F485997

General Info

Members Datasets Scaffolds Average Seq Length
929 439 925 92

Family's Representative Sequence

Representative Sequence 3300021441|Ga0213871_10019515|Ga0213871_100195152
Length 111
Sequence MTELLDIALQLPSDARSELASELPAGPPSEFPLGLAQRGYVGRIHRLAAGEAASALSDDELESRLIELGFVEGARVEILHEGILGRDPIAVRVDNVTIAIRRREAMAIIVA

Samples

Sample ID Description Type Environment
1 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
2 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
3 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
82 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
83 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
84 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
113 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
114 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
115 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
116 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
117 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
118 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
119 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
120 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
123 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
182 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
183 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
184 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
185 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
191 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
192 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
193 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
194 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
195 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
196 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
197 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
198 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
199 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
201 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
202 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
203 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
204 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
205 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
206 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
207 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
208 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
209 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
216 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
224 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
225 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
226 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
227 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
228 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
229 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
230 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
231 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
232 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
233 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
234 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
235 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
236 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
237 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
238 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
239 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
240 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
241 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
242 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
243 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
244 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
245 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
246 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
247 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
248 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
249 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
250 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
251 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
252 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
253 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
254 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
255 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
256 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
257 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
260 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
261 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
262 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
263 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
264 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
265 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
266 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
267 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
268 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
269 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
270 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
271 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
272 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
273 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
274 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
275 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
276 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
277 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
278 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
279 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
280 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
281 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
282 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
283 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
284 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
285 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
286 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
287 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
288 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
289 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
290 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
291 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
292 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
293 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
294 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
295 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
296 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
297 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
298 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
299 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
300 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
301 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
302 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
303 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
304 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
305 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
306 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
307 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
308 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
309 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
310 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
311 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
312 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
313 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
314 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
315 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
316 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
317 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
318 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
319 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
320 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
321 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
322 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
323 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
324 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
325 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
326 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
327 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
328 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
329 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
330 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
331 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
332 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
333 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
334 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
335 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
336 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
337 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
338 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
339 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
340 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
341 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
342 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
343 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
344 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
345 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
346 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
347 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
348 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
349 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
350 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
351 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
352 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
353 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
356 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
357 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
358 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
359 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
360 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
364 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
365 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
366 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
367 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
368 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
369 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
370 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
371 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
372 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
373 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
374 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
375 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
376 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
377 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
378 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
379 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
380 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
381 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
382 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
383 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
384 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
385 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
386 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
387 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
388 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
389 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
390 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
391 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
392 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
393 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
394 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
395 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
396 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
397 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
398 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
399 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
400 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
401 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
402 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
403 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
404 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
405 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
406 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
407 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
408 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
409 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
410 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
411 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
412 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
413 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
414 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
415 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
416 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
417 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
418 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
419 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
420 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
421 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
422 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
423 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
424 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
425 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
426 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
427 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
428 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
429 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
430 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
431 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
432 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
433 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
434 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
435 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
436 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
437 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
438 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
439 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.22
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.85
Nodule 2.26
Rhizoplane 5.06
Rhizosphere 60.28
Stem 0
Stem Tuber 0
Unclassified 10.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10049260 3300001979 Bacteria 1218
2 JGI24737J22298_10200636 3300001990 Bacteria 589
3 JGI25153J46596_10009426 3300003215 Bacteria 4538
4 JGI25153J46596_10009681 3300003215 Bacteria 4439
5 JGI25153J46596_10009764 3300003215 Bacteria 4412
6 JGI25160J50197_1001038 3300003354 Bacteria 14357
7 JGI25160J50197_1002799 3300003354 Bacteria 7987
8 JGI25404J52841_10065243 3300003659 Bacteria 762
9 Ga0055539_1018108 3300003752 Bacteria 849
10 Ga0055542_1006171 3300003762 Bacteria 2596
11 Ga0055526_1036333 3300003771 Bacteria 1308
12 Ga0055526_1083681 3300003771 Bacteria 616
13 Ga0055531_10001452 3300003794 Bacteria 17483
14 JGI25405J52794_10074847 3300003911 Bacteria 741
15 Ga0055543_1007350 3300004625 Bacteria 2557
16 Ga0065165_1009022 3300005262 Bacteria 4547
17 Ga0065165_1009421 3300005262 Bacteria 4380
18 Ga0065165_1032020 3300005262 Bacteria 1653
19 Ga0070683_100017083 3300005329 Bacteria 6405
20 Ga0070683_100287789 3300005329 Bacteria 1563
21 Ga0068869_100041945 3300005334 Bacteria 3278
22 Ga0070680_100166491 3300005336 Bacteria 1853
23 Ga0070680_100908337 3300005336 Bacteria 760
24 Ga0070682_101890726 3300005337 Bacteria 523
25 Ga0068868_100117188 3300005338 Bacteria 2170
26 Ga0070660_100151355 3300005339 Bacteria 1865
27 Ga0070691_10502212 3300005341 Bacteria 701
28 Ga0070668_100310687 3300005347 Bacteria 1324
29 Ga0070669_101811366 3300005353 Bacteria 533
30 Ga0070671_100016125 3300005355 Bacteria 6041
31 Ga0070674_100985290 3300005356 Bacteria 739
32 Ga0070673_101539322 3300005364 Bacteria 628
33 Ga0070659_100320536 3300005366 Bacteria 1296
34 Ga0070659_100389105 3300005366 Bacteria 1176
35 Ga0070709_10860417 3300005434 Bacteria 715
36 Ga0070709_11537159 3300005434 Bacteria 541
37 Ga0070714_100637769 3300005435 Bacteria 1025
38 Ga0070713_100537895 3300005436 Bacteria 1105
39 Ga0070713_101653565 3300005436 Bacteria 622
40 Ga0070710_10021089 3300005437 Bacteria 3390
41 Ga0070710_10026413 3300005437 Bacteria 3085
42 Ga0070710_10598807 3300005437 Bacteria 767
43 Ga0070710_11417924 3300005437 Bacteria 520
44 Ga0070711_100014236 3300005439 Bacteria 5009
45 Ga0070711_100102906 3300005439 Bacteria 2080
46 Ga0070711_101137207 3300005439 Bacteria 674
47 Ga0070708_101332860 3300005445 Bacteria 670
48 Ga0070663_100669534 3300005455 Bacteria 879
49 Ga0070678_102220964 3300005456 Bacteria 521
50 Ga0070662_101003699 3300005457 Bacteria 715
51 Ga0070662_101407564 3300005457 Bacteria 601
52 Ga0070681_10043341 3300005458 Bacteria 4508
53 Ga0070681_10176986 3300005458 Bacteria 2055
54 Ga0070679_100069743 3300005530 Bacteria 3506
55 Ga0070679_100167183 3300005530 Bacteria 2172
56 Ga0070684_100002379 3300005535 Bacteria 13868
57 Ga0068853_100002707 3300005539 Bacteria 13370
58 Ga0068853_100938869 3300005539 Bacteria 832
59 Ga0070696_100998745 3300005546 Bacteria 699
60 Ga0070693_100253786 3300005547 Bacteria 1167
61 Ga0070665_100488284 3300005548 Bacteria 1243
62 Ga0068855_100078484 3300005563 Bacteria 3830
63 Ga0068855_100096866 3300005563 Bacteria 3398
64 Ga0068855_100214813 3300005563 Bacteria 2159
65 Ga0068855_100269496 3300005563 Bacteria 1893
66 Ga0068855_100335734 3300005563 Bacteria 1667
67 Ga0068855_100678334 3300005563 Bacteria 1104
68 Ga0070664_100354923 3300005564 Bacteria 1334
69 Ga0070664_100756216 3300005564 Bacteria 907
70 Ga0068857_100073827 3300005577 Bacteria 3039
71 Ga0068857_100080405 3300005577 Bacteria 2910
72 Ga0068857_100081384 3300005577 Bacteria 2892
73 Ga0068857_100279812 3300005577 Bacteria 1535
74 Ga0068854_100004699 3300005578 Bacteria 8607
75 Ga0068856_100069412 3300005614 Bacteria 3484
76 Ga0068856_100145909 3300005614 Bacteria 2374
77 Ga0068852_100293128 3300005616 Bacteria 1572
78 Ga0068852_100724871 3300005616 Bacteria 1005
79 Ga0068852_101200886 3300005616 Bacteria 779
80 Ga0068859_100039038 3300005617 Bacteria 4762
81 Ga0068864_100208011 3300005618 Bacteria 1800
82 Ga0068864_101314320 3300005618 Bacteria 724
83 Ga0068866_10770201 3300005718 Bacteria 666
84 Ga0068861_101066536 3300005719 Bacteria 775
85 Ga0068851_10009920 3300005834 Bacteria 4434
86 Ga0068870_11278937 3300005840 Bacteria 534
87 Ga0068863_100586301 3300005841 Bacteria 1103
88 Ga0068863_100621340 3300005841 Bacteria 1070
89 Ga0068858_100141131 3300005842 Bacteria 2262
90 Ga0068858_100185403 3300005842 Bacteria 1965
91 Ga0068858_100317761 3300005842 Bacteria 1488
92 Ga0068858_101973230 3300005842 Bacteria 577
93 Ga0068860_100008166 3300005843 Bacteria 10422
94 Ga0081455_10000714 3300005937 Bacteria 43138
95 Ga0081455_10268126 3300005937 Bacteria 1240
96 Ga0081455_10349109 3300005937 Bacteria 1044
97 Ga0081540_1011827 3300005983 Bacteria 5799
98 Ga0081540_1020849 3300005983 Bacteria 3926
