91 |
| 362 | 3300025253 | Ga0209677_100848 | Ga0209677_1008487 | 91 |
| 363 | 3300025254 | Ga0209148_1000250 | Ga0209148_100025049 | 91 |
| 364 | 3300025254 | Ga0209148_1032460 | Ga0209148_10324602 | 91 |
| 365 | 3300025261 | Ga0209233_1003352 | Ga0209233_10033527 | 91 |
| 366 | 3300025261 | Ga0209233_1008106 | Ga0209233_10081062 | 91 |
| 367 | 3300025272 | Ga0209455_1004562 | Ga0209455_10045624 | 91 |
| 368 | 3300025272 | Ga0209455_1013630 | Ga0209455_10136302 | 91 |
| 369 | 3300025272 | Ga0209455_1018916 | Ga0209455_10189163 | 91 |
| 370 | 3300025295 | Ga0209564_1004440 | Ga0209564_10044409 | 91 |
| 371 | 3300025295 | Ga0209564_1028543 | Ga0209564_10285432 | 91 |
| 372 | 3300025297 | Ga0209758_1000141 | Ga0209758_100014179 | 91 |
| 373 | 3300025297 | Ga0209758_1000324 | Ga0209758_100032464 | 91 |
| 374 | 3300025297 | Ga0209758_1000476 | Ga0209758_100047629 | 91 |
| 375 | 3300025297 | Ga0209758_1003329 | Ga0209758_100332916 | 91 |
| 376 | 3300025297 | Ga0209758_1015424 | Ga0209758_10154245 | 91 |
| 377 | 3300025297 | Ga0209758_1046709 | Ga0209758_10467092 | 91 |
| 378 | 3300025297 | Ga0209758_1143950 | Ga0209758_11439502 | 91 |
| 379 | 3300025299 | Ga0209256_1002728 | Ga0209256_10027289 | 91 |
| 380 | 3300025299 | Ga0209256_1119567 | Ga0209256_11195671 | 91 |
| 381 | 3300025302 | Ga0207426_1000523 | Ga0207426_100052334 | 91 |
| 382 | 3300025302 | Ga0207426_1000768 | Ga0207426_100076831 | 91 |
| 383 | 3300025302 | Ga0207426_1026680 | Ga0207426_10266802 | 91 |
| 384 | 3300025302 | Ga0207426_1075073 | Ga0207426_10750732 | 91 |
| 385 | 3300025303 | Ga0209051_1152598 | Ga0209051_11525982 | 91 |
| 386 | 3300025304 | Ga0209257_1002582 | Ga0209257_10025829 | 91 |
| 387 | 3300025304 | Ga0209257_1099380 | Ga0209257_10993802 | 91 |
| 388 | 3300025321 | Ga0207656_10218751 | Ga0207656_102187512 | 91 |
| 389 | 3300025898 | Ga0207692_10017859 | Ga0207692_100178592 | 91 |
| 390 | 3300025898 | Ga0207692_10236359 | Ga0207692_102363592 | 91 |
| 391 | 3300025900 | Ga0207710_10017337 | Ga0207710_100173372 | 91 |
| 392 | 3300025900 | Ga0207710_10087928 | Ga0207710_100879282 | 91 |
| 393 | 3300025900 | Ga0207710_10292309 | Ga0207710_102923092 | 91 |
| 394 | 3300025901 | Ga0207688_10351273 | Ga0207688_103512732 | 91 |
| 395 | 3300025903 | Ga0207680_10158274 | Ga0207680_101582743 | 91 |
| 396 | 3300025903 | Ga0207680_11047434 | Ga0207680_110474342 | 91 |
| 397 | 3300025904 | Ga0207647_10004820 | Ga0207647_1000482012 | 91 |
| 398 | 3300025904 | Ga0207647_10356072 | Ga0207647_103560722 | 91 |
| 399 | 3300025904 | Ga0207647_10363351 | Ga0207647_103633512 | 91 |
| 400 | 3300025906 | Ga0207699_10221205 | Ga0207699_102212052 | 91 |
| 401 | 3300025908 | Ga0207643_10383008 | Ga0207643_103830082 | 91 |
| 402 | 3300025911 | Ga0207654_10017334 | Ga0207654_100173345 | 91 |
| 403 | 3300025911 | Ga0207654_10031960 | Ga0207654_100319605 | 91 |
| 404 | 3300025912 | Ga0207707_10003161 | Ga0207707_1000316118 | 91 |
| 405 | 3300025912 | Ga0207707_10015604 | Ga0207707_100156042 | 91 |
| 406 | 3300025913 | Ga0207695_10000062 | Ga0207695_10000062192 | 91 |
| 407 | 3300025913 | Ga0207695_10549340 | Ga0207695_105493402 | 91 |
| 408 | 3300025913 | Ga0207695_10841317 | Ga0207695_108413172 | 91 |
| 409 | 3300025913 | Ga0207695_11445368 | Ga0207695_114453681 | 91 |
| 410 | 3300025914 | Ga0207671_10001205 | Ga0207671_1000120524 | 91 |
| 411 | 3300025914 | Ga0207671_10043199 | Ga0207671_100431992 | 91 |
| 412 | 3300025914 | Ga0207671_10310269 | Ga0207671_103102692 | 91 |
| 413 | 3300025914 | Ga0207671_10501126 | Ga0207671_105011262 | 91 |
| 414 | 3300025914 | Ga0207671_10868137 | Ga0207671_108681372 | 91 |
| 415 | 3300025915 | Ga0207693_10180529 | Ga0207693_101805292 | 91 |
| 416 | 3300025916 | Ga0207663_10031577 | Ga0207663_100315772 | 91 |
| 417 | 3300025916 | Ga0207663_10103137 | Ga0207663_101031372 | 91 |
| 418 | 3300025916 | Ga0207663_10493414 | Ga0207663_104934142 | 91 |
| 419 | 3300025917 | Ga0207660_10018435 | Ga0207660_100184352 | 91 |
| 420 | 3300025917 | Ga0207660_10039296 | Ga0207660_100392962 | 91 |
| 421 | 3300025919 | Ga0207657_10114414 | Ga0207657_101144144 | 91 |
| 422 | 3300025919 | Ga0207657_10654947 | Ga0207657_106549472 | 91 |
| 423 | 3300025920 | Ga0207649_11220504 | Ga0207649_112205042 | 91 |
| 424 | 3300025920 | Ga0207649_11464123 | Ga0207649_114641231 | 91 |
| 425 | 3300025921 | Ga0207652_10009942 | Ga0207652_100099422 | 91 |
| 426 | 3300025921 | Ga0207652_10097768 | Ga0207652_100977682 | 91 |
| 427 | 3300025921 | Ga0207652_10676717 | Ga0207652_106767171 | 91 |
| 428 | 3300025923 | Ga0207681_11316448 | Ga0207681_113164482 | 91 |
| 429 | 3300025924 | Ga0207694_10248388 | Ga0207694_102483883 | 91 |
| 430 | 3300025924 | Ga0207694_10251592 | Ga0207694_102515922 | 91 |
| 431 | 3300025924 | Ga0207694_10809750 | Ga0207694_108097502 | 91 |
| 432 | 3300025924 | Ga0207694_11498117 | Ga0207694_114981172 | 91 |
| 433 | 3300025925 | Ga0207650_10815324 | Ga0207650_108153242 | 91 |
| 434 | 3300025926 | Ga0207659_10278920 | Ga0207659_102789202 | 91 |
| 435 | 3300025927 | Ga0207687_10135893 | Ga0207687_101358934 | 91 |
| 436 | 3300025927 | Ga0207687_11427527 | Ga0207687_114275271 | 91 |
| 437 | 3300025928 | Ga0207700_10359036 | Ga0207700_103590362 | 91 |
| 438 | 3300025928 | Ga0207700_11396031 | Ga0207700_113960311 | 91 |
| 439 | 3300025931 | Ga0207644_10034864 | Ga0207644_100348642 | 91 |
| 440 | 3300025931 | Ga0207644_10070535 | Ga0207644_100705354 | 91 |