99 Ga0081540_1084051 3300005983 Bacteria 1422
100 Ga0081539_10098447 3300005985 Bacteria 1496
101 Ga0070717_11113479 3300006028 Bacteria 719
102 Ga0075365_10030283 3300006038 Bacteria 3465
103 Ga0075365_10071715 3300006038 Bacteria 2332
104 Ga0075365_10117047 3300006038 Bacteria 1835
105 Ga0075365_10393087 3300006038 Bacteria 978
106 Ga0075365_10802132 3300006038 Bacteria 664
107 Ga0075368_10007220 3300006042 Bacteria 3916
108 Ga0075363_100023549 3300006048 Bacteria 3122
109 Ga0075363_100447620 3300006048 Bacteria 763
110 Ga0075364_10019903 3300006051 Bacteria 4218
111 Ga0075364_10122023 3300006051 Bacteria 1745
112 Ga0075364_10298960 3300006051 Bacteria 1096
113 Ga0075364_10433400 3300006051 Bacteria 898
114 Ga0070715_11010012 3300006163 Bacteria 519
115 Ga0070716_101324785 3300006173 Bacteria 583
116 Ga0070712_100157022 3300006175 Bacteria 1753
117 Ga0075362_10110997 3300006177 Bacteria 1291
118 Ga0075367_10032938 3300006178 Bacteria 2984
119 Ga0075367_10248766 3300006178 Bacteria 1115
120 Ga0075367_10630209 3300006178 Bacteria 682
121 Ga0075369_10007352 3300006186 Bacteria 4191
122 Ga0075369_10030294 3300006186 Bacteria 2278
123 Ga0075369_10036354 3300006186 Bacteria 2095
124 Ga0075369_10245182 3300006186 Bacteria 832
125 Ga0075369_10469816 3300006186 Bacteria 596
126 Ga0075366_10143771 3300006195 Bacteria 1443
127 Ga0075366_10301186 3300006195 Bacteria 981
128 Ga0097621_100456221 3300006237 Bacteria 1152
129 Ga0097621_100523543 3300006237 Bacteria 1076
130 Ga0075370_10052778 3300006353 Bacteria 2307
131 Ga0075370_10133804 3300006353 Bacteria 1447
132 Ga0075370_10168264 3300006353 Bacteria 1288
133 Ga0075370_10244142 3300006353 Bacteria 1063
134 Ga0068871_100096021 3300006358 Bacteria 2476
135 Ga0068871_101792176 3300006358 Unclassified 583
136 Ga0075433_10560537 3300006852 Bacteria 1004
137 Ga0075436_100156972 3300006914 Bacteria 1603
138 Ga0097620_100039039 3300006931 Bacteria 4762
139 Ga0099825_1037844 3300006941 Bacteria 1570
140 Ga0099825_1056720 3300006941 Bacteria 731
141 Ga0099824_1022136 3300006942 Bacteria 4258
142 Ga0099824_1022833 3300006942 Bacteria 4025
143 Ga0099824_1047115 3300006942 Bacteria 870
144 Ga0099822_1000918 3300006943 Bacteria 31646
145 Ga0099822_1054004 3300006943 Bacteria 1541
146 Ga0099823_1071320 3300006944 Bacteria 1534
147 Ga0075435_100550311 3300007076 Bacteria 999
148 Ga0105250_10176126 3300009092 Bacteria 897
149 Ga0105240_10010814 3300009093 Bacteria 12781
150 Ga0105240_10035144 3300009093 Bacteria 6461
151 Ga0105240_10104049 3300009093 Bacteria 3448
152 Ga0105240_10711275 3300009093 Bacteria 1095
153 Ga0105240_12304444 3300009093 Bacteria 558
154 Ga0105245_10123225 3300009098 Bacteria 2424
155 Ga0105245_10147697 3300009098 Bacteria 2219
156 Ga0105247_10053727 3300009101 Bacteria 2485
157 Ga0105247_10059084 3300009101 Bacteria 2373
158 Ga0105247_10106434 3300009101 Bacteria 1799
159 Ga0105247_10471358 3300009101 Bacteria 909
160 Ga0105243_10591683 3300009148 Bacteria 1067
161 Ga0105241_10001768 3300009174 Bacteria 16393
162 Ga0105241_10619548 3300009174 Bacteria 979
163 Ga0105241_10893969 3300009174 Bacteria 824
164 Ga0105241_12060637 3300009174 Bacteria 563
165 Ga0105242_10546253 3300009176 Bacteria 1110
166 Ga0105242_10624182 3300009176 Bacteria 1044
167 Ga0105248_10426959 3300009177 Bacteria 1493
168 Ga0105248_11952372 3300009177 Bacteria 666
169 Ga0105237_10065418 3300009545 Bacteria 3632
170 Ga0105237_10171437 3300009545 Bacteria 2170
171 Ga0105237_10357668 3300009545 Bacteria 1464
172 Ga0105237_10381641 3300009545 Bacteria 1414
173 Ga0105237_10547922 3300009545 Bacteria 1163
174 Ga0105237_10831447 3300009545 Bacteria 930
175 Ga0105237_11282315 3300009545 Bacteria 739
176 Ga0105237_11458796 3300009545 Bacteria 691
177 Ga0105237_11827303 3300009545 Unclassified 615
178 Ga0105237_11845280 3300009545 Bacteria 612
179 Ga0105238_10000897 3300009551 Bacteria 30590
180 Ga0105238_10080247 3300009551 Bacteria 3252
181 Ga0105238_10228238 3300009551 Bacteria 1839
182 Ga0105238_10532976 3300009551 Bacteria 1177
183 Ga0105238_10642873 3300009551 Bacteria 1070
184 Ga0105238_11198731 3300009551 Bacteria 784
185 Ga0105238_11648624 3300009551 Bacteria 672
186 Ga0105249_10667745 3300009553 Bacteria 1098
187 Ga0105239_10011774 3300010375 Bacteria 9762
188 Ga0105239_10048692 3300010375 Bacteria 4647
189 Ga0105239_10088740 3300010375 Bacteria 3410
190 Ga0105239_10207595 3300010375 Bacteria 2195
191 Ga0105239_10354585 3300010375 Bacteria 1656
192 Ga0105239_11811093 3300010375 Bacteria 707
193 Ga0105239_12281620 3300010375 Unclassified 630
194 Ga0105246_10306641 3300011119 Bacteria 1284
195 Ga0105246_10484958 3300011119 Bacteria 1047
196 Ga0157369_10036608 3300013105 Bacteria 5375
197 Ga0157369_10398041 3300013105 Bacteria 1429
198 Ga0157369_11818291 3300013105 Bacteria 619
199 Ga0157374_10931981 3300013296 Bacteria 887
200 Ga0157374_11585957 3300013296 Bacteria 679
201 Ga0157378_10256390 3300013297 Bacteria 1676
202 Ga0157378_10822584 3300013297 Bacteria 956
203 Ga0163162_10428704 3300013306 Bacteria 1454
204 Ga0163162_11590233 3300013306 Bacteria 745
205 Ga0157372_10237069 3300013307 Bacteria 2116
206 Ga0157372_12064595 3300013307 Bacteria 655
207 Ga0157375_10474540 3300013308 Bacteria 1416
208 Ga0157375_11276814 3300013308 Bacteria 863
209 Ga0163163_10054269 3300014325 Bacteria 3959
210 Ga0182008_10241705 3300014497 Bacteria 929
211 Ga0157379_10608602 3300014968 Bacteria 1020
212 Ga0157376_11380780 3300014969 Bacteria 736
213 Ga0157376_12338680 3300014969 Bacteria 574
214 Ga0182006_1091454 3300015261 Bacteria 1094
215 Ga0182007_10051805 3300015262 Bacteria 1353
216 Ga0163161_10245482 3300017792 Bacteria 1394
217 Ga0163161_10304076 3300017792 Bacteria 1257
218 Ga0214544_1000026 3300021320 Bacteria 161530
219 Ga0214542_1000025 3300021321 Bacteria 183588
220 Ga0214545_1000014 3300021324 Bacteria 183588
221 Ga0214543_1000034 3300021327 Bacteria 183712
222 Ga0213872_10208058 3300021361 Bacteria 836
223 Ga0213874_10032264 3300021377 Bacteria 1520
224 Ga0213874_10251965 3300021377 Bacteria 651
225 Ga0213875_10028728 3300021388 Bacteria 2639
226 Ga0213871_10019515 3300021441 Bacteria 1670
227 Ga0213871_10238265 3300021441 Bacteria 575
228 Ga0209677_100848 3300025253 Bacteria 15132
229 Ga0209148_1000250 3300025254 Bacteria 85755
230 Ga0209148_1032460 3300025254 Bacteria 768
231 Ga0209233_1003352 3300025261 Bacteria 5666
232 Ga0209233_1008106 3300025261 Bacteria 3279
233 Ga0209455_1004562 3300025272 Bacteria 4494
234 Ga0209455_1013630 3300025272 Bacteria 1877
235 Ga0209455_1018916 3300025272 Bacteria 1403
236 Ga0209564_1004440 3300025295 Bacteria 8581
237 Ga0209564_1028543 3300025295 Bacteria 1781
238 Ga0209564_1033620 3300025295 Bacteria 1521
239 Ga0209758_1000141 3300025297 Bacteria 172481
240 Ga0209758_1000324 3300025297 Bacteria 91475
241 Ga0209758_1000476 3300025297 Bacteria 66180
242 Ga0209758_1003329 3300025297 Bacteria 14791
243 Ga0209758_1015424 3300025297 Bacteria 3956
244 Ga0209758_1046709 3300025297 Bacteria 1557
245 Ga0209758_1143950 3300025297 Bacteria 614
246 Ga0209256_1002728 3300025299 Bacteria 13658
247 Ga0209256_1119567 3300025299 Bacteria 518
248 Ga0207426_1000523 3300025302 Bacteria 55736
249 Ga0207426_1000768 3300025302 Bacteria 35650
250 Ga0207426_1026680 3300025302 Bacteria 1931
251 Ga0207426_1075073 3300025302 Bacteria 931
252 Ga0209051_1152598 3300025303 Bacteria 540
253 Ga0209257_1002582 3300025304 Bacteria 17615
254 Ga0209257_1099380 3300025304 Bacteria 712
255 Ga0207656_10013316 3300025321 Bacteria 3141
256 Ga0207656_10218751 3300025321 Bacteria 925
257 Ga0207692_10017859 3300025898 Bacteria 3172
258 Ga0207692_10236359 3300025898 Bacteria 1089
259 Ga0207710_10017337 3300025900 Bacteria 3054
260 Ga0207710_10087928 3300025900 Bacteria 1450
261 Ga0207710_10292309 3300025900 Bacteria 822
262 Ga0207688_10351273 3300025901 Bacteria 909
263 Ga0207680_10158274 3300025903 Bacteria 1516
264 Ga0207680_11047434 3300025903 Bacteria 584
265 Ga0207647_10004820 3300025904 Bacteria 9980
266 Ga0207647_10356072 3300025904 Bacteria 828
267 Ga0207647_10363351 3300025904 Bacteria 819
268 Ga0207647_10604568 3300025904 Bacteria 605
269 Ga0207699_10221205 3300025906 Bacteria 1292
270 Ga0207643_10383008 3300025908 Bacteria 887
271 Ga0207654_10001817 3300025911 Bacteria 11078
272 Ga0207654_10017334 3300025911 Bacteria 3762
273 Ga0207654_10031960 3300025911 Bacteria 2903
274 Ga0207707_10003161 3300025912 Bacteria 14619
275 Ga0207707_10015604 3300025912 Bacteria 6618
276 Ga0207695_10000062 3300025913 Bacteria 351979
277 Ga0207695_10001771 3300025913 Bacteria 34099
278 Ga0207695_10549340 3300025913 Bacteria 1037
279 Ga0207695_10841317 3300025913 Bacteria 798
280 Ga0207695_11445368 3300025913 Bacteria 568
281 Ga0207671_10001205 3300025914 Bacteria 30737
282 Ga0207671_10043199 3300025914 Bacteria 3333
283 Ga0207671_10069940 3300025914 Bacteria 2616
284 Ga0207671_10151099 3300025914 Bacteria 1794
285 Ga0207671_10310269 3300025914 Bacteria 1247
286 Ga0207671_10501126 3300025914 Bacteria 968
287 Ga0207671_10868137 3300025914 Bacteria 714
288 Ga0207693_10180529 3300025915 Bacteria 1661
289 Ga0207663_10031577 3300025916 Bacteria 3136
290 Ga0207663_10103137 3300025916 Bacteria 1920
291 Ga0207663_10493414 3300025916 Bacteria 950
292 Ga0207660_10018435 3300025917 Bacteria 4652
293 Ga0207660_10039296 3300025917 Bacteria 3307
294 Ga0207657_10114414 3300025919 Bacteria 2225
295 Ga0207657_10654947 3300025919 Bacteria 817
296 Ga0207649_11220504 3300025920 Bacteria 594
297 Ga0207649_11464123 3300025920 Bacteria 541
298 Ga0207652_10009942 3300025921 Bacteria 7658
299 Ga0207652_10097768 3300025921 Bacteria 2588
300 Ga0207652_10676717 3300025921 Bacteria 922
301 Ga0207681_11316448 3300025923 Bacteria 607
302 Ga0207694_10000082 3300025924 Bacteria 109787
303 Ga0207694_10248388 3300025924 Bacteria 1455
304 Ga0207694_10251592 3300025924 Bacteria 1446
305 Ga0207694_10809750 3300025924 Bacteria 791
306 Ga0207694_11498117 3300025924 Bacteria 569
307 Ga0207650_10815324 3300025925 Bacteria 791
308 Ga0207659_10278920 3300025926 Bacteria 1366
309 Ga0207687_10135893 3300025927 Bacteria 1859
310 Ga0207687_11427527 3300025927 Bacteria 595
311 Ga0207700_10359036 3300025928 Bacteria 1270
312 Ga0207700_11396031 3300025928 Bacteria 623
313 Ga0207664_10996377 3300025929 Bacteria 751
314 Ga0207644_10034864 3300025931 Bacteria 3523
315 Ga0207644_10070535 3300025931 Bacteria 2554
316 Ga0207644_10492670 3300025931 Bacteria 1010
317 Ga0207690_10313724 3300025932 Bacteria 1230
318 Ga0207690_10383713 3300025932 Bacteria 1117
319 Ga0207706_10176626 3300025933 Bacteria 1876
320 Ga0207686_10518422 3300025934 Bacteria 927
321 Ga0207686_10828071 3300025934 Bacteria 743
322 Ga0207709_10805784 3300025935 Bacteria 758
323 Ga0207670_11165591 3300025936 Bacteria 652
324 Ga0207691_11706453 3300025940 Bacteria 510
325 Ga0207711_10214056 3300025941 Bacteria 1761
326 Ga0207711_10967616 3300025941 Bacteria 790
327 Ga0207711_11124129 3300025941 Bacteria 727
328 Ga0207689_10110262 3300025942 Bacteria 2261
329 Ga0207661_10029201 3300025944 Bacteria 4232
330 Ga0207679_10530099 3300025945 Bacteria 1054
331 Ga0207667_10002113 3300025949 Bacteria 24906
332 Ga0207667_10147910 3300025949 Bacteria 2418
333 Ga0207667_10373483 3300025949 Bacteria 1453
334 Ga0207667_10374749 3300025949 Bacteria 1450
335 Ga0207667_10471976 3300025949 Bacteria 1274
336 Ga0207667_11087428 3300025949 Bacteria 783
337 Ga0207712_10140293 3300025961 Bacteria 1853
338 Ga0207668_10094512 3300025972 Bacteria 2204
339 Ga0207668_10406470 3300025972 Bacteria 1152
340 Ga0207640_10031916 3300025981 Bacteria 3261
341 Ga0207640_11606466 3300025981 Bacteria 586
342 Ga0207658_10252038 3300025986 Bacteria 1500
343 Ga0207658_11272266 3300025986 Bacteria 673
344 Ga0207703_10232211 3300026035 Bacteria 1654
345 Ga0207703_10308243 3300026035 Bacteria 1446
346 Ga0207703_11307722 3300026035 Bacteria 697
347 Ga0207639_10081967 3300026041 Bacteria 2556
348 Ga0207639_10300138 3300026041 Bacteria 1419
349 Ga0207678_10036179 3300026067 Bacteria 4298
350 Ga0207678_10082732 3300026067 Bacteria 2746
351 Ga0207678_10112337 3300026067 Bacteria 2324
352 Ga0207678_10194954 3300026067 Bacteria 1731
353 Ga0207678_11423222 3300026067 Bacteria 613
354 Ga0207702_10000002 3300026078 Bacteria 491507
355 Ga0207702_10103833 3300026078 Bacteria 2514
356 Ga0207702_10253198 3300026078 Bacteria 1654
357 Ga0207702_10673829 3300026078 Bacteria 1018
358 Ga0207702_11589936 3300026078 Bacteria 647
359 Ga0207641_10456059 3300026088 Bacteria 1236
360 Ga0207648_10552188 3300026089 Bacteria 1058
361 Ga0207676_10198475 3300026095 Bacteria 1771
362 Ga0207676_11288139 3300026095 Bacteria 725
363 Ga0207674_10003760 3300026116 Bacteria 18518
364 Ga0207674_10049361 3300026116 Bacteria 4304
365 Ga0207674_10055434 3300026116 Bacteria 4030
366 Ga0207674_10226429 3300026116 Bacteria 1818
367 Ga0207675_100439246 3300026118 Bacteria 1291
368 Ga0207698_10107708 3300026142 Bacteria 2327
369 Ga0207698_10646257 3300026142 Bacteria 1047
370 Ga0209389_1000004 3300027296 Bacteria 263759
371 Ga0209389_1000023 3300027296 Bacteria 150730
372 Ga0209589_1000010 3300027357 Bacteria 237657
373 Ga0209589_1000035 3300027357 Bacteria 134091
374 Ga0209489_100011 3300027361 Bacteria 244710
375 Ga0209489_100079 3300027361 Bacteria 134091
376 Ga0209489_100295 3300027361 Bacteria 87273
377 Ga0209700_100013 3300027363 Bacteria 341906
378 Ga0209700_100077 3300027363 Bacteria 134091
379 Ga0209179_1081140 3300027512 Bacteria 715
380 Ga0209813_10002937 3300027866 Bacteria 3946
381 Ga0268266_11135739 3300028379 Bacteria 756
382 Ga0268265_11008457 3300028380 Bacteria 823
383 Ga0268264_10000093 3300028381 Bacteria 232057
384 Ga0268264_10341893 3300028381 Bacteria 1422
385 Ga0265337_1033985 3300028556 Bacteria 1502
386 Ga0265319_1009818 3300028563 Bacteria 4041
387 Ga0265323_10013826 3300028653 Bacteria 3210
388 Ga0265336_10000668 3300028666 Bacteria 18619
389 Ga0307517_10163514 3300028786 Bacteria 1486
390 Ga0307515_10119659 3300028794 Bacteria 2993
391 Ga0265338_10000013 3300028800 Bacteria 379065
392 Ga0265324_10035591 3300029957 Bacteria 1733
393 Ga0307511_10225658 3300030521 Bacteria 934
394 Ga0265763_1035790 3300030763 Bacteria 581
395 Ga0265340_10033490 3300031247 Bacteria 2558
396 Ga0265339_10012506 3300031249 Bacteria 5179
397 Ga0307513_10500169 3300031456 Bacteria 933
398 Ga0307513_10631505 3300031456 Bacteria 779
399 Ga0307509_10210400 3300031507 Bacteria 1770
400 Ga0307509_10778182 3300031507 Bacteria 622
401 Ga0307508_10242819 3300031616 Bacteria 1398
402 Ga0307508_10813867 3300031616 Bacteria 552
403 Ga0307508_10862876 3300031616 Bacteria 528
404 Ga0307514_10443328 3300031649 Bacteria 642
405 Ga0307405_10471950 3300031731 Bacteria 1000
406 Ga0307405_11000753 3300031731 Bacteria 713
407 Ga0307412_10193911 3300031911 Bacteria 1538
408 Ga0307510_10004240 3300033180 Bacteria 16847
409 Ga0307510_10385582 3300033180 Bacteria 846
410 Ga0373954_0486799 3300035118 Bacteria 611
411 Ga0373931_0551856 3300035691 Bacteria 749
412 Ga0373927_0453531 3300035695 Unclassified 847
413 Ga0373933_0000933 3300035724 Bacteria 17845
414 Ga0373947_0152144 3300035725 Bacteria 1491
415 Ga0373937_0597865 3300036401 Bacteria 1047
416 Ga0310109_026010 3300036534 Bacteria 783
417 Ga0373925_0038129 3300037068 Bacteria 3551
418 Ga0395900_0111877 3300037418 Bacteria 2804
419 Ga0395900_0177754 3300037418 Bacteria 2164
420 Ga0395900_0353195 3300037418 Bacteria 1443
421 Ga0395900_1279924 3300037418 Bacteria 647
422 Ga0395898_0186397 3300037466 Bacteria 1983
423 Ga0395898_0245757 3300037466 Bacteria 1706
424 Ga0395898_0321954 3300037466 Bacteria 1475
425 Ga0395898_0431498 3300037466 Bacteria 1256
426 Ga0395898_1656789 3300037466 Bacteria 563
427 Ga0395905_0005922 3300037471 Bacteria 12395
428 Ga0395905_0597083 3300037471 Bacteria 1006
429 Ga0395905_0866028 3300037471 Bacteria 806
430 Ga0395905_1010743 3300037471 Bacteria 735
431 Ga0436364_0525938 3300037853 Bacteria 3019
432 Ga0436364_1001751 3300037853 Bacteria 2108
433 Ga0395901_0106011 3300038443 Bacteria 2950
434 Ga0395901_0173084 3300038443 Bacteria 2265
435 Ga0395901_0263180 3300038443 Bacteria 1795
436 Ga0395901_0379301 3300038443 Bacteria 1455
437 Ga0395901_0450221 3300038443 Bacteria 1317
438 Ga0395901_1565111 3300038443 Bacteria 613
439 Ga0436365_0166945 3300039437 Bacteria 934
440 Ga0436365_0412690 3300039437 Bacteria 1126
441 Ga0436365_1432657 3300039437 Bacteria 830
442 Ga0436360_0391216 3300039438 Bacteria 866
443 Ga0436360_0473736 3300039438 Bacteria 870
444 Ga0436360_0592197 3300039438 Bacteria 772
445 Ga0436361_0064398 3300039447 Bacteria 1372
446 Ga0436361_0639306 3300039447 Bacteria 5579
447 Ga0436361_0859965 3300039447 Bacteria 945
448 Ga0436363_0212376 3300039450 Bacteria 16030
449 Ga0436363_0797948 3300039450 Bacteria 700
450 Ga0436363_0882467 3300039450 Bacteria 719
451 Ga0436363_1261222 3300039450 Bacteria 1086
452 Ga0436363_1470254 3300039450 Bacteria 2286
453 Ga0436362_0487714 3300039453 Bacteria 2658
454 Ga0439465_0109018 3300041413 Bacteria 962
455 Ga0451787_353093 3300041441 Bacteria 1199
456 Ga0451789_0721162 3300041443 Bacteria 811
457 Ga0451793_1933845 3300041452 Bacteria 1871
458 Ga0451797_0462493 3300041453 Bacteria 1368
459 Ga0451795_1213581 3300041456 Bacteria 2141
460 Ga0451833_0104584 3300041491 Bacteria 1176
461 Ga0451845_0603933 3300041501 Bacteria 827
462 Ga0451851_1265619 3300041507 Bacteria 789
463 Ga0451843_1287380 3300041509 Bacteria 815
464 Ga0451855_0754286 3300041511 Bacteria 1005
465 Ga0451853_1726574 3300041512 Bacteria 1480
466 Ga0451853_4033689 3300041512 Bacteria 949
467 Ga0466969_0040734 3300044656 Bacteria 2327
468 Ga0466969_0104323 3300044656 Bacteria 1332
469 Ga0466969_0206966 3300044656 Bacteria 894
470 Ga0466972_0000185 3300044658 Bacteria 48335
471 Ga0466972_0002548 3300044658 Bacteria 9011
472 Ga0466972_0068110 3300044658 Bacteria 1700
473 Ga0466972_0393405 3300044658 Bacteria 649
474 Ga0466972_0596219 3300044658 Bacteria 522
475 Ga0466965_0102633 3300044683 Bacteria 1464
476 Ga0466965_0166157 3300044683 Bacteria 1159
477 Ga0466966_0006716 3300044684 Bacteria 7622
478 Ga0466966_0035021 3300044684 Bacteria 3245
479 Ga0466966_0276665 3300044684 Bacteria 1010
480 Ga0466961_0000020 3300044693 Bacteria 107610
481 Ga0466961_0187725 3300044693 Bacteria 1282
482 Ga0466961_0285810 3300044693 Bacteria 1009
483 Ga0466961_0376621 3300044693 Bacteria 862
484 Ga0466963_0927209 3300044694 Bacteria 613
485 Ga0466964_0189350 3300044706 Bacteria 981
486 Ga0466964_0288861 3300044706 Bacteria 822
487 Ga0466964_0629727 3300044706 Bacteria 591
488 Ga0466971_0126027 3300044719 Bacteria 1187
489 Ga0466971_0682189 3300044719 Bacteria 516
490 Ga0466968_0073859 3300044735 Bacteria 1488
491 Ga0466968_0159590 3300044735 Bacteria 1040
492 Ga0466968_0390116 3300044735 Bacteria 681
493 Ga0466968_0459512 3300044735 Bacteria 630
494 Ga0466970_0131056 3300044765 Bacteria 1377
495 Ga0466970_0170778 3300044765 Bacteria 1205
496 Ga0466970_0331420 3300044765 Bacteria 862
497 Ga0466970_0345255 3300044765 Bacteria 844
498 Ga0466970_0621087 3300044765 Bacteria 628
499 Ga0466970_0934730 3300044765 Bacteria 510
500 Ga0466957_0212111 3300044842 Bacteria 1275
501 Ga0466957_0221501 3300044842 Bacteria 1249
502 Ga0466957_0550325 3300044842 Bacteria 804
503 Ga0466957_0796988 3300044842 Bacteria 671
504 Ga0466960_0035952 3300044901 Bacteria 2318
505 Ga0466960_0059495 3300044901 Bacteria 1869
506 Ga0466960_0247789 3300044901 Bacteria 989
507 Ga0466960_0290644 3300044901 Bacteria 918
508 Ga0466959_0003692 3300045049 Bacteria 10100
509 Ga0466959_0041108 3300045049 Bacteria 3414
510 Ga0466959_0130082 3300045049 Bacteria 1784
511 Ga0466959_0182710 3300045049 Bacteria 1466
512 Ga0466959_0434728 3300045049 Bacteria 890
513 Ga0466959_0513504 3300045049 Bacteria 809
514 Ga0466958_0205203 3300045836 Bacteria 1255
515 Ga0466967_0021975 3300045976 Bacteria 5195
516 Ga0466967_0063971 3300045976 Bacteria 3271
517 Ga0466967_0085926 3300045976 Bacteria 2849
518 Ga0466967_0200302 3300045976 Bacteria 1891
519 Ga0466967_0236600 3300045976 Bacteria 1741
520 Ga0466967_0286512 3300045976 Bacteria 1581
521 Ga0466967_0545508 3300045976 Bacteria 1141
522 Ga0466967_2137728 3300045976 Bacteria 556
523 Ga0466967_2373971 3300045976 Bacteria 526
524 Ga0495592_0203996 3300046454 Bacteria 1332
525 Ga0495592_0247794 3300046454 Bacteria 1179
526 Ga0495603_0045301 3300046455 Bacteria 2623
527 Ga0495603_0136583 3300046455 Bacteria 1427
528 Ga0495590_0199860 3300046457 Bacteria 734
529 Ga0495629_0001285 3300046459 Bacteria 19732
530 Ga0495638_0011802 3300046460 Bacteria 6013
531 Ga0495638_0035083 3300046460 Bacteria 3198
532 Ga0495651_0038466 3300046462 Bacteria 3725
533 Ga0495651_0101866 3300046462 Bacteria 2136
534 Ga0495651_0141007 3300046462 Bacteria 1748
535 Ga0495651_0820338 3300046462 Bacteria 573
536 Ga0495580_0877413 3300046472 Bacteria 578
537 Ga0495582_0191805 3300046473 Bacteria 1166
538 Ga0495605_0081061 3300046474 Bacteria 1518
539 Ga0495664_0056770 3300046477 Bacteria 2329
540 Ga0495664_0311759 3300046477 Bacteria 949
541 Ga0495664_0349210 3300046477 Bacteria 891
542 Ga0495664_0478508 3300046477 Bacteria 744
543 Ga0495596_0085800 3300046500 Bacteria 1222
544 Ga0495607_0091009 3300046501 Bacteria 1653
545 Ga0495607_0390050 3300046501 Bacteria 635
546 Ga0495606_0030986 3300046507 Bacteria 3724
547 Ga0495606_0067180 3300046507 Bacteria 2271
548 Ga0495606_0188110 3300046507 Bacteria 1185
549 Ga0495606_0328816 3300046507 Bacteria 818
550 Ga0495606_0575883 3300046507 Bacteria 556
551 Ga0495608_0060869 3300046511 Bacteria 2484
552 Ga0495608_0062211 3300046511 Bacteria 2453
553 Ga0495610_0049875 3300046512 Bacteria 2046
554 Ga0495610_0070967 3300046512 Bacteria 1625
555 Ga0495610_0318724 3300046512 Bacteria 594
556 Ga0495616_0200975 3300046513 Bacteria 876
557 Ga0495616_0455469 3300046513 Bacteria 517
558 Ga0495618_0072718 3300046514 Bacteria 2188
559 Ga0495618_0488045 3300046514 Bacteria 744
560 Ga0495620_0060288 3300046515 Bacteria 1582
561 Ga0495620_0253694 3300046515 Bacteria 670
562 Ga0495628_0132421 3300046516 Bacteria 1906
563 Ga0495630_0986379 3300046517 Bacteria 640
564 Ga0495631_0068084 3300046518 Bacteria 1540
565 Ga0495631_0284250 3300046518 Bacteria 704
566 Ga0495632_0146312 3300046519 Bacteria 1094
567 Ga0495637_0141801 3300046520 Bacteria 911
568 Ga0495643_0028133 3300046522 Bacteria 3154
569 Ga0495643_0075593 3300046522 Bacteria 1762
570 Ga0495648_0050585 3300046524 Bacteria 2537
571 Ga0495648_0064052 3300046524 Bacteria 2167
572 Ga0495648_0237437 3300046524 Bacteria 888
573 Ga0495648_0258598 3300046524 Bacteria 836
574 Ga0495666_0363793 3300046526 Bacteria 651
575 Ga0495652_0053762 3300046529 Bacteria 3432
576 Ga0495652_0469601 3300046529 Bacteria 877
577 Ga0495654_0095952 3300046530 Bacteria 1370
578 Ga0495654_0452613 3300046530 Bacteria 505
579 Ga0495640_0057207 3300046533 Bacteria 2662
580 Ga0495640_0140324 3300046533 Bacteria 1558
581 Ga0495587_0021616 3300046536 Bacteria 3969
582 Ga0495587_0245417 3300046536 Bacteria 1007
583 Ga0495609_0031800 3300046538 Bacteria 2398
584 Ga0495609_0133495 3300046538 Bacteria 1062
585 Ga0495597_0199933 3300046542 Bacteria 801
586 Ga0495597_0386445 3300046542 Bacteria 533
587 Ga0495645_0111168 3300046543 Bacteria 1938
588 Ga0495645_0112784 3300046543 Bacteria 1922
589 Ga0495622_0009981 3300046557 Bacteria 4392
590 Ga0495622_0040118 3300046557 Bacteria 2179
591 Ga0495622_0052370 3300046557 Bacteria 1893
592 Ga0495622_0290350 3300046557 Bacteria 714
593 Ga0495667_0053258 3300046559 Bacteria 2665
594 Ga0495667_0200209 3300046559 Bacteria 1278
595 Ga0495668_0048350 3300046616 Bacteria 2360
596 Ga0495668_0225914 3300046616 Bacteria 1025
597 Ga0495668_0241109 3300046616 Bacteria 990
598 Ga0495668_0331889 3300046616 Bacteria 834
599 Ga0495634_0040997 3300046642 Bacteria 3146
600 Ga0495634_0177656 3300046642 Bacteria 1335
601 Ga0495611_0249773 3300046648 Bacteria 822
602 Ga0495625_0030766 3300046660 Bacteria 4000
603 Ga0495625_0038858 3300046660 Bacteria 3479
604 Ga0495625_0198951 3300046660 Bacteria 1324
605 Ga0495625_0583290 3300046660 Bacteria 673
606 Ga0495635_0023671 3300046663 Bacteria 4277
607 Ga0495635_0031388 3300046663 Bacteria 3689
608 Ga0495661_0098074 3300046665 Bacteria 1655
609 Ga0495661_0126378 3300046665 Bacteria 1406
610 Ga0495661_0279441 3300046665 Bacteria 842
611 Ga0495588_0055901 3300046674 Bacteria 2037
612 Ga0495657_0016485 3300046675 Bacteria 5383
613 Ga0495657_0055404 3300046675 Bacteria 2644
614 Ga0495599_0035925 3300046678 Bacteria 3110
615 Ga0495623_0041891 3300046679 Bacteria 2918
616 Ga0495669_0406910 3300046684 Bacteria 660
617 Ga0495613_0079714 3300046689 Bacteria 2381
618 Ga0495613_0636937 3300046689 Bacteria 706
619 Ga0495624_0580529 3300046690 Bacteria 668
620 Ga0495670_0026163 3300046691 Bacteria 2888
621 Ga0495671_0043264 3300046692 Bacteria 2261
622 Ga0495671_0480141 3300046692 Bacteria 593
623 Ga0495649_0040446 3300046694 Bacteria 2553
624 Ga0495649_0042895 3300046694 Bacteria 2470
625 Ga0495649_0359144 3300046694 Bacteria 735
626 Ga0495600_0129859 3300046809 Bacteria 1638
627 Ga0495600_0203778 3300046809 Bacteria 1269
628 Ga0495660_0051426 3300046810 Bacteria 2242
629 Ga0495660_0360464 3300046810 Bacteria 645
630 Ga0495581_0128299 3300047315 Bacteria 1477
631 Ga0495581_0149248 3300047315 Bacteria 1365
632 Ga0495581_0812326 3300047315 Bacteria 536
633 Ga0495604_0003054 3300047317 Bacteria 13376
634 Ga0495604_0041708 3300047317 Bacteria 3598
635 Ga0495604_0217471 3300047317 Bacteria 1317
636 Ga0495674_0415602 3300047319 Bacteria 1084
637 Ga0495672_0036011 3300047320 Bacteria 3042
638 Ga0495676_0626363 3300047321 Bacteria 699
639 Ga0495680_0009821 3300047322 Bacteria 8580
640 Ga0495680_0759034 3300047322 Bacteria 636
641 Ga0495683_0033555 3300047323 Bacteria 2611
642 Ga0495683_0094088 3300047323 Bacteria 1448
643 Ga0495683_0191404 3300047323 Bacteria 928
644 Ga0495687_050393 3300047443 Bacteria 1774
645 Ga0495675_0013853 3300047444 Bacteria 5097
646 Ga0495679_049956 3300047446 Bacteria 1260
647 Ga0495673_0080196 3300047469 Bacteria 1353
648 Ga0495673_0101115 3300047469 Bacteria 1165
649 Ga0495681_0152685 3300047470 Bacteria 968
650 Ga0495684_0635979 3300047471 Bacteria 715
651 Ga0495686_0119194 3300047472 Bacteria 1575
652 Ga0495686_0168208 3300047472 Bacteria 1276
653 Ga0495686_0339242 3300047472 Bacteria 819
654 Ga0495686_0394564 3300047472 Bacteria 744
655 Ga0495593_0028504 3300047673 Bacteria 3066
656 Ga0495593_0246960 3300047673 Bacteria 894
657 Ga0495593_0436123 3300047673 Bacteria 655
658 Ga0495602_0052424 3300048088 Bacteria 3623
659 Ga0495602_0297797 3300048088 Bacteria 1181
660 Ga0495602_0975344 3300048088 Bacteria 560
661 Ga0495614_0104954 3300048089 Bacteria 1238
662 Ga0495614_0120350 3300048089 Bacteria 1157
663 Ga0495626_0064892 3300048091 Bacteria 1653
664 Ga0495626_0266394 3300048091 Bacteria 684
665 Ga0496100_0093485 3300048903 Bacteria 2057
666 Ga0496100_0178283 3300048903 Bacteria 1535
667 Ga0496100_0722340 3300048903 Bacteria 778
668 Ga0496101_0065722 3300048904 Bacteria 2644
669 Ga0496101_0328503 3300048904 Bacteria 1200
670 Ga0496101_1391190 3300048904 Bacteria 547
671 Ga0496102_0116763 3300048905 Bacteria 2490
672 Ga0496102_0140116 3300048905 Bacteria 2267
673 Ga0496102_0474575 3300048905 Bacteria 1172
674 Ga0496102_1126269 3300048905 Bacteria 704
675 Ga0496103_0008146 3300048906 Bacteria 6223
676 Ga0496103_0551670 3300048906 Bacteria 736
677 Ga0496104_0038487 3300048907 Bacteria 4475
678 Ga0496104_0044409 3300048907 Bacteria 4175
679 Ga0496104_0133123 3300048907 Bacteria 2388
680 Ga0496105_0032381 3300048908 Bacteria 4289
681 Ga0496105_0062791 3300048908 Bacteria 3065
682 Ga0496105_0063630 3300048908 Bacteria 3043
683 Ga0496106_0041714 3300048909 Bacteria 3439
684 Ga0496106_0217335 3300048909 Bacteria 1523
685 Ga0496106_0288897 3300048909 Bacteria 1314
686 Ga0496106_0471014 3300048909 Bacteria 1009
687 Ga0496106_1136216 3300048909 Bacteria 611
688 Ga0496107_0034315 3300048910 Bacteria 3634
689 Ga0496107_0151834 3300048910 Bacteria 1714
690 Ga0496107_0861897 3300048910 Bacteria 661
691 Ga0496108_0016881 3300048911 Bacteria 5967
692 Ga0496108_0421798 3300048911 Bacteria 1165
693 Ga0496108_0536819 3300048911 Bacteria 1021
694 Ga0496110_0034199 3300048913 Bacteria 4401
695 Ga0496110_0425015 3300048913 Bacteria 1211
696 Ga0496111_0156108 3300048914 Bacteria 1693
697 Ga0496111_0412822 3300048914 Bacteria 997
698 Ga0496112_0027577 3300048915 Bacteria 5476
699 Ga0496113_0051590 3300048916 Bacteria 3070
700 Ga0496113_0291175 3300048916 Bacteria 1306
701 Ga0496113_0295533 3300048916 Bacteria 1296
702 Ga0496114_0032966 3300048917 Bacteria 4266
703 Ga0496114_0215451 3300048917 Bacteria 1685
704 Ga0496115_0176298 3300048918 Bacteria 1768
705 Ga0496115_0690340 3300048918 Bacteria 803
706 Ga0496116_0001906 3300048919 Bacteria 22482
707 Ga0496116_0085259 3300048919 Bacteria 1942
708 Ga0496116_0380962 3300048919 Bacteria 632
709 Ga0496117_0015840 3300048920 Bacteria 6395
710 Ga0496117_0086903 3300048920 Bacteria 2029
711 Ga0496117_0134615 3300048920 Bacteria 1491
712 Ga0496117_0306801 3300048920 Bacteria 838
713 Ga0496117_0314808 3300048920 Bacteria 823
714 Ga0496118_0034657 3300048921 Bacteria 4113
715 Ga0496118_0151060 3300048921 Bacteria 1454
716 Ga0496118_0156238 3300048921 Bacteria 1418
717 Ga0496118_0160430 3300048921 Bacteria 1391
718 Ga0496118_0165431 3300048921 Bacteria 1360
719 Ga0496118_0571919 3300048921 Bacteria 546
720 Ga0496119_0018797 3300048922 Bacteria 5123
721 Ga0496119_0035827 3300048922 Bacteria 3246
722 Ga0496119_0045469 3300048922 Bacteria 2752
723 Ga0496119_0097375 3300048922 Bacteria 1658
724 Ga0496119_0313779 3300048922 Bacteria 769
725 Ga0496120_0029078 3300048923 Bacteria 3377
726 Ga0496120_0072474 3300048923 Bacteria 1887
727 Ga0496120_0095303 3300048923 Bacteria 1582
728 Ga0496120_0177773 3300048923 Bacteria 1047
729 Ga0496120_0222969 3300048923 Bacteria 900
730 Ga0496120_0287462 3300048923 Bacteria 758
731 Ga0496120_0298228 3300048923 Bacteria 739
732 Ga0496121_0009004 3300048924 Bacteria 11575
733 Ga0496121_0018129 3300048924 Bacteria 7121
734 Ga0496121_0048015 3300048924 Bacteria 3637
735 Ga0496121_0061856 3300048924 Bacteria 3070
736 Ga0496121_0118304 3300048924 Bacteria 2006
737 Ga0496121_0121261 3300048924 Bacteria 1974
738 Ga0496121_0206266 3300048924 Bacteria 1396
739 Ga0496121_0492157 3300048924 Bacteria 780
740 Ga0496121_0776870 3300048924 Bacteria 566
741 Ga0496122_0015242 3300048925 Bacteria 7356
742 Ga0496122_0125615 3300048925 Bacteria 1643
743 Ga0496122_0416039 3300048925 Bacteria 677
744 Ga0496123_0006942 3300048926 Bacteria 10813
745 Ga0496124_0065496 3300048927 Bacteria 3029
746 Ga0496124_0073104 3300048927 Bacteria 2838
747 Ga0496124_0126514 3300048927 Bacteria 2035
748 Ga0496124_0634846 3300048927 Bacteria 688
749 Ga0496124_0812105 3300048927 Bacteria 578
750 Ga0496125_0008019 3300048928 Bacteria 11150
751 Ga0496125_0034920 3300048928 Bacteria 4422
752 Ga0496125_0040757 3300048928 Bacteria 3979
753 Ga0496125_0082484 3300048928 Bacteria 2451
754 Ga0496125_0133841 3300048928 Bacteria 1738
755 Ga0496126_0009236 3300048929 Bacteria 10511
756 Ga0496126_0019391 3300048929 Bacteria 6698
757 Ga0496126_0050913 3300048929 Bacteria 3773
758 Ga0496126_0061206 3300048929 Bacteria 3382
759 Ga0496126_0092565 3300048929 Bacteria 2656
760 Ga0496126_0118740 3300048929 Bacteria 2295
761 Ga0496126_0156146 3300048929 Bacteria 1952
762 Ga0496126_0158694 3300048929 Bacteria 1934
763 Ga0496126_0248505 3300048929 Bacteria 1483
764 Ga0496126_0666681 3300048929 Bacteria 812
765 Ga0496126_1202423 3300048929 Bacteria 557
766 Ga0496126_1316172 3300048929 Bacteria 525
767 Ga0495678_069694 3300049459 Bacteria 1293
768 Ga0495682_0009626 3300049460 Bacteria 3767
769 Ga0501046_0015227 3300049580 Bacteria 6467
770 Ga0501047_0059550 3300049581 Bacteria 3686
771 Ga0501047_0196339 3300049581 Bacteria 1880
772 Ga0501067_0256177 3300049583 Bacteria 974
773 Ga0501070_0046583 3300049586 Bacteria 3605
774 Ga0501073_0041052 3300049589 Bacteria 3270
775 Ga0501074_0008985 3300049590 Bacteria 7251
776 Ga0501079_0568949 3300049741 Bacteria 891
777 Ga0501080_0094062 3300049742 Bacteria 2783
778 Ga0501035_0276557 3300049822 Bacteria 1420
779 Ga0501035_0479586 3300049822 Bacteria 1026
780 Ga0501044_0104264 3300049823 Bacteria 2850
781 Ga0501044_1000360 3300049823 Bacteria 708
782 nmdc:mga03683_549237_c1 3300050489 Bacteria 562
783 nmdc:mga03n38_11183_c1 3300050490 Bacteria 3335
784 nmdc:mga03n38_776574_c1 3300050490 Bacteria 556
785 nmdc:mga00v17_102408_c1 3300050491 Bacteria 1809
786 nmdc:mga00v17_238788_c1 3300050491 Bacteria 1178
787 nmdc:mga00v17_259155_c1 3300050491 Bacteria 1128
788 nmdc:mga00v17_64421_c2 3300050491 Bacteria 881
789 nmdc:mga00v17_919030_c1 3300050491 Bacteria 553
790 nmdc:mga0yw44_103399_c1 3300050492 Bacteria 1817
791 nmdc:mga0yw44_13689_c1 3300050492 Bacteria 4280
792 nmdc:mga0yw44_165223_c1 3300050492 Bacteria 1451
793 nmdc:mga0yw44_221506_c1 3300050492 Bacteria 1254
794 nmdc:mga0yw44_401444_c1 3300050492 Bacteria 927
795 nmdc:mga0yw44_42973_c1 3300050492 Bacteria 2697
796 nmdc:mga0yw44_598720_c1 3300050492 Bacteria 749
797 nmdc:mga0k408_143494_c1 3300050493 Bacteria 1421
798 nmdc:mga0k408_28971_c1 3300050493 Bacteria 2633
799 nmdc:mga06z11_2094_c1 3300050494 Bacteria 7575
800 nmdc:mga06z11_456721_c1 3300050494 Bacteria 772
801 nmdc:mga06z11_610461_c1 3300050494 Bacteria 664
802 nmdc:mga04h51_1146_c1 3300050495 Bacteria 6124
803 nmdc:mga07m45_22861_c1 3300050496 Bacteria 3415
804 nmdc:mga07m45_363215_c1 3300050496 Bacteria 841
805 nmdc:mga07m45_457164_c1 3300050496 Bacteria 740
806 nmdc:mga07m45_467920_c1 3300050496 Bacteria 731
807 nmdc:mga07m45_90366_c1 3300050496 Bacteria 1754
808 nmdc:mga0rr50_303449_c1 3300050513 Bacteria 1336
809 nmdc:mga08x19_99481_c1 3300050514 Bacteria 1928
810 nmdc:mga0sz30_19652_c1 3300050516 Bacteria 2718
811 nmdc:mga0sz30_484400_c1 3300050516 Bacteria 556
812 nmdc:mga0sz30_6876_c1 3300050516 Bacteria 4247
813 nmdc:mga0sz30_76137_c1 3300050516 Bacteria 1449
814 Ga0495601_0068670 3300053077 Bacteria 2259
815 Ga0495612_0369496 3300053078 Bacteria 649
816 Ga0495612_0621939 3300053078 Bacteria 500
817 Ga0500635_0015349 3300053080 Bacteria 2261
818 Ga0495655_0014862 3300053083 Bacteria 1642
819 Ga0495655_0023385 3300053083 Bacteria 1424
820 Ga0495655_0232483 3300053083 Bacteria 614
821 Ga0495619_0266401 3300053085 Bacteria 1187
822 Ga0500578_0124755 3300053086 Bacteria 1617
823 Ga0500578_0245251 3300053086 Bacteria 1081
824 Ga0500578_0311758 3300053086 Bacteria 930
825 Ga0500578_0438975 3300053086 Bacteria 745
826 Ga0500578_0547239 3300053086 Bacteria 644
827 Ga0500643_000197 3300053087 Bacteria 57531
828 Ga0500643_027764 3300053087 Bacteria 1756
829 Ga0500646_0204960 3300053090 Bacteria 678
830 Ga0500583_0009378 3300053092 Bacteria 3574
831 Ga0500583_0541466 3300053092 Bacteria 542
832 Ga0500651_0019621 3300053093 Bacteria 4203
833 Ga0500651_0185099 3300053093 Bacteria 1235
834 Ga0500566_0000102 3300053094 Bacteria 43512
835 Ga0500566_0002448 3300053094 Bacteria 11013
836 Ga0500640_035152 3300053095 Bacteria 2202
837 Ga0500648_043660 3300053097 Bacteria 2545
838 Ga0500650_0354334 3300053098 Bacteria 641
839 Ga0500650_0502924 3300053098 Bacteria 515
840 Ga0500554_003722 3300053102 Bacteria 3150
841 Ga0500554_114961 3300053102 Bacteria 906
842 Ga0500555_010096 3300053103 Bacteria 2703
843 Ga0500555_091693 3300053103 Bacteria 780
844 Ga0500556_0000005 3300053104 Bacteria 581135
845 Ga0500556_0036258 3300053104 Bacteria 1709
846 Ga0500557_249117 3300053105 Bacteria 556
847 Ga0500562_030251 3300053108 Bacteria 1426
848 Ga0500562_049547 3300053108 Bacteria 1122
849 Ga0500569_000840 3300053109 Bacteria 5448
850 Ga0500569_009325 3300053109 Bacteria 2277
851 Ga0500569_311000 3300053109 Bacteria 529
852 Ga0500572_000793 3300053111 Bacteria 10109
853 Ga0500593_240400 3300053117 Bacteria 621
854 Ga0500594_0088556 3300053118 Bacteria 936
855 Ga0500595_031991 3300053119 Bacteria 1760
856 Ga0500608_000388 3300053122 Bacteria 16893
857 Ga0500608_041848 3300053122 Bacteria 2198
858 Ga0500608_080533 3300053122 Bacteria 1537
859 Ga0500608_361337 3300053122 Bacteria 510
860 Ga0500614_079792 3300053123 Bacteria 913
861 Ga0500618_003834 3300053125 Bacteria 5017
862 Ga0500621_208643 3300053126 Bacteria 686
863 Ga0500626_346135 3300053128 Bacteria 501
864 Ga0500642_0000009 3300053130 Bacteria 286829
865 Ga0500642_0000439 3300053130 Bacteria 13378
866 Ga0500642_0023472 3300053130 Bacteria 2477
867 Ga0500652_000453 3300053131 Bacteria 14542
868 Ga0500652_077104 3300053131 Bacteria 1386
869 Ga0500655_084591 3300053133 Bacteria 655
870 Ga0500658_0111513 3300053134 Bacteria 1204
871 Ga0500559_0000586 3300053136 Bacteria 24993
872 Ga0500559_0000957 3300053136 Bacteria 18135
873 Ga0500559_0019024 3300053136 Bacteria 2902
874 Ga0500559_0175117 3300053136 Bacteria 1009
875 Ga0500564_181559 3300053138 Unclassified 877
876 Ga0500564_197302 3300053138 Bacteria 829
877 Ga0500568_0000637 3300053139 Bacteria 25280
878 Ga0500568_0047809 3300053139 Bacteria 1693
879 Ga0500573_0095639 3300053140 Bacteria 1674
880 Ga0500577_0165179 3300053142 Bacteria 944
881 Ga0500577_0256846 3300053142 Bacteria 760
882 Ga0500588_0159073 3300053146 Bacteria 821
883 Ga0500590_001186 3300053148 Bacteria 10342
884 Ga0500590_165775 3300053148 Bacteria 978
885 Ga0500590_361233 3300053148 Bacteria 514
886 Ga0500603_000257 3300053150 Bacteria 13994
887 Ga0500616_0000035 3300053153 Bacteria 394242
888 Ga0500616_0123607 3300053153 Bacteria 1232
889 Ga0500619_000798 3300053154 Bacteria 5377
890 Ga0500619_173863 3300053154 Bacteria 729
891 Ga0500619_254927 3300053154 Bacteria 577
892 Ga0500620_248540 3300053155 Bacteria 592
893 Ga0500622_0005661 3300053156 Bacteria 7435
894 Ga0500624_014925 3300053157 Bacteria 1182
895 Ga0500627_0003471 3300053158 Bacteria 4878
896 Ga0500633_0053212 3300053160 Bacteria 1403
897 Ga0500634_0036599 3300053161 Bacteria 2672
898 Ga0500634_0177245 3300053161 Bacteria 964
899 Ga0500638_175255 3300053162 Bacteria 930
900 Ga0500638_272255 3300053162 Bacteria 669
901 Ga0500639_017885 3300053163 Bacteria 3739
902 Ga0500639_198796 3300053163 Bacteria 864
903 Ga0500636_0003056 3300053177 Bacteria 9377
904 Ga0500636_0123188 3300053177 Bacteria 1452
905 Ga0500636_0198700 3300053177 Unclassified 1062
906 Ga0500636_0280932 3300053177 Bacteria 831
907 Ga0500636_0370467 3300053177 Bacteria 676
908 Ga0500636_0478097 3300053177 Bacteria 556
909 Ga0500637_0016076 3300053178 Bacteria 3983
910 Ga0500637_0300241 3300053178 Bacteria 876
911 Ga0500649_190022 3300053722 Bacteria 680
912 Ga0500570_091002 3300053724 Bacteria 1328
913 Ga0500576_192761 3300053725 Bacteria 704
914 Ga0500625_010749 3300053729 Bacteria 4131
915 Ga0500645_118861 3300053730 Bacteria 738
916 Ga0500645_170189 3300053730 Bacteria 595
917 Ga0500609_001617 3300053731 Bacteria 3280
918 Ga0500552_004298 3300053733 Bacteria 1493
919 Ga0500596_000109 3300053735 Bacteria 11573
920 Ga0500596_011502 3300053735 Bacteria 1353
921 Ga0500596_015690 3300053735 Bacteria 1137
922 Ga0500599_008872 3300053736 Bacteria 1310
923 Ga0500601_000397 3300053737 Bacteria 7498
924 Ga0500661_011097 3300055283 Bacteria 1633
925 Ga0466962_0097390 3300061719 Bacteria 1411