| 441 | 3300025931 | Ga0207644_10492670 | Ga0207644_104926702 | 91 |
| 442 | 3300025932 | Ga0207690_10313724 | Ga0207690_103137242 | 91 |
| 443 | 3300025932 | Ga0207690_10383713 | Ga0207690_103837132 | 91 |
| 444 | 3300025933 | Ga0207706_10176626 | Ga0207706_101766264 | 91 |
| 445 | 3300025934 | Ga0207686_10518422 | Ga0207686_105184222 | 91 |
| 446 | 3300025934 | Ga0207686_10828071 | Ga0207686_108280712 | 91 |
| 447 | 3300025935 | Ga0207709_10805784 | Ga0207709_108057842 | 91 |
| 448 | 3300025936 | Ga0207670_11165591 | Ga0207670_111655912 | 91 |
| 449 | 3300025940 | Ga0207691_11706453 | Ga0207691_117064532 | 91 |
| 450 | 3300025941 | Ga0207711_10214056 | Ga0207711_102140562 | 91 |
| 451 | 3300025941 | Ga0207711_10967616 | Ga0207711_109676162 | 91 |
| 452 | 3300025941 | Ga0207711_11124129 | Ga0207711_111241292 | 91 |
| 453 | 3300025942 | Ga0207689_10110262 | Ga0207689_101102622 | 91 |
| 454 | 3300025944 | Ga0207661_10029201 | Ga0207661_100292014 | 91 |
| 455 | 3300025945 | Ga0207679_10530099 | Ga0207679_105300992 | 91 |
| 456 | 3300025949 | Ga0207667_10147910 | Ga0207667_101479102 | 91 |
| 457 | 3300025949 | Ga0207667_10373483 | Ga0207667_103734831 | 91 |
| 458 | 3300025949 | Ga0207667_10374749 | Ga0207667_103747491 | 91 |
| 459 | 3300025949 | Ga0207667_10471976 | Ga0207667_104719762 | 91 |
| 460 | 3300025949 | Ga0207667_11087428 | Ga0207667_110874282 | 91 |
| 461 | 3300025961 | Ga0207712_10140293 | Ga0207712_101402932 | 91 |
| 462 | 3300025972 | Ga0207668_10094512 | Ga0207668_100945124 | 91 |
| 463 | 3300025972 | Ga0207668_10406470 | Ga0207668_104064702 | 91 |
| 464 | 3300025981 | Ga0207640_11606466 | Ga0207640_116064661 | 91 |
| 465 | 3300025986 | Ga0207658_10252038 | Ga0207658_102520382 | 91 |
| 466 | 3300025986 | Ga0207658_11272266 | Ga0207658_112722661 | 91 |
| 467 | 3300026035 | Ga0207703_10232211 | Ga0207703_102322112 | 91 |
| 468 | 3300026035 | Ga0207703_10308243 | Ga0207703_103082434 | 91 |
| 469 | 3300026035 | Ga0207703_11307722 | Ga0207703_113077222 | 91 |
| 470 | 3300026041 | Ga0207639_10081967 | Ga0207639_100819673 | 91 |
| 471 | 3300026041 | Ga0207639_10300138 | Ga0207639_103001382 | 91 |
| 472 | 3300026067 | Ga0207678_10082732 | Ga0207678_100827324 | 91 |
| 473 | 3300026067 | Ga0207678_10112337 | Ga0207678_101123372 | 91 |
| 474 | 3300026067 | Ga0207678_10194954 | Ga0207678_101949542 | 91 |
| 475 | 3300026067 | Ga0207678_11423222 | Ga0207678_114232222 | 91 |
| 476 | 3300026078 | Ga0207702_10103833 | Ga0207702_101038332 | 91 |
| 477 | 3300026078 | Ga0207702_10673829 | Ga0207702_106738292 | 91 |
| 478 | 3300026078 | Ga0207702_11589936 | Ga0207702_115899362 | 91 |
| 479 | 3300026088 | Ga0207641_10456059 | Ga0207641_104560592 | 91 |
| 480 | 3300026089 | Ga0207648_10552188 | Ga0207648_105521882 | 91 |
| 481 | 3300026095 | Ga0207676_10198475 | Ga0207676_101984754 | 91 |
| 482 | 3300026095 | Ga0207676_11288139 | Ga0207676_112881392 | 91 |
| 483 | 3300026116 | Ga0207674_10049361 | Ga0207674_100493612 | 91 |
| 484 | 3300026116 | Ga0207674_10055434 | Ga0207674_100554346 | 91 |
| 485 | 3300026116 | Ga0207674_10226429 | Ga0207674_102264292 | 91 |
| 486 | 3300026118 | Ga0207675_100439246 | Ga0207675_1004392462 | 91 |
| 487 | 3300026142 | Ga0207698_10646257 | Ga0207698_106462572 | 91 |
| 488 | 3300027296 | Ga0209389_1000004 | Ga0209389_100000474 | 91 |
| 489 | 3300027296 | Ga0209389_1000023 | Ga0209389_100002370 | 91 |
| 490 | 3300027357 | Ga0209589_1000010 | Ga0209589_100001089 | 91 |
| 491 | 3300027361 | Ga0209489_100011 | Ga0209489_100011147 | 91 |
| 492 | 3300027361 | Ga0209489_100295 | Ga0209489_10029573 | 91 |
| 493 | 3300027363 | Ga0209700_100013 | Ga0209700_100013160 | 91 |
| 494 | 3300027512 | Ga0209179_1081140 | Ga0209179_10811401 | 91 |
| 495 | 3300027866 | Ga0209813_10002937 | Ga0209813_100029372 | 91 |
| 496 | 3300028379 | Ga0268266_11135739 | Ga0268266_111357391 | 91 |
| 497 | 3300028380 | Ga0268265_11008457 | Ga0268265_110084572 | 91 |
| 498 | 3300028381 | Ga0268264_10000093 | Ga0268264_1000009323 | 91 |
| 499 | 3300028381 | Ga0268264_10341893 | Ga0268264_103418933 | 91 |
| 500 | 3300028556 | Ga0265337_1033985 | Ga0265337_10339852 | 91 |
| 501 | 3300028563 | Ga0265319_1009818 | Ga0265319_10098184 | 91 |
| 502 | 3300028653 | Ga0265323_10013826 | Ga0265323_100138262 | 91 |
| 503 | 3300028666 | Ga0265336_10000668 | Ga0265336_1000066813 | 91 |
| 504 | 3300028786 | Ga0307517_10163514 | Ga0307517_101635142 | 91 |
| 505 | 3300028800 | Ga0265338_10000013 | Ga0265338_10000013380 | 91 |
| 506 | 3300029957 | Ga0265324_10035591 | Ga0265324_100355914 | 91 |
| 507 | 3300030521 | Ga0307511_10225658 | Ga0307511_102256581 | 91 |
| 508 | 3300030763 | Ga0265763_1035790 | Ga0265763_10357901 | 91 |
| 509 | 3300031247 | Ga0265340_10033490 | Ga0265340_100334902 | 91 |
| 510 | 3300031249 | Ga0265339_10012506 | Ga0265339_100125063 | 91 |
| 511 | 3300031456 | Ga0307513_10500169 | Ga0307513_105001692 | 91 |
| 512 | 3300031507 | Ga0307509_10210400 | Ga0307509_102104001 | 91 |
| 513 | 3300031507 | Ga0307509_10778182 | Ga0307509_107781822 | 91 |
| 514 | 3300031616 | Ga0307508_10242819 | Ga0307508_102428192 | 91 |
| 515 | 3300031616 | Ga0307508_10862876 | Ga0307508_108628762 | 91 |
| 516 | 3300031649 | Ga0307514_10443328 | Ga0307514_104433282 | 91 |
| 517 | 3300031731 | Ga0307405_10471950 | Ga0307405_104719502 | 91 |
| 518 | 3300033180 | Ga0307510_10385582 | Ga0307510_103855821 | 91 |
| 519 | 3300035691 | Ga0373931_0551856 | Ga0373931_0551856_46_321 | 91 |
| 520 | 3300035695 | Ga0373927_0453531 | Ga0373927_0453531_140_415 | 91 |
| 521 | 3300035724 | Ga0373933_0000933 | Ga0373933_0000933_14481_14756 | 91 |
| 522 | 3300035725 | Ga0373947_0152144 | Ga0373947_0152144_1122_1397 | 91 |
| 523 | 3300036534 | Ga0310109_026010 | Ga0310109_026010_303_578 | 91 |
| 524 | 3300037068 | Ga0373925_0038129 | Ga0373925_0038129_227_502 | 91 |
| 525 | 3300037418 | Ga0395900_0111877 | Ga0395900_0111877_1752_2033 | 91 |
| 526 | 3300037418 | Ga0395900_0353195 | Ga0395900_0353195_635_910 | 91 |
| 527 | 3300037418 | Ga0395900_1279924 | Ga0395900_1279924_127_402 | 91 |
| 528 | 3300037466 | Ga0395898_0186397 | Ga0395898_0186397_364_645 | 91 |
| 529 | 3300037466 | Ga0395898_0321954 | Ga0395898_0321954_600_875 | 91 |
| 530 | 3300037466 | Ga0395898_0431498 | Ga0395898_0431498_133_408 | 91 |
| 531 | 3300037466 | Ga0395898_1656789 | Ga0395898_1656789_137_412 | 91 |
| 532 | 3300037471 | Ga0395905_0005922 | Ga0395905_0005922_11460_11735 | 91 |
| 533 | 3300037471 | Ga0395905_0866028 | Ga0395905_0866028_512_787 | 91 |
| 534 | 3300037471 | Ga0395905_1010743 | Ga0395905_1010743_130_405 | 91 |
| 535 | 3300037853 | Ga0436364_0525938 | Ga0436364_0525938_2538_2813 | 91 |
| 536 | 3300037853 | Ga0436364_1001751 | Ga0436364_1001751_1119_1394 | 91 |
| 537 | 3300038443 | Ga0395901_0106011 | Ga0395901_0106011_822_1097 | 91 |
| 538 | 3300038443 | Ga0395901_0263180 | Ga0395901_0263180_124_399 | 91 |
| 539 | 3300038443 | Ga0395901_0450221 | Ga0395901_0450221_921_1196 | 91 |
| 540 | 3300038443 | Ga0395901_1565111 | Ga0395901_1565111_171_452 | 91 |
| 541 | 3300039437 | Ga0436365_0166945 | Ga0436365_0166945_365_640 | 91 |
| 542 | 3300039437 | Ga0436365_0412690 | Ga0436365_0412690_72_347 | 91 |
| 543 | 3300039437 | Ga0436365_1432657 | Ga0436365_1432657_213_488 | 91 |
| 544 | 3300039438 | Ga0436360_0391216 | Ga0436360_0391216_581_856 | 91 |
| 545 | 3300039438 | Ga0436360_0473736 | Ga0436360_0473736_35_370 | 91 |
| 546 | 3300039438 | Ga0436360_0592197 | Ga0436360_0592197_289_624 | 91 |
| 547 | 3300039447 | Ga0436361_0064398 | Ga0436361_0064398_642_917 | 91 |
| 548 | 3300039447 | Ga0436361_0639306 | Ga0436361_0639306_1005_1340 | 91 |
| 549 | 3300039447 | Ga0436361_0859965 | Ga0436361_0859965_261_548 | 91 |
| 550 | 3300039450 | Ga0436363_0212376 | Ga0436363_0212376_9901_10176 | 91 |
| 551 | 3300039450 | Ga0436363_0797948 | Ga0436363_0797948_69_344 | 91 |
| 552 | 3300039450 | Ga0436363_1261222 | Ga0436363_1261222_758_1033 | 91 |
| 553 | 3300039450 | Ga0436363_1470254 | Ga0436363_1470254_480_755 | 91 |
| 554 | 3300041413 | Ga0439465_0109018 | Ga0439465_0109018_666_941 | 91 |
| 555 | 3300041441 | Ga0451787_353093 | Ga0451787_353093_850_1125 | 91 |
| 556 | 3300041443 | Ga0451789_0721162 | Ga0451789_0721162_471_746 | 91 |
| 557 | 3300041452 | Ga0451793_1933845 | Ga0451793_1933845_1372_1647 | 91 |
| 558 | 3300041453 | Ga0451797_0462493 | Ga0451797_0462493_1001_1276 | 91 |
| 559 | 3300041456 | Ga0451795_1213581 | Ga0451795_1213581_1272_1547 | 91 |
| 560 | 3300041491 | Ga0451833_0104584 | Ga0451833_0104584_719_994 | 91 |
| 561 | 3300041501 | Ga0451845_0603933 | Ga0451845_0603933_153_428 | 91 |
| 562 | 3300041507 | Ga0451851_1265619 | Ga0451851_1265619_329_604 | 91 |
| 563 | 3300041509 | Ga0451843_1287380 | Ga0451843_1287380_161_436 | 91 |
| 564 | 3300041511 | Ga0451855_0754286 | Ga0451855_0754286_667_942 | 91 |
| 565 | 3300041512 | Ga0451853_1726574 | Ga0451853_1726574_887_1162 | 91 |
| 566 | 3300041512 | Ga0451853_4033689 | Ga0451853_4033689_494_769 | 91 |
| 567 | 3300044656 | Ga0466969_0040734 | Ga0466969_0040734_321_596 | 91 |
| 568 | 3300044656 | Ga0466969_0104323 | Ga0466969_0104323_120_455 | 91 |
| 569 | 3300044658 | Ga0466972_0000185 | Ga0466972_0000185_40915_41190 | 91 |
| 570 | 3300044658 | Ga0466972_0002548 | Ga0466972_0002548_2941_3216 | 91 |
| 571 | 3300044658 | Ga0466972_0068110 | Ga0466972_0068110_451_726 | 91 |
| 572 | 3300044658 | Ga0466972_0393405 | Ga0466972_0393405_56_331 | 91 |
| 573 | 3300044658 | Ga0466972_0596219 | Ga0466972_0596219_54_329 | 91 |
| 574 | 3300044683 | Ga0466965_0102633 | Ga0466965_0102633_108_383 | 91 |
| 575 | 3300044683 | Ga0466965_0166157 | Ga0466965_0166157_673_948 | 91 |
| 576 | 3300044684 | Ga0466966_0006716 | Ga0466966_0006716_3071_3346 | 91 |
| 577 | 3300044684 | Ga0466966_0276665 | Ga0466966_0276665_702_977 | 91 |
| 578 | 3300044693 | Ga0466961_0000020 | Ga0466961_0000020_87549_87824 | 91 |
| 579 | 3300044693 | Ga0466961_0187725 | Ga0466961_0187725_962_1237 | 91 |
| 580 | 3300044693 | Ga0466961_0285810 | Ga0466961_0285810_546_821 | 91 |
| 581 | 3300044693 | Ga0466961_0376621 | Ga0466961_0376621_21_296 | 91 |
| 582 | 3300044694 | Ga0466963_0927209 | Ga0466963_0927209_173_448 | 91 |
| 583 | 3300044706 | Ga0466964_0189350 | Ga0466964_0189350_240_515 | 91 |
| 584 | 3300044706 | Ga0466964_0288861 | Ga0466964_0288861_302_577 | 91 |
| 585 | 3300044706 | Ga0466964_0629727 | Ga0466964_0629727_256_531 | 91 |
| 586 | 3300044719 | Ga0466971_0126027 | Ga0466971_0126027_694_969 | 91 |
| 587 | 3300044719 | Ga0466971_0682189 | Ga0466971_0682189_95_385 | 91 |
| 588 | 3300044735 | Ga0466968_0073859 | Ga0466968_0073859_259_534 | 91 |
| 589 | 3300044735 | Ga0466968_0159590 | Ga0466968_0159590_449_724 | 91 |
| 590 | 3300044735 | Ga0466968_0390116 | Ga0466968_0390116_44_379 | 91 |
| 591 | 3300044735 | Ga0466968_0459512 | Ga0466968_0459512_332_607 | 91 |
| 592 | 3300044765 | Ga0466970_0170778 | Ga0466970_0170778_117_392 | 91 |