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10711275 Ga0105240_107112752 82
2 3300009545 Ga0105237_10171437 Ga0105237_101714373 82
3 3300025914 Ga0207671_10151099 Ga0207671_101510992 82
4 3300037418 Ga0395900_0177754 Ga0395900_0177754_300_578 84
5 3300037466 Ga0395898_0245757 Ga0395898_0245757_951_1229 84
6 3300038443 Ga0395901_0379301 Ga0395901_0379301_658_936 84
7 3300049823 Ga0501044_1000360 Ga0501044_1000360_147_425 84
8 3300003771 Ga0055526_1083681 Ga0055526_10836811 87
9 3300006038 Ga0075365_10117047 Ga0075365_101170472 87
10 3300006051 Ga0075364_10019903 Ga0075364_100199032 87
11 3300006186 Ga0075369_10469816 Ga0075369_104698162 87
12 3300006353 Ga0075370_10168264 Ga0075370_101682642 87
13 3300025295 Ga0209564_1033620 Ga0209564_10336202 87
14 3300048909 Ga0496106_0471014 Ga0496106_0471014_114_398 87
15 3300048919 Ga0496116_0001906 Ga0496116_0001906_2933_3217 87
16 3300048920 Ga0496117_0015840 Ga0496117_0015840_5567_5851 87
17 3300048921 Ga0496118_0160430 Ga0496118_0160430_193_477 87
18 3300048927 Ga0496124_0126514 Ga0496124_0126514_944_1228 87
19 3300048928 Ga0496125_0034920 Ga0496125_0034920_3936_4220 87
20 3300050491 nmdc:mga00v17_64421_c2 nmdc:mga00v17_64421_c2_393_677 87
21 3300050496 nmdc:mga07m45_363215_c1 nmdc:mga07m45_363215_c1_275_559 87
22 3300050516 nmdc:mga0sz30_19652_c1 nmdc:mga0sz30_19652_c1_1389_1673 87
23 iso_pu_bacteria 2602042107 2603858020 87
24 iso_pu_bacteria 8006926726 8006930497 87
25 3300005718 Ga0068866_10770201 Ga0068866_107702011 88
26 3300006941 Ga0099825_1037844 Ga0099825_10378442 88
27 3300006942 Ga0099824_1022833 Ga0099824_10228332 88
28 3300006943 Ga0099822_1000918 Ga0099822_10009182 88
29 3300026067 Ga0207678_10036179 Ga0207678_100361792 88
30 3300027357 Ga0209589_1000035 Ga0209589_1000035127 88
31 3300027361 Ga0209489_100079 Ga0209489_100079127 88
32 3300027363 Ga0209700_100077 Ga0209700_100077127 88
33 3300028794 Ga0307515_10119659 Ga0307515_101196592 88
34 3300031456 Ga0307513_10631505 Ga0307513_106315052 88
35 3300031731 Ga0307405_11000753 Ga0307405_110007532 88
36 3300031911 Ga0307412_10193911 Ga0307412_101939112 88
37 3300037471 Ga0395905_0597083 Ga0395905_0597083_181_492 88
38 3300046460 Ga0495638_0011802 Ga0495638_0011802_985_1272 88
39 3300046501 Ga0495607_0390050 Ga0495607_0390050_165_452 88
40 3300046507 Ga0495606_0188110 Ga0495606_0188110_93_380 88
41 3300046512 Ga0495610_0049875 Ga0495610_0049875_1465_1752 88
42 3300046513 Ga0495616_0455469 Ga0495616_0455469_122_409 88
43 3300046515 Ga0495620_0060288 Ga0495620_0060288_153_440 88
44 3300046518 Ga0495631_0068084 Ga0495631_0068084_1005_1292 88
45 3300046520 Ga0495637_0141801 Ga0495637_0141801_176_463 88
46 3300046524 Ga0495648_0258598 Ga0495648_0258598_237_524 88
47 3300046530 Ga0495654_0095952 Ga0495654_0095952_240_527 88
48 3300046542 Ga0495597_0386445 Ga0495597_0386445_37_324 88
49 3300046557 Ga0495622_0040118 Ga0495622_0040118_886_1173 88
50 3300046616 Ga0495668_0225914 Ga0495668_0225914_480_767 88
51 3300046660 Ga0495625_0030766 Ga0495625_0030766_2545_2832 88
52 3300046660 Ga0495625_0198951 Ga0495625_0198951_68_352 88
53 3300046665 Ga0495661_0126378 Ga0495661_0126378_778_1065 88
54 3300046691 Ga0495670_0026163 Ga0495670_0026163_1747_2034 88
55 3300046692 Ga0495671_0480141 Ga0495671_0480141_37_324 88
56 3300046810 Ga0495660_0051426 Ga0495660_0051426_1153_1440 88
57 3300047317 Ga0495604_0217471 Ga0495604_0217471_123_410 88
58 3300047320 Ga0495672_0036011 Ga0495672_0036011_296_571 88
59 3300047321 Ga0495676_0626363 Ga0495676_0626363_261_548 88
60 3300047323 Ga0495683_0191404 Ga0495683_0191404_430_717 88
61 3300047470 Ga0495681_0152685 Ga0495681_0152685_186_473 88
62 3300047472 Ga0495686_0168208 Ga0495686_0168208_469_756 88
63 3300047673 Ga0495593_0246960 Ga0495593_0246960_586_873 88
64 3300048919 Ga0496116_0380962 Ga0496116_0380962_27_314 88
65 3300048920 Ga0496117_0134615 Ga0496117_0134615_183_470 88
66 3300048923 Ga0496120_0029078 Ga0496120_0029078_587_874 88
67 3300048923 Ga0496120_0287462 Ga0496120_0287462_82_366 88
68 3300048924 Ga0496121_0009004 Ga0496121_0009004_5711_5998 88
69 3300048924 Ga0496121_0118304 Ga0496121_0118304_202_507 88
70 3300048925 Ga0496122_0416039 Ga0496122_0416039_138_425 88
71 3300048926 Ga0496123_0006942 Ga0496123_0006942_2920_3207 88
72 3300048928 Ga0496125_0008019 Ga0496125_0008019_1407_1694 88
73 3300048929 Ga0496126_0118740 Ga0496126_0118740_1637_1924 88
74 3300049459 Ga0495678_069694 Ga0495678_069694_472_759 88
75 3300050492 nmdc:mga0yw44_165223_c1 nmdc:mga0yw44_165223_c1_780_1067 88
76 3300053086 Ga0500578_0311758 Ga0500578_0311758_161_448 88
77 3300053087 Ga0500643_027764 Ga0500643_027764_630_917 88
78 3300053090 Ga0500646_0204960 Ga0500646_0204960_129_416 88
79 3300053093 Ga0500651_0019621 Ga0500651_0019621_981_1268 88
80 3300053094 Ga0500566_0002448 Ga0500566_0002448_3980_4267 88
81 3300053102 Ga0500554_114961 Ga0500554_114961_50_337 88
82 3300053103 Ga0500555_091693 Ga0500555_091693_201_488 88
83 3300053104 Ga0500556_0000005 Ga0500556_0000005_416681_416968 88
84 3300053108 Ga0500562_049547 Ga0500562_049547_17_304 88
85 3300053109 Ga0500569_009325 Ga0500569_009325_1221_1508 88
86 3300053117 Ga0500593_240400 Ga0500593_240400_309_596 88
87 3300053122 Ga0500608_000388 Ga0500608_000388_6907_7194 88
88 3300053125 Ga0500618_003834 Ga0500618_003834_4532_4819 88
89 3300053126 Ga0500621_208643 Ga0500621_208643_200_487 88
90 3300053130 Ga0500642_0000009 Ga0500642_0000009_183341_183628 88
91 3300053131 Ga0500652_000453 Ga0500652_000453_7962_8249 88
92 3300053136 Ga0500559_0000957 Ga0500559_0000957_3849_4136 88
93 3300053138 Ga0500564_197302 Ga0500564_197302_333_620 88
94 3300053139 Ga0500568_0000637 Ga0500568_0000637_16098_16385 88
95 3300053142 Ga0500577_0256846 Ga0500577_0256846_93_380 88
96 3300053148 Ga0500590_001186 Ga0500590_001186_3633_3920 88
97 3300053153 Ga0500616_0000035 Ga0500616_0000035_5367_5654 88
98 3300053154 Ga0500619_254927 Ga0500619_254927_64_351 88
99 3300053157 Ga0500624_014925 Ga0500624_014925_41_328 88
100 3300053160 Ga0500633_0053212 Ga0500633_0053212_152_439 88
101 3300053161 Ga0500634_0177245 Ga0500634_0177245_377_664 88
102 3300053177 Ga0500636_0003056 Ga0500636_0003056_4091_4378 88
103 3300053724 Ga0500570_091002 Ga0500570_091002_980_1267 88
104 3300053730 Ga0500645_170189 Ga0500645_170189_200_487 88
105 3300053735 Ga0500596_015690 Ga0500596_015690_375_662 88
106 iso_pu_bacteria 2857524615 2857527402 88
107 iso_pu_bacteria 2893066018 2893071940 88
108 3300003911 JGI25405J52794_10074847 JGI25405J52794_100748472 89
109 3300005937 Ga0081455_10000714 Ga0081455_1000071427 89
110 3300047469 Ga0495673_0101115 Ga0495673_0101115_19_321 89
111 3300006028 Ga0070717_11113479 Ga0070717_111134792 90
112 3300031616 Ga0307508_10813867 Ga0307508_108138671 90
113 3300033180 Ga0307510_10004240 Ga0307510_1000424018 90
114 3300035118 Ga0373954_0486799 Ga0373954_0486799_185_466 90
115 3300036401 Ga0373937_0597865 Ga0373937_0597865_228_509 90
116 3300038443 Ga0395901_0173084 Ga0395901_0173084_927_1199 90
117 3300039450 Ga0436363_0882467 Ga0436363_0882467_49_321 90
118 3300039453 Ga0436362_0487714 Ga0436362_0487714_1262_1621 90
119 3300044656 Ga0466969_0206966 Ga0466969_0206966_69_350 90
120 3300044684 Ga0466966_0035021 Ga0466966_0035021_702_983 90
121 3300044765 Ga0466970_0131056 Ga0466970_0131056_774_1055 90
122 3300045049 Ga0466959_0130082 Ga0466959_0130082_177_458 90
123 3300046460 Ga0495638_0035083 Ga0495638_0035083_1092_1367 90
124 3300046462 Ga0495651_0141007 Ga0495651_0141007_674_955 90
125 3300046524 Ga0495648_0050585 Ga0495648_0050585_36_311 90
126 3300046530 Ga0495654_0452613 Ga0495654_0452613_35_310 90
127 3300046648 Ga0495611_0249773 Ga0495611_0249773_13_288 90
128 3300046660 Ga0495625_0583290 Ga0495625_0583290_118_393 90
129 3300046665 Ga0495661_0098074 Ga0495661_0098074_56_331 90
130 3300046694 Ga0495649_0359144 Ga0495649_0359144_314_589 90
131 3300046810 Ga0495660_0360464 Ga0495660_0360464_56_331 90
132 3300047322 Ga0495680_0759034 Ga0495680_0759034_46_327 90
133 3300047446 Ga0495679_049956 Ga0495679_049956_270_545 90
134 3300047472 Ga0495686_0394564 Ga0495686_0394564_294_569 90
135 3300048088 Ga0495602_0975344 Ga0495602_0975344_236_517 90
136 3300048091 Ga0495626_0266394 Ga0495626_0266394_351_626 90
137 3300048922 Ga0496119_0313779 Ga0496119_0313779_333_608 90
138 3300048923 Ga0496120_0177773 Ga0496120_0177773_576_851 90
139 3300048924 Ga0496121_0492157 Ga0496121_0492157_422_697 90
140 3300048927 Ga0496124_0812105 Ga0496124_0812105_31_309 90
141 3300053086 Ga0500578_0438975 Ga0500578_0438975_148_423 90
142 3300053087 Ga0500643_000197 Ga0500643_000197_680_955 90
143 3300053092 Ga0500583_0009378 Ga0500583_0009378_1377_1652 90
144 3300053098 Ga0500650_0354334 Ga0500650_0354334_115_390 90
145 3300053103 Ga0500555_010096 Ga0500555_010096_2362_2637 90
146 3300053104 Ga0500556_0036258 Ga0500556_0036258_555_830 90
147 3300053108 Ga0500562_030251 Ga0500562_030251_430_705 90
148 3300053118 Ga0500594_0088556 Ga0500594_0088556_646_921 90
149 3300053130 Ga0500642_0023472 Ga0500642_0023472_1471_1746 90
150 3300053131 Ga0500652_077104 Ga0500652_077104_708_983 90
151 3300053133 Ga0500655_084591 Ga0500655_084591_53_328 90
152 3300053134 Ga0500658_0111513 Ga0500658_0111513_53_328 90
153 3300053139 Ga0500568_0047809 Ga0500568_0047809_327_602 90
154 3300053142 Ga0500577_0165179 Ga0500577_0165179_261_536 90
155 3300053146 Ga0500588_0159073 Ga0500588_0159073_359_634 90
156 3300053153 Ga0500616_0123607 Ga0500616_0123607_927_1202 90
157 3300053156 Ga0500622_0005661 Ga0500622_0005661_867_1142 90
158 3300053158 Ga0500627_0003471 Ga0500627_0003471_3738_4013 90
159 3300053161 Ga0500634_0036599 Ga0500634_0036599_462_737 90
160 3300053730 Ga0500645_118861 Ga0500645_118861_342_617 90
161 3300053736 Ga0500599_008872 Ga0500599_008872_767_1042 90
162 3300055283 Ga0500661_011097 Ga0500661_011097_342_617 90
163 3300061719 Ga0466962_0097390 Ga0466962_0097390_222_503 90
164 3300001990 JGI24737J22298_10200636 JGI24737J22298_102006361 91
165 3300003215 JGI25153J46596_10009426 JGI25153J46596_100094262 91
166 3300003215 JGI25153J46596_10009681 JGI25153J46596_100096815 91
167 3300003215 JGI25153J46596_10009764 JGI25153J46596_100097645 91
168 3300003354 JGI25160J50197_1001038 JGI25160J50197_10010385 91
169 3300003354 JGI25160J50197_1002799 JGI25160J50197_10027992 91
170 3300003659 JGI25404J52841_10065243 JGI25404J52841_100652432 91
171 3300003752 Ga0055539_1018108 Ga0055539_10181082 91
172 3300003762 Ga0055542_1006171 Ga0055542_10061714 91
173 3300003771 Ga0055526_1036333 Ga0055526_10363331 91
174 3300003794 Ga0055531_10001452 Ga0055531_100014524 91
175 3300004625 Ga0055543_1007350 Ga0055543_10073502 91
176 3300005262 Ga0065165_1009022 Ga0065165_10090226 91
177 3300005262 Ga0065165_1009421 Ga0065165_10094215 91
178 3300005262 Ga0065165_1032020 Ga0065165_10320203 91
179 3300005329 Ga0070683_100017083 Ga0070683_1000170836 91
180 3300005329 Ga0070683_100287789 Ga0070683_1002877893 91
181 3300005334 Ga0068869_100041945 Ga0068869_1000419452 91
182 3300005336 Ga0070680_100166491 Ga0070680_1001664912 91
183 3300005336 Ga0070680_100908337 Ga0070680_1009083372 91
184 3300005337 Ga0070682_101890726 Ga0070682_1018907261 91
185 3300005338 Ga0068868_100117188 Ga0068868_1001171881 91
186 3300005339 Ga0070660_100151355 Ga0070660_1001513552 91
187 3300005347 Ga0070668_100310687 Ga0070668_1003106873 91
188 3300005353 Ga0070669_101811366 Ga0070669_1018113661 91
189 3300005355 Ga0070671_100016125 Ga0070671_1000161252 91
190 3300005356 Ga0070674_100985290 Ga0070674_1009852901 91
191 3300005364 Ga0070673_101539322 Ga0070673_1015393222 91
192 3300005366 Ga0070659_100320536 Ga0070659_1003205361 91
193 3300005366 Ga0070659_100389105 Ga0070659_1003891052 91
194 3300005434 Ga0070709_10860417 Ga0070709_108604172 91
195 3300005434 Ga0070709_11537159 Ga0070709_115371591 91
196 3300005435 Ga0070714_100637769 Ga0070714_1006377692 91
197 3300005436 Ga0070713_100537895 Ga0070713_1005378952 91
198 3300005436 Ga0070713_101653565 Ga0070713_1016535651 91
199 3300005437 Ga0070710_10021089 Ga0070710_100210893 91
200 3300005437 Ga0070710_10026413 Ga0070710_100264135 91
201 3300005437 Ga0070710_10598807 Ga0070710_105988071 91
202 3300005437 Ga0070710_11417924 Ga0070710_114179241 91
203 3300005439 Ga0070711_100014236 Ga0070711_1000142365 91
204 3300005439 Ga0070711_100102906 Ga0070711_1001029063 91
205 3300005439 Ga0070711_101137207 Ga0070711_1011372071 91
206 3300005445 Ga0070708_101332860 Ga0070708_1013328601 91
207 3300005455 Ga0070663_100669534 Ga0070663_1006695342 91
208 3300005456 Ga0070678_102220964 Ga0070678_1022209641 91
209 3300005457 Ga0070662_101003699 Ga0070662_1010036992 91
210 3300005457 Ga0070662_101407564 Ga0070662_1014075642 91
211 3300005458 Ga0070681_10043341 Ga0070681_100433415 91
212 3300005458 Ga0070681_10176986 Ga0070681_101769862 91
213 3300005530 Ga0070679_100069743 Ga0070679_1000697436 91
214 3300005530 Ga0070679_100167183 Ga0070679_1001671833 91
215 3300005535 Ga0070684_100002379 Ga0070684_10000237910 91
216 3300005539 Ga0068853_100938869 Ga0068853_1009388691 91
217 3300005546 Ga0070696_100998745 Ga0070696_1009987451 91
218 3300005547 Ga0070693_100253786 Ga0070693_1002537862 91
219 3300005548 Ga0070665_100488284 Ga0070665_1004882842 91
220 3300005563 Ga0068855_100078484 Ga0068855_1000784846 91
221 3300005563 Ga0068855_100214813 Ga0068855_1002148132 91
222 3300005563 Ga0068855_100269496 Ga0068855_1002694963 91
223 3300005563 Ga0068855_100335734 Ga0068855_1003357342 91
224 3300005563 Ga0068855_100678334 Ga0068855_1006783341 91
225 3300005564 Ga0070664_100354923 Ga0070664_1003549232 91
226 3300005564 Ga0070664_100756216 Ga0070664_1007562162 91
227 3300005577 Ga0068857_100073827 Ga0068857_1000738275 91
228 3300005577 Ga0068857_100081384 Ga0068857_1000813842 91
229 3300005577 Ga0068857_100279812 Ga0068857_1002798124 91
230 3300005614 Ga0068856_100069412 Ga0068856_1000694122 91
231 3300005616 Ga0068852_100724871 Ga0068852_1007248712 91
232 3300005616 Ga0068852_101200886 Ga0068852_1012008861 91
233 3300005617 Ga0068859_100039038 Ga0068859_1000390384 91
234 3300005618 Ga0068864_100208011 Ga0068864_1002080112 91
235 3300005618 Ga0068864_101314320 Ga0068864_1013143202 91
236 3300005719 Ga0068861_101066536 Ga0068861_1010665362 91
237 3300005840 Ga0068870_11278937 Ga0068870_112789371 91
238 3300005841 Ga0068863_100586301 Ga0068863_1005863012 91
239 3300005841 Ga0068863_100621340 Ga0068863_1006213402 91
240 3300005842 Ga0068858_100141131 Ga0068858_1001411314 91
241 3300005842 Ga0068858_100185403 Ga0068858_1001854032 91
242 3300005842 Ga0068858_100317761 Ga0068858_1003177612 91
243 3300005842 Ga0068858_101973230 Ga0068858_1019732302 91
244 3300005843 Ga0068860_100008166 Ga0068860_1000081665 91
245 3300005937 Ga0081455_10268126 Ga0081455_102681263 91
246 3300005937 Ga0081455_10349109 Ga0081455_103491092 91
247 3300005983 Ga0081540_1011827 Ga0081540_10118276 91
248 3300005983 Ga0081540_1020849 Ga0081540_10208494 91
249 3300005983 Ga0081540_1084051 Ga0081540_10840512 91
250 3300005985 Ga0081539_10098447 Ga0081539_100984473 91
251 3300006038 Ga0075365_10030283 Ga0075365_100302834 91
252 3300006038 Ga0075365_10071715 Ga0075365_100717152 91
253 3300006038 Ga0075365_10393087 Ga0075365_103930872 91
254 3300006038 Ga0075365_10802132 Ga0075365_108021322 91
255 3300006042 Ga0075368_10007220 Ga0075368_100072205 91
256 3300006048 Ga0075363_100023549 Ga0075363_1000235492 91
257 3300006048 Ga0075363_100447620 Ga0075363_1004476201 91
258 3300006051 Ga0075364_10122023 Ga0075364_101220234 91
259 3300006051 Ga0075364_10298960 Ga0075364_102989602 91
260 3300006051 Ga0075364_10433400 Ga0075364_104334002 91
261 3300006163 Ga0070715_11010012 Ga0070715_110100122 91
262 3300006173 Ga0070716_101324785 Ga0070716_1013247852 91
263 3300006175 Ga0070712_100157022 Ga0070712_1001570224 91
264 3300006177 Ga0075362_10110997 Ga0075362_101109972 91
265 3300006178 Ga0075367_10032938 Ga0075367_100329382 91
266 3300006178 Ga0075367_10248766 Ga0075367_102487663 91
267 3300006178 Ga0075367_10630209 Ga0075367_106302091 91
268 3300006186 Ga0075369_10007352 Ga0075369_100073522 91
269 3300006186 Ga0075369_10030294 Ga0075369_100302941 91
270 3300006186 Ga0075369_10036354 Ga0075369_100363542 91
271 3300006186 Ga0075369_10245182 Ga0075369_102451822 91
272 3300006195 Ga0075366_10143771 Ga0075366_101437712 91
273 3300006195 Ga0075366_10301186 Ga0075366_103011862 91
274 3300006237 Ga0097621_100456221 Ga0097621_1004562212 91
275 3300006237 Ga0097621_100523543 Ga0097621_1005235432 91
276 3300006353 Ga0075370_10052778 Ga0075370_100527784 91
277 3300006353 Ga0075370_10133804 Ga0075370_101338042 91
278 3300006353 Ga0075370_10244142 Ga0075370_102441423 91
279 3300006358 Ga0068871_100096021 Ga0068871_1000960212 91
280 3300006358 Ga0068871_101792176 Ga0068871_1017921761 91
281 3300006852 Ga0075433_10560537 Ga0075433_105605373 91
282 3300006914 Ga0075436_100156972 Ga0075436_1001569722 91
283 3300006931 Ga0097620_100039039 Ga0097620_1000390394 91
284 3300006941 Ga0099825_1056720 Ga0099825_10567202 91
285 3300006942 Ga0099824_1022136 Ga0099824_10221362 91
286 3300006942 Ga0099824_1047115 Ga0099824_10471152 91
287 3300006943 Ga0099822_1054004 Ga0099822_10540043 91
288 3300006944 Ga0099823_1071320 Ga0099823_10713203 91
289 3300007076 Ga0075435_100550311 Ga0075435_1005503112 91
290 3300009092 Ga0105250_10176126 Ga0105250_101761262 91
291 3300009093 Ga0105240_10035144 Ga0105240_100351442 91
292 3300009093 Ga0105240_10104049 Ga0105240_101040496 91
293 3300009093 Ga0105240_12304444 Ga0105240_123044441 91
294 3300009098 Ga0105245_10123225 Ga0105245_101232252 91
295 3300009098 Ga0105245_10147697 Ga0105245_101476972 91
296 3300009101 Ga0105247_10053727 Ga0105247_100537274 91
297 3300009101 Ga0105247_10059084 Ga0105247_100590842 91
298 3300009101 Ga0105247_10106434 Ga0105247_101064342 91
299 3300009101 Ga0105247_10471358 Ga0105247_104713582 91
300 3300009148 Ga0105243_10591683 Ga0105243_105916832 91
301 3300009174 Ga0105241_10619548 Ga0105241_106195481 91
302 3300009174 Ga0105241_10893969 Ga0105241_108939692 91
303 3300009174 Ga0105241_12060637 Ga0105241_120606372 91
304 3300009176 Ga0105242_10546253 Ga0105242_105462532 91
305 3300009176 Ga0105242_10624182 Ga0105242_106241821 91
306 3300009177 Ga0105248_10426959 Ga0105248_104269591 91
307 3300009177 Ga0105248_11952372 Ga0105248_119523722 91
308 3300009545 Ga0105237_10065418 Ga0105237_100654184 91
309 3300009545 Ga0105237_10357668 Ga0105237_103576682 91
310 3300009545 Ga0105237_10381641 Ga0105237_103816412 91
311 3300009545 Ga0105237_10547922 Ga0105237_105479222 91
312 3300009545 Ga0105237_10831447 Ga0105237_108314473 91
313 3300009545 Ga0105237_11282315 Ga0105237_112823152 91
314 3300009545 Ga0105237_11458796 Ga0105237_114587961 91
315 3300009551 Ga0105238_10080247 Ga0105238_100802474 91
316 3300009551 Ga0105238_10228238 Ga0105238_102282384 91
317 3300009551 Ga0105238_10532976 Ga0105238_105329762 91
318 3300009551 Ga0105238_10642873 Ga0105238_106428731 91
319 3300009551 Ga0105238_11198731 Ga0105238_111987311 91
320 3300009551 Ga0105238_11648624 Ga0105238_116486242 91
321 3300009553 Ga0105249_10667745 Ga0105249_106677451 91
322 3300010375 Ga0105239_10011774 Ga0105239_100117742 91
323 3300010375 Ga0105239_10088740 Ga0105239_100887402 91
324 3300010375 Ga0105239_10207595 Ga0105239_102075952 91
325 3300010375 Ga0105239_10354585 Ga0105239_103545854 91
326 3300010375 Ga0105239_11811093 Ga0105239_118110932 91
327 3300010375 Ga0105239_12281620 Ga0105239_122816201 91
328 3300011119 Ga0105246_10306641 Ga0105246_103066413 91
329 3300011119 Ga0105246_10484958 Ga0105246_104849582 91
330 3300013105 Ga0157369_10036608 Ga0157369_100366082 91
331 3300013105 Ga0157369_10398041 Ga0157369_103980413 91
332 3300013105 Ga0157369_11818291 Ga0157369_118182912 91
333 3300013296 Ga0157374_10931981 Ga0157374_109319812 91
334 3300013296 Ga0157374_11585957 Ga0157374_115859572 91
335 3300013297 Ga0157378_10256390 Ga0157378_102563901 91
336 3300013297 Ga0157378_10822584 Ga0157378_108225842 91
337 3300013306 Ga0163162_10428704 Ga0163162_104287042 91
338 3300013306 Ga0163162_11590233 Ga0163162_115902332 91
339 3300013307 Ga0157372_10237069 Ga0157372_102370695 91
340 3300013307 Ga0157372_12064595 Ga0157372_120645952 91
341 3300013308 Ga0157375_10474540 Ga0157375_104745402 91
342 3300013308 Ga0157375_11276814 Ga0157375_112768143 91
343 3300014325 Ga0163163_10054269 Ga0163163_100542695 91
344 3300014497 Ga0182008_10241705 Ga0182008_102417051 91
345 3300014968 Ga0157379_10608602 Ga0157379_106086021 91
346 3300014969 Ga0157376_11380780 Ga0157376_113807801 91
347 3300014969 Ga0157376_12338680 Ga0157376_123386802 91
348 3300015261 Ga0182006_1091454 Ga0182006_10914542 91
349 3300015262 Ga0182007_10051805 Ga0182007_100518052 91
350 3300017792 Ga0163161_10245482 Ga0163161_102454823 91
351 3300017792 Ga0163161_10304076 Ga0163161_103040762 91
352 3300021320 Ga0214544_1000026 Ga0214544_100002667 91
353 3300021321 Ga0214542_1000025 Ga0214542_100002594 91
354 3300021324 Ga0214545_1000014 Ga0214545_100001484 91
355 3300021327 Ga0214543_1000034 Ga0214543_100003493 91
356 3300021361 Ga0213872_10208058 Ga0213872_102080582 91
357 3300021377 Ga0213874_10032264 Ga0213874_100322642 91
358 3300021377 Ga0213874_10251965 Ga0213874_102519652 91
359 3300021388 Ga0213875_10028728 Ga0213875_100287284 91
360 3300021441 Ga0213871_10019515 Ga0213871_100195152 91
361 3300021441 Ga0213871_10238265 Ga0213871_102382652 91
362 3300025253 Ga0209677_100848 Ga0209677_1008487 91
363 3300025254 Ga0209148_1000250 Ga0209148_100025049 91
364 3300025254 Ga0209148_1032460 Ga0209148_10324602 91
365 3300025261 Ga0209233_1003352 Ga0209233_10033527 91
366 3300025261 Ga0209233_1008106 Ga0209233_10081062 91
367 3300025272 Ga0209455_1004562 Ga0209455_10045624 91
368 3300025272 Ga0209455_1013630 Ga0209455_10136302 91
369 3300025272 Ga0209455_1018916 Ga0209455_10189163 91
370 3300025295 Ga0209564_1004440 Ga0209564_10044409 91
371 3300025295 Ga0209564_1028543 Ga0209564_10285432 91
372 3300025297 Ga0209758_1000141 Ga0209758_100014179 91
373 3300025297 Ga0209758_1000324 Ga0209758_100032464 91
374 3300025297 Ga0209758_1000476 Ga0209758_100047629 91
375 3300025297 Ga0209758_1003329 Ga0209758_100332916 91
376 3300025297 Ga0209758_1015424 Ga0209758_10154245 91
377 3300025297 Ga0209758_1046709 Ga0209758_10467092 91
378 3300025297 Ga0209758_1143950 Ga0209758_11439502 91
379 3300025299 Ga0209256_1002728 Ga0209256_10027289 91
380 3300025299 Ga0209256_1119567 Ga0209256_11195671 91
381 3300025302 Ga0207426_1000523 Ga0207426_100052334 91
382 3300025302 Ga0207426_1000768 Ga0207426_100076831 91
383 3300025302 Ga0207426_1026680 Ga0207426_10266802 91
384 3300025302 Ga0207426_1075073 Ga0207426_10750732 91
385 3300025303 Ga0209051_1152598 Ga0209051_11525982 91
386 3300025304 Ga0209257_1002582 Ga0209257_10025829 91
387 3300025304 Ga0209257_1099380 Ga0209257_10993802 91
388 3300025321 Ga0207656_10218751 Ga0207656_102187512 91
389 3300025898 Ga0207692_10017859 Ga0207692_100178592 91
390 3300025898 Ga0207692_10236359 Ga0207692_102363592 91
391 3300025900 Ga0207710_10017337 Ga0207710_100173372 91
392 3300025900 Ga0207710_10087928 Ga0207710_100879282 91
393 3300025900 Ga0207710_10292309 Ga0207710_102923092 91
394 3300025901 Ga0207688_10351273 Ga0207688_103512732 91
395 3300025903 Ga0207680_10158274 Ga0207680_101582743 91
396 3300025903 Ga0207680_11047434 Ga0207680_110474342 91
397 3300025904 Ga0207647_10004820 Ga0207647_1000482012 91
398 3300025904 Ga0207647_10356072 Ga0207647_103560722 91
399 3300025904 Ga0207647_10363351 Ga0207647_103633512 91
400 3300025906 Ga0207699_10221205 Ga0207699_102212052 91
401 3300025908 Ga0207643_10383008 Ga0207643_103830082 91
402 3300025911 Ga0207654_10017334 Ga0207654_100173345 91
403 3300025911 Ga0207654_10031960 Ga0207654_100319605 91
404 3300025912 Ga0207707_10003161 Ga0207707_1000316118 91
405 3300025912 Ga0207707_10015604 Ga0207707_100156042 91
406 3300025913 Ga0207695_10000062 Ga0207695_10000062192 91
407 3300025913 Ga0207695_10549340 Ga0207695_105493402 91
408 3300025913 Ga0207695_10841317 Ga0207695_108413172 91
409 3300025913 Ga0207695_11445368 Ga0207695_114453681 91
410 3300025914 Ga0207671_10001205 Ga0207671_1000120524 91
411 3300025914 Ga0207671_10043199 Ga0207671_100431992 91
412 3300025914 Ga0207671_10310269 Ga0207671_103102692 91
413 3300025914 Ga0207671_10501126 Ga0207671_105011262 91
414 3300025914 Ga0207671_10868137 Ga0207671_108681372 91
415 3300025915 Ga0207693_10180529 Ga0207693_101805292 91
416 3300025916 Ga0207663_10031577 Ga0207663_100315772 91
417 3300025916 Ga0207663_10103137 Ga0207663_101031372 91
418 3300025916 Ga0207663_10493414 Ga0207663_104934142 91
419 3300025917 Ga0207660_10018435 Ga0207660_100184352 91
420 3300025917 Ga0207660_10039296 Ga0207660_100392962 91
421 3300025919 Ga0207657_10114414 Ga0207657_101144144 91
422 3300025919 Ga0207657_10654947 Ga0207657_106549472 91
423 3300025920 Ga0207649_11220504 Ga0207649_112205042 91
424 3300025920 Ga0207649_11464123 Ga0207649_114641231 91
425 3300025921 Ga0207652_10009942 Ga0207652_100099422 91
426 3300025921 Ga0207652_10097768 Ga0207652_100977682 91
427 3300025921 Ga0207652_10676717 Ga0207652_106767171 91
428 3300025923 Ga0207681_11316448 Ga0207681_113164482 91
429 3300025924 Ga0207694_10248388 Ga0207694_102483883 91
430 3300025924 Ga0207694_10251592 Ga0207694_102515922 91
431 3300025924 Ga0207694_10809750 Ga0207694_108097502 91
432 3300025924 Ga0207694_11498117 Ga0207694_114981172 91
433 3300025925 Ga0207650_10815324 Ga0207650_108153242 91
434 3300025926 Ga0207659_10278920 Ga0207659_102789202 91
435 3300025927 Ga0207687_10135893 Ga0207687_101358934 91
436 3300025927 Ga0207687_11427527 Ga0207687_114275271 91
437 3300025928 Ga0207700_10359036 Ga0207700_103590362 91
438 3300025928 Ga0207700_11396031 Ga0207700_113960311 91
439 3300025931 Ga0207644_10034864 Ga0207644_100348642 91
440 3300025931 Ga0207644_10070535 Ga0207644_100705354 91
441 3300025931 Ga0207644_10492670 Ga0207644_104926702 91
442 3300025932 Ga0207690_10313724 Ga0207690_103137242 91
443 3300025932 Ga0207690_10383713 Ga0207690_103837132 91
444 3300025933 Ga0207706_10176626 Ga0207706_101766264 91
445 3300025934 Ga0207686_10518422 Ga0207686_105184222 91
446 3300025934 Ga0207686_10828071 Ga0207686_108280712 91
447 3300025935 Ga0207709_10805784 Ga0207709_108057842 91
448 3300025936 Ga0207670_11165591 Ga0207670_111655912 91
449 3300025940 Ga0207691_11706453 Ga0207691_117064532 91
450 3300025941 Ga0207711_10214056 Ga0207711_102140562 91
451 3300025941 Ga0207711_10967616 Ga0207711_109676162 91
452 3300025941 Ga0207711_11124129 Ga0207711_111241292 91
453 3300025942 Ga0207689_10110262 Ga0207689_101102622 91
454 3300025944 Ga0207661_10029201 Ga0207661_100292014 91
455 3300025945 Ga0207679_10530099 Ga0207679_105300992 91
456 3300025949 Ga0207667_10147910 Ga0207667_101479102 91
457 3300025949 Ga0207667_10373483 Ga0207667_103734831 91
458 3300025949 Ga0207667_10374749 Ga0207667_103747491 91
459 3300025949 Ga0207667_10471976 Ga0207667_104719762 91
460 3300025949 Ga0207667_11087428 Ga0207667_110874282 91
461 3300025961 Ga0207712_10140293 Ga0207712_101402932 91
462 3300025972 Ga0207668_10094512 Ga0207668_100945124 91
463 3300025972 Ga0207668_10406470 Ga0207668_104064702 91
464 3300025981 Ga0207640_11606466 Ga0207640_116064661 91
465 3300025986 Ga0207658_10252038 Ga0207658_102520382 91
466 3300025986 Ga0207658_11272266 Ga0207658_112722661 91
467 3300026035 Ga0207703_10232211 Ga0207703_102322112 91
468 3300026035 Ga0207703_10308243 Ga0207703_103082434 91
469 3300026035 Ga0207703_11307722 Ga0207703_113077222 91
470 3300026041 Ga0207639_10081967 Ga0207639_100819673 91
471 3300026041 Ga0207639_10300138 Ga0207639_103001382 91
472 3300026067 Ga0207678_10082732 Ga0207678_100827324 91
473 3300026067 Ga0207678_10112337 Ga0207678_101123372 91
474 3300026067 Ga0207678_10194954 Ga0207678_101949542 91
475 3300026067 Ga0207678_11423222 Ga0207678_114232222 91
476 3300026078 Ga0207702_10103833 Ga0207702_101038332 91
477 3300026078 Ga0207702_10673829 Ga0207702_106738292 91
478 3300026078 Ga0207702_11589936 Ga0207702_115899362 91
479 3300026088 Ga0207641_10456059 Ga0207641_104560592 91