| 593 | 3300044765 | Ga0466970_0331420 | Ga0466970_0331420_547_822 | 91 |
| 594 | 3300044765 | Ga0466970_0345255 | Ga0466970_0345255_258_593 | 91 |
| 595 | 3300044765 | Ga0466970_0621087 | Ga0466970_0621087_176_451 | 91 |
| 596 | 3300044765 | Ga0466970_0934730 | Ga0466970_0934730_185_460 | 91 |
| 597 | 3300044842 | Ga0466957_0212111 | Ga0466957_0212111_696_971 | 91 |
| 598 | 3300044842 | Ga0466957_0221501 | Ga0466957_0221501_872_1147 | 91 |
| 599 | 3300044842 | Ga0466957_0550325 | Ga0466957_0550325_444_719 | 91 |
| 600 | 3300044842 | Ga0466957_0796988 | Ga0466957_0796988_265_540 | 91 |
| 601 | 3300044901 | Ga0466960_0035952 | Ga0466960_0035952_482_757 | 91 |
| 602 | 3300044901 | Ga0466960_0059495 | Ga0466960_0059495_1546_1821 | 91 |
| 603 | 3300044901 | Ga0466960_0247789 | Ga0466960_0247789_436_723 | 91 |
| 604 | 3300044901 | Ga0466960_0290644 | Ga0466960_0290644_262_537 | 91 |
| 605 | 3300045049 | Ga0466959_0003692 | Ga0466959_0003692_6979_7254 | 91 |
| 606 | 3300045049 | Ga0466959_0041108 | Ga0466959_0041108_416_751 | 91 |
| 607 | 3300045049 | Ga0466959_0182710 | Ga0466959_0182710_228_503 | 91 |
| 608 | 3300045049 | Ga0466959_0434728 | Ga0466959_0434728_581_856 | 91 |
| 609 | 3300045049 | Ga0466959_0513504 | Ga0466959_0513504_395_670 | 91 |
| 610 | 3300045836 | Ga0466958_0205203 | Ga0466958_0205203_840_1115 | 91 |
| 611 | 3300045976 | Ga0466967_0021975 | Ga0466967_0021975_4329_4604 | 91 |
| 612 | 3300045976 | Ga0466967_0063971 | Ga0466967_0063971_1672_1953 | 91 |
| 613 | 3300045976 | Ga0466967_0085926 | Ga0466967_0085926_125_400 | 91 |
| 614 | 3300045976 | Ga0466967_0200302 | Ga0466967_0200302_310_585 | 91 |
| 615 | 3300045976 | Ga0466967_0236600 | Ga0466967_0236600_440_715 | 91 |
| 616 | 3300045976 | Ga0466967_0286512 | Ga0466967_0286512_913_1188 | 91 |
| 617 | 3300045976 | Ga0466967_0545508 | Ga0466967_0545508_104_394 | 91 |
| 618 | 3300045976 | Ga0466967_2137728 | Ga0466967_2137728_24_299 | 91 |
| 619 | 3300045976 | Ga0466967_2373971 | Ga0466967_2373971_27_302 | 91 |
| 620 | 3300046454 | Ga0495592_0203996 | Ga0495592_0203996_106_384 | 91 |
| 621 | 3300046454 | Ga0495592_0247794 | Ga0495592_0247794_57_332 | 91 |
| 622 | 3300046455 | Ga0495603_0045301 | Ga0495603_0045301_646_927 | 91 |
| 623 | 3300046455 | Ga0495603_0136583 | Ga0495603_0136583_115_390 | 91 |
| 624 | 3300046457 | Ga0495590_0199860 | Ga0495590_0199860_318_593 | 91 |
| 625 | 3300046459 | Ga0495629_0001285 | Ga0495629_0001285_2145_2420 | 91 |
| 626 | 3300046462 | Ga0495651_0038466 | Ga0495651_0038466_2332_2607 | 91 |
| 627 | 3300046462 | Ga0495651_0101866 | Ga0495651_0101866_1086_1364 | 91 |
| 628 | 3300046462 | Ga0495651_0820338 | Ga0495651_0820338_181_456 | 91 |
| 629 | 3300046472 | Ga0495580_0877413 | Ga0495580_0877413_282_557 | 91 |
| 630 | 3300046473 | Ga0495582_0191805 | Ga0495582_0191805_475_750 | 91 |
| 631 | 3300046474 | Ga0495605_0081061 | Ga0495605_0081061_227_502 | 91 |
| 632 | 3300046477 | Ga0495664_0056770 | Ga0495664_0056770_1295_1570 | 91 |
| 633 | 3300046477 | Ga0495664_0311759 | Ga0495664_0311759_329_607 | 91 |
| 634 | 3300046477 | Ga0495664_0349210 | Ga0495664_0349210_276_551 | 91 |
| 635 | 3300046477 | Ga0495664_0478508 | Ga0495664_0478508_288_563 | 91 |
| 636 | 3300046500 | Ga0495596_0085800 | Ga0495596_0085800_755_1030 | 91 |
| 637 | 3300046501 | Ga0495607_0091009 | Ga0495607_0091009_195_470 | 91 |
| 638 | 3300046507 | Ga0495606_0030986 | Ga0495606_0030986_3096_3371 | 91 |
| 639 | 3300046507 | Ga0495606_0067180 | Ga0495606_0067180_1885_2160 | 91 |
| 640 | 3300046507 | Ga0495606_0328816 | Ga0495606_0328816_172_447 | 91 |
| 641 | 3300046507 | Ga0495606_0575883 | Ga0495606_0575883_35_310 | 91 |
| 642 | 3300046511 | Ga0495608_0060869 | Ga0495608_0060869_1775_2053 | 91 |
| 643 | 3300046511 | Ga0495608_0062211 | Ga0495608_0062211_1192_1467 | 91 |
| 644 | 3300046512 | Ga0495610_0070967 | Ga0495610_0070967_192_467 | 91 |
| 645 | 3300046512 | Ga0495610_0318724 | Ga0495610_0318724_113_388 | 91 |
| 646 | 3300046513 | Ga0495616_0200975 | Ga0495616_0200975_251_526 | 91 |
| 647 | 3300046514 | Ga0495618_0072718 | Ga0495618_0072718_1723_1998 | 91 |
| 648 | 3300046514 | Ga0495618_0488045 | Ga0495618_0488045_240_518 | 91 |
| 649 | 3300046515 | Ga0495620_0253694 | Ga0495620_0253694_148_423 | 91 |
| 650 | 3300046516 | Ga0495628_0132421 | Ga0495628_0132421_593_871 | 91 |
| 651 | 3300046517 | Ga0495630_0986379 | Ga0495630_0986379_276_557 | 91 |
| 652 | 3300046518 | Ga0495631_0284250 | Ga0495631_0284250_144_419 | 91 |
| 653 | 3300046519 | Ga0495632_0146312 | Ga0495632_0146312_387_662 | 91 |
| 654 | 3300046522 | Ga0495643_0028133 | Ga0495643_0028133_655_930 | 91 |
| 655 | 3300046522 | Ga0495643_0075593 | Ga0495643_0075593_977_1252 | 91 |
| 656 | 3300046524 | Ga0495648_0064052 | Ga0495648_0064052_1333_1608 | 91 |
| 657 | 3300046524 | Ga0495648_0237437 | Ga0495648_0237437_90_365 | 91 |
| 658 | 3300046526 | Ga0495666_0363793 | Ga0495666_0363793_65_340 | 91 |
| 659 | 3300046529 | Ga0495652_0053762 | Ga0495652_0053762_706_984 | 91 |
| 660 | 3300046529 | Ga0495652_0469601 | Ga0495652_0469601_281_556 | 91 |
| 661 | 3300046533 | Ga0495640_0057207 | Ga0495640_0057207_947_1222 | 91 |
| 662 | 3300046533 | Ga0495640_0140324 | Ga0495640_0140324_261_539 | 91 |
| 663 | 3300046536 | Ga0495587_0021616 | Ga0495587_0021616_325_603 | 91 |
| 664 | 3300046536 | Ga0495587_0245417 | Ga0495587_0245417_215_490 | 91 |
| 665 | 3300046538 | Ga0495609_0031800 | Ga0495609_0031800_1749_2024 | 91 |