480 3300026089 Ga0207648_10552188 Ga0207648_105521882 91
481 3300026095 Ga0207676_10198475 Ga0207676_101984754 91
482 3300026095 Ga0207676_11288139 Ga0207676_112881392 91
483 3300026116 Ga0207674_10049361 Ga0207674_100493612 91
484 3300026116 Ga0207674_10055434 Ga0207674_100554346 91
485 3300026116 Ga0207674_10226429 Ga0207674_102264292 91
486 3300026118 Ga0207675_100439246 Ga0207675_1004392462 91
487 3300026142 Ga0207698_10646257 Ga0207698_106462572 91
488 3300027296 Ga0209389_1000004 Ga0209389_100000474 91
489 3300027296 Ga0209389_1000023 Ga0209389_100002370 91
490 3300027357 Ga0209589_1000010 Ga0209589_100001089 91
491 3300027361 Ga0209489_100011 Ga0209489_100011147 91
492 3300027361 Ga0209489_100295 Ga0209489_10029573 91
493 3300027363 Ga0209700_100013 Ga0209700_100013160 91
494 3300027512 Ga0209179_1081140 Ga0209179_10811401 91
495 3300027866 Ga0209813_10002937 Ga0209813_100029372 91
496 3300028379 Ga0268266_11135739 Ga0268266_111357391 91
497 3300028380 Ga0268265_11008457 Ga0268265_110084572 91
498 3300028381 Ga0268264_10000093 Ga0268264_1000009323 91
499 3300028381 Ga0268264_10341893 Ga0268264_103418933 91
500 3300028556 Ga0265337_1033985 Ga0265337_10339852 91
501 3300028563 Ga0265319_1009818 Ga0265319_10098184 91
502 3300028653 Ga0265323_10013826 Ga0265323_100138262 91
503 3300028666 Ga0265336_10000668 Ga0265336_1000066813 91
504 3300028786 Ga0307517_10163514 Ga0307517_101635142 91
505 3300028800 Ga0265338_10000013 Ga0265338_10000013380 91
506 3300029957 Ga0265324_10035591 Ga0265324_100355914 91
507 3300030521 Ga0307511_10225658 Ga0307511_102256581 91
508 3300030763 Ga0265763_1035790 Ga0265763_10357901 91
509 3300031247 Ga0265340_10033490 Ga0265340_100334902 91
510 3300031249 Ga0265339_10012506 Ga0265339_100125063 91
511 3300031456 Ga0307513_10500169 Ga0307513_105001692 91
512 3300031507 Ga0307509_10210400 Ga0307509_102104001 91
513 3300031507 Ga0307509_10778182 Ga0307509_107781822 91
514 3300031616 Ga0307508_10242819 Ga0307508_102428192 91
515 3300031616 Ga0307508_10862876 Ga0307508_108628762 91
516 3300031649 Ga0307514_10443328 Ga0307514_104433282 91
517 3300031731 Ga0307405_10471950 Ga0307405_104719502 91
518 3300033180 Ga0307510_10385582 Ga0307510_103855821 91
519 3300035691 Ga0373931_0551856 Ga0373931_0551856_46_321 91
520 3300035695 Ga0373927_0453531 Ga0373927_0453531_140_415 91
521 3300035724 Ga0373933_0000933 Ga0373933_0000933_14481_14756 91
522 3300035725 Ga0373947_0152144 Ga0373947_0152144_1122_1397 91
523 3300036534 Ga0310109_026010 Ga0310109_026010_303_578 91
524 3300037068 Ga0373925_0038129 Ga0373925_0038129_227_502 91
525 3300037418 Ga0395900_0111877 Ga0395900_0111877_1752_2033 91
526 3300037418 Ga0395900_0353195 Ga0395900_0353195_635_910 91
527 3300037418 Ga0395900_1279924 Ga0395900_1279924_127_402 91
528 3300037466 Ga0395898_0186397 Ga0395898_0186397_364_645 91
529 3300037466 Ga0395898_0321954 Ga0395898_0321954_600_875 91
530 3300037466 Ga0395898_0431498 Ga0395898_0431498_133_408 91
531 3300037466 Ga0395898_1656789 Ga0395898_1656789_137_412 91
532 3300037471 Ga0395905_0005922 Ga0395905_0005922_11460_11735 91
533 3300037471 Ga0395905_0866028 Ga0395905_0866028_512_787 91
534 3300037471 Ga0395905_1010743 Ga0395905_1010743_130_405 91
535 3300037853 Ga0436364_0525938 Ga0436364_0525938_2538_2813 91
536 3300037853 Ga0436364_1001751 Ga0436364_1001751_1119_1394 91
537 3300038443 Ga0395901_0106011 Ga0395901_0106011_822_1097 91
538 3300038443 Ga0395901_0263180 Ga0395901_0263180_124_399 91
539 3300038443 Ga0395901_0450221 Ga0395901_0450221_921_1196 91
540 3300038443 Ga0395901_1565111 Ga0395901_1565111_171_452 91
541 3300039437 Ga0436365_0166945 Ga0436365_0166945_365_640 91
542 3300039437 Ga0436365_0412690 Ga0436365_0412690_72_347 91
543 3300039437 Ga0436365_1432657 Ga0436365_1432657_213_488 91
544 3300039438 Ga0436360_0391216 Ga0436360_0391216_581_856 91
545 3300039438 Ga0436360_0473736 Ga0436360_0473736_35_370 91
546 3300039438 Ga0436360_0592197 Ga0436360_0592197_289_624 91
547 3300039447 Ga0436361_0064398 Ga0436361_0064398_642_917 91
548 3300039447 Ga0436361_0639306 Ga0436361_0639306_1005_1340 91
549 3300039447 Ga0436361_0859965 Ga0436361_0859965_261_548 91
550 3300039450 Ga0436363_0212376 Ga0436363_0212376_9901_10176 91
551 3300039450 Ga0436363_0797948 Ga0436363_0797948_69_344 91
552 3300039450 Ga0436363_1261222 Ga0436363_1261222_758_1033 91
553 3300039450 Ga0436363_1470254 Ga0436363_1470254_480_755 91
554 3300041413 Ga0439465_0109018 Ga0439465_0109018_666_941 91
555 3300041441 Ga0451787_353093 Ga0451787_353093_850_1125 91
556 3300041443 Ga0451789_0721162 Ga0451789_0721162_471_746 91
557 3300041452 Ga0451793_1933845 Ga0451793_1933845_1372_1647 91
558 3300041453 Ga0451797_0462493 Ga0451797_0462493_1001_1276 91
559 3300041456 Ga0451795_1213581 Ga0451795_1213581_1272_1547 91
560 3300041491 Ga0451833_0104584 Ga0451833_0104584_719_994 91
561 3300041501 Ga0451845_0603933 Ga0451845_0603933_153_428 91
562 3300041507 Ga0451851_1265619 Ga0451851_1265619_329_604 91
563 3300041509 Ga0451843_1287380 Ga0451843_1287380_161_436 91
564 3300041511 Ga0451855_0754286 Ga0451855_0754286_667_942 91
565 3300041512 Ga0451853_1726574 Ga0451853_1726574_887_1162 91
566 3300041512 Ga0451853_4033689 Ga0451853_4033689_494_769 91
567 3300044656 Ga0466969_0040734 Ga0466969_0040734_321_596 91
568 3300044656 Ga0466969_0104323 Ga0466969_0104323_120_455 91
569 3300044658 Ga0466972_0000185 Ga0466972_0000185_40915_41190 91
570 3300044658 Ga0466972_0002548 Ga0466972_0002548_2941_3216 91
571 3300044658 Ga0466972_0068110 Ga0466972_0068110_451_726 91
572 3300044658 Ga0466972_0393405 Ga0466972_0393405_56_331 91
573 3300044658 Ga0466972_0596219 Ga0466972_0596219_54_329 91
574 3300044683 Ga0466965_0102633 Ga0466965_0102633_108_383 91
575 3300044683 Ga0466965_0166157 Ga0466965_0166157_673_948 91
576 3300044684 Ga0466966_0006716 Ga0466966_0006716_3071_3346 91
577 3300044684 Ga0466966_0276665 Ga0466966_0276665_702_977 91
578 3300044693 Ga0466961_0000020 Ga0466961_0000020_87549_87824 91
579 3300044693 Ga0466961_0187725 Ga0466961_0187725_962_1237 91
580 3300044693 Ga0466961_0285810 Ga0466961_0285810_546_821 91
581 3300044693 Ga0466961_0376621 Ga0466961_0376621_21_296 91
582 3300044694 Ga0466963_0927209 Ga0466963_0927209_173_448 91
583 3300044706 Ga0466964_0189350 Ga0466964_0189350_240_515 91
584 3300044706 Ga0466964_0288861 Ga0466964_0288861_302_577 91
585 3300044706 Ga0466964_0629727 Ga0466964_0629727_256_531 91
586 3300044719 Ga0466971_0126027 Ga0466971_0126027_694_969 91
587 3300044719 Ga0466971_0682189 Ga0466971_0682189_95_385 91
588 3300044735 Ga0466968_0073859 Ga0466968_0073859_259_534 91
589 3300044735 Ga0466968_0159590 Ga0466968_0159590_449_724 91
590 3300044735 Ga0466968_0390116 Ga0466968_0390116_44_379 91
591 3300044735 Ga0466968_0459512 Ga0466968_0459512_332_607 91
592 3300044765 Ga0466970_0170778 Ga0466970_0170778_117_392 91
593 3300044765 Ga0466970_0331420 Ga0466970_0331420_547_822 91
594 3300044765 Ga0466970_0345255 Ga0466970_0345255_258_593 91
595 3300044765 Ga0466970_0621087 Ga0466970_0621087_176_451 91
596 3300044765 Ga0466970_0934730 Ga0466970_0934730_185_460 91
597 3300044842 Ga0466957_0212111 Ga0466957_0212111_696_971 91
598 3300044842 Ga0466957_0221501 Ga0466957_0221501_872_1147 91
599 3300044842 Ga0466957_0550325 Ga0466957_0550325_444_719 91
600 3300044842 Ga0466957_0796988 Ga0466957_0796988_265_540 91
601 3300044901 Ga0466960_0035952 Ga0466960_0035952_482_757 91
602 3300044901 Ga0466960_0059495 Ga0466960_0059495_1546_1821 91
603 3300044901 Ga0466960_0247789 Ga0466960_0247789_436_723 91
604 3300044901 Ga0466960_0290644 Ga0466960_0290644_262_537 91
605 3300045049 Ga0466959_0003692 Ga0466959_0003692_6979_7254 91
606 3300045049 Ga0466959_0041108 Ga0466959_0041108_416_751 91
607 3300045049 Ga0466959_0182710 Ga0466959_0182710_228_503 91
608 3300045049 Ga0466959_0434728 Ga0466959_0434728_581_856 91
609 3300045049 Ga0466959_0513504 Ga0466959_0513504_395_670 91
610 3300045836 Ga0466958_0205203 Ga0466958_0205203_840_1115 91
611 3300045976 Ga0466967_0021975 Ga0466967_0021975_4329_4604 91
612 3300045976 Ga0466967_0063971 Ga0466967_0063971_1672_1953 91
613 3300045976 Ga0466967_0085926 Ga0466967_0085926_125_400 91
614 3300045976 Ga0466967_0200302 Ga0466967_0200302_310_585 91
615 3300045976 Ga0466967_0236600 Ga0466967_0236600_440_715 91
616 3300045976 Ga0466967_0286512 Ga0466967_0286512_913_1188 91
617 3300045976 Ga0466967_0545508 Ga0466967_0545508_104_394 91
618 3300045976 Ga0466967_2137728 Ga0466967_2137728_24_299 91
619 3300045976 Ga0466967_2373971 Ga0466967_2373971_27_302 91
620 3300046454 Ga0495592_0203996 Ga0495592_0203996_106_384 91
621 3300046454 Ga0495592_0247794 Ga0495592_0247794_57_332 91
622 3300046455 Ga0495603_0045301 Ga0495603_0045301_646_927 91
623 3300046455 Ga0495603_0136583 Ga0495603_0136583_115_390 91
624 3300046457 Ga0495590_0199860 Ga0495590_0199860_318_593 91
625 3300046459 Ga0495629_0001285 Ga0495629_0001285_2145_2420 91
626 3300046462 Ga0495651_0038466 Ga0495651_0038466_2332_2607 91
627 3300046462 Ga0495651_0101866 Ga0495651_0101866_1086_1364 91
628 3300046462 Ga0495651_0820338 Ga0495651_0820338_181_456 91
629 3300046472 Ga0495580_0877413 Ga0495580_0877413_282_557 91
630 3300046473 Ga0495582_0191805 Ga0495582_0191805_475_750 91
631 3300046474 Ga0495605_0081061 Ga0495605_0081061_227_502 91
632 3300046477 Ga0495664_0056770 Ga0495664_0056770_1295_1570 91
633 3300046477 Ga0495664_0311759 Ga0495664_0311759_329_607 91
634 3300046477 Ga0495664_0349210 Ga0495664_0349210_276_551 91
635 3300046477 Ga0495664_0478508 Ga0495664_0478508_288_563 91
636 3300046500 Ga0495596_0085800 Ga0495596_0085800_755_1030 91
637 3300046501 Ga0495607_0091009 Ga0495607_0091009_195_470 91
638 3300046507 Ga0495606_0030986 Ga0495606_0030986_3096_3371 91
639 3300046507 Ga0495606_0067180 Ga0495606_0067180_1885_2160 91
640 3300046507 Ga0495606_0328816 Ga0495606_0328816_172_447 91
641 3300046507 Ga0495606_0575883 Ga0495606_0575883_35_310 91
642 3300046511 Ga0495608_0060869 Ga0495608_0060869_1775_2053 91
643 3300046511 Ga0495608_0062211 Ga0495608_0062211_1192_1467 91
644 3300046512 Ga0495610_0070967 Ga0495610_0070967_192_467 91
645 3300046512 Ga0495610_0318724 Ga0495610_0318724_113_388 91
646 3300046513 Ga0495616_0200975 Ga0495616_0200975_251_526 91
647 3300046514 Ga0495618_0072718 Ga0495618_0072718_1723_1998 91
648 3300046514 Ga0495618_0488045 Ga0495618_0488045_240_518 91
649 3300046515 Ga0495620_0253694 Ga0495620_0253694_148_423 91
650 3300046516 Ga0495628_0132421 Ga0495628_0132421_593_871 91
651 3300046517 Ga0495630_0986379 Ga0495630_0986379_276_557 91
652 3300046518 Ga0495631_0284250 Ga0495631_0284250_144_419 91
653 3300046519 Ga0495632_0146312 Ga0495632_0146312_387_662 91
654 3300046522 Ga0495643_0028133 Ga0495643_0028133_655_930 91
655 3300046522 Ga0495643_0075593 Ga0495643_0075593_977_1252 91
656 3300046524 Ga0495648_0064052 Ga0495648_0064052_1333_1608 91
657 3300046524 Ga0495648_0237437 Ga0495648_0237437_90_365 91
658 3300046526 Ga0495666_0363793 Ga0495666_0363793_65_340 91
659 3300046529 Ga0495652_0053762 Ga0495652_0053762_706_984 91
660 3300046529 Ga0495652_0469601 Ga0495652_0469601_281_556 91
661 3300046533 Ga0495640_0057207 Ga0495640_0057207_947_1222 91
662 3300046533 Ga0495640_0140324 Ga0495640_0140324_261_539 91
663 3300046536 Ga0495587_0021616 Ga0495587_0021616_325_603 91
664 3300046536 Ga0495587_0245417 Ga0495587_0245417_215_490 91
665 3300046538 Ga0495609_0031800 Ga0495609_0031800_1749_2024 91
666 3300046538 Ga0495609_0133495 Ga0495609_0133495_329_604 91
667 3300046542 Ga0495597_0199933 Ga0495597_0199933_370_645 91
668 3300046543 Ga0495645_0111168 Ga0495645_0111168_772_1047 91
669 3300046543 Ga0495645_0112784 Ga0495645_0112784_1213_1491 91
670 3300046557 Ga0495622_0009981 Ga0495622_0009981_1521_1796 91
671 3300046557 Ga0495622_0052370 Ga0495622_0052370_1105_1380 91
672 3300046557 Ga0495622_0290350 Ga0495622_0290350_304_579 91
673 3300046559 Ga0495667_0053258 Ga0495667_0053258_1428_1706 91
674 3300046559 Ga0495667_0200209 Ga0495667_0200209_983_1258 91
675 3300046616 Ga0495668_0048350 Ga0495668_0048350_222_497 91
676 3300046616 Ga0495668_0241109 Ga0495668_0241109_525_800 91
677 3300046616 Ga0495668_0331889 Ga0495668_0331889_254_529 91
678 3300046642 Ga0495634_0040997 Ga0495634_0040997_266_544 91
679 3300046642 Ga0495634_0177656 Ga0495634_0177656_944_1219 91
680 3300046660 Ga0495625_0038858 Ga0495625_0038858_2118_2393 91
681 3300046663 Ga0495635_0023671 Ga0495635_0023671_1998_2273 91
682 3300046663 Ga0495635_0031388 Ga0495635_0031388_432_710 91
683 3300046665 Ga0495661_0279441 Ga0495661_0279441_539_814 91
684 3300046674 Ga0495588_0055901 Ga0495588_0055901_697_972 91
685 3300046675 Ga0495657_0016485 Ga0495657_0016485_3053_3328 91
686 3300046675 Ga0495657_0055404 Ga0495657_0055404_925_1203 91
687 3300046678 Ga0495599_0035925 Ga0495599_0035925_263_541 91
688 3300046679 Ga0495623_0041891 Ga0495623_0041891_1324_1602 91
689 3300046684 Ga0495669_0406910 Ga0495669_0406910_175_450 91
690 3300046689 Ga0495613_0079714 Ga0495613_0079714_1065_1340 91
691 3300046689 Ga0495613_0636937 Ga0495613_0636937_176_454 91
692 3300046690 Ga0495624_0580529 Ga0495624_0580529_163_438 91
693 3300046692 Ga0495671_0043264 Ga0495671_0043264_1009_1284 91
694 3300046694 Ga0495649_0040446 Ga0495649_0040446_734_1009 91
695 3300046694 Ga0495649_0042895 Ga0495649_0042895_622_897 91
696 3300046809 Ga0495600_0129859 Ga0495600_0129859_361_636 91
697 3300046809 Ga0495600_0203778 Ga0495600_0203778_219_497 91
698 3300047315 Ga0495581_0128299 Ga0495581_0128299_1031_1306 91
699 3300047315 Ga0495581_0149248 Ga0495581_0149248_151_426 91
700 3300047315 Ga0495581_0812326 Ga0495581_0812326_203_484 91
701 3300047317 Ga0495604_0003054 Ga0495604_0003054_7765_8040 91
702 3300047317 Ga0495604_0041708 Ga0495604_0041708_3067_3345 91
703 3300047319 Ga0495674_0415602 Ga0495674_0415602_366_641 91
704 3300047322 Ga0495680_0009821 Ga0495680_0009821_7252_7530 91
705 3300047323 Ga0495683_0033555 Ga0495683_0033555_1689_1964 91
706 3300047323 Ga0495683_0094088 Ga0495683_0094088_139_414 91
707 3300047443 Ga0495687_050393 Ga0495687_050393_1184_1459 91
708 3300047444 Ga0495675_0013853 Ga0495675_0013853_2563_2841 91
709 3300047469 Ga0495673_0080196 Ga0495673_0080196_1016_1297 91
710 3300047471 Ga0495684_0635979 Ga0495684_0635979_200_478 91
711 3300047472 Ga0495686_0119194 Ga0495686_0119194_224_499 91
712 3300047472 Ga0495686_0339242 Ga0495686_0339242_319_594 91
713 3300047673 Ga0495593_0028504 Ga0495593_0028504_1832_2107 91
714 3300047673 Ga0495593_0436123 Ga0495593_0436123_351_629 91
715 3300048088 Ga0495602_0052424 Ga0495602_0052424_2172_2450 91
716 3300048088 Ga0495602_0297797 Ga0495602_0297797_28_303 91
717 3300048089 Ga0495614_0104954 Ga0495614_0104954_298_573 91
718 3300048089 Ga0495614_0120350 Ga0495614_0120350_386_661 91
719 3300048091 Ga0495626_0064892 Ga0495626_0064892_1244_1519 91
720 3300048903 Ga0496100_0093485 Ga0496100_0093485_445_720 91
721 3300048903 Ga0496100_0178283 Ga0496100_0178283_240_515 91
722 3300048903 Ga0496100_0722340 Ga0496100_0722340_187_462 91
723 3300048904 Ga0496101_0065722 Ga0496101_0065722_1086_1361 91
724 3300048904 Ga0496101_0328503 Ga0496101_0328503_20_295 91
725 3300048904 Ga0496101_1391190 Ga0496101_1391190_244_519 91
726 3300048905 Ga0496102_0116763 Ga0496102_0116763_1039_1314 91
727 3300048905 Ga0496102_0140116 Ga0496102_0140116_428_703 91
728 3300048905 Ga0496102_1126269 Ga0496102_1126269_199_474 91
729 3300048906 Ga0496103_0008146 Ga0496103_0008146_2005_2280 91
730 3300048906 Ga0496103_0551670 Ga0496103_0551670_205_480 91
731 3300048907 Ga0496104_0038487 Ga0496104_0038487_3108_3383 91
732 3300048907 Ga0496104_0044409 Ga0496104_0044409_2923_3198 91
733 3300048907 Ga0496104_0133123 Ga0496104_0133123_1899_2174 91
734 3300048908 Ga0496105_0032381 Ga0496105_0032381_1151_1426 91
735 3300048908 Ga0496105_0062791 Ga0496105_0062791_2039_2314 91
736 3300048908 Ga0496105_0063630 Ga0496105_0063630_977_1252 91
737 3300048909 Ga0496106_0041714 Ga0496106_0041714_2282_2557 91
738 3300048909 Ga0496106_0217335 Ga0496106_0217335_951_1226 91
739 3300048909 Ga0496106_0288897 Ga0496106_0288897_633_908 91
740 3300048909 Ga0496106_1136216 Ga0496106_1136216_195_470 91
741 3300048910 Ga0496107_0034315 Ga0496107_0034315_229_504 91
742 3300048910 Ga0496107_0151834 Ga0496107_0151834_83_358 91
743 3300048910 Ga0496107_0861897 Ga0496107_0861897_204_479 91
744 3300048911 Ga0496108_0016881 Ga0496108_0016881_1881_2156 91
745 3300048911 Ga0496108_0421798 Ga0496108_0421798_706_981 91
746 3300048911 Ga0496108_0536819 Ga0496108_0536819_263_538 91
747 3300048913 Ga0496110_0034199 Ga0496110_0034199_3045_3320 91
748 3300048913 Ga0496110_0425015 Ga0496110_0425015_266_541 91
749 3300048914 Ga0496111_0156108 Ga0496111_0156108_135_410 91
750 3300048914 Ga0496111_0412822 Ga0496111_0412822_616_891 91
751 3300048915 Ga0496112_0027577 Ga0496112_0027577_3466_3741 91
752 3300048916 Ga0496113_0051590 Ga0496113_0051590_1037_1312 91
753 3300048916 Ga0496113_0291175 Ga0496113_0291175_611_886 91
754 3300048916 Ga0496113_0295533 Ga0496113_0295533_50_325 91
755 3300048917 Ga0496114_0032966 Ga0496114_0032966_2680_2955 91
756 3300048917 Ga0496114_0215451 Ga0496114_0215451_298_573 91
757 3300048918 Ga0496115_0176298 Ga0496115_0176298_253_528 91
758 3300048918 Ga0496115_0690340 Ga0496115_0690340_286_561 91
759 3300048919 Ga0496116_0085259 Ga0496116_0085259_110_385 91
760 3300048920 Ga0496117_0086903 Ga0496117_0086903_149_424 91
761 3300048920 Ga0496117_0306801 Ga0496117_0306801_321_596 91
762 3300048920 Ga0496117_0314808 Ga0496117_0314808_229_504 91
763 3300048921 Ga0496118_0034657 Ga0496118_0034657_917_1192 91
764 3300048921 Ga0496118_0151060 Ga0496118_0151060_411_686 91
765 3300048921 Ga0496118_0156238 Ga0496118_0156238_866_1141 91
766 3300048921 Ga0496118_0165431 Ga0496118_0165431_744_1019 91
767 3300048921 Ga0496118_0571919 Ga0496118_0571919_50_325 91
768 3300048922 Ga0496119_0018797 Ga0496119_0018797_4528_4803 91
769 3300048922 Ga0496119_0035827 Ga0496119_0035827_2870_3145 91
770 3300048922 Ga0496119_0045469 Ga0496119_0045469_1222_1497 91
771 3300048922 Ga0496119_0097375 Ga0496119_0097375_1177_1452 91
772 3300048923 Ga0496120_0072474 Ga0496120_0072474_1031_1306 91
773 3300048923 Ga0496120_0095303 Ga0496120_0095303_123_398 91
774 3300048923 Ga0496120_0222969 Ga0496120_0222969_250_525 91
775 3300048923 Ga0496120_0298228 Ga0496120_0298228_275_550 91
776 3300048924 Ga0496121_0018129 Ga0496121_0018129_3059_3334 91
777 3300048924 Ga0496121_0048015 Ga0496121_0048015_534_809 91
778 3300048924 Ga0496121_0061856 Ga0496121_0061856_1325_1600 91
779 3300048924 Ga0496121_0121261 Ga0496121_0121261_1050_1325 91
780 3300048924 Ga0496121_0206266 Ga0496121_0206266_243_518 91
781 3300048924 Ga0496121_0776870 Ga0496121_0776870_105_380 91
782 3300048925 Ga0496122_0015242 Ga0496122_0015242_6049_6375 91
783 3300048925 Ga0496122_0125615 Ga0496122_0125615_659_934 91
784 3300048927 Ga0496124_0065496 Ga0496124_0065496_903_1178 91
785 3300048927 Ga0496124_0073104 Ga0496124_0073104_634_909 91
786 3300048927 Ga0496124_0634846 Ga0496124_0634846_259_534 91
787 3300048928 Ga0496125_0040757 Ga0496125_0040757_1200_1475 91
788 3300048928 Ga0496125_0082484 Ga0496125_0082484_187_462 91
789 3300048928 Ga0496125_0133841 Ga0496125_0133841_1214_1489 91
790 3300048929 Ga0496126_0009236 Ga0496126_0009236_7308_7583 91
791 3300048929 Ga0496126_0019391 Ga0496126_0019391_4647_4922 91
792 3300048929 Ga0496126_0050913 Ga0496126_0050913_3464_3739 91
793 3300048929 Ga0496126_0061206 Ga0496126_0061206_1810_2085 91
794 3300048929 Ga0496126_0092565 Ga0496126_0092565_2114_2389 91
795 3300048929 Ga0496126_0156146 Ga0496126_0156146_623_949 91
796 3300048929 Ga0496126_0158694 Ga0496126_0158694_88_369 91
797 3300048929 Ga0496126_0248505 Ga0496126_0248505_334_615 91
798 3300048929 Ga0496126_0666681 Ga0496126_0666681_167_442 91
799 3300048929 Ga0496126_1202423 Ga0496126_1202423_168_449 91
800 3300048929 Ga0496126_1316172 Ga0496126_1316172_102_377 91
801 3300049460 Ga0495682_0009626 Ga0495682_0009626_2752_3027 91
802 3300049580 Ga0501046_0015227 Ga0501046_0015227_4122_4397 91
803 3300049581 Ga0501047_0059550 Ga0501047_0059550_2240_2515 91
804 3300049581 Ga0501047_0196339 Ga0501047_0196339_517_798 91
805 3300049583 Ga0501067_0256177 Ga0501067_0256177_322_597 91
806 3300049586 Ga0501070_0046583 Ga0501070_0046583_1374_1649 91
807 3300049589 Ga0501073_0041052 Ga0501073_0041052_940_1215 91
808 3300049590 Ga0501074_0008985 Ga0501074_0008985_4814_5089 91
809 3300049741 Ga0501079_0568949 Ga0501079_0568949_420_695 91
810 3300049742 Ga0501080_0094062 Ga0501080_0094062_1472_1747 91
811 3300049822 Ga0501035_0276557 Ga0501035_0276557_519_794 91
812 3300049822 Ga0501035_0479586 Ga0501035_0479586_177_458 91
813 3300049823 Ga0501044_0104264 Ga0501044_0104264_118_399 91
814 3300050489 nmdc:mga03683_549237_c1 nmdc:mga03683_549237_c1_102_380 91
815 3300050490 nmdc:mga03n38_11183_c1 nmdc:mga03n38_11183_c1_2853_3128 91
816 3300050490 nmdc:mga03n38_776574_c1 nmdc:mga03n38_776574_c1_131_418 91
817 3300050491 nmdc:mga00v17_102408_c1 nmdc:mga00v17_102408_c1_1403_1678 91
818 3300050491 nmdc:mga00v17_238788_c1 nmdc:mga00v17_238788_c1_219_494 91
819 3300050491 nmdc:mga00v17_259155_c1 nmdc:mga00v17_259155_c1_192_467 91
820 3300050491 nmdc:mga00v17_919030_c1 nmdc:mga00v17_919030_c1_253_531 91
821 3300050492 nmdc:mga0yw44_103399_c1 nmdc:mga0yw44_103399_c1_817_1092 91
822 3300050492 nmdc:mga0yw44_13689_c1 nmdc:mga0yw44_13689_c1_2923_3198 91
823 3300050492 nmdc:mga0yw44_221506_c1 nmdc:mga0yw44_221506_c1_940_1215 91
824 3300050492 nmdc:mga0yw44_401444_c1 nmdc:mga0yw44_401444_c1_389_664 91
825 3300050492 nmdc:mga0yw44_42973_c1 nmdc:mga0yw44_42973_c1_157_432 91
826 3300050492 nmdc:mga0yw44_598720_c1 nmdc:mga0yw44_598720_c1_320_598 91
827 3300050493 nmdc:mga0k408_143494_c1 nmdc:mga0k408_143494_c1_958_1236 91
828 3300050493 nmdc:mga0k408_28971_c1 nmdc:mga0k408_28971_c1_846_1121 91
829 3300050494 nmdc:mga06z11_2094_c1 nmdc:mga06z11_2094_c1_559_834 91
830 3300050494 nmdc:mga06z11_456721_c1 nmdc:mga06z11_456721_c1_360_638 91
831 3300050494 nmdc:mga06z11_610461_c1 nmdc:mga06z11_610461_c1_297_572 91
832 3300050495 nmdc:mga04h51_1146_c1 nmdc:mga04h51_1146_c1_5621_5896 91
833 3300050496 nmdc:mga07m45_22861_c1 nmdc:mga07m45_22861_c1_867_1142 91
834 3300050496 nmdc:mga07m45_457164_c1 nmdc:mga07m45_457164_c1_51_338 91
835 3300050496 nmdc:mga07m45_467920_c1 nmdc:mga07m45_467920_c1_298_576 91
836 3300050496 nmdc:mga07m45_90366_c1 nmdc:mga07m45_90366_c1_1022_1297 91
837 3300050513 nmdc:mga0rr50_303449_c1 nmdc:mga0rr50_303449_c1_566_841 91
838 3300050514 nmdc:mga08x19_99481_c1 nmdc:mga08x19_99481_c1_215_490 91
839 3300050516 nmdc:mga0sz30_484400_c1 nmdc:mga0sz30_484400_c1_97_375 91
840 3300050516 nmdc:mga0sz30_6876_c1 nmdc:mga0sz30_6876_c1_1247_1522 91
841 3300050516 nmdc:mga0sz30_76137_c1 nmdc:mga0sz30_76137_c1_546_821 91
842 3300053077 Ga0495601_0068670 Ga0495601_0068670_41_316 91
843 3300053078 Ga0495612_0369496 Ga0495612_0369496_127_405 91
844 3300053078 Ga0495612_0621939 Ga0495612_0621939_82_363 91
845 3300053080 Ga0500635_0015349 Ga0500635_0015349_69_350 91
846 3300053083 Ga0495655_0014862 Ga0495655_0014862_1282_1557 91
847 3300053083 Ga0495655_0023385 Ga0495655_0023385_259_534 91
848 3300053083 Ga0495655_0232483 Ga0495655_0232483_145_420 91
849 3300053085 Ga0495619_0266401 Ga0495619_0266401_119_394 91
850 3300053086 Ga0500578_0124755 Ga0500578_0124755_1124_1399 91
851 3300053086 Ga0500578_0245251 Ga0500578_0245251_586_861 91
852 3300053086 Ga0500578_0547239 Ga0500578_0547239_307_582 91
853 3300053092 Ga0500583_0541466 Ga0500583_0541466_16_291 91
854 3300053093 Ga0500651_0185099 Ga0500651_0185099_364_639 91
855 3300053094 Ga0500566_0000102 Ga0500566_0000102_3010_3285 91
856 3300053095 Ga0500640_035152 Ga0500640_035152_1085_1360 91
857 3300053097 Ga0500648_043660 Ga0500648_043660_126_401 91
858 3300053098 Ga0500650_0502924 Ga0500650_0502924_70_345 91
859 3300053102 Ga0500554_003722 Ga0500554_003722_1878_2159 91
860 3300053105 Ga0500557_249117 Ga0500557_249117_132_407 91
861 3300053109 Ga0500569_000840 Ga0500569_000840_2472_2747 91
862 3300053109 Ga0500569_311000 Ga0500569_311000_99_374 91
863 3300053111 Ga0500572_000793 Ga0500572_000793_5848_6123 91
864 3300053119 Ga0500595_031991 Ga0500595_031991_608_883 91
865 3300053122 Ga0500608_041848 Ga0500608_041848_637_912 91
866 3300053122 Ga0500608_080533 Ga0500608_080533_35_310 91
867 3300053122 Ga0500608_361337 Ga0500608_361337_85_360 91
868 3300053123 Ga0500614_079792 Ga0500614_079792_106_381 91
869 3300053128 Ga0500626_346135 Ga0500626_346135_119_394 91
870 3300053130 Ga0500642_0000439 Ga0500642_0000439_3027_3302 91
871 3300053136 Ga0500559_0000586 Ga0500559_0000586_14157_14432 91
872 3300053136 Ga0500559_0019024 Ga0500559_0019024_1831_2106 91
873 3300053136 Ga0500559_0175117 Ga0500559_0175117_711_986 91
874 3300053138 Ga0500564_181559 Ga0500564_181559_449_724 91
875 3300053140 Ga0500573_0095639 Ga0500573_0095639_969_1244 91
876 3300053148 Ga0500590_165775 Ga0500590_165775_497_772 91
877 3300053148 Ga0500590_361233 Ga0500590_361233_167_442 91
878 3300053150 Ga0500603_000257 Ga0500603_000257_12647_12928 91
879 3300053154 Ga0500619_000798 Ga0500619_000798_2553_2828 91
880 3300053154 Ga0500619_173863 Ga0500619_173863_431_706 91
881 3300053155 Ga0500620_248540 Ga0500620_248540_35_310 91
882 3300053162 Ga0500638_175255 Ga0500638_175255_234_509 91
883 3300053162 Ga0500638_272255 Ga0500638_272255_287_562 91
884 3300053163 Ga0500639_017885 Ga0500639_017885_2461_2736 91
885 3300053163 Ga0500639_198796 Ga0500639_198796_31_306 91
886 3300053177 Ga0500636_0123188 Ga0500636_0123188_151_447 91
887 3300053177 Ga0500636_0198700 Ga0500636_0198700_224_499 91
888 3300053177 Ga0500636_0280932 Ga0500636_0280932_234_509 91
889 3300053177 Ga0500636_0370467 Ga0500636_0370467_188_463 91
890 3300053177 Ga0500636_0478097 Ga0500636_0478097_205_480 91
891 3300053178 Ga0500637_0016076 Ga0500637_0016076_922_1203 91
892 3300053178 Ga0500637_0300241 Ga0500637_0300241_349_624 91
893 3300053722 Ga0500649_190022 Ga0500649_190022_90_365 91
894 3300053725 Ga0500576_192761 Ga0500576_192761_94_369 91
895 3300053729 Ga0500625_010749 Ga0500625_010749_3707_3982 91
896 3300053731 Ga0500609_001617 Ga0500609_001617_758_1033 91
897 3300053733 Ga0500552_004298 Ga0500552_004298_518_793 91
898 3300053735 Ga0500596_000109 Ga0500596_000109_10012_10287 91
899 3300053735 Ga0500596_011502 Ga0500596_011502_626_901 91
900 3300053737 Ga0500601_000397 Ga0500601_000397_148_423 91
901 3300001979 JGI24740J21852_10049260 JGI24740J21852_100492602 92
902 3300005341 Ga0070691_10502212 Ga0070691_105022122 92
903 3300005539 Ga0068853_100002707 Ga0068853_10000270711 92
904 3300005563 Ga0068855_100096866 Ga0068855_1000968661 92
905 3300005577 Ga0068857_100080405 Ga0068857_1000804052 92
906 3300005578 Ga0068854_100004699 Ga0068854_1000046996 92
907 3300005614 Ga0068856_100145909 Ga0068856_1001459092 92
908 3300005616 Ga0068852_100293128 Ga0068852_1002931282 92
909 3300005834 Ga0068851_10009920 Ga0068851_100099203 92
910 3300009093 Ga0105240_10010814 Ga0105240_100108142 92
911 3300009174 Ga0105241_10001768 Ga0105241_100017682 92
912 3300009545 Ga0105237_11827303 Ga0105237_118273031 92
913 3300009545 Ga0105237_11845280 Ga0105237_118452802 92
914 3300009551 Ga0105238_10000897 Ga0105238_1000089717 92
915 3300010375 Ga0105239_10048692 Ga0105239_100486922 92
916 3300025321 Ga0207656_10013316 Ga0207656_100133162 92
917 3300025904 Ga0207647_10604568 Ga0207647_106045681 92
918 3300025911 Ga0207654_10001817 Ga0207654_100018171 92
919 3300025913 Ga0207695_10001771 Ga0207695_1000177127 92
920 3300025914 Ga0207671_10069940 Ga0207671_100699401 92
921 3300025924 Ga0207694_10000082 Ga0207694_1000008237 92
922 3300025929 Ga0207664_10996377 Ga0207664_109963771 92
923 3300025949 Ga0207667_10002113 Ga0207667_1000211311 92
924 3300025981 Ga0207640_10031916 Ga0207640_100319162 92
925 3300026078 Ga0207702_10000002 Ga0207702_10000002383 92
926 3300026078 Ga0207702_10253198 Ga0207702_102531982 92
927 3300026116 Ga0207674_10003760 Ga0207674_100037602 92
928 3300026142 Ga0207698_10107708 Ga0207698_101077082 92
929 3300048905 Ga0496102_0474575 Ga0496102_0474575_83_376 92