| 666 | 3300046538 | Ga0495609_0133495 | Ga0495609_0133495_329_604 | 91 |
| 667 | 3300046542 | Ga0495597_0199933 | Ga0495597_0199933_370_645 | 91 |
| 668 | 3300046543 | Ga0495645_0111168 | Ga0495645_0111168_772_1047 | 91 |
| 669 | 3300046543 | Ga0495645_0112784 | Ga0495645_0112784_1213_1491 | 91 |
| 670 | 3300046557 | Ga0495622_0009981 | Ga0495622_0009981_1521_1796 | 91 |
| 671 | 3300046557 | Ga0495622_0052370 | Ga0495622_0052370_1105_1380 | 91 |
| 672 | 3300046557 | Ga0495622_0290350 | Ga0495622_0290350_304_579 | 91 |
| 673 | 3300046559 | Ga0495667_0053258 | Ga0495667_0053258_1428_1706 | 91 |
| 674 | 3300046559 | Ga0495667_0200209 | Ga0495667_0200209_983_1258 | 91 |
| 675 | 3300046616 | Ga0495668_0048350 | Ga0495668_0048350_222_497 | 91 |
| 676 | 3300046616 | Ga0495668_0241109 | Ga0495668_0241109_525_800 | 91 |
| 677 | 3300046616 | Ga0495668_0331889 | Ga0495668_0331889_254_529 | 91 |
| 678 | 3300046642 | Ga0495634_0040997 | Ga0495634_0040997_266_544 | 91 |
| 679 | 3300046642 | Ga0495634_0177656 | Ga0495634_0177656_944_1219 | 91 |
| 680 | 3300046660 | Ga0495625_0038858 | Ga0495625_0038858_2118_2393 | 91 |
| 681 | 3300046663 | Ga0495635_0023671 | Ga0495635_0023671_1998_2273 | 91 |
| 682 | 3300046663 | Ga0495635_0031388 | Ga0495635_0031388_432_710 | 91 |
| 683 | 3300046665 | Ga0495661_0279441 | Ga0495661_0279441_539_814 | 91 |
| 684 | 3300046674 | Ga0495588_0055901 | Ga0495588_0055901_697_972 | 91 |
| 685 | 3300046675 | Ga0495657_0016485 | Ga0495657_0016485_3053_3328 | 91 |
| 686 | 3300046675 | Ga0495657_0055404 | Ga0495657_0055404_925_1203 | 91 |
| 687 | 3300046678 | Ga0495599_0035925 | Ga0495599_0035925_263_541 | 91 |
| 688 | 3300046679 | Ga0495623_0041891 | Ga0495623_0041891_1324_1602 | 91 |
| 689 | 3300046684 | Ga0495669_0406910 | Ga0495669_0406910_175_450 | 91 |
| 690 | 3300046689 | Ga0495613_0079714 | Ga0495613_0079714_1065_1340 | 91 |
| 691 | 3300046689 | Ga0495613_0636937 | Ga0495613_0636937_176_454 | 91 |
| 692 | 3300046690 | Ga0495624_0580529 | Ga0495624_0580529_163_438 | 91 |
| 693 | 3300046692 | Ga0495671_0043264 | Ga0495671_0043264_1009_1284 | 91 |
| 694 | 3300046694 | Ga0495649_0040446 | Ga0495649_0040446_734_1009 | 91 |
| 695 | 3300046694 | Ga0495649_0042895 | Ga0495649_0042895_622_897 | 91 |
| 696 | 3300046809 | Ga0495600_0129859 | Ga0495600_0129859_361_636 | 91 |
| 697 | 3300046809 | Ga0495600_0203778 | Ga0495600_0203778_219_497 | 91 |
| 698 | 3300047315 | Ga0495581_0128299 | Ga0495581_0128299_1031_1306 | 91 |
| 699 | 3300047315 | Ga0495581_0149248 | Ga0495581_0149248_151_426 | 91 |
| 700 | 3300047315 | Ga0495581_0812326 | Ga0495581_0812326_203_484 | 91 |
| 701 | 3300047317 | Ga0495604_0003054 | Ga0495604_0003054_7765_8040 | 91 |
| 702 | 3300047317 | Ga0495604_0041708 | Ga0495604_0041708_3067_3345 | 91 |
| 703 | 3300047319 | Ga0495674_0415602 | Ga0495674_0415602_366_641 | 91 |
| 704 | 3300047322 | Ga0495680_0009821 | Ga0495680_0009821_7252_7530 | 91 |
| 705 | 3300047323 | Ga0495683_0033555 | Ga0495683_0033555_1689_1964 | 91 |
| 706 | 3300047323 | Ga0495683_0094088 | Ga0495683_0094088_139_414 | 91 |
| 707 | 3300047443 | Ga0495687_050393 | Ga0495687_050393_1184_1459 | 91 |
| 708 | 3300047444 | Ga0495675_0013853 | Ga0495675_0013853_2563_2841 | 91 |
| 709 | 3300047469 | Ga0495673_0080196 | Ga0495673_0080196_1016_1297 | 91 |
| 710 | 3300047471 | Ga0495684_0635979 | Ga0495684_0635979_200_478 | 91 |
| 711 | 3300047472 | Ga0495686_0119194 | Ga0495686_0119194_224_499 | 91 |
| 712 | 3300047472 | Ga0495686_0339242 | Ga0495686_0339242_319_594 | 91 |
| 713 | 3300047673 | Ga0495593_0028504 | Ga0495593_0028504_1832_2107 | 91 |
| 714 | 3300047673 | Ga0495593_0436123 | Ga0495593_0436123_351_629 | 91 |
| 715 | 3300048088 | Ga0495602_0052424 | Ga0495602_0052424_2172_2450 | 91 |
| 716 | 3300048088 | Ga0495602_0297797 | Ga0495602_0297797_28_303 | 91 |
| 717 | 3300048089 | Ga0495614_0104954 | Ga0495614_0104954_298_573 | 91 |
| 718 | 3300048089 | Ga0495614_0120350 | Ga0495614_0120350_386_661 | 91 |
| 719 | 3300048091 | Ga0495626_0064892 | Ga0495626_0064892_1244_1519 | 91 |
| 720 | 3300048903 | Ga0496100_0093485 | Ga0496100_0093485_445_720 | 91 |
| 721 | 3300048903 | Ga0496100_0178283 | Ga0496100_0178283_240_515 | 91 |
| 722 | 3300048903 | Ga0496100_0722340 | Ga0496100_0722340_187_462 | 91 |
| 723 | 3300048904 | Ga0496101_0065722 | Ga0496101_0065722_1086_1361 | 91 |
| 724 | 3300048904 | Ga0496101_0328503 | Ga0496101_0328503_20_295 | 91 |
| 725 | 3300048904 | Ga0496101_1391190 | Ga0496101_1391190_244_519 | 91 |
| 726 | 3300048905 | Ga0496102_0116763 | Ga0496102_0116763_1039_1314 | 91 |
| 727 | 3300048905 | Ga0496102_0140116 | Ga0496102_0140116_428_703 | 91 |
| 728 | 3300048905 | Ga0496102_1126269 | Ga0496102_1126269_199_474 | 91 |
| 729 | 3300048906 | Ga0496103_0008146 | Ga0496103_0008146_2005_2280 | 91 |
| 730 | 3300048906 | Ga0496103_0551670 | Ga0496103_0551670_205_480 | 91 |
| 731 | 3300048907 | Ga0496104_0038487 | Ga0496104_0038487_3108_3383 | 91 |
| 732 | 3300048907 | Ga0496104_0044409 | Ga0496104_0044409_2923_3198 | 91 |
| 733 | 3300048907 | Ga0496104_0133123 | Ga0496104_0133123_1899_2174 | 91 |
| 734 | 3300048908 | Ga0496105_0032381 | Ga0496105_0032381_1151_1426 | 91 |
| 735 | 3300048908 | Ga0496105_0062791 | Ga0496105_0062791_2039_2314 | 91 |
| 736 | 3300048908 | Ga0496105_0063630 | Ga0496105_0063630_977_1252 | 91 |
| 737 | 3300048909 | Ga0496106_0041714 | Ga0496106_0041714_2282_2557 | 91 |
| 738 | 3300048909 | Ga0496106_0217335 | Ga0496106_0217335_951_1226 | 91 |