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04023

FeoA

FeoA domain

31

111

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e19-assembly1.cif.gz_D crystal structure of iron uptake regulatory protein (feoa) solved by sulfur sad in a monoclinic space group 0.9275 11 91
7r7b-assembly2.cif.gz_B 1.50 angstroem crystal structure of feoa from bacteroides fragilis 0.9152 12 92
3e19-assembly1.cif.gz_B crystal structure of iron uptake regulatory protein (feoa) solved by sulfur sad in a monoclinic space group 0.915 11 91
2k5l-assembly1.cif.gz_A solution nmr structure of protein feoa from clostridium thermocellum, northeast structural genomics consortium target cmr17 0.9114 12 92
3e19-assembly1.cif.gz_A crystal structure of iron uptake regulatory protein (feoa) solved by sulfur sad in a monoclinic space group 0.9044 11 92
ID Description Score Start End Superfamily
2k5lA00 Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) 0.9114 12 92 2.30.30.90
3e19A01 Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) 0.8969 21 92 2.30.30.90
af_Q57987_2_81_2.30.30.90 Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) 0.8966 13 92 2.30.30.90
2k5iA01 Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) 0.8921 12 91 2.30.30.90
2k5fA01 Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) 0.8655 12 91 2.30.30.90
ID Description Score Start End GO Terms
AF-A0A810D1T4-F1-model_v4 Iron transporter FeoA 0.9661 12 92 GO:0046914
AF-A0A810D1T4-F1-model_v4 Iron transporter FeoA 0.9545 12 92 GO:0046914
AF-A0A316J9M0-F1-model_v4 Ferrous iron transporter FeoA-like domain-containing protein 0.9486 11 92 GO:0046914
AF-A0A1H6HE32-F1-model_v4 Ferrous iron transport protein A 0.9422 10 91 GO:0046914
AF-A0A537NG22-F1-model_v4 Ferrous iron transport protein A 0.9413 10 92 GO:0046914

Feature Viewer

pLDDT pTM Quality
89.73 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map