| 739 | 3300048909 | Ga0496106_0288897 | Ga0496106_0288897_633_908 | 91 |
| 740 | 3300048909 | Ga0496106_1136216 | Ga0496106_1136216_195_470 | 91 |
| 741 | 3300048910 | Ga0496107_0034315 | Ga0496107_0034315_229_504 | 91 |
| 742 | 3300048910 | Ga0496107_0151834 | Ga0496107_0151834_83_358 | 91 |
| 743 | 3300048910 | Ga0496107_0861897 | Ga0496107_0861897_204_479 | 91 |
| 744 | 3300048911 | Ga0496108_0016881 | Ga0496108_0016881_1881_2156 | 91 |
| 745 | 3300048911 | Ga0496108_0421798 | Ga0496108_0421798_706_981 | 91 |
| 746 | 3300048911 | Ga0496108_0536819 | Ga0496108_0536819_263_538 | 91 |
| 747 | 3300048913 | Ga0496110_0034199 | Ga0496110_0034199_3045_3320 | 91 |
| 748 | 3300048913 | Ga0496110_0425015 | Ga0496110_0425015_266_541 | 91 |
| 749 | 3300048914 | Ga0496111_0156108 | Ga0496111_0156108_135_410 | 91 |
| 750 | 3300048914 | Ga0496111_0412822 | Ga0496111_0412822_616_891 | 91 |
| 751 | 3300048915 | Ga0496112_0027577 | Ga0496112_0027577_3466_3741 | 91 |
| 752 | 3300048916 | Ga0496113_0051590 | Ga0496113_0051590_1037_1312 | 91 |
| 753 | 3300048916 | Ga0496113_0291175 | Ga0496113_0291175_611_886 | 91 |
| 754 | 3300048916 | Ga0496113_0295533 | Ga0496113_0295533_50_325 | 91 |
| 755 | 3300048917 | Ga0496114_0032966 | Ga0496114_0032966_2680_2955 | 91 |
| 756 | 3300048917 | Ga0496114_0215451 | Ga0496114_0215451_298_573 | 91 |
| 757 | 3300048918 | Ga0496115_0176298 | Ga0496115_0176298_253_528 | 91 |
| 758 | 3300048918 | Ga0496115_0690340 | Ga0496115_0690340_286_561 | 91 |
| 759 | 3300048919 | Ga0496116_0085259 | Ga0496116_0085259_110_385 | 91 |
| 760 | 3300048920 | Ga0496117_0086903 | Ga0496117_0086903_149_424 | 91 |
| 761 | 3300048920 | Ga0496117_0306801 | Ga0496117_0306801_321_596 | 91 |
| 762 | 3300048920 | Ga0496117_0314808 | Ga0496117_0314808_229_504 | 91 |
| 763 | 3300048921 | Ga0496118_0034657 | Ga0496118_0034657_917_1192 | 91 |
| 764 | 3300048921 | Ga0496118_0151060 | Ga0496118_0151060_411_686 | 91 |
| 765 | 3300048921 | Ga0496118_0156238 | Ga0496118_0156238_866_1141 | 91 |
| 766 | 3300048921 | Ga0496118_0165431 | Ga0496118_0165431_744_1019 | 91 |
| 767 | 3300048921 | Ga0496118_0571919 | Ga0496118_0571919_50_325 | 91 |
| 768 | 3300048922 | Ga0496119_0018797 | Ga0496119_0018797_4528_4803 | 91 |
| 769 | 3300048922 | Ga0496119_0035827 | Ga0496119_0035827_2870_3145 | 91 |
| 770 | 3300048922 | Ga0496119_0045469 | Ga0496119_0045469_1222_1497 | 91 |
| 771 | 3300048922 | Ga0496119_0097375 | Ga0496119_0097375_1177_1452 | 91 |
| 772 | 3300048923 | Ga0496120_0072474 | Ga0496120_0072474_1031_1306 | 91 |
| 773 | 3300048923 | Ga0496120_0095303 | Ga0496120_0095303_123_398 | 91 |
| 774 | 3300048923 | Ga0496120_0222969 | Ga0496120_0222969_250_525 | 91 |
| 775 | 3300048923 | Ga0496120_0298228 | Ga0496120_0298228_275_550 | 91 |
| 776 | 3300048924 | Ga0496121_0018129 | Ga0496121_0018129_3059_3334 | 91 |
| 777 | 3300048924 | Ga0496121_0048015 | Ga0496121_0048015_534_809 | 91 |
| 778 | 3300048924 | Ga0496121_0061856 | Ga0496121_0061856_1325_1600 | 91 |
| 779 | 3300048924 | Ga0496121_0121261 | Ga0496121_0121261_1050_1325 | 91 |
| 780 | 3300048924 | Ga0496121_0206266 | Ga0496121_0206266_243_518 | 91 |
| 781 | 3300048924 | Ga0496121_0776870 | Ga0496121_0776870_105_380 | 91 |
| 782 | 3300048925 | Ga0496122_0015242 | Ga0496122_0015242_6049_6375 | 91 |
| 783 | 3300048925 | Ga0496122_0125615 | Ga0496122_0125615_659_934 | 91 |
| 784 | 3300048927 | Ga0496124_0065496 | Ga0496124_0065496_903_1178 | 91 |
| 785 | 3300048927 | Ga0496124_0073104 | Ga0496124_0073104_634_909 | 91 |
| 786 | 3300048927 | Ga0496124_0634846 | Ga0496124_0634846_259_534 | 91 |
| 787 | 3300048928 | Ga0496125_0040757 | Ga0496125_0040757_1200_1475 | 91 |
| 788 | 3300048928 | Ga0496125_0082484 | Ga0496125_0082484_187_462 | 91 |
| 789 | 3300048928 | Ga0496125_0133841 | Ga0496125_0133841_1214_1489 | 91 |
| 790 | 3300048929 | Ga0496126_0009236 | Ga0496126_0009236_7308_7583 | 91 |
| 791 | 3300048929 | Ga0496126_0019391 | Ga0496126_0019391_4647_4922 | 91 |
| 792 | 3300048929 | Ga0496126_0050913 | Ga0496126_0050913_3464_3739 | 91 |
| 793 | 3300048929 | Ga0496126_0061206 | Ga0496126_0061206_1810_2085 | 91 |
| 794 | 3300048929 | Ga0496126_0092565 | Ga0496126_0092565_2114_2389 | 91 |
| 795 | 3300048929 | Ga0496126_0156146 | Ga0496126_0156146_623_949 | 91 |
| 796 | 3300048929 | Ga0496126_0158694 | Ga0496126_0158694_88_369 | 91 |
| 797 | 3300048929 | Ga0496126_0248505 | Ga0496126_0248505_334_615 | 91 |
| 798 | 3300048929 | Ga0496126_0666681 | Ga0496126_0666681_167_442 | 91 |
| 799 | 3300048929 | Ga0496126_1202423 | Ga0496126_1202423_168_449 | 91 |
| 800 | 3300048929 | Ga0496126_1316172 | Ga0496126_1316172_102_377 | 91 |
| 801 | 3300049460 | Ga0495682_0009626 | Ga0495682_0009626_2752_3027 | 91 |
| 802 | 3300049580 | Ga0501046_0015227 | Ga0501046_0015227_4122_4397 | 91 |
| 803 | 3300049581 | Ga0501047_0059550 | Ga0501047_0059550_2240_2515 | 91 |
| 804 | 3300049581 | Ga0501047_0196339 | Ga0501047_0196339_517_798 | 91 |
| 805 | 3300049583 | Ga0501067_0256177 | Ga0501067_0256177_322_597 | 91 |
| 806 | 3300049586 | Ga0501070_0046583 | Ga0501070_0046583_1374_1649 | 91 |
| 807 | 3300049589 | Ga0501073_0041052 | Ga0501073_0041052_940_1215 | 91 |
| 808 | 3300049590 | Ga0501074_0008985 | Ga0501074_0008985_4814_5089 | 91 |
| 809 | 3300049741 | Ga0501079_0568949 | Ga0501079_0568949_420_695 | 91 |
| 810 | 3300049742 | Ga0501080_0094062 | Ga0501080_0094062_1472_1747 | 91 |
| 811 | 3300049822 | Ga0501035_0276557 | Ga0501035_0276557_519_794 | 91 |
| 812 | 3300049822 | Ga0501035_0479586 | Ga0501035_0479586_177_458 | 91 |
| 813 | 3300049823 | Ga0501044_0104264 | Ga0501044_0104264_118_399 | 91 |
| 814 | 3300050489 | nmdc:mga03683_549237_c1 | nmdc:mga03683_549237_c1_102_380 | 91 |
| 815 | 3300050490 | nmdc:mga03n38_11183_c1 | nmdc:mga03n38_11183_c1_2853_3128 | 91 |
| 816 | 3300050490 | nmdc:mga03n38_776574_c1 | nmdc:mga03n38_776574_c1_131_418 | 91 |
| 817 | 3300050491 | nmdc:mga00v17_102408_c1 | nmdc:mga00v17_102408_c1_1403_1678 | 91 |
| 818 | 3300050491 | nmdc:mga00v17_238788_c1 | nmdc:mga00v17_238788_c1_219_494 | 91 |
| 819 | 3300050491 | nmdc:mga00v17_259155_c1 | nmdc:mga00v17_259155_c1_192_467 | 91 |
| 820 | 3300050491 | nmdc:mga00v17_919030_c1 | nmdc:mga00v17_919030_c1_253_531 | 91 |
| 821 | 3300050492 | nmdc:mga0yw44_103399_c1 | nmdc:mga0yw44_103399_c1_817_1092 | 91 |
| 822 | 3300050492 | nmdc:mga0yw44_13689_c1 | nmdc:mga0yw44_13689_c1_2923_3198 | 91 |
| 823 | 3300050492 | nmdc:mga0yw44_221506_c1 | nmdc:mga0yw44_221506_c1_940_1215 | 91 |
| 824 | 3300050492 | nmdc:mga0yw44_401444_c1 | nmdc:mga0yw44_401444_c1_389_664 | 91 |
| 825 | 3300050492 | nmdc:mga0yw44_42973_c1 | nmdc:mga0yw44_42973_c1_157_432 | 91 |
| 826 | 3300050492 | nmdc:mga0yw44_598720_c1 | nmdc:mga0yw44_598720_c1_320_598 | 91 |
| 827 | 3300050493 | nmdc:mga0k408_143494_c1 | nmdc:mga0k408_143494_c1_958_1236 | 91 |
| 828 | 3300050493 | nmdc:mga0k408_28971_c1 | nmdc:mga0k408_28971_c1_846_1121 | 91 |
| 829 | 3300050494 | nmdc:mga06z11_2094_c1 | nmdc:mga06z11_2094_c1_559_834 | 91 |
| 830 | 3300050494 | nmdc:mga06z11_456721_c1 | nmdc:mga06z11_456721_c1_360_638 | 91 |
| 831 | 3300050494 | nmdc:mga06z11_610461_c1 | nmdc:mga06z11_610461_c1_297_572 | 91 |
| 832 | 3300050495 | nmdc:mga04h51_1146_c1 | nmdc:mga04h51_1146_c1_5621_5896 | 91 |
| 833 | 3300050496 | nmdc:mga07m45_22861_c1 | nmdc:mga07m45_22861_c1_867_1142 | 91 |
| 834 | 3300050496 | nmdc:mga07m45_457164_c1 | nmdc:mga07m45_457164_c1_51_338 | 91 |
| 835 | 3300050496 | nmdc:mga07m45_467920_c1 | nmdc:mga07m45_467920_c1_298_576 | 91 |
| 836 | 3300050496 | nmdc:mga07m45_90366_c1 | nmdc:mga07m45_90366_c1_1022_1297 | 91 |
| 837 | 3300050513 | nmdc:mga0rr50_303449_c1 | nmdc:mga0rr50_303449_c1_566_841 | 91 |
| 838 | 3300050514 | nmdc:mga08x19_99481_c1 | nmdc:mga08x19_99481_c1_215_490 | 91 |
| 839 | 3300050516 | nmdc:mga0sz30_484400_c1 | nmdc:mga0sz30_484400_c1_97_375 | 91 |
| 840 | 3300050516 | nmdc:mga0sz30_6876_c1 | nmdc:mga0sz30_6876_c1_1247_1522 | 91 |
| 841 | 3300050516 | nmdc:mga0sz30_76137_c1 | nmdc:mga0sz30_76137_c1_546_821 | 91 |
| 842 | 3300053077 | Ga0495601_0068670 | Ga0495601_0068670_41_316 | 91 |
| 843 | 3300053078 | Ga0495612_0369496 | Ga0495612_0369496_127_405 | 91 |
| 844 | 3300053078 | Ga0495612_0621939 | Ga0495612_0621939_82_363 | 91 |
| 845 | 3300053080 | Ga0500635_0015349 | Ga0500635_0015349_69_350 | 91 |
| 846 | 3300053083 | Ga0495655_0014862 | Ga0495655_0014862_1282_1557 | 91 |
| 847 | 3300053083 | Ga0495655_0023385 | Ga0495655_0023385_259_534 | 91 |
| 848 | 3300053083 | Ga0495655_0232483 | Ga0495655_0232483_145_420 | 91 |
| 849 | 3300053085 | Ga0495619_0266401 | Ga0495619_0266401_119_394 | 91 |
| 850 | 3300053086 | Ga0500578_0124755 | Ga0500578_0124755_1124_1399 | 91 |
| 851 | 3300053086 | Ga0500578_0245251 | Ga0500578_0245251_586_861 | 91 |
| 852 | 3300053086 | Ga0500578_0547239 | Ga0500578_0547239_307_582 | 91 |
| 853 | 3300053092 | Ga0500583_0541466 | Ga0500583_0541466_16_291 | 91 |
| 854 | 3300053093 | Ga0500651_0185099 | Ga0500651_0185099_364_639 | 91 |
| 855 | 3300053094 | Ga0500566_0000102 | Ga0500566_0000102_3010_3285 | 91 |
| 856 | 3300053095 | Ga0500640_035152 | Ga0500640_035152_1085_1360 | 91 |
| 857 | 3300053097 | Ga0500648_043660 | Ga0500648_043660_126_401 | 91 |
| 858 | 3300053098 | Ga0500650_0502924 | Ga0500650_0502924_70_345 | 91 |
| 859 | 3300053102 | Ga0500554_003722 | Ga0500554_003722_1878_2159 | 91 |
| 860 | 3300053105 | Ga0500557_249117 | Ga0500557_249117_132_407 | 91 |
| 861 | 3300053109 | Ga0500569_000840 | Ga0500569_000840_2472_2747 | 91 |
| 862 | 3300053109 | Ga0500569_311000 | Ga0500569_311000_99_374 | 91 |
| 863 | 3300053111 | Ga0500572_000793 | Ga0500572_000793_5848_6123 | 91 |
| 864 | 3300053119 | Ga0500595_031991 | Ga0500595_031991_608_883 | 91 |
| 865 | 3300053122 | Ga0500608_041848 | Ga0500608_041848_637_912 | 91 |
| 866 | 3300053122 | Ga0500608_080533 | Ga0500608_080533_35_310 | 91 |
| 867 | 3300053122 | Ga0500608_361337 | Ga0500608_361337_85_360 | 91 |
| 868 | 3300053123 | Ga0500614_079792 | Ga0500614_079792_106_381 | 91 |
| 869 | 3300053128 | Ga0500626_346135 | Ga0500626_346135_119_394 | 91 |
| 870 | 3300053130 | Ga0500642_0000439 | Ga0500642_0000439_3027_3302 | 91 |
| 871 | 3300053136 | Ga0500559_0000586 | Ga0500559_0000586_14157_14432 | 91 |
| 872 | 3300053136 | Ga0500559_0019024 | Ga0500559_0019024_1831_2106 | 91 |
| 873 | 3300053136 | Ga0500559_0175117 | Ga0500559_0175117_711_986 | 91 |
| 874 | 3300053138 | Ga0500564_181559 | Ga0500564_181559_449_724 | 91 |
| 875 | 3300053140 | Ga0500573_0095639 | Ga0500573_0095639_969_1244 | 91 |
| 876 | 3300053148 | Ga0500590_165775 | Ga0500590_165775_497_772 | 91 |
| 877 | 3300053148 | Ga0500590_361233 | Ga0500590_361233_167_442 | 91 |
| 878 | 3300053150 | Ga0500603_000257 | Ga0500603_000257_12647_12928 | 91 |
| 879 | 3300053154 | Ga0500619_000798 | Ga0500619_000798_2553_2828 | 91 |
| 880 | 3300053154 | Ga0500619_173863 | Ga0500619_173863_431_706 | 91 |
| 881 | 3300053155 | Ga0500620_248540 | Ga0500620_248540_35_310 | 91 |
| 882 | 3300053162 | Ga0500638_175255 | Ga0500638_175255_234_509 | 91 |
| 883 | 3300053162 | Ga0500638_272255 | Ga0500638_272255_287_562 | 91 |
| 884 | 3300053163 | Ga0500639_017885 | Ga0500639_017885_2461_2736 | 91 |
| 885 | 3300053163 | Ga0500639_198796 | Ga0500639_198796_31_306 | 91 |
| 886 | 3300053177 | Ga0500636_0123188 | Ga0500636_0123188_151_447 | 91 |
| 887 | 3300053177 | Ga0500636_0198700 | Ga0500636_0198700_224_499 | 91 |
| 888 | 3300053177 | Ga0500636_0280932 | Ga0500636_0280932_234_509 | 91 |
| 889 | 3300053177 | Ga0500636_0370467 | Ga0500636_0370467_188_463 | 91 |
| 890 | 3300053177 | Ga0500636_0478097 | Ga0500636_0478097_205_480 | 91 |
| 891 | 3300053178 | Ga0500637_0016076 | Ga0500637_0016076_922_1203 | 91 |
| 892 | 3300053178 | Ga0500637_0300241 | Ga0500637_0300241_349_624 | 91 |
| 893 | 3300053722 | Ga0500649_190022 | Ga0500649_190022_90_365 | 91 |
| 894 | 3300053725 | Ga0500576_192761 | Ga0500576_192761_94_369 | 91 |
| 895 | 3300053729 | Ga0500625_010749 | Ga0500625_010749_3707_3982 | 91 |
| 896 | 3300053731 | Ga0500609_001617 | Ga0500609_001617_758_1033 | 91 |
| 897 | 3300053733 | Ga0500552_004298 | Ga0500552_004298_518_793 | 91 |
| 898 | 3300053735 | Ga0500596_000109 | Ga0500596_000109_10012_10287 | 91 |
| 899 | 3300053735 | Ga0500596_011502 | Ga0500596_011502_626_901 | 91 |
| 900 | 3300053737 | Ga0500601_000397 | Ga0500601_000397_148_423 | 91 |
| 901 | 3300001979 | JGI24740J21852_10049260 | JGI24740J21852_100492602 | 92 |
| 902 | 3300005341 | Ga0070691_10502212 | Ga0070691_105022122 | 92 |
| 903 | 3300005539 | Ga0068853_100002707 | Ga0068853_10000270711 | 92 |
| 904 | 3300005563 | Ga0068855_100096866 | Ga0068855_1000968661 | 92 |
| 905 | 3300005577 | Ga0068857_100080405 | Ga0068857_1000804052 | 92 |
| 906 | 3300005578 | Ga0068854_100004699 | Ga0068854_1000046996 | 92 |
| 907 | 3300005614 | Ga0068856_100145909 | Ga0068856_1001459092 | 92 |
| 908 | 3300005616 | Ga0068852_100293128 | Ga0068852_1002931282 | 92 |
| 909 | 3300005834 | Ga0068851_10009920 | Ga0068851_100099203 | 92 |
| 910 | 3300009093 | Ga0105240_10010814 | Ga0105240_100108142 | 92 |
| 911 | 3300009174 | Ga0105241_10001768 | Ga0105241_100017682 | 92 |
| 912 | 3300009545 | Ga0105237_11827303 | Ga0105237_118273031 | 92 |
| 913 | 3300009545 | Ga0105237_11845280 | Ga0105237_118452802 | 92 |
| 914 | 3300009551 | Ga0105238_10000897 | Ga0105238_1000089717 | 92 |
| 915 | 3300010375 | Ga0105239_10048692 | Ga0105239_100486922 | 92 |
| 916 | 3300025321 | Ga0207656_10013316 | Ga0207656_100133162 | 92 |
| 917 | 3300025904 | Ga0207647_10604568 | Ga0207647_106045681 | 92 |
| 918 | 3300025911 | Ga0207654_10001817 | Ga0207654_100018171 | 92 |
| 919 | 3300025913 | Ga0207695_10001771 | Ga0207695_1000177127 | 92 |
| 920 | 3300025914 | Ga0207671_10069940 | Ga0207671_100699401 | 92 |
| 921 | 3300025924 | Ga0207694_10000082 | Ga0207694_1000008237 | 92 |
| 922 | 3300025929 | Ga0207664_10996377 | Ga0207664_109963771 | 92 |
| 923 | 3300025949 | Ga0207667_10002113 | Ga0207667_1000211311 | 92 |
| 924 | 3300025981 | Ga0207640_10031916 | Ga0207640_100319162 | 92 |
| 925 | 3300026078 | Ga0207702_10000002 | Ga0207702_10000002383 | 92 |
| 926 | 3300026078 | Ga0207702_10253198 | Ga0207702_102531982 | 92 |
| 927 | 3300026116 | Ga0207674_10003760 | Ga0207674_100037602 | 92 |
| 928 | 3300026142 | Ga0207698_10107708 | Ga0207698_101077082 | 92 |
| 929 | 3300048905 | Ga0496102_0474575 | Ga0496102_0474575_83_376 | 92 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3e19-assembly1.cif.gz_D | crystal structure of iron uptake regulatory protein (feoa) solved by sulfur sad in a monoclinic space group | 0.9275 | 11 | 91 |
| 7r7b-assembly2.cif.gz_B | 1.50 angstroem crystal structure of feoa from bacteroides fragilis | 0.9152 | 12 | 92 |
| 3e19-assembly1.cif.gz_B | crystal structure of iron uptake regulatory protein (feoa) solved by sulfur sad in a monoclinic space group | 0.915 | 11 | 91 |
| 2k5l-assembly1.cif.gz_A | solution nmr structure of protein feoa from clostridium thermocellum, northeast structural genomics consortium target cmr17 | 0.9114 | 12 | 92 |
| 3e19-assembly1.cif.gz_A | crystal structure of iron uptake regulatory protein (feoa) solved by sulfur sad in a monoclinic space group | 0.9044 | 11 | 92 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2k5lA00 | Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) | 0.9114 | 12 | 92 | 2.30.30.90 |
| 3e19A01 | Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) | 0.8969 | 21 | 92 | 2.30.30.90 |
| af_Q57987_2_81_2.30.30.90 | Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) | 0.8966 | 13 | 92 | 2.30.30.90 |
| 2k5iA01 | Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) | 0.8921 | 12 | 91 | 2.30.30.90 |
| 2k5fA01 | Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) | 0.8655 | 12 | 91 | 2.30.30.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A810D1T4-F1-model_v4 | Iron transporter FeoA | 0.9661 | 12 | 92 |
GO:0046914
|
| AF-A0A810D1T4-F1-model_v4 | Iron transporter FeoA | 0.9545 | 12 | 92 |
GO:0046914
|
| AF-A0A316J9M0-F1-model_v4 | Ferrous iron transporter FeoA-like domain-containing protein | 0.9486 | 11 | 92 |
GO:0046914
|
| AF-A0A1H6HE32-F1-model_v4 | Ferrous iron transport protein A | 0.9422 | 10 | 91 |
GO:0046914
|
| AF-A0A537NG22-F1-model_v4 | Ferrous iron transport protein A | 0.9413 | 10 | 92 |
GO:0046914
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar